2VWXA

Ephb4 kinase domain inhibitor complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
281
structure length
274
Chain Sequence
KEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Inhibitors of the Tyrosine Kinase Ephb4. Part 2: Structure-Based Discovery and Optimisation of 3,5-Bis Substituted Anilinopyrimidines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 274
sequence length 281
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vwxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vwxA01
2OW3A 4YBJA 3NAXA 4AW2A 3HUBA 2J7TA 3ZFYA 3REPA 4AGCA 4YUQA 4RJ8A 2X7GA 1M2RA 2VNWA 3E88A 3KKVA 4IM0A 2NPQA 3RWPA 2Q83A 4PUZA 3AC8A 4FTCA 3F2NA 3WE4A 4PPCA 3UP7A 2XIXA 4QMZA 4Q9ZA 5C27A 1TKIA 4XX9A 4LV8A 2ZOQA 3RPVA 4GJ3A 4AA5A 3EZVA 3QA0A 4FV0A 5FM3A 2VWYA 4TWPA 1LP4A 2PVHA 3QX2A 4X2NA 5AA8A 1KE6A 4TRLA 3F3ZA 4CFFA 3RPOA 2WTIA 5E8ZA 4GKHA 4ALVA 3VO3A 4BICA 2OGVA 4USFA 4F0FA 3D4QA 2E9UA 2R3KA 5IA4A 3ATSA 5K4JA 2X4ZA 5M06A 5DI1A 2R0UA 3NAYA 4WA9A 5HBJA 4LUDA 4II5A 2X8IA 1Q62A 3R73A 4NCTA 3ZLYA 5M4IA 3MPTA 3PRIA 4F0IA 3RP9A 4D2TA 3OC1A 2CMWA 2VWZA 4YHFA 3BGZA 5KHXA 1KV1A 2R64A 2YDKA 5I9WA 3HKOA 3L9LA 1JQHA 2WMWA 2GNGA 4FSQA 4O2ZA 1NVQA 4RA5A 4U3YA 4LOPA 3WZEA 2YAKA 3DT1A 5DA3A 3IKAA 3NDMA 1OL6A 4YPSA 3OXTA 4M7IA 1CKJA 2FSOX 2X6DA 4MCVA 1ATPE 5IDNA 4FICA 3BWJA 1SNXA 1ZLTA 5DN3A 4WD5A 4UN0C 4O81A 2QOKA 2BFXA 2VWUA 5HO8A 1ZOHA 3H0YA 4DH1A 3I1AA 1ZYJA 4GFGA 2BCJA 1OBGA 5EKOA 4MXZA 5A9UA 4EUTA 5B2KA 2HOGA 4CMTA 2VTJA 4QT1A 4YO4A 3PIYA 3W2SA 1BL7A 2XNEA 5CU3A 4DYMA 3QRIA 4IFGA 4NJDA 4YJQA 3V8TA 1M7QA 4FZDB 4W4YA 4AUAA 3E8NA 1VYWA 3Q9XA 4HYIA 2BZHB 5AIKA 3ZUUA 3MA3A 4FTMA 3VS1A 4RZVA 4O0VA 4WIHA 3NMUF 2VD5A 3SD0A 2OJFE 3BLRA 4M67A 3VRYA 2DWBA 1YHWA 1B38A 4RPVA 3GCVA 2H6DA 4PL4A 2UW8A 2XB7A 4O7SA 3OP5A 3QQJA 4PY1A 4OTFA 5J7BA 1Q99A 1ZYDA 2X8DA 4NK9A 1CMKE 1PHKA 4FSUA 3TUDA 2CNUA 4PPAA 5HLNA 3TNQB 4ANSA 5A54A 1O9UA 4BCOA 5KMNA 4YJVA 3C13A 4RJ6A 4J52A 4AW5A 2GDOA 2OH4A 3DK7A 4CCBA 3A7JA 4XG7A 3TIZA 4Q9SA 2OZOA 2RFEA 4XRJA 2YJRA 2I40A 5BVWA 2PZ5A 4EOLA 2XNMA 3AC2A 3FC2A 4S2ZA 2KTYA 4ZLOA 4BCJA 3ZU7A 3A7GA 4U3ZA 4E6AA 4B8MA 4M84A 3F5PA 3ZDIA 5HTBA 4QMUA 5AUXA 2GTMA 3LXNA 2JAVA 3QCSA 4DFUA 4JXFA 1S9IA 3QQUA 4DHFA 2B4SB 1NVSA 2VU3A 3NYNA 4G6OA 4TNBA 4TNDA 3DXNA 3KC3A 4CFUA 2PVLA 5EOLA 4D4SA 4H3PA 4RRVA 4FG8A 3AD4A 4OW8A 4QMWA 4XMOA 4G3GA 3HEGA 3KVWA 4K9YA 4NH1A 4WNKA 5E9EA 1XHAA 3IW6A 2OWBA 3QU0A 5J79A 1PKDA 2RSVA 3KN6A 3AT3A 1XO2B 4C33A 3NUNA 3CKXA 3RKBA 2A27A 3ODZX 3SOCA 4HGEA 4CTCA 4DTBA 3TTIA 2J0JA 3BEAA 4CFVA 4D0WA 4KABA 2QOBA 3IOKA 4FSNA 1J1BA 5DNRA 5BUIA 2H34A 1G5SA 2OXXA 3Q6WA 3QUPA 5D12A 4FSWA 4ERKA 5L2WA 3V01A 3EFWA 3QXPA 3UGCA 4O0TA 4O38A 4G9CA 4O7YA 4FK6A 2AUHA 1GOLA 3AD6A 1UU3A 2PZIA 3R1NA 1V1KA 1PW2A 5HG7A 3EMGA 3B2WA 2BILB 2QVSE 2XJ2A 3R7VA 3UP2A 5E8VA 5F1ZA 3OCSA 2C5YA 2QC6A 4UWYA 3CGOA 3GU5A 4JIAA 4RIWB 2W9FB 3OEZA 5E1EA 3DNDA 3GCSA 5T3QA 4O7RA 5KBRA 3L9MA 1FVRA 1RDQE 4ITIA 4JG8A 4L46A 4AW1A 4C4GA 5M57A 5EQYA 3NUAA 2W5HA 2WQNA 1SVGA 2BAQA 3KMWA 2RFSA 4IZ5A 2QG7A 2ZB0A 3EQBA 2PK9A 4J7BA 5AV4A 4UX9A 4XCUA 1BI8A 4QMQA 5BVDA 3KA0A 4AZVA 1Q8YA 1FVVA 1YI4A 2GS7A 3MSSA 3FKNA 5LQFA 4BTJA 3EN6A 4S31A 3F3WA 3CBLA 3L9PA 2CSNA 4JNWA 3EQFA 2YCFA 4CQEA 3RTPA 4K8AA 4PMMA 3ORTA 3N4VA 2PY3A 3ZRMA 3FLSA 2FSTX 4FEQA 3PJ2A 4ASDA 1H24A 4KBKA 3S4QA 5LCKA 5CENA 2BRGA 4C7TA 3TT0A 3OWKA 4YR8A 4FSYA 3HP2A 4FVPA 3G90X 3LFFA 4MBIA 2Z7SA 3IO7A 1KE9A 4MF0A 1CSNA 3S1HA 2B9JA 3IW8A 2J5FA 3QRTA 5AR7A 3OBJA 3U4UA 2G15A 3C50A 3P79A 3B8RA 4PTCA 5D7AA 2KULA 4GK2A 5DFPA 3RM6A 5CAQA 4D9UA 3DJ5A 4R3PA 3BYUA 3R8VA 3CPBA 4EBWA 4G5JA 4FIEA 4FV8A 3F7ZA 4A4OA 4NU1A 4J98A 4BKYA 3MBLA 1ERKA 3AGMA 4KIKB 1WVXA 3C4XA 4FTJA 3IOPA 4G5PA 3DAJA 3NYOA 3R63A 4DFNA 3Q52A 2WMXA 4DH3A 4EQMA 5FTGA 5M09A 1UNGA 3QBNA 3QHRA 4MF1A 3R9DA 3EKKA 1OI9A 4Y72A 3UOJA 1YWVA 2OO8X 2WELA 4MVFA 3VUIA 1Y8YA 3JY9A 4EOQA 5HBHA 3QRKA 4P90A 5HNGA 4GT4A 1GZOA 3N4TA 4X3FB 3MPMA 3NYXA 2QR8A 3R9OA 3P7AA 4HCVA 5JFXA 2YM7A 2JKOA 2A19B 2UZEA 2UW3A 2ETKA 4BDFA 3PJ1A 3P1AA 2JDSA 3QC4A 4H05A 2CPKE 4FTAA 4BCFA 4M8TA 3KXZA 4K11A 4IIRA 3KK8A 3DGKA 5CSXA 5LVPA 2UW4A 2JBPA 3UIMA 5KZIA 1BUHA 3RM7A 3A99A 3BE9A 3VS2A 5BQ0A 2H8HA 3OMVA 4EHGA 3A8WA 5L8JA 1OB3A 4AX8A 1EH4A 3PJCA 5IUGA 5IZFA 2BROA 4ERWA 5ETAA 3QUDA 2W1FA 4DH7A 3C4EA 2IN6A 2QONA 4S34A 5IF1A 3OTVA 4IX6A 2B9FA 4F4PA 2FA2A 3NSZA 5EHYA 4MNFA 1YXVA 4BDJA 4AZTA 4X2FA 4C62A 3HA8A 2ITXA 5B0XA 3ZSGA 3CIKA 1L3RE 3GC0A 3G5DA 1SNUA 4M0YA 4NIFB 4QPSA 4JDIA 3TTJA 3FZTA 5L2TA 3TNWA 5FXQA 2C0TA 4L67A 5M53A 2G1TA 1B39A 5GZ9A 2Y9QA 5DRBA 4CG8A 5K0XA 4O6LA 3UBDA 3CS9A 5JFVA 4GJ2A 3UIXA 1URCA 2E9OA 2PMOX 4KWPA 2GQRA 3M11A 3R9HA 3R8MA 2BPMA 2E9PA 4EQCA 2RG5A 3UIBA 3GP0A 5A4EA 1XH5A 2YM5A 5EFQA 3AMBA 5HNBA 4CMUA 1ZOEA 2C68A 1O6YA 3DQXA 5IPJA 1AD5A 5EHLA 2QOFA 5AV0A 4AW0A 3IW4A 3RK5A 1V0PA 5FEDA 3RVGA 4YC8A 2ITOA 3S95A 4CT1A 2WQMA 3LFBA 3VNTA 1XH8A 3OW4A 4PDSA 4DFYA 3QKMA 3VUMA 2UZWE 3WF9A 4ZTSA 4ZZMA 1IRKA 2UVXA 4RC4A 3AGLA 1JKLA 3K3IA 2BRMA 1ZY5A 4RJ4A 2ZV2A 5HO6A 2J0LA 4ZLZA 