2VWXA

Ephb4 kinase domain inhibitor complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
281
structure length
274
Chain Sequence
KEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Inhibitors of the Tyrosine Kinase Ephb4. Part 2: Structure-Based Discovery and Optimisation of 3,5-Bis Substituted Anilinopyrimidines.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 274
sequence length 281
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vwxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vwxA01
3W33A 4IAFA 2VV9A 4PWNA 1O6KA 3FMLA 2GFSA 3O50A 4FTLA 3UDBA 4A9TA 2WXVA 1ZLTA 2C6EA 4JL9A 2IZRA 4BDCA 2JAVA 3FBVA 4IWDA 5EHLA 3NYNA 3L1SA 3FXWA 4IZYA 1R3CA 3OMVA 3RAKA 1M17A 4C4EA 3EN9A 2QOIA 3DU8A 1XH5A 4OLIA 5E7RA 5FBOA 4G6OA 3NUPA 4EQUA 3H0YA 3KXHA 3UZPA 4JX3A 5HU3A 1JOWB 3UQGA 3QL8A 4OTDA 2VO3A 4BDEA 3EQRA 4GG7A 4BCKA 2OK1A 4X0MA 4JRVA 4MF0A 3U4WA 5ETCA 4WSQA 4ZTSA 5HIEA 3OWLA 5KE0A 3ZSIA 2BIYA 2QQ7A 5JSMA 2OW3A 3Q9XA 5L2WA 2OZAB 3H9RA 1Y8YA 3JR1A 4DITA 5EHOA 4FC0A 4GS6A 3TL8A 4XV2A 3UOHA 3ZLSA 4BY9E 4N70A 2OFUA 3BRBA 4FSRA 1FINA 5DR9A 3EIDA 4QTCA 4FIFA 4DEIA 5HOAA 4YHJA 3QYZA 4GFGA 3KVXA 3PZHA 1WBPA 3IKAA 2X4FA 3BWFA 5M44A 4USDA 2Y9QA 4TYHB 3MFUA 5GJDA 4YC6A 2BCJA 4GU9A 5E8UA 3SA0A 4ZS4A 2WGJA 4S2ZA 3D94A 4JG7A 2OF4A 4FTJA 4HVDA 3VUKA 4IM0A 4NL0A 3A4PA 2R7BA 2WMQA 3BGPA 5DEYA 4HNFA 2H6DA 5KZ0A 2P55A 3EQBA 1K2PA 4FGRA 5EYMA 4UN0C 4NYEA 3BLRA 3EFJA 3U55A 2PE1A 1FOTA 2I40A 4QMZA 3BHVA 3DCVA 5C9CA 2IZSA 5JQ8A 1PKGA 2QG7A 4QO9A 4CG8A 4IX5A 1Q5KA 4HNIA 5AP4A 3EFLA 4C38A 4DGLC 4FBXA 3TCPA 3V8WA 2QKRA 3L9NA 3OW3A 4Y8DA 3IGOA 3QZGA 3ZLYA 4A4XA 4I0TA 5G1XA 5IMXA 4Z16A 3AC4A 2CGVA 4IAAA 2ZDUA 4PUZA 2JIIA 2XNGA 4WOVA 4AZWA 2XIKA 4YO4A 2P0CA 2B9JA 3NCGA 3QRUA 4IX4A 5IH5A 3H10A 4CKRA 2QD9A 3HA8A 4E8AA 3LCKA 4P90A 4FV0A 4F65A 5JFXA 3RNIA 5DG5A 4FV3A 5C01A 4RSSA 3BU6A 4ACGA 4CD0A 4I5HA 5TOZA 3W2SA 3KVWA 4BCGA 2B0QA 2WEVA 2OG8A 4Y46A 3EJ1A 3I4BA 5HE0A 2SRCA 4BDJA 3D7TB 1I44A 3E8DA 4FYNA 3FZ1A 4BHZA 4EH4A 4FTMA 3ODZX 3S4QA 3TZ7A 4D1XA 3EQFA 2R3MA 3I1AA 4L3PA 4XG8A 4USEA 4FZDB 2JFMA 4BB4A 3ZLXA 1HCKA 1PXPA 3BBTB 3DTWA 1JKKA 4FG7A 3TTIA 5IA3A 2F9GA 2VWUA 3QU0A 4GCJA 3TZMA 4CCBA 4FIJA 5IZFA 1YWNA 5HLPA 2PUIA 3RM7A 5AP1A 3NW6A 2CMWA 2F4JA 2VUWA 4I6QA 1QPCA 2ZV7A 2OJIA 4QPSA 1ZMUA 4UB7A 1SNXA 4UYNA 4E6DA 3TM0A 1JBPE 3RCDA 3R8UA 3R8LA 3GCVA 1OKZA 2ITZA 2VTJA 4PP7A 2BDWA 3QRKA 2IW8A 1TVOA 3DBEA 5FP6A 3TG1A 4YLKA 4GSBA 2X7GA 4A7CA 5JN2A 2HZIA 3S00A 4IZ5A 3UIBA 3CTJA 4WUAA 4I4EA 2R5TA 4O81A 5F9EA 4CQGA 5AEPA 4FSYA 3R1NA 4UMTA 2VTRA 2V22A 2WQBA 3LFEA 4O0YA 4D28A 3JYAA 2QLUA 5AP5A 5L2QA 3TACA 3LMHA 3R8PA 4V05A 4E93A 2IG7A 2ACXA 4QMMA 4RX8A 3GBZA 4CRLA 3NPCA 4AT4A 4TWPA 5JK3A 1W83A 4O27B 3W2CA 4CMOA 4A4LA 4FZFB 4G5PA 3FSKA 5DBXA 3VS3A 3BI6A 3IG7A 4L46A 5HIBA 3MTFA 2PE2A 5F1ZA 3V5LA 5EDQA 4FG8A 5CQUA 2VTAA 5AR7A 4RVMA 4WNKA 4EOQA 5LQFA 4DTKA 2X2MA 5CVGA 4AGUA 2F2UA 4YTFA 1Z57A 4RC4A 4F1OA 3HZTA 5CWZA 4RC2A 5GZAA 2XKDA 5FM3A 4BWKA 3RAHA 4Y5QA 4UWCA 3RM6A 4N57A 5CU2A 3FC1X 5CT7A 2XZSA 5LMKC 3GI3A 5FLFA 3NAYA 4BCMA 1PXIA 3QA0A 4JRNA 1OECA 4B8LA 5I9WA 3OW4A 4L7FA 3FLYA 3RVGA 3WYXA 4PP9A 2GS7A 4YLJA 3TNIA 4DGMA 5D41A 4G2FA 5AIKA 4KNBA 1Q62A 4FEQA 3HEGA 3PG1A 4B4LA 4ZZNA 2R3RA 5CLPA 3QLFA 5KMMA 5GIOE 5HBJA 4U6RA 4B9DA 2J2IB 2J4ZA 2WAJA 3OOMA 4D0WA 4BCHA 4D2VA 1VJYA 4LMNA 4X3FB 4ZLZA 3UMWA 4EH6A 4LMUA 2XIRA 3ZEWA 5B2KA 1J7LA 1YOMA 3D5XA 3CD3A 3O7LD 4EOIA 3EZRA 4L6QA 5I9YA 3OEFX 5C03A 3BQCA 3REPA 4I21A 4QYHA 3VAPA 4LL0A 3V5QA 1KE6A 2R3PA 3NS9A 4PL5A 4B6LA 2XP2A 4I6HA 4EJNA 4UZHA 5EFQA 2UZUE 2BRGA 2YDKA 2J0MB 4UALA 3CGFA 3R9NA 3ZXZA 3QTSA 4NFNA 5H2UA 5AAFA 3QQUA 3ORIA 3HDMA 1OKWA 3O7LB 4FL3A 4RIWA 3C4WA 4R5YA 4MKCA 4YSMA 4XG2A 5A4TA 5GIPE 4PTEA 4AZVA 2EB3A 5AUZA 1DI9A 3R2YA 5L6OA 5K5XA 4ANMA 4E5AX 2XIYA 4XEYA 4LOPA 4JDIA 4AF3A 4ZY6A 4UX9A 3VF8A 3WARA 1NVSA 4Z7GA 5I3OA 4BZOA 1WZYA 3Q04A 3TZ8A 4M66A 4EHGA 5JMSA 4KD1A 2VWVA 3F5XA 5EI8A 2A0CX 4RJ3A 3VS6A 2W0JA 3W8QA 3KRWA 4D1ZA 3GFWA 3V8TA 1WVWA 3UIXA 4D9UA 2DS1A 3EQIA 5KMIA 5HO6A 4IHPA 4FNXA 2VGOA 2PVFA 4BWXA 4RQKA 2WNTA 5AUYA 3EL8A 2XVDA 2VO6A 2XA4A 1YDSE 2QKWB 4IIRA 5AUWA 5FG8A 4YJRA 3OS3A 5IQEA 4L7SA 4Q9SA 4GJ2A 4C4IA 3THBA 2NP8A 3RWQA 3UZTA 2R0IA 4W8EA 3AC3A 3PIYA 3RAIA 3S95A 4RT7A 2GTMA 4C0TA 2CKEA 2H96A 4FKOA 2JDRA 3H0ZA 1REJA 3UVRA 1PMVA 5EM6A 4ZLOA 2PULA 2DWBA 4FEXA 4LRJA 3OD6X 2YIRA 3SGCA 3QQJA 2NO3A 4FI1A 3VW8A 5IU2A 2P4IA 3PUPA 4C2WA 2XK6A 3QF9A 5CF6A 4IFGA 2AC3A 2WO6A 4CMTA 5EH0A 4GKHA 3FYKX 4N4SA 2OXYA 3W18A 1H07A 1ZXEA 3GCUA 4DEHA 4MNEA 2G01A 2O64A 4IWQA 4U9AA 3ZDUA 1OIQA 4U5JA 3DLSA 4K1BA 5H8GA 4U80A 3GQLA 4L3JA 2PUNA 1LUFA 4ALUA 3E3BX 2BZJA 2WTWA 3DJ7A 4B0GA 5FEQA 3D5WA 4RBLA 4DGNA 3EYGA 4USFA 3LFFA 5CAVA 4ZIMA 4RWKA 4YBJA 4BYJA 4ENXA 5M08A 2J5FA 1P4OA 4KAOA 2ZB1A 3KULA 1JKTA 2QONA 2HZNA 1YVJA 4I94A 4J7BA 2JGZA 4R1VA 4CFFA 4G3CA 1XWSA 5IH6A 5G6VA 3KC3A 4CZYB 5HVKA 3KK9A 2OWBA 2VN9A 4XV1A 4RMZA 4CKIA 3CKWA 4DC2A 5A14A 5HTIA 4DE4A 4RIOA 3LFBA 4XUFA 1PHKA 4GVAA 3II5A 3LE6A 3GVUA 1K9AA 3NRMA 3PY3A 