5BYYA 2PZYA 5EYDA 4RJ3A 3TZ7A 4UMQA 3PE2A 1JPAA 2P33A 3R71A 1LPUA 2R3NA 4EL9A 2VO0A 2W5BA 3POZA 4OT6A 2JITA 4NSTA 2QODA 4GIIA 4EORA 3OOGA 2C30A 2R3QA 5EI2A 5AM6A 4BTMA 3LMGA 4DEHA 3KRRA 4KB8A 3LCKA 4NM3A 4UZDA 1QPDA 2WMAA 4LL5A 2ITTA 4QMLA 2PVFA 3KRJA 3BU5A 3A8XA 3CXWA 4UZHA 3MY5A 2V7OA 4YBKA 3QALE 4O1OA 3P0MA 1H1QA 3AC4A 4EK4A 1JWHA 4IBMA 3PWDA 1TQMA 5C1QB 2W1HA 5FLFA 5JRSA 4BVUA 5G6VA 3I6UA 3LFNA 4FVQA 4JS8A 4BCNA 4H36A 2YAAA 3RHXA 1YKRA 2CGWA 2BTRA 4R3CA 3LIJA 3LFQA 5TOZA 3ZYAA 4ZTRA 2W9ZB 3UO6A 4RWIA 5AX3A 2PSQA 3E7VA 3P4KA 4XLIA 4FTKA 3QTRA 2HXQA 3EL8A 1H0WA 3L8PA 3F9NA 3PE1A 2I0EA 3GFWA 3KMMA 2VX0A 4M15A 4BTKA 2G2FA 4E4XA 4Y83A 4PL5A 3SXSA 5CEOA 3FYKX 1CDKA 4IX5A 1W82A 3I79A 2QO9A 2NP8A 3KRXA 3QLGA 2HXLA 4L43A 5JFSA 5EI8A 3BBWA 3T3UA 3R9RA 3CTQA 2AC5A 2VTLA 3RPSA 5L6OA 3E8EA 4TYHA 4GSBA 2A1AB 3C4FA 4UMPA 1JAMA 3R1QA 3ANRA 4M14A 3DAEA 4BI0A 3PFQA 4F08A 4GVAA 5JEBA 3HV5A 2BRNA 3FEGA 4JBQA 4JRVA 3VULA 4USEA 5M08A 1KWPA 1URWA 5LXMA 4F9YA 3EIDA 1GZKA 5FP6A 3G9LX 4FTNA 1IR3A 4WOVA 4Y73A 3IONA 3TNPC 4GFOA 2VRXA 3MY0A 4BRXA 5A4CA 3D7TA 5FXRA 4BDDA 3LXLA 3N9XA 3CTJA 2R3IA 3D83A 4DH5A 4DA5A 1TVOA 4HYHA 4N6ZA 1IAJA 4RWKA 4TXCA 2IVUA 2IW8A 4FV5A 2QD9A 3FWQA 3WARA 1UU7A 3GCUA 3HZTA 1APME 2C5NA 4HVSA 1H25A 2X2KA 4D2VA 5E8SA 2QI8A 4DFLA 3HL7A 4JG7A 3SKCA 2HZ0A 3QD2B 1ZY4A 4GT5A 4P4CA 5IEVA 2AYPA 1U5RA 2J5EA 2JBOA 4GW8A 5I0BA 3BCEA 3KXHA 5J87A 3TZ8A 4WG3A 2YCQA 4YZDA 1OKWA 2ZV7A 5DLSA 4YLJA 4AE6A 2XK8A 5HORA 5HO7A 3FLWA 3QTZA 4RVTA 3FL5A 3W55A 2F57A 5CALA 1UV5A 2HELA 2NRUA 2PVYA 2P2HA 3DK6A 3ALNA 1FGIA 3ZHPC 5HU9A 1P4OA 1YQJA 3AT4A 3BE2A 5I4NA 1W0XC 2BKZA 4I0RA 4WG5A 1H28A 1FMOE 2HENA 2JIUA 4ZOGA 5HLWA 3PY0A 1PF8A 2GPHA 2UZDA 1BX6A 2PUPA 4FA2A 2PULA 3LFSA 3MVMA 3FXZA 5JRQA 2XF0A 4OBPA 4PWNA 4BGHA 4O22A 1YXTA 4KRDA 4ALWA 2WTDA 4ZY4A 4IH8A 4ZS4A 2OKRA 4XP2A 2P2IA 2OZAA 4QP1A 2GNJA 4WUAA 5IH6A 5D41A 4DGGA 4F70A 4O83A 3EQCA 4RG0A 4ITHA 4BKZA 2FYSA 3U6JA 4TT7A 4I5MA 4N6YA 3HAMA 2VX1A 3E64A 4DT9A 3R8LA 1H01A 2R7BA 3KXMA 5T68A 3QRJA 4MAOA 4R1VA 1MRYA 3OY1A 3U8WA 3AMYA 5CF8A 4R78A 3A2CA 5IQGA 5K9IA 3PYYA 4FIJA 4Z7HA 3VS3A 4QO9A 2WD1A 5CEIA 3Q53A 2O0UA 4PQNA 3UQGA 1OL1A 4DFBA 4YP8A 1KOAA 3H0ZA 4OR5A 5TO8A 3QWJA 3PA4A 4CXAA 4OTHA 4Z7GA 4ZJJA 4RC3A 1NT2A 3C51A 3QQGA 2FSLX 5KUPA 2QU5A 2YDJA 5H9BA 3WZKA 5ANDA 3OFMA 1G8AA 5EW9A 5E4HA 3R7YA 5EQEA 1YI6A 1XBAA 2EUFB 2VZ6A 3O96A 3QLFA 3Q9WA 5DH3A 3SG8A 2HWPA 4EYJA 1SVEA 3R1SA 2CNQA 5AAEA 2O2UA 4CCUA 1OUKA 4R7HA 3MI9A 3WZUA 4ASZA 3R28A 5AP1A 2I1MA 4YZMA 4L44A 4WRSA 2UV2A 3LKMA 2XBJA 4C4FA 4M12A 3NNVA 1HCLA 4XP0A 2JDVA 3RINA 4AN3A 3BYVA 3ZC5A 4G3FA 4JX3A 3PSDA 1GAGA 2QKRA 3JUHA 3G2FA 1JSUA 5AM7A 4QYFA 2JDTA 4MKCA 2ACXA 4RIXA 1R3CA 3EHAA 3R83A 4FSMA 1IG1A 3UOHA 4TZRA 4DEEA 5IEXA 5H2UA 4FVRA 3RAIA 3NR9A 4EOMA 3FLQA 4M13A 2JDOA 2JGZA 4BKJA 5ITAA 3LXKA 4JR3A 2EXMA 4FOCA 4MXYA 3ZCLA 4UWBA 1VYZA 2V55A 3QQFA 4OLIA 3E92A 3ZZEA 4XG4A 3EFJA 2XIRA 2XYNA 2XM8A 4IDVA 4RFMA 5DPVA 4GKIA 3MB7A 1YHSA 1H1WA 3CCNA 3PJ8A 2HK5A 3OVVA 3I4BA 4RIYA 1KE5A 1WBTA 4D1SA 4EJNA 1REJA 4R7BA 3GQLA 2J4ZA 2JIVA 2RL5A 4JT3A 3ZS5A 2BAKA 4NM0A 3D94A 4CG9A 3R30A 5JGDA 4EK6A 3KREA 4CV8A 4DEAA 3ZMMA 1DI8A 4TYEA 3D5XA 4XRLA 3D14A 1VJYA 5BVFA 4YPDA 2PWLA 2O8YA 5D1JA 5E92A 4DBXA 3QFVA 1FGKA 4E6QA 3A4PA 3DKGA 4YZ9A 2C5VA 3FKOA 2QR7A 2OXDA 2VWIA 3E8CA 3EFLA 4ZSEA 4FT5A 5FM2A 5AWMA 1U59A 5CY3A 4D2PA 4PNIA 4MWHA 2B53A 2X7FA 3MWUA 4RMZA 4EH2A 2BFYA 3NLBA 4GG5A 4F1MA 5CF5A 3AD5A 3BLHA 5L4QA 3FI8A 3PPJA 3VS5A 3UPZA 2ITUA 3AC3A 3BEGA 2B54A 5HG5A 1YDSE 2QOOA 3BBTB 3MY1A 4BIBA 4C3RA 4J95A 1KSWA 4F1OA 5BX0A 1YXSA 3C5UA 4D4VA 1H27A 1XKKA 1YRPA 4KIPA 3U6HA 4MWIA 5BVKA 2P3GX 4G2FA 4IZYA 4ORKA 1PYXA 5ANJA 5LMKA 5M56A 5D10A 1XWSA 2PVKA 4IXPA 1WBNA 4KINA 4ZSLA 1LEZA 2V7AA 2BVAA 5BMMA 4E7WA 2C47A 3HMPA 3ORPA 4C3FA 3V5LA 4V05A 4IWQA 3VRZA 4MXXA 4I3ZA 3OWJA 2WNTA 1A06A 4UALA 2AC3A 3IGGA 3KU2A 4FTRA 4WSQA 4DAWA 1LUFA 3PXFA 2DS1A 4ZMFA 5J5SA 5KX8A 3TKUA 5CASA 2QU6A 2WB8A 3H3CA 4GUEA 2IWIA 4I5PA 5CNNA 4CTBA 3DDQA 1IA8A 2ERZE 3EWHA 3LCDA 4KKEA 4DGNA 5KKRB 1E1VA 2GQSA 3EN7A 4QRCA 2ZM1A 1DI9A 3C4WA 3VC4A 4I4FA 2Z60A 3WF7A 4WKQA 1H1RA 4JL9A 3WF8A 1JKKA 4FEWA 3V5WA 4BGGA 2Z8CA 2YIYA 2EXEA 3BHHA 3MVLA 1YVJA 4ANMA 1OZ1A 4ZSGA 3HDMA 2J90A 4FGRA 5DYJA 1W7HA 2CJMA 2GHLA 3OTUA 4OAUC 4FTOA 2OH0E 4HVDA 5FEEA 2PL0A 5DBXA 3VF8A 5HESA 1HOWA 2ITNA 3RAKA 2WEVA 3TEIA 3D5UA 4MH7A 4OTDA 4FZ7A 3F5GA 5DGZA 3SV0A 4EOPA 3MH1A 4X7QA 2YIRA 3TL8A 3F3VA 2C6OA 4IAIA 4N70A 3FSFA 5CU4A 4S33A 5IA3A 5CQUA 3PIXA 4QP3A 3RWQA 1BYGA 4A9UA 2QOQA 3QTQA 4I20A 4NKAA 3BELA 3BU6A 2W1IA 4TYHB 3TJDA 2XVDA 3GCQA 3OT3A 2VAGA 3ZDUA 4DGOA 5J1WA 5JK3A 2HZ4A 5EW3A 5CTPA 5FGKA 4AXAA 4OTIA 4EZ7A 3DY7A 3LCSA 3COKA 2YZAA 3GC7A 4L7SA 3DNEA 4JRNA 4O0YA 3IQ7A 5AUWA 2ZMDA 5AP6A 1PXLA 4IB3A 3EN5A 1A9UA 2PHKA 3GBZA 1QPEA 4C4IA 4E20A 5JN2A 1OL2A 1DAWA 4V04A 3D9VA 2I6LA 4FV2A 2VO3A 4XV9A 2YM3A 3D7TB 1BLXA 5L8KA 4JLCA 1LEWA 2O64A 3COMA 3G33A 1PXMA 1JVPP 4J8NA 1KV2A 3RNIA 5DOSA 4CLJA 4DEGA 2BAJA 4HNFA 3DZQA 4D2SA 3HV6A 3COIA 5CNOA 4C2WA 2XZSA 