3MESA 3PA4A 1STCE 4O22A 4CFVA 4AA5A 5DH3A 2P2HA 1XH9A 5M4UA 2FO0A 2XNPA 2RIOA 4QYGA 4BBEA 3PPKA 3QRIA 3VUHA 5CF4A 4FVPA 4Z9LA 4EOJA 3EHAA 1M7NA 3TV7A 1LEZA 1A06A 3DK3A 3AT4A 4EH8A 5CASA 5C8NA 3HVCA 3AMYA 2OLCA 1MUOA 2E9NA 3ORXA 4MD9E 5ANKA 4FV1A 5AP7A 3C1XA 3B8RA 4D55A 2Y6OA 4HVIA 4CG9A 4G9CA 3RNYA 3RTPA 3BEGA 2W17A 1J7IA 2YLEA 3DOGA 4IZ7A 3LMIA 4ZTMA 3PIXA 3ZFXA 4M7IA 4CLIA 4PNKA 4KIOA 4K9YA 4BKYA 4BTFA 2C5XA 4KUJA 4HJOA 4LL5A 5CZHA 4JBOA 3QD0A 4FTRA 4L68A 4AW0A 1JQHA 3QD2B 5J9YA 4ZK5A 2BHEA 3HMMA 4BBFA 4EWHA 3DXQA 3PXZA 1QPJA 3KREA 4C02A 5HU9A 4F64A 4G6NA 3F6XA 4O83A 2C3LA 5E1EA 4F0GA 3OUNB 4YHTA 2F7ZE 2V62A 4X3FC 3DBCA 1GJOA 2GCDA 5E90A 5KMNA 1KWPA 4GT3A 3AD6A 4YTIA 1YOJA 4BHNA 4IAIA 3B2TA 3WZKA 1RW8A 2F57A 4OTGA 4U43A 3Q96A 5EK7A 5HORA 3LLAA 4AP7A 4G31A 3ZSGA 4MWIA 5JGDA 1JSVA 3SW4A 4YGAA 5M07A 5IEXA 4FSZA 2W05A 5K9IA 4LI5A 3BGQA 4J1RA 2YDIA 4RRVA 1Q41A 4NWMA 3FMDA 2HW7A 5K5NA 4FIGA 4O0XA 4XOZA 4PDYA 3EKKA 2WZJA 2ITQA 3LCTA 4CFWA 4O7TA 1H0VA 3OWPA 4JS8A 5A4EA 1CMKE 2B4SB 4JR7A 4GYGA 4RZWA 3NVKI 1NT2A 4UY9A 3OY3A 3CJFA 2ZM1A 4TTHB 2ITNA 3L8PA 4EC9A 3OCSA 2WTIA 3ULIA 4BZDA 4CQEA 4EH5A 2OU7A 3OBGA 5K4JA 1NVQA 4XRLA 4G6LA 5KHWA 3F2AA 3NIZA 5D1JA 3CTHA 4JX7A 4NM7A 4RIXB 3ORPA 4DGOA 4EZ7A 5M57A 4BFMA 2XMYA 2BAJA 2X6EA 4ARKA 2WOUA 4FV9A 4ENYA 4RIYB 3FPQA 3QGWA 3HV4A 2CN5A 4I3ZA 3MIYA 4QPMA 3VQHA 4AA0A 4O7RA 3AGMA 3ANRA 3ZH8A 4DA5A 2XK7A 1OL6A 4BIEA 3KB7A 3QD4A 5BVOA 3R22A 1UKIA 2C0OA 1U5RA 3ITZA 1ZRZA 2W1IA 2YM7A 4KA3A 2ZOQA 1W7HA 1Y57A 4Z55A 4LQMA 4JQEA 4UWBA 4CLJA 2B7AA 4G1WA 4CFXA 1DS5A 1Q3WA 2OJGA 4CYIA 2QOCA 3FMKA 1CDKA 3IW4A 3P79A 3PRIA 3NUSA 2XKCA 4MXYA 3VS5A 2EUFB 4ZMEA 2PUUA 2GS6A 4LGGA 3GC8A 2O65A 2CPKE 3OCTA 3NYVA 4KBAA 4O0TA 1OKVA 3FL5A 4QMLA 3JXWA 3HMNA 2OXDA 2DUVA 4BVUA 4DBNA 4QMOA 4RLLA 3N51A 4DT8A 2XF0A 4FT0A 5IH4A 2GQRA 1MP8A 1H00A 3O96A 3RAWA 1OITA 3AG9A 2I0VA 1V0BA 4WUNA 4C57A 2W1HA 3HUCA 5FXRA 5HD4A 3LFCA 5CNNA 5E1SA 4WA9A 3U51A 3U87A 1W8CA 4AU8A 5D10A 4TN6A 3OHTA 1UKHA 3VN9A 2OH4A 2OH0E 1KUTA 4ANLA 4YP8A 1H01A 3NZ0A 3FY2A 3MI9A 3TIZA 3R28A 4EBWA 3UQCA 4BDKA 3U4UA 3MY0A 1DAYA 3ZC6A 3HMPA 3EQDA 3L9PA 2V7OA 4KBCA 1WFCA 3IW6A 4E20A 3UQFA 1YI3A 2PZRA 1W84A 4O82A 4DH3A 2GNJA 3SD0A 4TXCA 4QMVA 3EFWA 1JAMA 5AADA 3HAMA 2JDTA 3DFCB 3FHIA 3PTGA 1A48A 2QODA 5HG7A 2GTNA 3KXXA 2WIHA 4K2RA 4QYYA 4FZAB 3ZUVA 1IAJA 4U42A 4E6AA 3HNGA 2BZKB 5FTOA 5GZ8A 5LMKA 2XK8A 4CFUA 3QBNA 2E9PA 4HVSA 2IWIA 2Y7JA 2HWOA 5AIRA 4APPA 1OBDA 1WBOA 1Y6BA 3F2RA 2OZAA 5AMNA 2YM4A 3M11A 5FXQA 3DY7A 3QFVA 4BBMA 3FE3A 3M42A 3QCSA 4G17A 3GXLA 4FKJA 3RWPA 2HXLA 2EU9A 3DDPA 2J50A 4FODA 4LRKA 4BWPA 2XK9A 1JSUA 2FA2A 3F66A 5KUPA 2GQGA 4HW7A 3OTUA 4M67A 3BBWA 5HZNA 4XYFA 5IEVA 2WELA 4FTTA 2QO7A 4YZNA 2QOQA 3A99A 4TYHA 3G15A 3D4QA 4EOSA 3F2NA 4FL1A 4IADA 4L52A 2CNUA 5ANGA 3ZOSA 5AV4A 3IECA 1YKRA 1E1XA 4KRDA 4OBPA 3FAAA 5GNKA 3BYMA 5LCKA 1JPAA 3OT8A 5JFWA 3R63A 1WBVA 3KN6A 4KS8A 1R0EA 3RINA 2JKQA 3QXOA 3CY3A 3HV7A 4X21A 2YIQA 1ZYLA 3PSBA 5FEEA 3VS4A 3TDWA 3VUDA 3DLZA 4JAJA 3FI2A 4QMYA 4ZAUA 3LLTA 3ZC5A 1GIHA 3R21A 4FGBA 3LFQA 3T3UA 3EOCA 3O51A 3FXXA 4LGDA 3L8XA 4EUTA 3V5PA 1MQ4A 4IVCA 4AXAA 4E6QA 3FEGA 4JLCA 4QMXA 4PMTA 4PL3A 2J7TA 3AC8A 4KSPA 4TY1A 2BVAA 5CVFA 4FTKA 4YNEA 1RJBA 2X7OA 4MVFA 2HAKA 2B9FA 4D2WA 4MCVA 3FLNC 5J5SA 2VTMA 2OF2A 3ORZA 3R1QA 3RZFA 5C4KA 5BVWA 1YXSA 2BR1A 3RK9A 1NXKA 1BUHA 3GUBA 4RA4A 1IA8A 4CZTA 4BDBA 4BICA 5F20A 3OEZA 2VTPA 3KRRA 3Q60A 2A27A 3D7TA 3SLSA 4RG0A 3BGZA 4F1TA 3R8ZA 1PXNA 4LFIA 3MVMA 4D4YA 3N4TA 2HZ0A 3JVSA 2VWBA 1SMHA 4MHAA 5LVLA 3BYVA 5DR2A 4S30A 4FSWA 5AP2A 3VRYA 4WBOA 3E3PA 5J9ZA 3G6GA 4O38A 2VTLA 4IVBA 3JUHA 3GOPA 2EXMA 4JIKA 4O2PA 3N9XA 1ZMWA 2GSFA 3QX4A 4I0RA 4NM5A 3GENA 3R73A 3GC9A 3PJ3A 1ATPE 3PA5A 2VGPA 1FMKA 5DI1A 4U40A 4TKSA 1ZYSA 4ZXTA 1FVTA 5HG5A 4FV2A 4U41A 4IB5A 2UZBA 2ONLC 4R8QA 4HPTE 4Y85A 4LV5A 5EDRA 2BMCA 4BZNA 3BE2A 3D2KA 2XEZA 3KF4A 4BDGA 3R0TA 2FSMX 1H1RA 1Q61A 3EZVA 3QWKA 4HGEA 3SRVB 3ZFMA 3OTVA 4QYEA 2W99B 4X3JA 5AV2A 3UG2A 4H3QA 1IAHA 3H9FA 4P2KA 4HYHA 2W5BA 2PE0A 5FDXA 4EK4A 3FDNA 3LXKA 4L3LA 4DEEA 3JPVA 4MX9A 4CYJA 2WIPA 3ERKA 2C0IA 4EHVA 1VR2A 2W9FB 3P86A 1ZWSA 4G34A 4QP4A 3WZDA 4EONA 3LJ1A 3RHXA 2VTSA 2GPHA 4ZSEA 2PSQA 2OZOA 4XLIA 3UYSA 5J1VA 4RJ5A 4JOAA 2XBAA 3PJCA 5EW3A 3VS1A 2PYWA 5AR4A 1X8BA 3AC2A 4O7YA 5J8IA 1U54A 5AV0A 4YC3A 3TUCA 1XH7A 1K3AA 5CEQA 5CU0A 3MB7A 4YJNA 2ZVAA 3UC3A 4WRSA 5E8ZA 3UBDA 2E9OA 3FQSA 3A8WA 2CN8A 4IWPA 3E88A 4ZTNA 2AUHA 5CSHA 4NCTC 4U3YA 5I0BA 5JKGA 3MY1A 2RKUA 4OAVB 1GY3A 4HCVA 1IA9A 4BDHA 4I6BA 1P5EA 1SZMA 4JQ8A 3D15A 5EYCA 3OROA 3K54A 4GIHA 5I9VA 3P1AA 5HX6A 5HEZA 2RG6A 4NZWB 2IO6A 4U7ZA 3NWWA 3WOWA 3IW5A 3KL8A 1OL5A 1ZOHA 5KZIA 2EB2A 4KIQA 4N6ZA 4TZRA 4AUAA 2OICA 3R7OA 5BYLA 4A9YA 4F9CA 4JNWA 5HNGA 3NAXA 4QQJA 3A2CA 3UODA 1QMZA 2O2UA 2EXEA 5CF8A 5KKRB 2UW3A 1BKXA 5BVNA 1ND4A 5EI6A 4BRXA 3Q6UA 2PZPA 5M55A 5HHWA 3LFSA 1VEBA 2OKRA 2Q0BA 4UXLA 1L8TA 2GU8A 4QQ5A 3D9VA 4RJ8A 1AGWA 1GZNA 4B99A 2C6TA 3P7AA 3C4FA 4QP1A 5B0XA 5EYKA 2Y6MA 2R2PA 1F3MC 5A46A 2J51A 5B7VA 2B9HA 4DG3E 