4LOOA 4NT4A 2XK4A 5HCZA 2X2MA 3QKKA 2W96B 3QYWA 5IH5A 4UXQA 1IAHA 4CYJA 3JR1A 3WZJA 4IWPA 5KBQA 4RX8A 5L2SA 5AUYA 4X3FC 5FBOA 2B52A 4EC8A 5LMKC 1QCFA 4ZZNA 2XCHA 3VS4A 3NUPA 2HZIA 4IAFA 5GHVA 4WT6A 2W1DA 3R7OA 4LMUA 2YM6A 4I21A 5TR6A 1A48A 3V6SA 3VBQA 1Q8TA 3DDPA 4FGBA 4KS8A 4NEUA 4NJ3A 2PMNX 2R7IA 4FIIA 3TCPA 5L2IA 3DXQA 5IUHA 3O17A 2JEDA 4R5YA 5JGBA 4J1RA 1ND4A 4IZAA 3G0EA 3QHWA 2YERA 4S30A 4ZAUA 2PMLX 1H08A 3HV7A 4HNIA 4OTRA 2YIQA 5ETFA 3W32A 4BDBA 1Y6AA 5HX6A 1OBDA 1Q5KA 3ELJA 5HCXA 2OZAB 3QQHA 3F61A 4BCKA 2I0HA 2WU7A 3DBDA 5M4UA 1G8SA 1Q41A 1H1SA 1WFCA 3CJFA 3EL7A 1AGWA 4HCTA 4QMSA 3RHKA 4DEDA 4H58A 2FUMA 4JIKA 4BDGA 4U41A 4HYSA 3ORLA 4EH6A 3UC3A 2ETRA 1AQ1A 4G3EA 4K0YA 3R8PA 5HVKA 3OCGA 1PXKA 3PXZA 1BI7A 1ZYSA 2W4KA 4QPMA 3FQSA 5A4TA 4XG6A 5HGIA 2IJMA 4X6RA 5DEWA 4B8LA 4A4XA 4ZY5A 1HCKA 1GZNA 3A7HA 2UVYA 3GC9A 4WNMA 5KZ0A 5L6WL 5I9VA 5K4IA 4FKRA 4FKTA 4BFMA 2XCKA 3MV5A 4FKGA 5FTQA 1B6CB 2XK7A 3BIZA 4QMNA 5H8GA 2W7XA 4YC6A 4ANOA 4L3LA 4BIEA 5B2LA 1E9HA 3CP9A 3VUTA 3KGAA 3NX8A 3CQUA 1OVEA 4BYJA 3UC4A 1V0OA 4BDHA 2X81A 4FBXA 4AS0A 3KXXA 3BYMA 4MBLA 3SOAA 5IEYA 4NW6A 4AN9A 5EYKA 2PU8A 3UMXA 3JY0A 1L8TA 3LLAA 3CC6A 5CU6A 2YISA 3OOMA 3OXIA 5M55A 1JOWB 3TV4A 1FINA 3ZTXA 2YZLA 4CFMA 1PXPA 4FL3A 1OITA 1I09A 4NCTC 5AJQA 1CKIA 4O7LA 5HU3A 3P9JA 3SAYA 3K5VA 2OJGA 3KFAA 3Q4CA 5HVYA 5A4QA 5DEYA 5IA5A 3QTIA 3GOPA 4EI4A 3DOGA 5A14A 2B7AA 4RX9A 3FI2A 3FY2A 4FEVA 3HAVA 5ETIA 2GCDA 3ALOA 1ZXEA 3BRBA 3DQWA 4RIXB 1ZRZA 2Z2WA 1ZMWA 4ZZOA 3D0EA 2OBJA 2CHLA 3EYHA 4JDHA 1RW8A 4ANBA 3QQLA 3GQIA 1PMUA 4CKRA 2GQGA 4QMVA 4IVDA 3P78A 1PKGA 4WNPA 1WMKA 3EQGA 5EDRA 4F1TA 5AR3A 2EXCX 3A60A 2WTKB 3S00A 2W4JA 2JAMA 3R0TA 4HZSA 3M1SA 3UZPA 5AA9A 3MA6A 4BWPA 2CKPA 2QOLA 4MNEB 5DG5A 1GY3A 3P86A 4RIYB 2XBAA 3HV3A 1U4DA 4XG2A 3PIZA 5HTCA 4L8MA 5IQCA 4EONA 2QHNA 2V22A 5EYMA 3UDBA 4F0GA 4Q5EA 1FPUA 3BHYA 2XJ0A 2WMVA 4AA4A 2ITPA 4ANNA 4KIQA 4RQVA 3QTWA 3HX4A 5LARA 5LVNA 5TE0A 4KUJA 2HWOA 3ENMA 1P4FA 5M07A 5A6NA 2QQ7A 1Q97A 2OIQA 3D7ZA 4YNOA 3O7LD 4J96A 3VIDA 4B9DA 1UVRA 4FNXA 5D9HA 4IEBA 2YFXA 3AXWA 5K5XA 1WCCA 4E1ZA 5AP4A 4EK3A 3UZRA 5M51A 1OMWA 1XH9A 2C3LA 3Q04A 5I3OA 5BNJA 2REIA 2CGVA 2IW6A 3ET7A 5AP3A 3ZRKA 2JFMA 4YNEA 2IW9A 4YJUA 3BI6A 3CY2A 3D2KA 2Y0AA 3W16A 3UNZA 3ID6C 3TUBA 4G17A 4RVMA 4IADA 3VVHA 4GFMA 4QMYA 4QP8A 2Y4PA 3ORMA 4FKVA 3B8QA 2VWBA 1JSTA 4J99A 5DIAA 4TW9A 2OF4A 4ACDA 5C26A 2QOHA 3DBEA 3O7LB 4IM3A 4ASEA 4U44A 2ZDTA 3ZO2A 2XS0A 4APCA 4NYEA 2XK6A 1OECA 4F99A 4N4SA 3JS2A 3IW5A 4FV4A 4ACCA 2YCSA 3JYAA 4FV7A 4WNOA 4C0TA 4FZAB 4E5BA 3D5VA 3WIKA 5KMOA 4FODA 2LGCA 2C5OA 2E9VA 3PVWA 2WO6A 3VBVA 2R4BA 3GFEA 4BDCA 4OTPA 4C38A 4AOTA 2X8EA 3C7QA 1DAYA 4O6EA 4PTGA 3RJCA 2OU7A 2YIXA 4FT0A 4JDKA 4R5SA 2OIBA 3FAAA 3PVBA 3LQ3A 3F88A 3QD4A 5ANGA 4E26A 1ZMUA 2WMBA 2ERKA 4CFNA 4JDJA 2RGPA 4FKUA 3QTXA 4M68A 5CI7A 2C0OA 4NM7A 4W8DA 1WBWA 5KMIA 5AP0A 5HEZA 4RQKA 3BGPA 4GYIA 5AP2A 5EH0A 4NTTA 3E62A 4UXLA 4YGAA 5C9CA 3TUCA 4AGUA 4BWXA 3W1FA 1O6LA 4FT3A 1F3MC 5KNJA 1OKYA 2W99B 1WBVA 1OKZA 2GU8A 4F9AA 2C6KA 1G3NA 5J95A 4CFXA 3S2PA 4U42A 3FMEA 3MFTA 3HUCA 3FBVA 3JVSA 4ZK5A 3R7GA 5DT3A 2X4FA 4FUXA 4P5ZA 4EQUA 3F5XA 3CEKA 4A9RA 2DQ7X 2ZYBA 3MTFA 5AIRA 3E93A 4KBCA 1UNLA 1Y91A 5CAUA 4WUNA 5FWKK 3MESA 2PE0A 4PTEA 4U97A 3FMDA 4AT4A 3V5TA 3FV8A 4EOOA 1Y8GA 3DFCB 4YTIA 3RZFA 1J1CA 4FC0A 3FXWA 5EG3A 2EB2A 2CCHA 4MEDA 1BL6A 2VX3A 1PXNA 2P55A 5LMBA 4GUBA 3ZXTA 2ZV8A 4EOIA 4ACMA 2HW6A 3KXGA 4KSQA 5AX9A 1NW1A 1XJDA 4ARKA 4ZJVA 3QA8A 5I9YA 4YJNA 5ETCA 5E90A 4XOYA 3R00A 2RG6A 2B1PA 1H26A 3FZRA 3W8QA 1H1PA 1XH4A 3BHVA 4EH9A 5CAOA 3F2RA 2PUIA 1Q61A 3CTHA 3R8UA 3LCTA 3PG1A 3MH3A 3CD3A 2QOCA 3T3VA 3UNJA 1J7UA 4O7VA 4HVHA 3KULA 5IA1A 4XUFA 2ZV9A 3NUUA 3PPZA 2PVMA 4HW7A 4F7LA 4X6QC 5IQAA 2BHEA 4IHPA 1OKVA 1Z9XA 2QO2A 4RBLA 2VTMA 4FKWA 4QP4A 4A06A 4ZEGA 1U46A 3Q9YA 2WTJA 3KL8A 3MJ1A 2WMUA 4Y46A 2WIHA 1STCE 2BZIB 2GNLA 2BDWA 4L3PA 3AG9A 2ZMCA 3MJ2A 1KOBA 4FTLA 3FY0A 3G9NA 4GVJA 4FNZA 4GMYA 3VHKA 3QCQA 4UB7A 5TF9A 5IQDA 4G1WA 3SXFA 5DWRA 3GI3A 4QTCA 3KB7A 3LFCA 3NUXA 4FSTA 2C1AA 1UA2A 4DG0E 3NVKI 2OXYA 4GU9A 3BV3A 3RI1A 2ZM4A 4NL0A 2BIKB 1R39A 4FT7A 4BHNA 4IACA 3PSCA 4LOQA 4F63A 3TWJA 1W84A 5CVFA 4FKLA 4EBVA 3I7BA 2SRCA 3K5UA 3LM5A 4I41A 4IVBA 4XHKB 3UMWA 4EHZA 3II5A 2G2HA 3EZRA 1R0PA 4NM5A 4BDIA 4D55A 4EHVA 5GIOE 1Y57A 3UE4A 3IK3A 3E5AA 4G3CA 5GNKA 1M52A 4TYGA 3R8ZA 3TV6A 4D5KA 5D11A 2ITVA 4ANQA 4R77A 4FT9A 4KS7A 2WEIA 2WMTA 4AG8A 1W8CA 4F9WA 3T9IA 1R1WA 5CANA 2YDIA 2WU6A 5IQFA 4A9SA 3FKLA 3FI4A 3OWPA 2E9NA 4R8QA 5HG9A 2R2PA 3P23A 4YZCA 4IC8A 2EVAA 4QYHA 3W8LA 4AZEA 1SM2A 4IAKA 2GFCA 1QPCA 1SYKA 1U5QA 3M42A 4EH3A 4YJOA 4EZ5A 3Q3BA 2Q0BA 2IVSA 3PG3A 3VBXA 4RLLA 3DBFA 2VUWA 4AZFA 3ZONA 2FB8A 1H00A 1SMHA 3F2AA 3EQDA 3G51A 5GJFA 5AFVA 5FP5A 4G31A 4GIHA 3BGQA 3ITZA 3UQCA 5C8MA 3R2BA 3ORIA 1CTPE 3IPHA 3CPCA 3QXOA 4KNBA 2OG8A 3IGOA 4QP9A 4UY9A 5I5ZA 1YWNA 2YLFA 4CRSA 4ZIMA 3KQ7A 3O8PA 2VWVA 2HY81 2OF2A 4O2PA 4O1PA 5E1SA 4C02A 4D0XA 5A46A 3NIZA 3UG2A 3GNIB 4AGWA 2QLUA 2H9VA 5HE3A 2BKKA 3R22A 5A4LA 4I23A 4F65A 4RWJA 5GZAA 3RZBA 3MH2A 3I6WA 4HCUA 3ATTA 1FQ1B 3ZBXA 2JKKA 4FL1A 4GS6A 4DGMA 3IW7A 1KUTA 5DR6A 4UYAA 4GL9A 3VUKA 3NUYA 4QP7A 3DS6A 5KKRC 4DF3A 3QCXA 2XMYA 1OPKA 1PMEA 2XP2A 3O8UA 1CM8A 4LG4A 3S0OA 3FQEA 1OPJA 3ZM9A 3Q6UA 3IS5A 3EOCA 4JG6A 3NPCA 5CWZA 3OUNB 4KSPA 4R1YA 4X0MA 3VBWA 4AACA 2FO0A 3R01A 4FKOA 3R21A 2Y6MA 4U6RA 4AE9A 4OGRA 5F94A 4L53A 4NZWB 2C6IA 4CKIA 5CEQA 4LGHA 4A9TA 4JQ8A 2UZTA 3BQCA 4FOBA 4FKSA 3V04A 4FG9A 2WAJA 4OUCA 4Y95A 4X2GA 3O8TA 4IFCA 2BDJA 4QMTA 5EOBA 1FBNA 1XH7A 2BALA 4AFJA 1M2QA 4AOJA 2IZRA 3TIYA 5IQIA 3FUPA 3R04A 2JLDA 4AF3A 2QNJA 4M97A 4QQTA 4Z55A 4RGJA 3KCKA 2VNYA 3ANQA 2VV9A 4O21A 1DS5A 2J2IB 3PPKA 4I0TA 3KXNA 2RFNA 1TQPA 5D7VA 4YSJA 3DBQA 3CE3A 2P4IA 2R3JA 2F2UA 2GS2A 4BC6A 4ENXA 5AR5A 4O86A 4W4VA 1M17A 3ZEPA 4I6HA 2E2BA 3N4UA 2PTKA 4LUEA 5DHJA 4X21A 3GVUA 4FG7A 4N57A 1GZ8A 3HMNA 2F7EE 5I9UA 2BZKB 4DLJA 2OI4X 2QCSA 3C1XA 3COHA 5HIBA 2Z02A 3O71A 4CVAA 3PXKA 2XNBA 3VHEA 2R3MA 2VTQA 3HRBA 5HLPA 2GFSA 3HRCA 4MQ2A 2WTVA 4E73A 3Q9ZA 3MTLA 4HYUA 4F64A 2VN9A 3EYGA 4ZJIA 5BUJA 5E8WA 4MD7E 5IQHA 3LJ1A 2XA4A 2YCRA 4AT3A 2XK9A 1QL6A 3OS3A 3I0QA 3MPAA 3Q60A 1OIUA 2DUVA 4EKLA 4L00A 4BGQA 3VUGA 2VGOA 4KIOA 4JBVA 4TY1A 4RA4A 4C58A 4C61A 5F9EA 2CKOA 4D4YA 1ZMVA 2EU9A 5I9XA 3I0OA 5K5NA 4DEIA 4JAIA 5HD4A 4BY9E 3OCTA 4J53A 4MNEA 5EM8A 4C59A 1NXKA 3QCYA 4FYOA 4QP6A 5FDXA 4BB4A 3ORXA 4UV0A 5EI6A 2O5KA 4LM5A 4XG9A 3ZLWA 4PDYA 3DZOA 5L8LA 1FMKA 4IE9A 4CRLA 5FTOA 3SG9A 3NW7A 4BCGA 4BR3A 2QHMA 4JI9A 3R2YA 4YSMA 3PXQA 2YWPA 3C4CA 4JQEA 5J9YA 3DLSA 4F6WA 1OPLA 3V6RA 2IZUA 3ZSHA 4DH8A 4L3JA 5E8TA 4JBOA 3FSKA 1WZYA 1BKXA 2J50A 3ZO3A 4YURA 3FYJX 3MFUA 4ZXTA 2C1BA 2NO3A 4EC9A 3OEFX 3UJGA 3DFAA 4AN2A 4I4EA 4AU8A 3G6HA 2WGJA 4HVIA 3W2QA 3AT2A 5HG8A 1PJKA 4W9WA 4YLLA 3KN5A 3UZTA 1UKIA 4V0GA 4QQJA 4F9CA 2X39A 5CF6A 4KBAA 4LRMA 4P5QA 5BMSA 3TV7A 2B9IA 3BHUA 3RALA 4UEUA 4WG4A 1BMKA 4CKJA 1Z57A 5CT7A 2XUUA 4R6VA 5FEQA 5HOAA 3SC1A 2C0IA 3BYSA 3SRVA 2R3FA 5JFWA 5L6PA 4QQ5A 4I0SA 3P7CA 3RGFA 3ZEWA 5B7VA 4YJRA 4FEXA 3VQUA 2QO7A 4QNAA 2ZAZA 4WSYA 4BWKA 4IVAA 1JSVA 2X7OA 5AUVA 3WI6A 4G9RA 4NW5A 3VAPA 4FX3A 5AEPA 4P7EA 3LFAA 4G16A 4F6UA 4F7JA 4FUYA 2B9HA 1U54A 2BR1A 3L8VA 4FK3A 4IX3A 2WQEA 3O0GA 2WOTA 4C36A 3NEWA 4IB1A 4ZTNA 4D4RA 4MQ1A 2A4LA 4XG3A 2OK1A 1ZOGA 3OHTA 3FC1X 2VTPA 3OUKA 1P14A 3PRFA 2PE2A 4EK5A 1Q8UA 4CYIA 5DE2A 3R9NA 3PTGA 1UKHA 3Q5IA 1PMNA 1WBOA 5HE1A 1T45A 3C0IA 4BDAA 3QRUA 2R9SA 3KULB 3NWWA 4FV9A 5E8XA 3P08A 3PSBA 3E7OA 4OTGA 2XKFA 2HYYA 5EM5A 3IG7A 3WIGA 4C35A 4DITA 5LJJA 5J9LA 5CEMA 3Q2JA 2GTNA 3PZEA 4Q2AA 1SVHA 4G3DA 4KKGA 1ZWSA 4X2KA 1ZZLA 1J7LA 4EOSA 2VTTA 4RVKA 2VTRA 5CYIA 4I94A 3UPXA 2IVTA 3EN9A 4FIHA 3FL4A 4FF8A 4I5HA 4YJSA 5F20A 5J8IA 4RFYA 5BVEA 3ZXZA 1GIIA 2ITWA 5F95A 4ZMEA 3LJ2A 3TKIA 2ZB1A 5EM6A 3KF4A 1O6KA 3KCFA 2Q0NA 2C4GA 3THBA 3TI1A 4A9YA 1YWRA 3LJ0A 4JR7A 4EEVA 3BX5A 3PP0A 5IA0A 3EQPA 2BTSA 4H3BA 3F7WA 1YW2A 2WTKC 3AC5A 3QZHA 5IA2A 4UMUA 3O23A 3GXLA 4NKSA 3ORKA 4V01A 3DV3A 5F4NA 3RCJA 3SXRA 4Z9LA 2GNHA 3CQWA 2XRUA 4FSZA 5C4KA 4C37A 2C3JA 5KCVA 1KE7A 1Q24A 3FMMA 3PUPA 4JOAA 5J1VA 1W98A 1WAKA 4FNWA 4QP2A 3VUHA 4QD6A 2F7XE 4TPTA 4FE2A 3RNYA 2J51A 5TT7A 4EOKA 4AFEA 5FQDC 3QZFA 3I5ZA 4U9AA 2G01A 4BCMA 4DG3E 3RCDA 2Y4IB 3U87A 3VJOA 3MFSA 3SX9A 1M14A 4EHEA 3FZSA 3I60A 4RJ5A 3DU8A 3MYGA 1UU8A 2CGXA 4FV1A 4NTSA 4PNKA 3U51A 5HI2A 2UW5A 3DAKA 4U79A 3LCOA 5JZNA 4C3PA 5DMZA 5CXZA 4WO5A 3E3PA 3UIUA 4C4HA 1MRVA 4OBOA 3W2CA 2EWAA 5FXSA 3FZ1A 5CS6A 2PVRA 3A7FA 3DJ6A 3KEXA 5EDQA 5K0KA 3VUDA 3ZO4A 3UOLA 1H4LA 1XBBA 3FZOA 5EW8A 2C6TA 4CZTA 4AAAA 2QKWB 2GNIA 3NZ0A 1FOTA 3QYZA 4E4LA 4O91A 4BCPA 5JT2A 3M2WA 3RMFA 3ZRLA 2GS6A 4DFZE 4UMTA 5KMMA 2HAKA 5LVLA 3RPYA 2YN8A 1LR4A 4IQ6A 1GIJA 3NCZA 4GRBA 4AZWA 3JPVA 3KVXA 2GHGA 3HYHA 3NUSA 4YLKA 4ZTLA 2YA9A 4QTAA 2PVJA 3WE8A 4QTEA 3CSVA 3E3BX 1H0VA 3QWKA 4S32A 2X2LA 3ZM4A 4CMOA 2UZUE 2VWXA 2QOIA 2J0MB 2Y8OA 4K33A 4U8ZA 4XS2A 4TWOA 4EKKA 3H9OA 3JXWA 4LL0A 3BWFA 4F7SA 5G1XA 3HVCA 4OTQA 3T9TA 5CU0A 3UQFA 4Q5HA 4LGGA 1UWHA 3ORZA 3FQHA 2QLQA 2O63A 3BPRA 4JAJA 2XNNA 4GCJA 4F7NA 4TWNA 3T8OA 2HIWA 3MB6A 4FYNA 5CSVA 4AGDA 5IH4A 4ANLA 3F69A 5M44A 3MW1A 3ZC6A 3MVJA 5DRDA 1XR1A 4CNHA 3AC1A 2C6LA 2WHBA 3G15A 4HJOA 5AR8A 3EN4A 1XBCA 4YU2A 5BUEA 3HA6A 3LZBA 4O0WA 1OIQA 3U4WA 1GJOA 2R3PA 5T6KA 3L1SA 4HPUE 5FUTA 3K54A 4BZOA 1OIYA 5IUIA 4W8EA 4ACGA 5C8KA 5I9ZA 3NGAA 1I44A 4KA3A 4DE4A 3IDBA 3L8XA 4AT5A 3DPKA 3A62A 3Q4ZA 3FXXA 3R1YA 4FV3A 2JDRA 1YXUA 3VQHA 1P5EA 2DYLA 3Q4UA 4AA0A 2B0QA 5GJGA 3BKBA 2R3HA 4GEOA 1QMZA 3GU7A 3BYOA 4X3JA 3CJGA 4LQMA 4Y5QA 5CQWA 3TXOA 2GNFA 4DGLC 1ZYLA 3QZGA 4K77A 3UODA 2R3OA 5BVNA 4O7NA 3KMUA 1OL5A 2X6EA 3NW6A 4L42A 4LFIA 2C6DA 2UZLA 4MYGA 4AQCA 4B6LA 1F0QA 4APPA 5CI6A 3WOWA 4HOKA 1NY3A 1X8BA 3W10A 3LXPA 3E8DA 5AAFA 4IC7A 3QZIA 2WXVA 4U7ZA 2OJ9A 4CQGA 5JQ8A 3LW0A 5BVOA 4XV3A 5CVGA 3OG7A 3W2RA 3ODYX 3SVVA 3U6IA 3D5WA 2XH5A 2PVNA 3E63A 3POOA 4C57A 4GYGA 5AP7A 5KMLA 2XYUA 2PYWA 3FMLA 1RJBA 1R0EA 2GMXA 3UNKA 3TKHA 3E87A 4WRGA 4EH5A 4IZ7A 4C4JA 2PUUA 2VTNA 2F49A 3Q96A 5HHWA 2XNPA 5LVMA 