3RALA 3A7GA 3ID6C 2QLQA 3GT8A 3IK3A 3HECA 4RFYA 1GNGA 3MV5A 3ROYA 3HMIA 4G16A 4DFBA 2YHVA 3KXGA 4C4JA 4OAUC 4AE6A 3D5VA 2CHLA 2UZVA 4C62A 2UW9A 4R3CA 1YDRE 2KTYA 3C0IA 3E5AA 3SKCA 4IDTA 4IANA 3R9RA 4DINA 4EL9A 2C6DA 3BZ3A 4M69B 3PVWA 3QKMA 2PU8A 1OM1A 3SOCA 4OTIA 3QWJA 3VULA 3MFRA 4ZTRA 4JG6A 2R4BA 4DBXA 4MH7A 5CX9A 3KF7A 3FI8A 4KABA 4RWJA 2WQEA 3TT0A 4WG5A 5CENA 4XP2A 3CKXA 1YI6A 2QOKA 3R1SA 2GS2A 4FKVA 3VJNA 4Q9ZA 4QTEA 2ZM4A 2WMWA 2FH9A 3BU5A 2JDSA 1OZ1A 3LXLA 3P5KA 3SQQA 2UZNA 2PVKA 4QQCA 1SVHA 3A7IA 3P78A 1JNKA 3FMEA 4GJ3A 5IQIA 3ZCLA 3AC1A 1HOWA 2BAQA 4PPCA 3GC7A 5TKDA 4AFJA 4I24A 5CI6A 4D0XA 4D4SA 3UGCA 3ZM4A 3DS6A 3ZEPA 4I5MA 4UMQA 3DKFA 1H1QA 2Q0NA 3F5GA 2OFVA 3FZSA 2YM3A 4DLIA 4C2VA 4ITJA 4R78A 4OTHA 1XHAA 4CXAA 4ZY5A 3VBQA 2Y8OA 3BWJA 2XBJA 3UE4A 5GINE 4RFMA 4EQCA 3N4VA 3RP9A 3FMMA 2W4OA 2UZEA 4JI9A 1DM2A 2X9FA 2XJ1A 4QP7A 3TUBA 2RFSA 3V04A 4O86A 1PF8A 4ACDA 4E5BA 2XJ2A 4HGLA 3PSCA 2UV2A 2NRUA 3PP1A 3G9LX 2PZYA 1OI9A 2YLFA 3MVLA 4DN5A 1U59A 2FYSA 4EJ7A 5TE0A 3GQIA 1ZOGA 2XYUA 2BDJA 3LW0A 3O2MA 1YXTA 3ALOA 5LMAA 4C8BA 2YWVA 5LARA 3FQHA 4NUSA 5E8XA 5HNBA 3DBQA 4FSTA 5BVFA 2WFYA 1JSTA 1XQZA 2PVLA 4BF2A 5ITAA 4M12A 3IO7A 5BUEA 3PJ2A 5EQEA 3ZO1A 5CAQA 3B2WA 3LOKA 3HV3A 3ZONA 3O8TA 5LMBA 2YJRA 2R3IA 3HP5A 2XCHA 4IFCA 4EZ3A 3ORTA 4O0RA 2W9ZB 5L8LA 3K3JA 4JR3A 2ZV8A 1OVEA 4RA5A 4YSJA 1AD5A 1Q8UA 2R3NA 5JFVA 4JT3A 2QOHA 1UNHA 2YZAA 3UP7A 3F3UA 1MRVA 3QAME 3QHWA 4F6WA 2ETMA 3PJ8A 5EKNA 4RX9A 3CQUA 2QOOA 3V01A 5HCZA 4H05A 4WKQA 3BQRA 4ZOGA 3PLAE 2WHBA 1OGUA 3F9NA 3M2WA 4FMQA 3FI3A 5H8BA 3PXKA 4EKLA 4AGCA 5DVRA 1YXVA 5HBEA 3DT1A 3QXPA 3PXYA 4I6FA 4QMNA 1KE5A 1E1VA 2ITYA 4V04A 2I1MA 3LQ3A 3LXPA 2CGXA 3OXZA 3VJOA 3BV3A 3U8WA 2R3LA 3MA6A 4FK6A 1YXXA 3FLSA 4U8ZA 5JT2A 3WI6A 3C4XA 3OWJA 3AQVA 4H3PA 4TT7A 3UNZA 4F63A 4MXZA 4F7NA 4MAOA 3S3IA 1UWHA 4CFMA 5EQYA 3U6HA 1P14A 4LGHA 1DAWA 2GHMA 3MB6A 3NNXA 3RPVA 3ZO4A 2B52A 4Q2AA 5HE3A 3WBLA 2J0IA 5M53A 4IDVA 5FXSA 4IC8A 3RK5A 3E63A 2KULA 3F3ZA 4KRCA 5BNJA 5IUHA 4ACMA 2R3GA 4DFUA 1CKIA 1IRKA 1PMNA 3R04A 4HCUA 5ANDA 5L6WL 3VW6A 1VZOA 2Z2WA 2Z8CA 4F7SA 4MD8E 1SVEA 4YLLA 1H24A 2R3QA 1ERKA 2Y4IC 4PMSA 4DFNA 5KKRC 1UNLA 2IJMA 3E8CA 4FK3A 3MPMA 5FBNC 2UVXA 2GDOA 3MY5A 3A7FA 4EI4A 4L42A 4D2TA 4ERKA 3CGOA 5IQCA 1B39A 2UZLA 3GU8A 1LEWA 2UW8A 4GL9A 3G0EA 3MFSA 5D12A 2WMBA 4BDDA 1R39A 2IVTA 4IXPA 4NT4A 3ZO2A 5AP6A 5M56A 1YHWA 5IDPA 2GNGA 3OP5A 1YWRA 2JBOA 2PWLA 5C8MA 4FKRA 2YCFA 4NTSA 4L53A 4EHZA 2RSVA 5L3AA 3CC6A 2YABA 5L4QA 1Q8TA 1PYEA 2HY81 4BCOA 3KRXA 3PE2A 4UMUA 4L44A 5JRSA 4NJDA 1M2RA 4X2KA 4KKHA 3EN4A 4YZ9A 5CALA 3QD3A 2OIBA 1J7UA 1R78A 4XBRA 3TKHA 2C5YA 4QMSA 3ANQA 1S9JA 1YOLA 3KMUA 1KE7A 5ETFA 4BTKA 3Q2JA 4IWOA 3SOAA 2CNQA 2EWAA 1FVVA 3PY1A 3R6XA 4KIPA 4BR3A 4YHFA 3QALE 4IH8A 2WEIA 3RZBA 3F69A 5AX3A 2JDVA 4O21A 4B8MA 3QZFA 1H4LA 3IW7A 4GRBA 4J96A 2O3PA 3NGAA 3ATTA 1XBBA 2E9VA 4R77A 4AGDA 3TN8A 4W9WA 4HYIA 3VBXA 4DF3A 5DRBA 4AT5A 4M84A 4EK8A 4C61A 3UPXA 2YZLA 3UOJA 4RIXA 3BLHA 4TYGA 2QOBA 1PXLA 3QUDA 3UIMA 1IR3A 2LGCA 5HTBA 2AC5A 4NW5A 4BGHA 4FTCA 4HZSA 5EYDA 4EOKA 1I09A 3NDMA 1U46A 3ZZEA 4JBVA 3UNKA 2HENA 2QHNA 3QHRA 3OXTA 4V0GA 3RPYA 4RWLA 3F82A 3EFKA 4AS0A 2QVSE 2I0EA 2UW6A 3DBFA 3TV6A 2W4JA 3IONA 2IW6A 1APME 4XMOA 3WF7A 3POZA 4LOQA 1BL6A 5CI7A 3FKLA 4FKPA 2Z02A 3NUXA 1YXUA 3AC5A 4NKAA 4XV3A 4KS7A 3UO6A 1JKSA 4HGSA 3QQKA 4NKSA 4WG4A 2ONLA 5LCJA 3I7CA 2ESMA 4TNBA 3P0MA 5GZ9A 3KK8A 5M06A 4EHEA 4EQMA 2VX1A 2HWPA 2IVUA 4GYIA 2VU3A 2R3OA 4TYJA 4TNDA 2UZDA 2HXQA 2G9XA 4NU1A 2PVYA 4DFLA 4JJRA 2YJSA 4IM2A 3NYXA 4BI2A 4O7VA 5EOLA 1PYXA 4IB0A 2NPQA 4XLVA 3V6RA 1FVRA 3DTCA 3A8XA 4LUDA 4XX9A 4C4HA 4QP9A 3PPZA 3TKUA 3MW1A 4XHKB 3VBTA 4AOJA 4UXQA 4N6YA 4EH2A 4DH7A 4QYFA 3CD8A 3RBWA 4D5HA 4DHFA 4G3GA 1ZYJA 3MTLA 3BV2A 4PY1A 4GVJA 1GZ8A 2C0TA 2ZAZA 3Q4UA 4GFOA 4HYSA 4NM0A 4QNYA 5BX0A 5K0XA 2VX3A 1H26A 1PKDA 4QMUA 3VBYA 3C5UA 4EH9A 3V5JA 4ALWA 4OT6A 4C37A 5I4NA 5KBQA 2OSCA 3TTJA 3C7QA 3BCEA 1Y8GA 4DGGA 2V55A 3TV4A 4BCIA 4ZY4A 5A6NA 1Z9XA 3MJ2A 1RDQE 2VRXA 3OFMA 4RWIA 3O8PA 4GV1A 5CAOA 2C6KA 4IMYA 3ACKA 5CXHA 4IX3A 5EDPA 5AR8A 1Y6AA 2VO7A 4Z3VA 4ASZA 2HY0A 4FKLA 5HG9A 1UU9A 1URCA 3KRLA 4BYIA 1OMWA 2R3JA 3SHEA 5FD2A 5DOSA 5LWNA 4BTJA 3MGYA 3BKBA 4MTAA 3LCDA 1J3HA 3QTWA 4LUEA 4OT5A 5B2LA 5H3QA 1ZMVA 3TNQB 3V8SA 2X8DA 3KCKA 5CS6A 3UMXA 3HRBA 3ZS5A 5BYZA 1SYKA 2X0GA 3IDPA 3MH0A 3FSFA 3R01A 5EM8A 3EN6A 3NSZA 4RIWB 3DFAA 1PW2A 3H3CA 4GEOA 4DEAA 4TWCA 5KMJA 4O84A 4YTHA 3F5PA 4ITHA 3ETAA 4S33A 2VNWA 4DG0E 4L8MA 4CGAA 3DK6A 4MWHA 2ITXA 3LVPA 3NNUA 5EQPA 4LM5A 4YC8A 2YFXA 1KV2A 2HELA 3BHUA 5FRIA 4F7JA 1IG1A 3OC1A 3VIDA 2IVSA 2WQOA 3LQ5A 4G9RA 2H8HA 4I93A 3TNWA 4AA4A 5CAPA 4W4VA 4QMQA 1M2PA 3MYGA 3BYSA 4NFMA 3LJ2A 2ZYBA 5DWRA 4MK0A 4ZTQA 3R83A 3RGFA 2R64A 1XH6A 3ORKA 4CFNA 4XG3A 4DFXE 4Q5HA 1NY3A 2P33A 4O0SA 3WF5A 2GMXA 2YCQA 5DR6A 4F4PA 3SAYA 5A9UA 5DNRA 4CKJA 5J1WA 2C5OA 1M52A 1O9UA 1W0XC 2W7XA 4ZJIA 3WYYA 4FV7A 3CE3A 2RFNA 3ORMA 3EQGA 3WE4A 5JRQA 3IOPA 2A2AA 2BZHB 4FTNA 1MQBA 3C9WA 3E7VA 5L2SA 1YWVA 2HW6A 5DIAA 3O0GA 3W2PA 