2UW6A 3CR0A 2P0CA 4G34A 2XKEA 4I6QA 3EB0A 4YZNA 4O27B 4FIFA 4K1BA 3GU8A 4WHZA 2GHMA 4C4EA 4B7TA 1K9AA 1YI3A 4ACHA 3FMHA 2W1CA 4I5CA 3TZ9A 2ZM3A 4DFXE 3AQVA 4JVGA 4WBOA 2W17A 5HIDA 1ZARA 3ZSIA 1PMVA 2BRBA 3O50A 3BZ3A 4RC2A 2LAVA 1UNHA 4AP7A 5FG8A 4CD0A 5EM7A 5CAVA 2G2IA 2JKMA 3ZFXA 3F66A 3HLLA 4A7CA 3TM0A 5KO1A 5CEPA 1RQQA 4JBPA 3OW3A 3I5NA 4YJTA 5ICPA 2C69A 3ACJA 5EKNA 3V5PA 4DINA 3QGWA 3GC8A 4LV5A 5HTIA 4QYEA 3GT8A 3ZLSA 2I0VA 3VW6A 4YMJA 3HP5A 2CCIA 2J0KA 3DB6A 5CZIA 2ESMA 2YM8A 4M0ZA 4L7FA 4QMXA 4BBFA 3LFEA 2R0IA 3PXYA 4EH7A 3OBGA 2O3PA 4JX7A 3V5QA 4PP7A 1P2AA 5ANIA 4DLIA 5JZJA 4V0GB 3F82A 3KF7A 4K6ZA 4PPBA 4YO6A 1DM2A 5ANOA 3U9CA 3ZOSA 4ZSJA 2BIYA 3WF5A 4NWMA 4BYIA 4U43A 4ENYA 4EWQA 4E8AA 4DG2E 4PRJA 4A4LA 3ERKA 4LYNA 5CVHA 4H39A 5E8YA 5C01A 3ZH8A 3NVMB 3SRVB 3A61A 3FLNC 2OSCA 4UWCA 3F3UA 4F9BA 4QMOA 4FKJA 2F7ZE 3DK3A 3HGKA 2VTAA 3NIEA 4WBBB 4BZDA 4D5HA 3DTCA 4C2VA 4DC2A 1GIHA 4JJRA 3Q32A 5AADA 2JKQA 4FTQA 1OGUA 2VGPA 4ZS0A 3R7UA 3HMIA 3QX4A 4M3QA 5HE2A 1WBSA 1ZZ2A 2NNWB 3HNGA 4HVGA 1U54B 2CGUA 4Y8DA 4CT2A 1JKSA 1PXJA 5HX8A 4B4LA 1MRUA 3GCPA 2QG5A 4CZUA 4CZYB 2PMIA 5CF4A 3DXPA 4EH8A 3GB2A 4M66A 4OBQA 5A3XA 4E5WA 3HV4A 3ULZA 4TWCA 5CSWA 4DT8A 3SA0A 1NA7A 4U81A 4UBAA 1XH6A 2YWVA 4EH4A 3FDNA 3MVHA 4IB5A 4CEGA 3U54A 3DA6A 3FPMA 3VS6A 2PPQA 1VZOA 4HGSA 4E4NA 3NCGA 3ROCA 2F4JA 2J0IA 4RSSA 4YTCA 4OTWA 4ZY6A 3WYYA 5FDPA 3DTWA 3AMAA 1JNKA 5DVRA 4FTIA 3VN9A 5I3RA 2UZVA 5BYLA 5M4CA 1VEBA 4PV0A 2FSMX 3MH0A 4J97A 5J7HA 3Q4TA 4JQ7A 2OIDA 3KRWA 3GU4A 5LWMA 3FE3A 3LE6A 2PUNA 4IWOA 5GINE 5HKMA 1IASA 3H4JA 5C8NA 4RFZA 5IQBA 4MXAA 5TKDA 1RE8A 3LLTA 3L8SA 2FGIA 4EK8A 3TDWA 3RAHA 2IVVA 2VTIA 3LVPA 2V5QA 5ANKA 4FEUA 4LGDA 5DT0A 3OWLA 1VR2A 2YITA 2BMCA 2OJJA 3DKFA 3OXZA 4GH2A 3FHIA 5BPYA 4LMNA 3ZUVA 4PP9A 3FMJA 4W4WA 3SW7A 2XEYA 5B2MA 4RLKA 2WOUA 4YTFA 5EQPA 5DT4A 3C9WA 3LFDA 5HE0A 2CNVA 2A2AA 3SHEA 4CSVA 4D2RA 2WPAA 3QD0A 2W5AA 4D9TA 1OL7A 2J6MA 1MQ4A 2YLEA 4IMYA 4KD1A 3UYSA 4GT3A 5JMSA 3P5KA 3U9NA 3OROA 4UMRA 2XIZA 4KKHA 3WBLA 2UZBA 2IZTA 3HECA 4O0UA 4O7ZA 5BYZA 4QMMA 4CLIA 1XQZA 2FH9A 3KRLA 5HNIX 3VS0A 5JQ5A 4ONAA 4I1ZA 2OICA 4U40A 4PX6A 3O2MA 4PDPA 4EJ7A 3TDVA 3MFRA 4I93A 2O65A 2XNGA 1ZAOA 2YACA 4IVCA 4AOIA 2W4OA 3GENA 3QGYA 4MBJA 4BZNA 1Q3DA 2W1EA 2RKUA 2VO7A 4M69A 2CLQA 4ZTHA 4YC3A 4QQCA 5EYCA 3W2OA 2X1NA 5ACBC 2XEZA 3PVUA 3SW4A 5AAGA 3ORNA 3NW5A 2W0JA 4IJ9A 1OM1A 4TL0A 1NVRA 4FR4A 5FBNC 4MD8E 2F2CB 1YDTE 3CD8A 1J91A 2WQBA 2XRWA 3F5UA 4FI1A 2BHHA 4BL1A 4Z16A 1F5QA 4IB0A 4XOZA 2YEXA 4J71A 4U80A 5H8EA 2YM4A 4PF4A 1OIRA 4YTHA 4MHAA 2XNOA 3GEQA 2BUJA 4BI1A 2X9FA 4YHJA 1ZYCA 3BHTA 3DBCA 3ZLXA 4IWDA 4CV9A 5C4LA 5HVJA 5CAPA 4E93A 3PDTA 5IG1A 3FHRA 4ITJA 3TZMA 5E91A 3HMOA 4QYGA 4XP3A 4B0GA 3R6XA 1YXXA 2OFVA 2C6EA 5CXHA 4MTAA 3ZUTA 3F6XA 4H1JA 4FSRA 4QTBA 3R7EA 2ITQA 3TNIA 3ZBFA 3QKLA 4YHTA 2WMRA 3GUBA 5CT0A 3H9RA 4IJPA 1YHVA 4TN6A 4RX5A 4C8BA 3PA5A 4OAVB 1K2PA 4EUUA 4HGLA 3MGYA 3A4OX 4O96A 4E3CA 2Z7QA 2WFYA 4QPAA 2I7QA 4BDKA 4PDOA 5L2QA 4Z3VA 3F3TA 4E5AX 2NRYA 4IAZA 3LQ5A 2WMSA 4QOXA 4TKSA 3QTSA 3LQ8A 2XM9A 2UUEA 3PXRA 3RK9A 3VW8A 2A0CX 3NNXA 5KMJA 3IDPA 1Z5MA 3W33A 2I0YA 2X9EA 3BQRA 4P2KA 4TTHB 4AZSA 3V8WA 3WYXA 4F09A 5JH6A 4K18A 4QMPA 3UOKA 3CKWA 3W2PA 2JD5A 3OCBA 4MD9E 1IEPA 2XIKA 3D2IA 3VBYA 5EK7A 3R7IA 3OD6X 3OT8A 3VBTA 1MUOA 3CQEA 4GK4A 2J9MA 3ZFMA 4FZ6A 3PA3A 3JVRA 4RVLA 3H9FA 3MS9A 2GSFA 3ULIA 2JFLA 3LM0A 1YOJA 2UZOA 5GJDA 5ACKA 4XJ0A 5JSMA 5GIPE 4G6NA 3C0GA 5FRIA 4BTFA 5AP5A 3PY1A 5HZNA 3EH9A 3VF9A 2R3GA 5L3AA 1PY5A 4X2JA 5AV3A 4XV1A 2XKDA 4O0RA 4PL3A 3PP1A 3VS7A 2CKEA 1REKA 1YDRE 3LAUA 4W9XA 5HD7A 2JIIA 3MDYA 3BLQA 3DKOA 4Y85A 3TG1A 3WF6A 4E6DA 5HIEA 3QC9A 3VJNA 2WIPA 4H3QA 5DR2A 2CLXA 1GNGA 5IKWA 1CKPA 2R3RA 3ZZWA 3TN8A 4E6CA 3EKNA 4NUSA 4D2WA 2UW0A 3FLYA 5CSHA 4LRJA 2W1ZA 3TJCA 3WILA 3BU3A 2ETMA 2PZPA 2ZVAA 3EQRA 4N0SA 4FKQA 3ROYA 4ALUA 2ONLA 2PE1A 1T46A 3PZHA 3FMKA 3EQHA 2RIOA 5AV2A 3UTOA 5AUZA 3K3JA 3MN3A 5H8BA 5CZHA 3GGFA 5IMEA 2BRHA 1YOMA 2EB3A 1YOLA 4ID7A 4MXCA 3ETAA 4Y5HA 4TYIA 1IA9A 4USDA 4DCAA 3D15A 4L01A 5K3YA 3FLZA 4MX9A 3Q2MA 3RPRA 3UO5A 3NS9A 5CLPA 2VTSA 3DLZA 4GV1A 4G6LA 5HBEA 4HPTE 3IDCA 4QYYA 2WMQA 4ZTQA 2W06A 4BF2A 3LMHA 1MP8A 3GOKA 5KMKA 2H96A 2HCKA 5LMAA 4YJPA 1M7NA 2IZSA 1Y6BA 4GU6A 1OUYA 2C6MA 4DBNA 4XG8A 5HCYA 2CN8A 3GU6A 3OF0A 3FZPA 4RWLA 3EQIA 5AUUA 3QTUA 3RAWA 3HDNA 3OY3A 4U5JA 2HZNA 5AMNA 4BBMA 3PLSA 3B2TA 3PLAE 4NFMA 2IPXA 2UW7A 4BI2A 2Z7LA 2PZRA 4D1XA 3DB8A 3DJ7A 2OFUA 4MXOA 5DR9A 3EJ1A 4O0XA 4GK3A 2Y4IC 4U0IA 3SDJA 3MIAA 2V62A 3H30A 3P7BA 5H3QA 1Q8WA 3WZDA 4IX4A 4PMTA 4AWIA 5CSPA 4PMSA 2WQOA 3BV2A 4B99A 1WBPA 4O7WA 3SGCA 2YJSA 2Y7JA 4FNYA 4LRKA 4RT7A 4TYJA 3AOXA 5E7RA 3QUEA 4IM2A 2VTOA 3Q5ZA 2CN5A 3UVPA 3C0HA 1MQBA 3QAME 5KE0A 4XH6A 4DCEA 5LOHA 3L9NA 3V51A 3UVQA 4EOJA 3DKCA 4BN1A 4DTAA 2UZNA 2XJ1A 5CEKA 4XEYA 2Y6OA 2X0GA 4W4XA 4DN5A 3RK7A 5JKGA 3SQQA 5IDPA 4IANA 2B55A 4RIOA 1W83A 3CY3A 5AV1A 3KK9A 4CFWA 5IU2A 1QPJA 4DTKA 4IAYA 4BCQA 1Q4LA 4IDTA 4RIWA 5E8UA 2VTHA 3ENHA 4A07A 4XYFA 5CU2A 1Q3WA 3QD3A 4FZFB 1J3HA 2BZJA 5ANEA 3OZ6A 4EWHA 2ITZA 3TACA 1M2PA 2XIYA 4RJ7A 4F6SA 1H07A 3C4ZA 4ZTMA 3EFKA 2HY0A 2RFDA 4FL2A 3I81A 2XKCA 5GZ8A 1V0BA 3V3VA 3UVRA 2VWWA 4U45A 1J7IA 3FJQE 4J8MA 2BDFA 5HICA 1PYEA 1E1XA 3V5JA 5J5TA 2ONLC 2R3LA 3I7CA 4LI5A 4H1MA 2IG7A 4I6FA 4EZ3A 4FKIA 3W18A 2WKMA 4XBUA 4I92A 3ACKA 3DCVA 2W1GA 2WTCA 3LHJA 4D1ZA 2VO6A 4IAAA 4ZP5A 3CGFA 2ZJWA 1WVWA 4KAOA 4BHZA 5A6OA 3TNHA 3QL8A 2C3IB 3K2LA 4ZSAA 4O84A 1JBPE 2WTWA 3MIYA 2YIWA 1JLUE 3RBWA 3SLSA 4L68A 3PY3A 4EYMA 2G9XA 3HMMA 3V8SA 5IMXA 1Q8ZA 1PRYA 5AUTA 4FKPA 1PXIA 2CKQA 3FI3A 5JGAA 2UW9A 5HQ0A 4FMQA 4O7TA 4XV2A 3PJ3A 3CLYA 2W05A 3N51A 2CDZA 3QF9A 4XNEA 5C03A 4D58A 4KIKA 2JC6A 4L52A 1TQIA 3FPQA 2ITYA 5IQEA 4I24A 3C5IA 4K2RA 4PMPA 5KHWA 5LCJA 2OJIA 4XBRA 3G6GA 3PVGA 1FVTA 5M4FA 4L45A 5LWNA 5AR4A 3QQKA 4L9IA 1S9JA 4QNYA 4R3RA 3NNWA 5IISA 3H10A 5J9ZA 2YHVA 1PXOA 4MK0A 3ZO1A 4E4MA 4BCHA 4L6QA 4X3FA 4QTDA 4ASXA 2ZDUA 3A7IA 2FVDA 3HRFA 4YZBA 2UVZA 4FV6A 1JKTA 2C5XA 2R5TA 4OT5A 4RX7A 2RF9A 5CX9A 4I22A 2QURA 4GG7A 3LMIA 3S3IA 4R7IA 2IO6A 4O82A 4BBEA 4FTTA 4ZLYA 4HGTA 4M69B 1H8FA 4DEBA 4FIGA 3O51A 4HZRA 4BCIA 3NRMA 5FD2A 5LVOA 3UG1A 4RZWA 1UU9A 1UWJA 2XK3A 2Z7RA 3LOKA 4UYNA 2OLCA 1WVYA 4KRCA 5AR2A 4BDEA 3FMNA 3NNUA 4NFNA 4CGAA 3R02A 2V0DA 3VWAA 1SZMA 2F9GA 4O0SA 4XLVA 3G0FA 3IECA 3KY2A 4I6BA 4BIDA 4FTUA 2HW7A 3U55A 3UYTA 2C3KA 3UO4A 4D28A 4IW0A 5EDPA 2WZJA 3LPBA 3PWYA 4NIFA 2YABA 4C34A 1R78A 3NYVA 1K3AA 5EHOA 1KE8A
chains in the Genus database with same CATH superfamily
2OW3A 4YBJA 3NAXA 4AW2A 3HUBA 2J7TA 3ZFYA 3REPA 4AGCA 4YUQA 3UDZA 4RJ8A 2X7GA 1M2RA 2VNWA 3E88A 3KKVA 4IM0A 2NPQA 3RWPA 2Q83A 4PUZA 3AC8A 4FTCA 3F2NA 3WE4A 4PPCA 3UP7A 2XIXA 4QMZA 4Q9ZA 5C27A 1TKIA 4XX9A 4LV8A 2ZOQA 3RPVA 4GJ3A 4AA5A 3EZVA 3QA0A 4FV0A 3UDTA 5FM3A 2VWYA 4TWPA 1LP4A 2PVHA 3QX2A 4X2NA 5AA8A 1KE6A 4TRLA 3F3ZA 4CFFA 3RPOA 2WTIA 5E8ZA 4GKHA 4ALVA 3VO3A 4BICA 2OGVA 4USFA 4F0FA 3D4QA 2E9UA 2R3KA 5IA4A 3ATSA 5K4JA 2X4ZA 5M06A 5DI1A 2R0UA 3NAYA 4WA9A 5HBJA 4LUDA 4II5A 2X8IA 1Q62A 3R73A 4NCTA 3ZLYA 5M4IA 3MPTA 3PRIA 4F0IA 3RP9A 4D2TA 3OC1A 2CMWA 2VWZA 4YHFA 3BGZA 5KHXA 1KV1A 2R64A 2YDKA 5I9WA 3HKOA 3L9LA 1JQHA 2WMWA 2GNGA 4FSQA 4O2ZA 1NVQA 4RA5A 4U3YA 4LOPA 3W0NA 3WZEA 2YAKA 3DT1A 5DA3A 3IKAA 3NDMA 1OL6A 4YPSA 3OXTA 4M7IA 1CKJA 2FSOX 2X6DA 4MCVA 1ATPE 5IDNA 4FICA 3BWJA 1SNXA 1ZLTA 5DN3A 4WD5A 4UN0C 4O81A 2QOKA 2BFXA 2VWUA 5HO8A 1ZOHA 3H0YA 4DH1A 3I1AA 2XALA 1ZYJA 4GFGA 2BCJA 1OBGA 5EKOA 4MXZA 5A9UA 4EUTA 5B2KA 2HOGA 4CMTA 2VTJA 4QT1A 4YO4A 3PIYA 3W2SA 1BL7A 2XNEA 5CU3A 4DYMA 3QRIA 3VONA 4IFGA 4NJDA 4YJQA 3V8TA 1M7QA 4FZDB 4W4YA 4AUAA 3E8NA 1VYWA 3Q9XA 4HYIA 2BZHB 5AIKA 3ZUUA 3MA3A 4FTMA 3VS1A 4RZVA 4O0VA 4WIHA 3NMUF 2VD5A 3SD0A 2OJFE 3BLRA 4M67A 3VRYA 2DWBA 1YHWA 1B38A 4RPVA 3GCVA 2H6DA 4PL4A 2UW8A 2XB7A 4O7SA 3OP5A 3QQJA 4PY1A 4OTFA 5J7BA 1Q99A 1ZYDA 2X8DA 4NK9A 1CMKE 1PHKA 4FSUA 3TUDA 2CNUA 4PPAA 5HLNA 3TNQB 4ANSA 5A54A 1O9UA 4BCOA 5KMNA 4YJVA 3C13A 4RJ6A 4J52A 4AW5A 2GDOA 2OH4A 3DK7A 4CCBA 3A7JA 4XG7A 3TIZA 4Q9SA 2OZOA 2RFEA 4XRJA 2YJRA 2I40A 5BVWA 2PZ5A 4EOLA 2XNMA 3AC2A 3FC2A 4S2ZA 2KTYA 4ZLOA 4BCJA 3ZU7A 3A7GA 4U3ZA 4E6AA 4B8MA 4M84A 3F5PA 3ZDIA 5HTBA 4QMUA 5AUXA 2GTMA 3LXNA 2JAVA 3QCSA 4DFUA 4JXFA 1S9IA 3QQUA 4DHFA 2B4SB 1NVSA 2VU3A 3NYNA 4G6OA 4TNBA 4TNDA 3DXNA 3KC3A 4CFUA 2PVLA 5EOLA 4D4SA 4LDTA 4H3PA 4RRVA 4FG8A 3AD4A 4OW8A 4QMWA 4XMOA 4G3GA 3HEGA 3KVWA 4K9YA 4NH1A 4WNKA 5E9EA 1XHAA 3IW6A 2OWBA 3QU0A 5J79A 1PKDA 2RSVA 3KN6A 2XAOA 3AT3A 1XO2B 4C33A 3NUNA 3CKXA 3RKBA 2A27A 3ODZX 3SOCA 4HGEA 4CTCA 4DTBA 3TTIA 2J0JA 3BEAA 4CFVA 4D0WA 4KABA 2QOBA 3IOKA 4FSNA 1J1BA 5DNRA 5BUIA 2H34A 1G5SA 2OXXA 3Q6WA 3QUPA 5D12A 4FSWA 4ERKA 5L2WA 3V01A 3EFWA 3QXPA 3UGCA 4O0TA 4O38A 4G9CA 1XMLA 4FK6A 4O7YA 2AUHA 1GOLA 3AD6A 1UU3A 2PZIA 3R1NA 1V1KA 1PW2A 5HG7A 3EMGA 3B2WA 2BILB 2QVSE 2XJ2A 3R7VA 3UP2A 5E8VA 5F1ZA 3OCSA 2C5YA 2QC6A 4UWYA 3CGOA 3GU5A 4JIAA 4RIWB 2W9FB 3OEZA 5E1EA 3DNDA 3GCSA 5T3QA 4O7RA 5KBRA 3L9MA 1FVRA 1RDQE 4ITIA 4JG8A 4L46A 4AW1A 4C4GA 5M57A 5EQYA 3NUAA 2W5HA 4AXFA 2WQNA 1SVGA 2BAQA 3KMWA 2RFSA 4IZ5A 2QG7A 2ZB0A 3EQBA 2PK9A 4J7BA 5AV4A 4UX9A 4XCUA 1BI8A 4QMQA 4QEBA 5BVDA 3KA0A 4AZVA 1Q8YA 1FVVA 1YI4A 2GS7A 3MSSA 3FKNA 5LQFA 3AKKA 4BTJA 3EN6A 4S31A 3F3WA 3CBLA 3L9PA 2CSNA 4JNWA 3EQFA 2YCFA 4CQEA 3RTPA 4K8AA 4PMMA 3ORTA 3N4VA 2PY3A 3ZRMA 3FLSA 2FSTX 4FEQA 3PJ2A 4ASDA 1H24A 4KBKA 3S4QA 5LCKA 5CENA 2BRGA 4C7TA 3TT0A 3OWKA 4YR8A 4FSYA 3HP2A 4FVPA 3G90X 3LFFA 4MBIA 2Z7SA 3IO7A 1KE9A 4MF0A 1CSNA 3S1HA 2B9JA 3IW8A 2J5FA 3QRTA 5AR7A 3OBJA 3U4UA 2G15A 3C50A 3P79A 3B8RA 4PTCA 5D7AA 2KULA 4GK2A 5DFPA 3RM6A 5CAQA 4D9UA 3DJ5A 4R3PA 3BYUA 3R8VA 3CPBA 4EBWA 4G5JA 4FIEA 4FV8A 3F7ZA 4A4OA 4NU1A 4J98A 4BKYA 3MBLA 1ERKA 3AGMA 4KIKB 1WVXA 3C4XA 4FTJA 3IOPA 4G5PA 3DAJA 3NYOA 3R63A 4DFNA 3Q52A 2WMXA 4DH3A 4EQMA 5FTGA 5M09A 1UNGA 3QBNA 3QHRA 4MF1A 3R9DA 3EKKA 1OI9A 4Y72A 3UOJA 1YWVA 2OO8X 2WELA 4MVFA 3VUIA 1Y8YA 3JY9A 4EOQA 5HBHA 3QRKA 4P90A 5HNGA 4GT4A 1GZOA 3N4TA 4X3FB 3MPMA 3NYXA 2QR8A 3R9OA 3P7AA 4HCVA 5JFXA 2YM7A 2JKOA 2A19B 2UZEA 2UW3A 