3GU4A 3VBVA 3PVGA 5HESA 5E8SA 3POOA 5AAGA 2QURA 1XBAA 2H34A 2VTNA 4LOOA 3I60A 4CMUA 4NW6A 3SXFA 3MPAA 3OG7A 3P4KA 3C13A 4RLKA 5IKWA 4PDPA 2Z7LA 3FZRA 3PWYA 3UOLA 5EG3A 4MQ2A 4KIKB 2YAAA 2ZMDA 4I92A 5LVNA 4ASDA 3PG3A 4D2SA 4IZAA 3KCFA 4XG6A 4BKJA 2R9SA 1MRUA 4MNEB 2BRHA 4OTPA 2VAGA 1ZY4A 5FTGA 3PVUA 4WSYA 4NTTA 5IQFA 3I0QA 2FGIA 3WE8A 5IA0A 1OPKA 4MF1A 5AR3A 4J98A 4M14A 3NYOA 2BAKA 1XO2B 2P3GX 3PFQA 4ZSAA 5C27A 4ANOA 3OT3A 3KULB 4WHZA 1BX6A 3KFAA 4XBUA 2VTIA 4AN9A 2RF9A 2PUPA 2P2IA 1BYGA 2G2IA 3Q53A 4KKEA 4RPVA 5JZNA 2LAVA 4CTCA 4EYJA 3EH9A 3F3WA 1IEPA 1CM8A 3GB2A 4BDFA 1ZARA 3QLGA 3OF0A 3WZJA 4J53A 3NNWA 3OOGA 2VZ6A 4GK4A 3D14A 5CY3A 5AV3A 3UO4A 3I0OA 4EKKA 5AUTA 4QP8A 3ZRKA 4ANNA 3NLBA 3ZU7A 3EN5A 3CJGA 3A4OX 4F9YA 2JKMA 2YWPA 4R6VA 3ZDIA 3P7BA 4OBQA 3HYHA 3R1YA 2GHLA 4N0SA 4FTUA 3R02A 5A4CA 2ITPA 4O91A 4GG5A 3E87A 4FIHA 4AW5A 5JGBA 4O7SA 3EQPA 2UZOA 1OUYA 3W2QA 2X39A 3AD4A 4FIIA 3LHJA 3FUPA 4M3QA 5DGZA 4PTCA 4Q5EA 2QOLA 4AZFA 4D2RA 1YRPA 4AZTA 1GIJA 2BRMA 2X8EA 4EH7A 3U54A 1PXKA 2WMTA 3QYWA 2WTVA 4IAYA 3UOKA 4AOIA 2PVMA 3HX4A 4EK3A 3BLQA 4ID7A 3U6IA 3DB8A 3QTRA 3PA3A 4KINA 3QKLA 4EWQA 5C4LA 3QQFA 2ITWA 1W98A 4J99A 4S32A 4X2FA 5CANA 4E7WA 1H25A 3R7VA 3QX2A 3MH2A 3FY0A 3NUYA 4QMPA 1UV5A 3R9DA 3TXOA 5FP5A 4XP0A 5E91A 5IISA 4APCA 3GCSA 3D5UA 3OWKA 3U6JA 2UUEA 1BLXA 4U0IA 4C59A 4C4FA 2UZWE 4CNHA 1A9UA 4ZS0A 2BKKA 3PXFA 4DTAA 2BTSA 4E3CA 4HVGA 2Y4PA 3SXSA 4ALVA 1FPUA 4IC7A 3U9NA 3O71A 3QTZA 5DHJA 1J1BA 1JVPP 1KV1A 1RQQA 1UU7A 2O63A 4WO5A 3VUGA 4DLJA 3S0OA 5M09A 3MH3A 3RMFA 4FNYA 4MXOA 4UZDA 4O0VA 2XCKA 4X6RA 3FMHA 3QQGA 3R9HA 4PF4A 3A60A 3QRJA 4ZZMA 5B2MA 3DV3A 4ANQA 4IVDA 3ZBXA 4AW1A 3AGLA 4FKWA 1OL7A 3BE9A 4YJUA 4M0ZA 4C7TA 3V5WA 5BQ0A 5LXMA 4QTDA 4BKZA 3UIUA 2NRYA 4F7LA 1KE9A 4LYNA 5AR5A 4AX8A 5CEMA 5GJGA 2ZM3A 2C6MA 2BRNA 4J8MA 3PVBA 2I0HA 3QKKA 3TJCA 2W1ZA 3VS2A 2FUMA 4MQ1A 5CQWA 4MNFA 4NJ3A 4S31A 4DH5A 4ZTLA 5DPVA 3EYHA 4FSUA 2HOGA 1IASA 3COMA 3CP9A 2ZJWA 2OI4X 1YHVA 4BCJA 1GZOA 2XM8A 5CSPA 4WG3A 2JAMA 1PJKA 3PWDA 5DN3A 1VYZA 4PQNA 4FV8A 2WMSA 2WB8A 2YIXA 3ENMA 1CSNA 3W32A 1NVRA 2X6DA 3D2IA 3C4EA 2ETRA 3MBLA 4O1OA 5H8EA 3ULZA 5KNJA 5K4IA 3V5TA 3A7JA 3K2LA 4YPSA 2XKEA 3R30A 2RFEA 2QC6A 4BI1A 4JVGA 5KMOA 5HLNA 5AUUA 2JIVA 3WF9A 4YBKA 1H0WA 5KX8A 4IAKA 1YI4A 2YAKA 4AG8A 2G2FA 5ETIA 1ZAOA 2BROA 2OIQA 3M1SA 5AM6A 3JY0A 3F3VA 3R2BA 4QD6A 3FMJA 4Y73A 1RE8A 1M2QA 2UZTA 4FTOA 4FTQA 5HQ0A 2XNEA 5L8KA 3QCXA 3W8LA 4J97A 2WD1A 4BIBA 2C5NA 3DA6A 4WNPA 3FI4A 1WVYA 4ACHA 3CY2A 3C50A 4ZJJA 3IGGA 3QTIA 3W1FA 2XS0A 3Q52A 2PZ5A 3FZOA 4FKIA 1OUKA 3BHTA 4IQ6A 4XG4A 4DEDA 3R8MA 2O0UA 3CTQA 4I0SA 4DFZE 5BUJA 5IG1A 4ZSJA 2J9MA 1CKPA 1JWHA 4HCTA 5J7BA 3E93A 4PDSA 1XH8A 5ACKA 4BDIA 3G0FA 4RQVA 4AAAA 2CKPA 4XG9A 4FNWA 3LM0A 3ENHA 4H1JA 2XB7A 3FXZA 2VD5A 3DNDA 2UW7A 2XRUA 2X8IA 2X2KA 1Q97A 3R8VA 5KMKA 4FEUA 2YM8A 3RPOA 4BN1A 2JKKA 5E8TA 3RPSA 4IW0A 4YMJA 2PVNA 5C1QB 4JAIA 4CT2A 5E9EA 4X2JA 3W10A 1TQMA 3PPJA 4GK2A 4AW2A 3KY2A 4YNOA 5M4CA 5IUGA 2BIKB 4JBPA 4PPBA 5A4LA 4PX6A 3WILA 1F0QA 2E9UA 5I9XA 1PXOA 1P2AA 2G2HA 3CEKA 5AJQA 2HZ4A 4FX3A 3JVRA 4RJ6A 3COIA 5F95A 3C0GA 3DB6A 3LFDA 5L8JA 5T68A 4R7IA 4PMPA 3ZLWA 5C8KA 4E26A 5DMZA 5AA9A 4FOCA 3PIZA 4H58A 5ETAA 3ZTXA 4L67A 4EEVA 5JEBA 3DAEA 4AQCA 4O7WA 1F5QA 4ZTHA 4OTFA 5HICA 5E8VA 2CGWA 2FSOX 3Q9WA 5A3XA 1FMOE 2RGPA 3DXNA 4D4VA 4E4MA 5DFPA 1KOBA 3DDQA 3I5NA 4FR4A 4K0YA 3GC0A 2BTRA 4GUEA 4DTBA 4P5QA 4FVRA 5LVOA 3KMWA 2Z7RA 1M7QA 4FKSA 3Q4ZA 4YO6A 2JITA 4NIFB 2YEXA 4MXXA 1JLUE 4EOOA 5BYYA 2FB8A 4I22A 2CDZA 4HZRA 5CZIA 5IQGA 2Y4IB 4IACA 1J91A 1G5SA 3HMOA 5AA8A 5FUTA 3KMMA 3FWQA 2WMUA 4G3EA 4E4XA 3QTUA 1KSWA 3DAKA 3R71A 5CU3A 3Q4CA 3QUPA 4F0IA 2YN8A 3L8VA 4QNAA 5CVHA 1BI7A 5BUIA 2YERA 4OTWA 3SC1A 1O6LA 4TPTA 3TUDA 4X3FA 4NK9A 2NNWB 3S2PA 1OKYA 2J5EA 2PPQA 1H08A 3E62A 2VO0A 1H1WA 1WMKA 5IF1A 4DYMA 1G8AA 1BL7A 2DYLA 2UW0A 5CU6A 4JG8A 5HGIA 3RHKA 2C6LA 1Q4LA 5H9BA 4AGWA 3H30A 3I7BA 4EUUA 3E8NA 1Q8WA 2BDFA 4HPUE 5D11A 5AV1A 5HE2A 3TWJA 3QQLA 5DT4A 3WZUA 4A07A 3LJ0A 4D2PA 4Z7HA 4RX5A 1U5QA 4JIAA 1UU8A 2B1PA 2ITTA 1O6YA 3ZYAA 3G2FA 2HK5A 2UW4A 3F7WA 2PVRA 1UU3A 2E2BA 3PZEA 2X81A 4ANBA 3VHEA 3LFNA 3E64A 4QMTA 3E7OA 2CGUA 3V3VA 3VBWA 3KKVA 3FQEA 4OR5A 4U97A 1OPJA 2JDOA 1Q3DA 2H9VA 4WBBB 3EB0A 4U81A 4X2NA 4M8TA 3MVHA 3Q6WA 5EHYA 5BMMA 4QP2A 1QPEA 4FT9A 1H27A 2PTKA 4FVQA 4FNZA 2I0YA 3QUEA 4G3FA 5F4NA 3VNTA 1UNGA 4O6LA 4UBAA 1UA2A 1XBCA 3GU5A 4E4NA 3VUMA 4MXCA 2PVJA 1J1CA 2W5HA 4LV8A 3NUNA 4D9TA 2XJ0A 3IDBA 3VUIA 2W4KA 3D83A 3EL7A 1H8FA 4J71A 1LP4A 4M0YA 5FGKA 4O0WA 1EH4A 1SVGA 3R00A 1U4DA 5JZJA 3FZPA 3R7IA 2ERZE 4CSVA 4KKGA 5CAUA 1GZKA 2QI8A 3VC4A 1HCLA 2EVAA 4O6EA 5HVJA 3ZUUA 3UPZA 1Q8YA 5FTQA 4QRCA 5IMEA 2R3KA 4F9AA 3CCNA 1ZY5A 5DT0A 5EM5A 3Q9ZA 5CXZA 1Q8ZA 4RC3A 4CT1A 2CNVA 5EI2A 3WZEA 4FF8A 4OTQA 2XM9A 1QPDA 4K11A 5EOBA 2YCSA 1OIYA 2HYYA 2YM6A 5IA4A 4E5WA 3MA3A 1CKJA 4I4FA 4AZSA 4IB1A 4NH1A 4ORKA 3B8QA 5DYJA 3AXWA 2IZUA 4I5PA 1LR4A 4YZMA 4CV9A 2YM5A 4TYIA 5HD7A 3ROCA 4E4LA 3OCGA 4W9XA 4GIIA 3F7ZA 3KN5A 4FEWA 3I5ZA 4K77A 