2ETKA 4BDFA 3PJ1A 3P1AA 2JDSA 3QC4A 4H05A 3W0SA 2CPKE 4FTAA 4BCFA 4M8TA 3KXZA 4K11A 4IIRA 3KK8A 3DGKA 5CSXA 5LVPA 2UW4A 2JBPA 3UIMA 5KZIA 1BUHA 3RM7A 3A99A 3BE9A 3VS2A 5BQ0A 2H8HA 3OMVA 4EHGA 3A8WA 5L8JA 1OB3A 4AX8A 1EH4A 3PJCA 4O4BB 5IUGA 2BROA 4ERWA 5IZFA 5ETAA 3QUDA 2W1FA 4DH7A 3C4EA 2IN6A 2QONA 4S34A 5IF1A 3W0QA 3OTVA 4IX6A 2B9FA 4F4PA 2FA2A 3NSZA 5EHYA 4MNFA 1YXVA 4BDJA 4AZTA 4X2FA 4C62A 3HA8A 2ITXA 5B0XA 3ZSGA 3CIKA 1L3RE 3GC0A 3G5DA 1SNUA 4M0YA 4NIFB 4QPSA 4JDIA 3TTJA 3FZTA 5L2TA 3TNWA 5FXQA 2C0TA 4L67A 5M53A 2G1TA 1B39A 5GZ9A 2Y9QA 5DRBA 4CG8A 5K0XA 4O6LA 3UBDA 3CS9A 5JFVA 4GJ2A 3UIXA 1URCA 2E9OA 2PMOX 4KWPA 2GQRA 3M11A 3R9HA 3R8MA 2BPMA 2E9PA 4EQCA 2RG5A 3UIBA 3GP0A 5A4EA 1XH5A 2YM5A 5EFQA 3AMBA 5HNBA 4CMUA 1ZOEA 2C68A 1O6YA 3DQXA 5IPJA 1AD5A 5EHLA 2QOFA 5AV0A 4AW0A 3IW4A 3RK5A 1V0PA 5FEDA 3RVGA 4YC8A 2ITOA 3S95A 4CT1A 2WQMA 3LFBA 3VNTA 1XH8A 3OW4A 4PDSA 4DFYA 3QKMA 3VUMA 2UZWE 3WF9A 4ZTSA 4ZZMA 1IRKA 2UVXA 4RC4A 3AGLA 1JKLA 3K3IA 2BRMA 1ZY5A 4RJ4A 2ZV2A 5HO6A 2J0LA 4ZLZA 5BYYA 2PZYA 5EYDA 4RJ3A 3TZ7A 4UMQA 3PE2A 1JPAA 2P33A 3R71A 1LPUA 2R3NA 4EL9A 2VO0A 2W5BA 3POZA 4OT6A 2JITA 4NSTA 2QODA 4GIIA 4EORA 3OOGA 2C30A 2R3QA 5EI2A 5AM6A 4BTMA 3LMGA 4DEHA 3KRRA 4KB8A 3LCKA 4NM3A 4UZDA 1QPDA 2WMAA 4LL5A 2ITTA 4QMLA 2PVFA 3KRJA 3BU5A 3A8XA 3CXWA 4UZHA 3MY5A 2V7OA 4YBKA 3QALE 4O1OA 3P0MA 1H1QA 3AC4A 4EK4A 1JWHA 4IBMA 3PWDA 1TQMA 5C1QB 2W1HA 5FLFA 5JRSA 4BVUA 5G6VA 3I6UA 3LFNA 4FVQA 4JS8A 4BCNA 4H36A 2YAAA 3RHXA 1YKRA 2CGWA 2BTRA 4R3CA 3LIJA 3LFQA 5TOZA 3ZYAA 4ZTRA 2W9ZB 3UO6A 4RWIA 5AX3A 2PSQA 3E7VA 3P4KA 4XLIA 4FTKA 3QTRA 2HXQA 3EL8A 1H0WA 3L8PA 3F9NA 3PE1A 2I0EA 3GFWA 3KMMA 2VX0A 4M15A 4BTKA 2G2FA 4E4XA 4Y83A 4PL5A 3SXSA 5CEOA 3FYKX 1CDKA 4IX5A 1W82A 3I79A 2QO9A 2NP8A 3KRXA 3QLGA 2HXLA 4L43A 5JFSA 5EI8A 3BBWA 3T3UA 3R9RA 3CTQA 2AC5A 2VTLA 3RPSA 5L6OA 3E8EA 4TYHA 4GSBA 2A1AB 3C4FA 4UMPA 1JAMA 3R1QA 3ANRA 4M14A 3DAEA 4BI0A 3PFQA 4F08A 4GVAA 5JEBA 3HV5A 2BRNA 3FEGA 4JBQA 4JRVA 3VULA 4USEA 5M08A 1KWPA 1URWA 5LXMA 4F9YA 3EIDA 1GZKA 5FP6A 3G9LX 4FTNA 1IR3A 4WOVA 4Y73A 3IONA 3TNPC 4GFOA 2VRXA 3MY0A 4BRXA 5A4CA 3D7TA 5FXRA 4BDDA 2XARA 3LXLA 3N9XA 4DDIA 3CTJA 2R3IA 3D83A 4DH5A 4DA5A 1TVOA 4HYHA 4N6ZA 1IAJA 4RWKA 4TXCA 2IVUA 2IW8A 4FV5A 3TMOA 2X0OA 2QD9A 3FWQA 3WARA 1UU7A 3GCUA 3HZTA 1APME 2C5NA 4HVSA 1H25A 2X2KA 4D2VA 5E8SA 2QI8A 4DFLA 3HL7A 4JG7A 3SKCA 2HZ0A 3QD2B 1ZY4A 4GT5A 4P4CA 5IEVA 2AYPA 1U5RA 2J5EA 2JBOA 4GW8A 5I0BA 3BCEA 3KXHA 5J87A 3UDSA 3TZ8A 4WG3A 2YCQA 4YZDA 1OKWA 2ZV7A 5DLSA 4YLJA 4AE6A 2XK8A 5HORA 5HO7A 3FLWA 3QTZA 4RVTA 3FL5A 3W55A 2F57A 5CALA 1UV5A 2HELA 2NRUA 2PVYA 2P2HA 3DK6A 3ALNA 1FGIA 3ZHPC 5HU9A 1P4OA 1YQJA 3AT4A 3BE2A 5I4NA 1W0XC 2BKZA 4I0RA 4WG5A 1H28A 1FMOE 2HENA 2JIUA 4ZOGA 5HLWA 3PY0A 1PF8A 2GPHA 2UZDA 1BX6A 2PUPA 4FA2A 2PULA 3LFSA 3MVMA 3FXZA 5JRQA 2XF0A 4OBPA 4PWNA 4BGHA 4O22A 1YXTA 4KRDA 4ALWA 2WTDA 4ZY4A 4IH8A 4ZS4A 2OKRA 4XP2A 2P2IA 2OZAA 4QP1A 2GNJA 4WUAA 5IH6A 5D41A 4DGGA 4F70A 4O83A 3EQCA 4RG0A 4ITHA 4BKZA 2FYSA 3U6JA 4LV7A 4TT7A 4I5MA 4N6YA 3HAMA 2VX1A 3E64A 4DT9A 3R8LA 1H01A 2R7BA 3KXMA 5T68A 3QRJA 4MAOA 4R1VA 1MRYA 3OY1A 3U8WA 3AMYA 5CF8A 4R78A 3A2CA 5IQGA 5K9IA 3PYYA 3ML1A 4FIJA 4Z7HA 3VS3A 4QO9A 2WD1A 5CEIA 3Q53A 2O0UA 4PQNA 3UQGA 1OL1A 4DFBA 4YP8A 1KOAA 3H0ZA 4OR5A 5TO8A 3QWJA 3PA4A 2XANA 4CXAA 4OTHA 4Z7GA 4ZJJA 4RC3A 1NT2A 3C51A 3QQGA 2FSLX 5KUPA 2QU5A 2YDJA 5H9BA 2AEGA 3WZKA 5ANDA 3OFMA 1G8AA 5EW9A 5E4HA 3R7YA 5EQEA 1YI6A 1XBAA 2EUFB 2VZ6A 3O96A 3QLFA 3Q9WA 5DH3A 3SG8A 2HWPA 4EYJA 1SVEA 3R1SA 2CNQA 5AAEA 2O2UA 4CCUA 1OUKA 4R7HA 3MI9A 3WZUA 4ASZA 3R28A 5AP1A 2I1MA 4YZMA 4L44A 4WRSA 2UV2A 3LKMA 2XBJA 4C4FA 4M12A 3NNVA 1HCLA 4XP0A 2JDVA 3RINA 4AN3A 3BYVA 3ZC5A 4G3FA 4JX3A 3PSDA 1GAGA 2QKRA 3JUHA 3G2FA 1JSUA 5AM7A 4QYFA 2JDTA 4MKCA 2ACXA 4RIXA 1R3CA 3EHAA 3R83A 4FSMA 1IG1A 3UOHA 4TZRA 4DEEA 5IEXA 5H2UA 4FVRA 3RAIA 3NR9A 4EOMA 3FLQA 4M13A 2JDOA 2JGZA 4BKJA 3PUFC 5ITAA 3LXKA 4JR3A 2EXMA 4FOCA 4MXYA 3ZCLA 4UWBA 1VYZA 2V55A 3QQFA 4OLIA 3E92A 3ZZEA 4XG4A 3EFJA 2XIRA 2XYNA 2XM8A 4IDVA 4RFMA 5DPVA 4GKIA 3MB7A 1YHSA 1H1WA 3CCNA 3PJ8A 2HK5A 3OVVA 3I4BA 4RIYA 1KE5A 4QDVA 1WBTA 4D1SA 4EJNA 1REJA 4R7BA 3GQLA 2J4ZA 2JIVA 2RL5A 4JT3A 3ZS5A 2BAKA 4NM0A 3D94A 4CG9A 3R30A 5JGDA 4EK6A 3KREA 4CV8A 4DEAA 3ZMMA 1DI8A 4TYEA 3D5XA 4XRLA 3D14A 1VJYA 5BVFA 4YPDA 2PWLA 2O8YA 5D1JA 5E92A 3BL7A 4DBXA 3QFVA 1FGKA 4E6QA 3A4PA 3DKGA 4YZ9A 2C5VA 3FKOA 2QR7A 2OXDA 2VWIA 3E8CA 3EFLA 4ZSEA 4FT5A 5FM2A 5AWMA 1U59A 5CY3A 4D2PA 4PNIA 4MWHA 2B53A 2X7FA 3MWUA 4RMZA 4EH2A 2BFYA 3NLBA 4GG5A 4F1MA 5CF5A 3AD5A 3BLHA 5L4QA 3FI8A 3PPJA 3VS5A 3UPZA 2ITUA 3AC3A 3BEGA 2B54A 5HG5A 1YDSE 2QOOA 3BBTB 3MY1A 4BIBA 4C3RA 4J95A 1KSWA 4F1OA 5BX0A 1YXSA 2XAMA 3C5UA 4D4VA 1H27A 1XKKA 1YRPA 4KIPA 3U6HA 4MWIA 5BVKA 2P3GX 4G2FA 4IZYA 4ORKA 1PYXA 5ANJA 5LMKA 5M56A 5D10A 1XWSA 2PVKA 4IXPA 1WBNA 4KINA 4ZSLA 1LEZA 2V7AA 2BVAA 5BMMA 4E7WA 2C47A 3HMPA 3ORPA 4C3FA 3V5LA 4V05A 4IWQA 3VRZA 4MXXA 4I3ZA 3OWJA 2WNTA 1A06A 4UALA 2AC3A 3IGGA 3KU2A 4FTRA 4WSQA 4DAWA 1LUFA 3PXFA 3KIOC 2DS1A 4ZMFA 5J5SA 5KX8A 3TKUA 5CASA 2QU6A 2WB8A 3H3CA 4GUEA 2IWIA 4I5PA 5CNNA 4CTBA 3DDQA 1IA8A 2ERZE 3EWHA 3LCDA 4KKEA 1OGYA 4DGNA 5KKRB 1E1VA 2GQSA 3EN7A 4QRCA 2ZM1A 1DI9A 3C4WA 3VC4A 4I4FA 2Z60A 3WF7A 4WKQA 1H1RA 4JL9A 3WF8A 1JKKA 4FEWA 4AAYA 3V5WA 4BGGA 2Z8CA 2YIYA 2EXEA 3BHHA 3MVLA 1YVJA 4ANMA 1OZ1A 4ZSGA 3HDMA 2J90A 4O4EA 4FGRA 5DYJA 1W7HA 2CJMA 2GHLA 3OTUA 4OAUC 4FTOA 2OH0E 4HVDA 5FEEA 2PL0A 5DBXA 3VF8A 5HESA 1HOWA 2ITNA 3RAKA 2WEVA 3TEIA 3D5UA 4MH7A 4OTDA 4FZ7A 3F5GA 5DGZA 3SV0A 4EOPA 3MH1A 4X7QA 2YIRA 3TL8A 3F3VA 2C6OA 4IAIA 4N70A 3FSFA 5CU4A 4S33A 5IA3A 5CQUA 3PIXA 4QP3A 3RWQA 1BYGA 4A9UA 2QOQA 3QTQA 4I20A 4NKAA 3BELA 3BU6A 2W1IA 4TYHB 3TJDA 2XVDA 3GCQA 3OT3A 2VAGA 3ZDUA 4DGOA 5J1WA 5JK3A 2HZ4A 5EW3A 5CTPA 5FGKA 4AXAA 4OTIA 4EZ7A 3DY7A 3LCSA 3COKA 2YZAA 3GC7A 4L7SA 3DNEA 4JRNA 4O0YA 3IQ7A 5AUWA 2ZMDA 5AP6A 1PXLA 4IB3A 3EN5A 1A9UA 2PHKA 3GBZA 1QPEA 4C4IA 4E20A 5JN2A 1OL2A 1DAWA 4V04A 3D9VA 2I6LA 4FV2A 2VO3A 4XV9A 2YM3A 3D7TB 1BLXA 5L8KA 4JLCA 1LEWA 2O64A 3COMA 3G33A 1PXMA 1JVPP 4J8NA 1KV2A 3RNIA 5DOSA 4CLJA 4DEGA 2BAJA 4HNFA 3DZQA 4D2SA 3HV6A 3COIA 5CNOA 4C2WA 2XZSA 4LOOA 4NT4A 3AKJA 2XK4A 5HCZA 2X2MA 3QKKA 2W96B 3QYWA 5IH5A 4UXQA 1IAHA 4CYJA 3JR1A 3WZJA 4IWPA 5KBQA 4RX8A 5L2SA 5AUYA 4X3FC 5FBOA 2B52A 4EC8A 5LMKC 2AQXA 1QCFA 4ZZNA 2XCHA 3VS4A 3NUPA 2HZIA 4IAFA 5GHVA 4WT6A 2W1DA 3R7OA 4LMUA 2YM6A 4I21A 5TR6A 1A48A 3V6SA 3VBQA 1Q8TA 3DDPA 4FGBA 4KS8A 4NEUA 4NJ3A 2PMNX 2R7IA 4FIIA 3TCPA 5L2IA 3DXQA 5IUHA 3O17A 2JEDA 4R5YA 5JGBA 4J1RA 1ND4A 4IZAA 3G0EA 3QHWA 2YERA 4S30A 4ZAUA 2PMLX 1H08A 3HV7A 4HNIA 4OTRA 2YIQA 5ETFA 3W32A 4BDBA 1Y6AA 5HX6A 1OBDA 1Q5KA 3ELJA 5HCXA 2OZAB 3QQHA 3F61A 4BCKA 2I0HA 2WU7A 3DBDA 5M4UA 1G8SA 1Q41A 1H1SA 1WFCA 3CJFA 3EL7A 1AGWA 4HCTA 4QMSA 3RHKA 4DEDA 4H58A 2FUMA 4JIKA 1G8KA 4BDGA 4U41A 4HYSA 3ORLA 4EH6A 3UC3A 2ETRA 1AQ1A 4G3EA 4K0YA 3R8PA 5HVKA 3OCGA 1PXKA 3PXZA 1BI7A 1ZYSA 2W4KA 4QPMA 3FQSA 5A4TA 4XG6A 5HGIA 2IJMA 4X6RA 5DEWA 4B8LA 4A4XA 4ZY5A 1HCKA 1GZNA 3A7HA 2UVYA 3GC9A 4WNMA 5KZ0A 5L6WL 5I9VA 5K4IA 4FKRA 4FKTA 4BFMA 2XCKA 3MV5A 4FKGA 5FTQA 1B6CB 2XK7A 3BIZA 4QMNA 5H8GA 2W7XA 4YC6A 4ANOA 4L3LA 4BIEA 5B2LA 1E9HA 3CP9A 3VUTA 3KGAA 3NX8A 3CQUA 1OVEA 4BYJA 3UC4A 1V0OA 4BDHA 2X81A 4FBXA 4AS0A 3KXXA 3BYMA 4MBLA 3SOAA 5IEYA 4NW6A 4AN9A 5EYKA 2PU8A 3UMXA 3JY0A 1L8TA 3LLAA 3CC6A 5CU6A 2YISA 3OOMA 3OXIA 5M55A 1JOWB 3TV4A 1FINA 3ZTXA 2YZLA 4CFMA 1PXPA 4FL3A 1OITA 1I09A 4NCTC 5AJQA 1CKIA 4O7LA 5HU3A 3P9JA 3SAYA 3K5VA 2OJGA 3KFAA 3Q4CA 5HVYA 5A4QA 5DEYA 5IA5A 3QTIA 3GOPA 4EI4A 3DOGA 5A14A 2B7AA 4RX9A 3FI2A 3FY2A 4FEVA 3HAVA 5ETIA 2GCDA 3ALOA 1ZXEA 3BRBA 3DQWA 4RIXB 1ZRZA 2Z2WA 1ZMWA 4ZZOA 3D0EA 2OBJA 2CHLA 3EYHA 4JDHA 1RW8A 4ANBA 3QQLA 3GQIA 1PMUA 4CKRA 2GQGA 4QMVA 4IVDA 3P78A 1PKGA 4WNPA 1WMKA 3EQGA 5EDRA 4F1TA 5AR3A 2EXCX 3A60A 2WTKB 3S00A 2W4JA 2JAMA 3R0TA 4HZSA 3M1SA 3UZPA 5AA9A 3MA6A 4BWPA 2CKPA 2QOLA 4MNEB 5DG5A 1GY3A 3P86A 4RIYB 2XBAA 3HV3A 1U4DA 4XG2A 3PIZA 5HTCA 4L8MA 5IQCA 4EONA 2QHNA 2V22A 5EYMA 3UDBA 4F0GA 4Q5EA 1FPUA 3BHYA 2XJ0A 2WMVA 4AA4A 2ITPA 4ANNA 4KIQA 4RQVA 3QTWA 3HX4A 5LARA 5LVNA 5TE0A 4KUJA 2HWOA 3ENMA 4DDGA 1P4FA 5M07A 5A6NA 2QQ7A 1Q97A 2OIQA 3D7ZA 4YNOA 3O7LD 4J96A 3VIDA 4B9DA 1UVRA 4FNXA 5D9HA 4IEBA 2YFXA 3AXWA 5K5XA 1WCCA 4E1ZA 5AP4A 4EK3A 3UZRA 5M51A 1OMWA 1XH9A 2C3LA 3Q04A 5I3OA 5BNJA 2REIA 2CGVA 2IW6A 3ET7A 5AP3A 3ZRKA 2JFMA 4YNEA 2IW9A 4YJUA 1TFFA 3BI6A 3CY2A 3D2KA 2Y0AA 3W16A 3UNZA 3ID6C 3TUBA 4G17A 4RVMA 4IADA 3VVHA 4GFMA 4QMYA 4QP8A 2Y4PA 3ORMA 4FKVA 3B8QA 4O4CA 2VWBA 1JSTA 4J99A 5DIAA 4TW9A 2OF4A 4ACDA 5C26A 2QOHA 3DBEA 3O7LB 4IM3A 4ASEA 4U44A 2ZDTA 3ZO2A 2XS0A 4APCA 4NYEA 2XK6A 1OECA 4F99A 4N4SA 3JS2A 3IW5A 4FV4A 4ACCA 2YCSA 3JYAA 4FV7A 4WNOA 4C0TA 4FZAB 4E5BA 3D5VA 3WIKA 5KMOA 4FODA 2LGCA 2C5OA 2E9VA 3PVWA 2WO6A 3VBVA 2R4BA 3GFEA 4BDCA 4OTPA 4C38A 4AOTA 2X8EA 3C7QA 1DAYA 4O6EA 4PTGA 3RJCA 2OU7A 2YIXA 4FT0A 4JDKA 4R5SA 2OIBA 3FAAA 3PVBA 3LQ3A 3F88A 3QD4A 5ANGA 4E26A 1ZMUA 2WMBA 2ERKA 4CFNA 4JDJA 2RGPA 4FKUA 3QTXA 4M68A 5CI7A 2C0OA 4NM7A 4W8DA 1WBWA 5KMIA 5AP0A 5HEZA 4RQKA 3BGPA 4GYIA 5AP2A 5EH0A 4NTTA 3E62A 4UXLA 4YGAA 5C9CA 3TUCA 4AGUA 4BWXA 3W1FA 1O6LA 4FT3A 1F3MC 5KNJA 1OKYA 2W99B 1WBVA 1OKZA 2GU8A 4F9AA 2C6KA 1G3NA 5J95A 4CFXA 3S2PA 4U42A 3FMEA 3MFTA 3HUCA 3FBVA 3JVSA 4ZK5A 3R7GA 5DT3A 2X4FA 4FUXA 4P5ZA 4EQUA 3F5XA 3CEKA 4A9RA 2DQ7X 2ZYBA 3MTFA 5AIRA 3E93A 4KBCA 1UNLA 1Y91A 5CAUA 4WUNA 5FWKK 3MESA 2PE0A 4PTEA 4U97A 3FMDA 4AT4A 3V5TA 3W0PA 3FV8A 4EOOA 1Y8GA 3DFCB 4YTIA 3RZFA 1J1CA 4FC0A 3FXWA 5EG3A 2EB2A 2CCHA 4MEDA 1BL6A 2VX3A 1PXNA 2P55A 5LMBA 4GUBA 3ZXTA 2ZV8A 4EOIA 4ACMA 2HW6A 3KXGA 4KSQA 5AX9A 1NW1A 1XJDA 4ARKA 4ZJVA 3QA8A 5I9YA 4YJNA 5ETCA 5E90A 4XOYA 3R00A 5BV3A 2RG6A 2B1PA 1H26A 3FZRA 3W8QA 1H1PA 1XH4A 3BHVA 4EH9A 5CAOA 3F2RA 2PUIA 1Q61A 3CTHA 3R8UA 3LCTA 3PG1A 3MH3A 3CD3A 2QOCA 3T3VA 3UNJA 1J7UA 4O7VA 4HVHA 3KULA 5IA1A 4XUFA 2ZV9A 3NUUA 3PPZA 2PVMA 4HW7A 4F7LA 4X6QC 5IQAA 2BHEA 4IHPA 1OKVA 1Z9XA 2QO2A 4RBLA 2VTMA 4FKWA 4QP4A 4A06A 4ZEGA 1U46A 3Q9YA 2WTJA 3KL8A