5HG8A 2WOTA 3CSVA 3LXNA 3CPCA 2XNBA 2ITUA 4RZVA 3W2RA 2OIDA 5A4QA 3JS2A 3QQHA 4CZUA 1FGIA 4O96A 4GW8A 4IB3A 4R3RA 3Q5ZA 3LAUA 3L9MA 2UW5A 3ZZWA 5J79A 5CF5A 3TNPC 4D58A 1UWJA 5CEKA 4X7QA 2ITVA 4YZDA 4IBMA 4B7TA 5HCXA 3FL4A 5CSXA 3BELA 4JDKA 2W1EA 4MBLA 2I7QA 2JIUA 4IE9A 2X4ZA 1U54B 2CKOA 1Q99A 4NM3A 3VUTA 2V0DA 3DBDA 3GCQA 2XK3A 1OIRA 3TJDA 2AYPA 2PMIA 4O0UA 3V51A 5FWKK 4MXAA 4RJ4A 3LM5A 1YQJA 3H4JA 3NX8A 3MH1A 2WQNA 3P23A 4OTRA 5D7VA 3RCJA 1VYWA 4UV0A 3EWHA 4NSTA 5AP0A 4H39A 3DPKA 2GNHA 3Q32A 4O2ZA 4C35A 5M4IA 4KB8A 4TWOA 2YCRA 2FVDA 5D9HA 4DFYA 2HCKA 3BHHA 3ELJA 3QTXA 4FSNA 1PMEA 1PY5A 2A4LA 3KXZA 5EKOA 2XH5A 3O23A 4WT6A 4IEBA 2F7EE 2X9EA 3FZTA 3PXRA 4P4CA 5EW8A 5F94A 3VWAA 5IDNA 3SW7A 2BFXA 4U79A 1REKA 1WBTA 5AM7A 5HX8A 2XIZA 5HTCA 4EC8A 4FV6A 2QO2A 3CBLA 5AUVA 3TEIA 4FA2A 3TKIA 4XRJA 3HL7A 4TWNA 5CTPA 4OUCA 3KGAA 3KXMA 4I1ZA 4ERWA 5LWMA 4EYMA 3QRTA 2O8YA 2PMLX 3FPMA 3LKMA 5HVYA 2C68A 3MWUA 5HI2A 2IPXA 2Z7SA 3CR0A 4XNEA 4K33A 4AZEA 3MFTA 4NEUA 3RKBA 1OPLA 4FTIA 4EK6A 4BL1A 3UZRA 2CKQA 3DJ6A 3NNVA 4S34A 4EORA 4L01A 4XV9A 4YTCA 2YACA 3ET7A 2YDJA 4FUYA 4GK3A 3G33A 4JDJA 5EM7A 4BGQA 4C4GA 1SM2A 2WKMA 4II5A 4W4WA 5FEDA 4ZEGA 3WIGA 4X2GA 3BEAA 2CCIA 5T3QA 3F3TA 3GOKA 2PMNX 1CTPE 3P7CA 4FL2A 3ZFYA 4DEBA 4QOXA 4CV8A 5IPJA 3TDVA 3VQUA 4QPAA 2OBJA 4BIDA 2W06A 3CS9A 5HBHA 3G9NA 1Q24A 4DEGA 1V0OA 4F1MA 5IA5A 2C6IA 3NIEA 1T45A 3LZBA 2OJ9A 2VTHA 3PRFA 4TRLA 1R1WA 1PXMA 4XCUA 5GJFA 1ZZ2A 4YU2A 4E6CA 4G5JA 2A19B 4EOPA 4UMPA 3MVJA 1NW1A 4AN3A 4RGJA 2B9IA 4WIHA 3OBJA 3C4ZA 3ZHPC 4YUQA 5J7HA 5A54A 1GOLA 4ASEA 4D5KA 4MYGA 5IQAA 4YJVA 1WBSA 4BGGA 3L9LA 5ANIA 2BFYA 2J90A 3G51A 1H1SA 4R7BA 3HAVA 3G5DA 3P08A 3HV6A 1H28A 2C1BA 5IA2A 3ZBFA 3MN3A 3A7HA 3QC4A 2G1TA 3Q4TA 4ANSA 1OBGA 3DGKA 2FSLX 4RIYA 4RJ7A 4O1PA 4BCFA 3SDJA 4AOTA 4AT3A 5KMLA 2QR7A 3OUKA 3Q2MA 5FQDC 3FYJX 3I6WA 3UVQA 3VRZA 5KCVA 4E1ZA 2XEYA 3CPBA 1SNUA 2VWWA 4YURA 2CLXA 3KA0A 3GCPA 2VX0A 3F5UA 3SG9A 4KIKA 3RJCA 2WU6A 4DT9A 4W4YA 3SV0A 4WD5A 4I41A 3VS7A 4YJSA 1ZYDA 3R7YA 2QNJA 3OZ6A 4HYUA 4P5ZA 4PTGA 1YHSA 2F49A 3TNHA 5CYIA 3Q3BA 5IQDA 5ANEA 5CT0A 1R0PA 1KOAA 4GT5A 4JXFA 2ITOA 5IQBA 2CJMA 2ZMCA 3AD5A 4FIEA 3C51A 4F0FA 5KO1A 2JD5A 3DZOA 2RG5A 2A1AB 5ICPA 4FV4A 4CRSA 2GNFA 2QHMA 1V0PA 4I23A 3PE1A 2WQMA 4I5CA 1W82A 2WMVA 3QZIA 4G3DA 4ACCA 4BI0A 3DXPA 1ZOEA 5CSWA 2PK9A 5AUXA 3NR9A 5JGAA 3R7EA 1B6CB 2DQ7X 2WTJA 2QOFA 3DJ5A 3HA6A 4H3BA 1WCCA 4AN2A 5I5ZA 2C3KA 1AQ1A 2BILB 5JH6A 5KBRA 1PRYA 4YJTA 4L00A 2C4GA 3PXQA 3ALNA 3HDNA 3LMGA 2CCHA 5JFSA 2VNYA 2XYNA 3NVMB 1TKIA 3QTQA 3DK7A 4HGTA 5DLSA 3W2OA 4H36A 4NCTA 4O7LA 2QG5A 3PYYA 3IS5A 2EXCX 3KEXA 2Q83A 2UVYA 2ETKA 5BVEA 3UTOA 4X6QC 4AFEA 2C1AA 4DG2E 5CU4A 3OCBA 2J0JA 4D1SA 1URWA 2PVHA 3WIKA 4FICA 5J95A 1OB3A 2RL5A 3QCYA 4FV5A 4M97A 5K3YA 3ZMMA 3NW7A 4LG4A 3O8UA 5DA3A 2C5VA 3D0EA 3LQ8A 4C34A 4U44A 5ACBC 4J8NA 3DAJA 3ATSA 4MBJA 4RVKA 3A61A 1OL2A 3R7UA 5E4HA 4DCEA 2W96B 5L2TA 3C5IA 4C58A 4YZCA 2Z60A 4I20A 5DEWA 3COKA 4CEGA 2W1CA 4P7EA 4FT7A 3OVVA 3UG1A 5CEIA 4A06A 3KRJA 2V5QA 3FV8A 5D7AA 4OGRA 3I6UA 3QGYA 2WTKB 3HLLA 3VS0A 5M51A 3BX5A 3G6HA 3HP2A 2C30A 1UVRA 4AE9A 4IVAA 2HIWA 3ZSHA 4HOKA 2YA9A 4PPAA 2C69A 3AOXA 2IN6A 4IJPA 5HE1A 1WAKA 4FT3A 3IPHA 2XIXA 2YIWA 5A6OA 2VTTA 4YJOA 2B55A 4FZ6A 5BVKA 2PMOX 4IAZA 4JQ7A 5I9UA 3VO3A 3BU3A 2I6LA 3UJGA 1XJDA 5AX9A 2XKFA 5HLWA 2BUJA 2VTQA 2C3JA 3E8EA 2JFLA 3GP0A 2JEDA 2ZB0A 4EK5A 1Y91A 3T8OA 4XH6A 4H1MA 2VWIA 5J5TA 4O7ZA 3DKCA 3R9OA 5IQHA 3HGKA 3FJQE 4PNIA 3ZO3A 4ZSLA 4A4OA 2OJFE 2QR8A 3CQWA 3K5UA 3QCQA 3T9TA 5FDPA 2B54A 4L9IA 5DE2A 3RK7A 4FE2A 2JBPA 3KQ7A 2YITA 4BC6A 1FGKA 3JY9A 2W1GA 3FHRA 3COHA 4TW9A 4CTBA 4ZLYA 4OBOA 4QTBA 5J87A 4EBVA 4EZ5A 2WTDA 4GFMA 3QZHA 2OGVA 4IJ9A 4ZZOA 4FSQA 4GUBA 2WMXA 3WF6A 5ANOA 3N4UA 1GAGA 2JKOA 3FKNA 4BCNA 3CXWA 5E92A 3AT2A 2PY3A 1YW2A 4LRMA 4D4RA 1FQ1B 3I79A 3ZXTA 4E73A 1V1KA 2IVVA 2GQSA 2W1DA 2XRWA 1BI8A 4R3PA 3NCZA 4WRGA 5HNIX 5I9ZA 4J52A 5BPYA 4A9SA 3GGFA 5KHXA 4YZBA 3PSDA 2QU6A 1QL6A 2XUUA 3UP2A 4GKIA 2YIYA 4KBKA 4OW8A 4F09A 2OXXA 2WMRA 3ACJA 4V0GB 3EQHA 3IQ7A 1PXJA 4R7HA 4QMWA 3LCOA 3PLSA 4M13A 3SX9A 5TT7A 2WMAA 3P9JA 4ONAA 5TR6A 4BCPA 5IEYA 1M14A 5LJJA 4BDAA 2BALA 3R7GA 2VWXA 3NMUF 3LCSA 2IZTA 1MRYA 3UVPA 4QQTA 3HV5A 3MSSA 5M4FA 5IUIA 4XG7A 3ZUTA 5J9LA 4PL4A 4F99A 4DH1A 5AFVA 1PMUA 2YISA 3NW5A 3MJ1A 1XKKA 1B38A 4L43A 4QP6A 4ZSGA 2BZIB 2W5AA 5AR2A 3OXIA 4F9WA 1G3NA 1XH4A 2J6MA 3L8SA 5BVDA 2PZIA 2REIA 3KXNA 2GFCA 3BYUA 4Y5HA 5DT3A 3ORNA 1Z5MA 5AP3A 2J0KA 4FEVA 4XS2A 3SRVA 4U45A 3UNJA 1E9HA 5AAEA 5LVMA 1XR1A 4ASXA 4RVTA 4DH8A 3EN7A 4TYEA 2GHGA 1WBNA 1FBNA 2QU5A 3GU6A 3W16A 2ZV9A 3D7ZA 5C26A 3MPTA 4XP3A 5I3RA 4L45A 2X2LA 2XNMA 2XK4A 4Y83A 5FM2A 3PJ1A 2R0UA 4F6SA 4ZMFA 2Z7QA 4Y95A 5E8WA 2JLDA 3CLYA 3FMNA 1TQPA 2RFDA 3GFEA 2VTOA 4IM3A 3TI1A 3GEQA 4ITIA 3BPRA 4J95A 3ODYX 4FT5A 1NA7A 4AACA 3UO5A 3TIYA 5HCYA 2R7IA 3E92A 4FKGA 4R1YA 3VVHA 3V6SA 5CEPA 2UVZA 4F6UA 4EOMA 3HUBA 2CSNA 4K6ZA 4KWPA 2X1NA 3T3VA 4EH3A 2BPMA 3MDYA 3IW8A 4QTAA 3KU2A 1JKLA 3BHYA 5ANJA 3EQCA 2W1FA 4A9UA 4BTMA 4XJ0A 5GHVA 4UEUA 1ZZLA 1LPUA 5TO8A 2IW9A 3DKGA 3FLWA 3RPRA 4C36A 4ZJVA 1WBWA 5JQ5A 3K3IA 4ZP5A 4IX6A 4V01A 3DZQA 4BCQA 3QA8A 4FKTA 4FKQA 3CIKA 3T9IA 3F61A 4CVAA 3HRFA 2BHHA 4NIFA 3K5VA 2O5KA 2C47A 3PDTA 4DCAA 2ERKA 1OL1A 3GNIB 3ZM9A 1ZYCA 4FG9A 3SXRA 2Y0AA 4UMRA 3DQWA 4YPDA 3VHKA 3IDCA 4JDHA 2WTKC 3EMGA 2R3FA 1BMKA 3TZ9A 1S9IA 4FUXA 5HO8A 4TL0A 3FLZA 3Q5IA 4K8AA 3ZRLA 4M68A 2WU7A 3S1HA 3FLQA 4O7NA 5DRDA 2G15A 3PP0A 1H1PA 3DNEA 2WPAA 4C3PA 5CSVA 2V7AA 3DKOA 4DAWA 3MIAA 4M15A 3HRCA 4W8DA 3LIJA 5EW9A 5IA1A 4C3RA 2QCSA 4K18A 3AMBA 4GU6A 2XNNA 4W4XA 4A9RA 5HIDA 3U9CA 3WF8A 2QO9A 3F88A 2C3IB 3FC2A 3NEWA 3NUUA 4PRJA 2F7XE 2BKZA 4UYAA 4F70A 3ORLA 1DI8A 3FKOA 3CQEA 4JBQA 4R5SA 3SVVA 2X7FA 3PY0A 3SG8A 4FZ7A 2GNIA 1T46A 2VWZA 2XNOA 3MS9A 4WNMA 4M69A 2F2CB 5BMSA 5L6PA 5E8YA 5K0KA 2OO8X 4UWYA 3UC4A 4C33A 1GIIA 2JC6A 4GMYA 3G90X 3VF9A 1OIUA 2WTCA 2C6OA 2ZDTA 4PV0A 3W55A 4FTAA 3HKOA 4PMMA 3BYOA 3QC9A 2BRBA 5TF9A 4F08A 4EOLA 3C0HA 3IOKA 4GH2A 2ZV2A 4RX7A 1YDTE 3H9OA 3RI1A 4MBIA 4FKUA 3O17A 3GU7A 1P4FA 1WVXA 3DQXA 4FYOA 4MD7E 4C3FA 2GNLA 4MEDA 2VWYA 2PHKA 4AWIA 3I81A 5CNOA 3AMAA 1KE8A 4YJPA 5LOHA 2PL0A 4YJQA 2FSTX 4CCUA 4QT1A 4F9BA 3OY1A 3LFAA 3EKNA 5L2IA 4FSMA 4XOYA 4GT4A 3BIZA 1L3RE 4PDOA 4KSQA 4U3ZA 2CLQA 2R3HA 5T6KA 1G8SA 1QCFA 4HVHA 5HKMA 5HO7A 3C4CA 2J0LA 1TQIA 4Y72A 4RFZA 3AT3A 4FOBA 4WNOA 3A62A 3LPBA 4RVLA 4QP3A 3NUAA 2B53A 3Q9YA 4YR8A 5CEOA 5LVPA 3ZRMA 2OJJA 3UYTA 5AWMA
chains in the Genus database with same CATH superfamily
3W33A 4IAFA 2VV9A 4PWNA 1O6KA 3FMLA 2GFSA 3O50A 4FTLA 3UDBA 4A9TA 2WXVA 1ZLTA 2C6EA 4JL9A 2IZRA 4BDCA 2JAVA 3FBVA 4IWDA 5EHLA 3NYNA 3L1SA 3FXWA 4IZYA 1R3CA 3OMVA 3RAKA 1M17A 4C4EA 3EN9A 2QOIA 3DU8A 1XH5A 4OLIA 5E7RA 5FBOA 4G6OA 3NUPA 4EQUA 3H0YA 3KXHA 3UZPA 4JX3A 2XAMA 5HU3A 1JOWB 3UQGA 3QL8A 4OTDA 2VO3A 4BDEA 3EQRA 4GG7A 4BCKA 2OK1A 4X0MA 4JRVA 4MF0A 3U4WA 5ETCA 4WSQA 4ZTSA 5HIEA 3OWLA 5KE0A 3ZSIA 2BIYA 2QQ7A 5JSMA 2OW3A 3Q9XA 5L2WA 2OZAB 3H9RA 1Y8YA 3JR1A 4DITA 5EHOA 4FC0A 4GS6A 3TL8A 4XV2A 3UOHA 3ZLSA 4BY9E 4N70A 2OFUA 3BRBA 4FSRA 1FINA 5DR9A 3EIDA 4QTCA 4FIFA 4DEIA 5HOAA 4YHJA 3QYZA 4GFGA 3KVXA 3PZHA 1WBPA 3IKAA 2X4FA 3BWFA 5M44A 4USDA 2Y9QA 4TYHB 3MFUA 5GJDA 4YC6A 2BCJA 4GU9A 5E8UA 3SA0A 4ZS4A 2WGJA 4S2ZA 3D94A 4JG7A 2OF4A 4FTJA 4HVDA 3VUKA 4IM0A 4NL0A 3A4PA 2R7BA 2WMQA 3BGPA 5DEYA 4HNFA 2H6DA 5KZ0A 2P55A 3EQBA 1K2PA 4FGRA 5EYMA 4UN0C 4NYEA 3BLRA 3EFJA 3U55A 2PE1A 1FOTA 2I40A 4QMZA 3BHVA 3DCVA 5C9CA 2IZSA 5JQ8A 1PKGA 2QG7A 4QO9A 4CG8A 4IX5A 1Q5KA 4HNIA 5AP4A 3EFLA 4C38A 4DGLC 4FBXA 3TCPA 3V8WA 2QKRA 3L9NA 3OW3A 1W2CA 4Y8DA 3IGOA 3QZGA 3ZLYA 4A4XA 4I0TA 5G1XA 5IMXA 4Z16A 3AC4A 2CGVA 4IAAA 2ZDUA 4PUZA 2JIIA 2XNGA 4WOVA 4AZWA 2XIKA 4YO4A 2P0CA 2B9JA 3NCGA 3QRUA 4IX4A 5IH5A 3H10A 4CKRA 2QD9A 3HA8A 4E8AA 3LCKA 4P90A 4FV0A 4F65A 5JFXA 3RNIA 5DG5A 4FV3A 5C01A 4RSSA 3BU6A 4ACGA 4CD0A 4I5HA 5TOZA 3W2SA 3KVWA 4BCGA 2B0QA 2WEVA 2OG8A 4Y46A 3EJ1A 3I4BA 5HE0A 2SRCA 4BDJA 3D7TB 1I44A 3E8DA 4FYNA 3FZ1A 4BHZA 4EH4A 4FTMA 3ODZX 3S4QA 3TZ7A 4D1XA 3EQFA 2R3MA 3I1AA 4L3PA 4XG8A 4USEA 4FZDB 2JFMA 4BB4A 3ZLXA 1HCKA 1PXPA 3BBTB 3DTWA 1JKKA 4FG7A 3TTIA 5IA3A 3W0RA 2F9GA 2VWUA 3QU0A 4GCJA 3TZMA 4CCBA 4FIJA 5IZFA 1YWNA 5HLPA 2PUIA 3RM7A 5AP1A 3NW6A 2CMWA 2F4JA 2VUWA 4I6QA 1QPCA 2ZV7A 2OJIA 4QPSA 1ZMUA 4UB7A 1SNXA 4UYNA 4E6DA 3TM0A 1JBPE 3RCDA 3R8UA 3R8LA 3GCVA 1OKZA 2ITZA 2VTJA 4PP7A 2BDWA 3QRKA 2IW8A 1TVOA 3DBEA 5FP6A 3TG1A 4YLKA 4GSBA 2X7GA 4A7CA 5JN2A 2HZIA 3S00A 4IZ5A 3UIBA 3CTJA 4WUAA 4I4EA 2R5TA 4O81A 5F9EA 4CQGA 5AEPA 4FSYA 3R1NA 4UMTA 2VTRA 2V22A 2WQBA 3LFEA 4O0YA 4D28A 3JYAA 2QLUA 5AP5A 5L2QA 3TACA 3LMHA 3R8PA 4V05A 4E93A 2IG7A 2ACXA 4QMMA 4RX8A 3GBZA 4CRLA 3NPCA 4AT4A 4TWPA 5JK3A 1W83A 4QDEA 4O27B 2XAOA 3W2CA 4CMOA 4A4LA 4FZFB 4G5PA 3FSKA 5DBXA 3VS3A 3BI6A 3IG7A 4L46A 5HIBA 3MTFA 2PE2A 5F1ZA 3V5LA 5EDQA 4FG8A 5CQUA 2VTAA 5AR7A 4RVMA 4WNKA 4EOQA 5LQFA 4DTKA 2X2MA 5CVGA 4AGUA 2F2UA 4YTFA 1Z57A 4RC4A 4F1OA 3HZTA 5CWZA 4RC2A 5GZAA 2XKDA 5FM3A 4BWKA 3RAHA 4Y5QA 4UWCA 3RM6A 4N57A 5CU2A 3FC1X 5CT7A 2XZSA 5LMKC 3GI3A 5FLFA 3NAYA 4BCMA 1PXIA 3QA0A 4JRNA 1OECA 4B8LA 5I9WA 3OW4A 4L7FA 3FLYA 3RVGA 3WYXA 4PP9A 2GS7A 4YLJA 3TNIA 4DGMA 5D41A 4G2FA 5AIKA 4KNBA 1Q62A 4FEQA 3HEGA 3PG1A 4B4LA 4ZZNA 2R3RA 5CLPA 3QLFA 5KMMA 5GIOE 5HBJA 4U6RA 4B9DA 2J2IB 2J4ZA 2WAJA 3OOMA 4D0WA 4BCHA 4D2VA 1VJYA 4LMNA 4X3FB 4ZLZA 3UMWA 4EH6A 4LMUA 2XIRA 3ZEWA 5B2KA 1J7LA 1YOMA 3D5XA 3CD3A 3O7LD 4EOIA 3EZRA 4L6QA 5I9YA 3OEFX 5C03A 3BQCA 3REPA 4I21A 4QYHA 3VAPA 4LL0A 3V5QA 1KE6A 2R3PA 3NS9A 4PL5A 4B6LA 2XP2A 4I6HA 4EJNA 4UZHA 5EFQA 2UZUE 2BRGA 2YDKA 2J0MB 4UALA 3CGFA 3R9NA 3ZXZA 3QTSA 4NFNA 5H2UA 5AAFA 3QQUA 3ORIA 3HDMA 1OKWA 3O7LB 4FL3A 4RIWA 3C4WA 4R5YA 4MKCA 4YSMA 4XG2A 5A4TA 5GIPE 4PTEA 4AZVA 2EB3A 5AUZA 1DI9A 3R2YA 5L6OA 5K5XA 4ANMA 4E5AX 2XIYA 4XEYA 4LOPA 4JDIA 4AF3A 4ZY6A 4UX9A 3VF8A 3WARA 1NVSA 4Z7GA 5I3OA 4BZOA 4FRFA 1WZYA 3Q04A 3TZ8A 4M66A 4EHGA 5JMSA 4KD1A 2VWVA 3F5XA 5EI8A 2A0CX 4RJ3A 3VS6A 2W0JA 3W8QA 3KRWA 4D1ZA 3GFWA 3V8TA 1WVWA 3UIXA 4D9UA 2DS1A 3EQIA 5KMIA 5HO6A 4IHPA 4FNXA 2VGOA 2PVFA 4BWXA 4RQKA 2WNTA 5AUYA 3EL8A 2XVDA 2VO6A 2XA4A 1YDSE 2QKWB 4IIRA 5AUWA 5FG8A 4YJRA 3OS3A 5IQEA 4L7SA 4Q9SA 4GJ2A 4C4IA 3THBA 2NP8A 3RWQA 3UZTA 2R0IA 4W8EA 3AC3A 3PIYA 3RAIA 3S95A 4RT7A 2GTMA 4C0TA 2CKEA 2H96A 4FKOA 2JDRA 3H0ZA 1REJA 3UVRA 1PMVA 5EM6A 4ZLOA 2PULA 2DWBA 4FEXA 4LRJA 3OD6X 2YIRA 3SGCA 3QQJA 2NO3A 4FI1A 3VW8A 5IU2A 2P4IA 3PUPA 4C2WA 2XK6A 3QF9A 5CF6A 4IFGA 2AC3A 2WO6A 4CMTA 5EH0A 4GKHA 3FYKX 4N4SA 2OXYA 3W18A 1H07A 1ZXEA 3GCUA 4DEHA 4MNEA 2G01A 2O64A 4IWQA 4U9AA 3ZDUA 1OIQA 4U5JA 3DLSA 4K1BA 5H8GA 4U80A 3GQLA 4L3JA 2PUNA 1LUFA 4ALUA 3E3BX 2BZJA 2WTWA 3DJ7A 4B0GA 5FEQA 3D5WA 4RBLA 4DGNA 3EYGA 4USFA 3LFFA 5CAVA 4ZIMA 4RWKA 4YBJA 4BYJA 4ENXA 5M08A 2J5FA 1P4OA 4KAOA 2ZB1A 3KULA 1JKTA 2QONA 2HZNA 1YVJA 4I94A 4J7BA 2JGZA 4R1VA 4CFFA 4G3CA 1XWSA 5IH6A 5G6VA 3KC3A 4CZYB 5HVKA 3KK9A 2OWBA 2VN9A 4XV1A 4RMZA 4DDGA 4CKIA 3CKWA 4DC2A 5A14A 5HTIA 4DE4A 4RIOA 3LFBA 4XUFA 1PHKA 4GVAA 3II5A 3LE6A 3GVUA 1K9AA 3NRMA 3PY3A 3MESA 3PA4A 1STCE 4O22A 4CFVA 4AA5A 5DH3A 4AXFA 2P2HA 1XH9A 5M4UA 2FO0A 2XNPA 2RIOA 4QYGA 4BBEA 3PPKA 3QRIA 3VUHA 5CF4A 4FVPA 4Z9LA 4EOJA 3EHAA 1M7NA 3TV7A 1LEZA 1A06A 3DK3A 3AT4A 4EH8A 5CASA 5C8NA 3HVCA 3AMYA 2OLCA 1MUOA 2E9NA 3ORXA 4MD9E 5ANKA 4FV1A 5AP7A 3C1XA 3B8RA 4D55A 2Y6OA 4HVIA 4CG9A 4G9CA 3RNYA 3RTPA 3BEGA 2W17A 1J7IA 2YLEA 3DOGA 4IZ7A 3LMIA 4ZTMA 3PIXA 3ZFXA 4M7IA 4CLIA 4PNKA 4KIOA 4K9YA 4BKYA 4BTFA 2C5XA 4KUJA 4HJOA 4LL5A 5CZHA 2X0QA 4JBOA 3QD0A 4FTRA 4L68A 4AW0A 1JQHA 3QD2B 5J9YA 4ZK5A 2BHEA 3HMMA 4BBFA 4EWHA 3DXQA 3PXZA 1QPJA 3KREA 4C02A 5HU9A 4F64A 4G6NA 3F6XA 4O83A 2C3LA 5E1EA 4F0GA 3OUNB 4YHTA 2F7ZE 2V62A 4X3FC 3DBCA 1GJOA 2GCDA 5E90A 5KMNA 1KWPA 4GT3A 3AD6A 4YTIA 1YOJA 4BHNA 4IAIA 3B2TA 3WZKA 1RW8A 2F57A 4OTGA 4U43A 3Q96A 5EK7A 5HORA 3LLAA 4AP7A 4G31A 3ZSGA 4MWIA 5JGDA 1JSVA 3SW4A 4YGAA 5M07A 5IEXA 4FSZA 2W05A 1XMMA 5K9IA 4LI5A 3BGQA 4J1RA 2YDIA 4RRVA 1Q41A 4NWMA 3FMDA 2HW7A 5K5NA 4FIGA 4O0XA 4XOZA 1ST4A 3EKKA 4PDYA 2WZJA 2ITQA 3LCTA 4CFWA 4O7TA 1H0VA 3OWPA 4JS8A 5A4EA 1CMKE 2B4SB 4JR7A 4GYGA 4RZWA 3NVKI 1NT2A 4UY9A 3OY3A 3CJFA 2ZM1A 4TTHB 2ITNA 3L8PA 4EC9A 3OCSA 2WTIA 3ULIA 4BZDA 4CQEA 4EH5A 2OU7A 3OBGA 5K4JA 1NVQA 4XRLA 4G6LA 5KHWA 3F2AA 3NIZA 4DHIB 5D1JA 3CTHA 4JX7A 4NM7A 4RIXB 3ORPA 4DGOA 4EZ7A 5M57A 4BFMA 2XMYA 2BAJA 2X6EA 4ARKA 2WOUA 4FV9A 4ENYA 4RIYB 3FPQA 3QGWA 3HV4A 2CN5A 4I3ZA 3MIYA 4QPMA 3VQHA 4AA0A 1G8JA 4O7RA 3AGMA 3ANRA 3ZH8A 4DA5A 2XK7A 1OL6A 4BIEA 3KB7A 3QD4A 5BVOA 3R22A 1UKIA 2C0OA 1U5RA 1G8KA 3ITZA 1ZRZA 2W1IA 2YM7A 4KA3A 2ZOQA 1W7HA 1Y57A 4Z55A 4LQMA 4JQEA 4UWBA 4CLJA 2B7AA 4DHZA 4G1WA 4CFXA 1DS5A 1Q3WA 2OJGA 4CYIA 2QOCA 3FMKA 1CDKA 3IW4A 3P79A 3PRIA 3NUSA 2XKCA 4MXYA 3VS5A 2EUFB 4ZMEA 2PUUA 2GS6A 4LGGA 3GC8A 2O65A 2CPKE 3OCTA 3NYVA 4KBAA 4O0TA 1OKVA 3FL5A 4QMLA 3JXWA 3HMNA 2OXDA 2DUVA 4BVUA 4DBNA 4QMOA 4RLLA 3N51A 4DT8A 2XF0A 4FT0A 5IH4A 2GQRA 1MP8A 1H00A 3O96A 3RAWA 1OITA 3AG9A 2I0VA 1V0BA 4WUNA 4C57A 2W1HA 3HUCA 5FXRA 5HD4A 3LFCA 5CNNA 5E1SA 4WA9A 3U51A 3U87A 1W8CA 4AU8A 5D10A 4TN6A 3OHTA 1UKHA 3VN9A 2OH4A 2OH0E 1KUTA 4ANLA 4YP8A 1H01A 3NZ0A 3FY2A 3MI9A 3TIZA 3R28A 4EBWA 3UQCA 4BDKA 3U4UA 3MY0A 1DAYA 3ZC6A 3HMPA 3EQDA 3L9PA 2V7OA 4KBCA 1WFCA 3IW6A 4E20A 3UQFA 1YI3A 2PZRA 1W84A 4O82A 4DH3A 2GNJA 3SD0A 4TXCA 4QMVA 3EFWA 1JAMA 5AADA 3HAMA 2JDTA 3DFCB 3FHIA 3PTGA 1A48A 2QODA 5HG7A 2GTNA 3KXXA 2WIHA 4K2RA 4QYYA 4FZAB 3ZUVA 1IAJA 4U42A 4E6AA 3HNGA 2BZKB 5FTOA 5GZ8A 5LMKA 2XK8A 4CFUA 3QBNA 2E9PA 4HVSA 2IWIA 2Y7JA 2HWOA 5AIRA 4APPA 1OBDA 1WBOA 1Y6BA 3F2RA 2OZAA 5AMNA 2YM4A 3M11A 5FXQA 3DY7A 3QFVA 4BBMA 3FE3A 3M42A 3QCSA 4G17A 3GXLA 4FKJA 3RWPA 2HXLA 2EU9A 3DDPA 2J50A 4FODA 4LRKA 4BWPA 2XK9A 1JSUA 2FA2A 3F66A 5KUPA 2GQGA 4HW7A 3OTUA 4M67A 3BBWA 5HZNA 4XYFA 5IEVA 2WELA 4FTTA 2QO7A 4YZNA 2QOQA 3A99A 4TYHA 3G15A 3D4QA 4EOSA 3F2NA 4FL1A 4IADA 4L52A 2CNUA 5ANGA 3ZOSA 5AV4A 3IECA 1YKRA 1E1XA 4KRDA 4OBPA 3FAAA 5GNKA 3BYMA 5LCKA 1JPAA 3OT8A 5JFWA 3R63A 1WBVA 3KN6A 4KS8A 1R0EA 3RINA 2JKQA 2X0OA 3QXOA 3CY3A 3HV7A 4X21A 2YIQA 1ZYLA 3PSBA 5FEEA 3VS4A 3TDWA 3VUDA 3DLZA 4JAJA 3FI2A 4QMYA 4ZAUA 3LLTA 3ZC5A 1GIHA 3R21A 4FGBA 3LFQA 2XALA 3T3UA 3EOCA 3O51A 3FXXA 4LGDA 3L8XA 4EUTA 3V5PA 1MQ4A 4IVCA 4AXAA 4E6QA 3FEGA 4JLCA 4QMXA 4PMTA 4PL3A 2J7TA 3AC8A 4KSPA 4TY1A 2BVAA 5CVFA 4FTKA 4YNEA 1RJBA 2X7OA 4MVFA 2HAKA 2B9FA 4D2WA 4MCVA 3FLNC 5J5SA 2VTMA 2OF2A 3ORZA 3R1QA 3RZFA 5C4KA 5BVWA 1YXSA 2BR1A 3RK9A 1NXKA 1BUHA 3GUBA 4RA4A 1IA8A 4CZTA 4BDBA 4BICA 5F20A 3OEZA 2VTPA 3KRRA 3Q60A 2A27A 3D7TA 3SLSA 4RG0A 3BGZA 4F1TA 3R8ZA 1PXNA 4LFIA 3MVMA 4D4YA 3N4TA 2HZ0A 3JVSA 2VWBA 1SMHA 4MHAA 5LVLA 3BYVA 5DR2A 4S30A 4FSWA 5AP2A 3VRYA 4WBOA 3E3PA 5J9ZA 3G6GA 4O38A 2VTLA 4IVBA 3JUHA 3GOPA 2EXMA 4JIKA 4O2PA 3N9XA 1ZMWA 2GSFA 3QX4A 4I0RA 4NM5A 3GENA 3R73A 3GC9A 3PJ3A 1ATPE 3PA5A 2VGPA 1FMKA 5DI1A 4U40A 4TKSA 1ZYSA 4ZXTA 1FVTA 5HG5A 4FV2A 4U41A 4IB5A 2UZBA 2ONLC 4R8QA 4HPTE 4Y85A 4LV5A 5EDRA 2BMCA 4BZNA 3BE2A 3D2KA 2XEZA 3KF4A 4BDGA 3R0TA 2FSMX 1H1RA 1Q61A 3EZVA 3QWKA 4HGEA 3SRVB 3ZFMA 3OTVA 4QYEA 2W99B 4X3JA 5AV2A 3UG2A 4H3QA 1IAHA 3H9FA 4P2KA 4HYHA 2W5BA 2PE0A 5FDXA 4EK4A 3FDNA 3LXKA 4L3LA 4DEEA 3JPVA 4MX9A 4CYJA 2WIPA 3ERKA 2C0IA 4EHVA 1VR2A 2W9FB 3P86A 1ZWSA 4G34A 4QP4A 3WZDA 4EONA 3LJ1A 3RHXA 2VTSA 2GPHA 4ZSEA 2PSQA 2OZOA 4XLIA 3UYSA 5J1VA 4RJ5A 4JOAA 2XBAA 3PJCA 5EW3A 3VS1A 2PYWA 4BJJB 5AR4A 1X8BA 3AC2A 4O7YA 5J8IA 1U54A 5AV0A 4YC3A 3TUCA 1XH7A 1K3AA 5CEQA 5CU0A 3MB7A 4YJNA 2ZVAA 3UC3A 4WRSA 5E8ZA 3UBDA 2E9OA 3FQSA 3A8WA 2CN8A 4IWPA 3E88A 4ZTNA 2AUHA 5CSHA 4NCTC 4U3YA 5I0BA 5JKGA 3MY1A 2RKUA 4OAVB 1GY3A 4HCVA 1IA9A 4BDHA 4I6BA 1P5EA 1SZMA 4JQ8A 3D15A 5EYCA 3OROA 3K54A 4GIHA 5I9VA 3P1AA 5HX6A 5HEZA 2RG6A 4NZWB 2IO6A 4U7ZA 3NWWA 3WOWA 3IW5A 3KL8A 1OL5A 1ZOHA 5KZIA 2EB2A 4KIQA 4N6ZA 4TZRA 4AUAA 2OICA 3R7OA 5BYLA 4A9YA 4F9CA 4JNWA 5HNGA 3NAXA 4QQJA 3A2CA 3UODA 1QMZA 2O2UA 2EXEA 5CF8A 5KKRB 2UW3A 1BKXA 5BVNA 1ND4A 5EI6A 4BRXA 3Q6UA 2PZPA 5M55A 5HHWA 3LFSA 1VEBA 2OKRA 2Q0BA 4UXLA 1L8TA 3P5JC 2GU8A 4QQ5A 3D9VA 4RJ8A 1AGWA 1GZNA 4B99A 2C6TA 3P7AA 3C4FA 4QP1A 5B0XA 5EYKA 2Y6MA 2R2PA 1F3MC 5A46A 2J51A 5B7VA 2B9HA 4DG3E 3VONA 3RALA 3A7GA 3ID6C 2QLQA 3GT8A 3IK3A 3HECA 4RFYA 4FJVA 1GNGA 3MV5A 3ROYA 3HMIA 4G16A 4DFBA 2YHVA 3KXGA 4C4JA 4OAUC 4AE6A 3D5VA 2CHLA 2UZVA 4C62A 2UW9A 4R3CA 1YDRE 2KTYA 3C0IA 3E5AA 3SKCA 4IDTA 4IANA 3R9RA 4DINA 4EL9A 2C6DA 3BZ3A 4M69B 3PVWA 3QKMA 2PU8A 1OM1A 3SOCA 4OTIA 3QWJA 3VULA 3MFRA 4ZTRA 4JG6A 2R4BA 4DBXA 4MH7A 5CX9A 3KF7A 3FI8A 4KABA 4RWJA 2WQEA 3TT0A 4WG5A 5CENA 4XP2A 3CKXA 1YI6A 2QOKA 3R1SA 2GS2A 4FKVA 3VJNA 4Q9ZA 4QTEA 2ZM4A 2WMWA 2FH9A 3BU5A 2JDSA 1OZ1A 3LXLA 3P5KA 3SQQA 2UZNA 2PVKA 4QQCA 4AAYA 1SVHA 3A7IA 3P78A 1JNKA 3FMEA 4GJ3A 5IQIA 3ZCLA 3AC1A 1HOWA 2BAQA 4PPCA 3GC7A 5TKDA 4AFJA 4I24A 5CI6A 4D0XA 4D4SA 3UGCA 3ZM4A 3DS6A 3ZEPA 4I5MA 4UMQA 3DKFA 1H1QA 2Q0NA 3F5GA 2OFVA 3FZSA 2YM3A 4DLIA 2XARA 4C2VA 4ITJA 4R78A 4OTHA 1XHAA 4CXAA 4ZY5A 3VBQA 3AKKA 2Y8OA 3BWJA 2XBJA 3UE4A 5GINE 4RFMA 4EQCA 3N4VA 3RP9A 3FMMA 2W4OA 2UZEA 4JI9A 1DM2A 2X9FA 2XJ1A 4QP7A 3TUBA 2RFSA 3V04A 4O86A 1PF8A 4ACDA 4E5BA 2XJ2A 4HGLA 3PSCA 2UV2A 2NRUA 3PP1A 3G9LX 2PZYA 1OI9A 2YLFA 3MVLA 4DN5A 1U59A 2FYSA 4EJ7A 5TE0A 3GQIA 1ZOGA 2XYUA 2BDJA 3LW0A 3O2MA 1YXTA 4AXCA 3ALOA 5LMAA 4C8BA 2YWVA 5LARA 3FQHA 4NUSA 5E8XA 5HNBA 3DBQA 4FSTA 5BVFA 2WFYA 1JSTA 1XQZA 2PVLA 4BF2A 5ITAA 4M12A 3IO7A 5BUEA 3PJ2A 4DHJA 5EQEA 3ZO1A 5CAQA 3B2WA 3LOKA 3HV3A 3ZONA 3O8TA 5LMBA 2YJRA 2R3IA 3HP5A 2XCHA 4IFCA 4EZ3A 3ORTA 4O0RA 2W9ZB 5L8LA 3K3JA 4JR3A 2ZV8A 1OVEA 4RA5A 4YSJA 1AD5A 1Q8UA 2R3NA 5JFVA 4JT3A 2QOHA 1UNHA 2YZAA 3UP7A 3F3UA 1MRVA 3QAME 3QHWA 4F6WA 2ETMA 3PJ8A 5EKNA 4RX9A 3CQUA 2QOOA 3V01A 5HCZA 4H05A 4WKQA 3BQRA 4ZOGA 3PLAE 2WHBA 1OGUA 3F9NA 3M2WA 4FMQA 3FI3A 5H8BA 3PXKA 4EKLA 4AGCA 5DVRA 1YXVA 5HBEA 3AKJA 3DT1A 3QXPA 3PXYA 4I6FA 4QMNA 1KE5A 1E1VA 2ITYA 4V04A 2I1MA 3LQ3A 3LXPA 2CGXA 3OXZA 3VJOA 3BV3A 3U8WA 2R3LA 3MA6A 4FK6A 1YXXA 3FLSA 4U8ZA 5JT2A 3BL9A 3WI6A 3C4XA 3OWJA 3AQVA 4H3PA 4TT7A 3UNZA 4F63A 4MXZA 4F7NA 4MAOA 3S3IA 1UWHA 4CFMA 5EQYA 3U6HA 1P14A 4LGHA 1DAWA 2GHMA 3MB6A 3NNXA 3RPVA 3ZO4A 2B52A 4Q2AA 5HE3A 3WBLA 2J0IA 5M53A 3TMOA 4IDVA 5FXSA 4IC8A 3RK5A 3E63A 2KULA 3F3ZA 4KRCA 5BNJA 5IUHA 4ACMA 2R3GA 4DFUA 1CKIA 1IRKA 1PMNA 3R04A 4HCUA 5ANDA 5L6WL 3VW6A 1VZOA 2Z2WA 2Z8CA 4F7SA 4MD8E 1SVEA 4YLLA 1H24A 2R3QA 1ERKA 2Y4IC 4PMSA 4DFNA 5KKRC 1UNLA 2IJMA 3E8CA 4FK3A 3MPMA 5FBNC 2UVXA 2GDOA 3MY5A 3A7FA 2NYAA 4EI4A 4L42A 4D2TA 4ERKA 3CGOA 5IQCA 1B39A 2UZLA 3GU8A 1LEWA 2UW8A 4GL9A 3G0EA 3MFSA 5D12A 2WMBA 4BDDA 1R39A 2IVTA 4IXPA 4NT4A 3ZO2A 4AXDA 5AP6A 5M56A 1YHWA 5IDPA 2GNGA 3OP5A 1YWRA 2JBOA 2PWLA 5C8MA 4FKRA 3W0OA 2YCFA 4NTSA 4L53A 4EHZA 2RSVA 5L3AA 3CC6A 2YABA 5L4QA 1Q8TA 1PYEA 2HY81 4BCOA 3KRXA 3PE2A 4UMUA 4L44A 5JRSA 4NJDA 1M2RA 4X2KA 4KKHA 3EN4A 4YZ9A 5CALA 3QD3A 2OIBA 1J7UA 1R78A 4XBRA 3TKHA 2C5YA 4QMSA 3ANQA 1S9JA 1YOLA 3KMUA 1KE7A 5ETFA 4BTKA 3Q2JA 4IWOA 3SOAA 2CNQA 2EWAA 1FVVA 3PY1A 3R6XA 4KIPA 4BR3A 4YHFA 3QALE 4IH8A 2WEIA 3RZBA 3F69A 5AX3A 2JDVA 4O21A 4O4EA 4B8MA 3QZFA 1H4LA 3IW7A 4GRBA 4J96A 2O3PA 3NGAA 3ATTA 1XBBA 2E9VA 4R77A 4AGDA 3TN8A 4W9WA 4HYIA 3VBXA 4DF3A 5DRBA 4AT5A 4M84A 4EK8A 4C61A 3UPXA 2YZLA 3UOJA 4RIXA 3BLHA 4TYGA 2QOBA 1PXLA 3QUDA 3UIMA 1IR3A 2LGCA 5HTBA 2AC5A 4NW5A 4BGHA 4FTCA 4HZSA 5EYDA 4EOKA 1I09A 3NDMA 1U46A 3ZZEA 4JBVA 3UNKA 2HENA 2QHNA 3QHRA 3OXTA 4V0GA 3RPYA 4RWLA 3F82A 3EFKA 4AS0A 2QVSE 2I0EA 2UW6A 3DBFA 3TV6A 2W4JA 4O4BB 3IONA 3PFYA 2IW6A 1APME 4XMOA 3WF7A 3POZA 4LOQA 1BL6A 5CI7A 3FKLA 4FKPA 2Z02A 3NUXA 1YXUA 3AC5A 4NKAA 4XV3A 4KS7A 3UO6A 1JKSA 4HGSA 2IEWA 3QQKA 4NKSA 4WG4A 2ONLA 5LCJA 3I7CA 2ESMA 4TNBA 3P0MA 5GZ9A 3KK8A 5M06A 4EHEA 4EQMA 2VX1A 2HWPA 2IVUA 4GYIA 2VU3A 2R3OA 4TYJA 4TNDA 2UZDA 2HXQA 2G9XA 4NU1A 2PVYA 4DFLA 4JJRA 2YJSA 4IM2A 3NYXA 4BI2A 4O7VA 5EOLA 1PYXA 4IB0A 2NPQA 4XLVA 3V6RA 1FVRA 3DTCA 3A8XA 4LUDA 4XX9A 4C4HA 4MUQA 4QP9A 3PPZA 3TKUA 3MW1A 4XHKB 3VBTA 4AOJA 4UXQA 4N6YA 4EH2A 4DH7A 4QYFA 3CD8A 3RBWA 4D5HA 4DHFA 4G3GA 1ZYJA 3MTLA 3BV2A 4PY1A 4GVJA 1GZ8A 2C0TA 2ZAZA 3Q4UA 4GFOA 4HYSA 4NM0A 4QNYA 5BX0A 5K0XA 2VX3A 1H26A