2FB8A

Structure of the b-raf kinase domain bound to sb-590885
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
272
structure length
259
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords B-Raf proto-oncogene serine/threonine-protein kinase
publication title Demonstration of a genetic therapeutic index for tumors expressing oncogenic BRAF by the kinase inhibitor SB-590885.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 259
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2fb8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2fb8A01
4IE9A 4OTQA 4RQKA 3QRTA 5L6OA 3R9NA 4HW7A 3UC3A 4DN5A 3R2YA 5F1ZA 3N9XA 1XH6A 2O63A 5HOAA 2YWPA 3PSBA 1YXUA 2OGVA 3PJ8A 4ZY5A 5HKMA 4NK9A 5FBNC 4BTJA 4DFNA 5CF6A 5CXZA 4L68A 2QR8A 4W4YA 2WO6A 4M13A 5LCJA 3DBDA 4FSNA 4XV9A 4BTKA 5LMKA 4V04A 4WG5A 3L9PA 4IVCA 4TYIA 3LMHA 4RX7A 4MXCA 3K54A 5F94A 1CMKE 5AV1A 5EKOA 3PDTA 1H08A 3Q4CA 3KKVA 5J1VA 4X3FC 4B8LA 3EFKA 3JPVA 1H8FA 4NU1A 4Y72A 1IR3A 3BZ3A 4K8AA 3WZDA 4CZTA 2QOFA 3ANQA 1U54A 5ACKA 3MTLA 2VWVA 3F5UA 3ETAA 4Z9LA 1DI9A 5J5SA 3FKOA 2WTDA 3F69A 1H00A 2WTCA 2CGUA 3VS4A 4DEDA 2HW6A 4PTEA 4QTEA 3KULA 5KMKA 2BRGA 3MV5A 4D5KA 5BMSA 3RK7A 3W2OA 3P7AA 4XH6A 5KZIA 1ZLTA 2VTQA 4IW0A 4C37A 2ZYBA 4JXFA 2EB2A 4E6AA 4RX5A 1KV1A 5DT0A 3CCNA 2JKKA 2BDWA 4XP2A 4DC2A 4U8ZA 2HZNA 3O8PA 4YSMA 5AWMA 3WF8A 4F0FA 3OBJA 4F4PA 3L1SA 5LVPA 3QU0A 3D5XA 2OIBA 2QI8A 3C4WA 3KN6A 1MRYA 4I6BA 4XS2A 1OB3A 3EQHA 5AR3A 2VTIA 3QKMA 4DLIA 5AADA 4NM7A 4QP8A 2EVAA 2YIQA 4NM5A 5CVGA 3S95A 4OAVB 3N4UA 4DT8A 2W17A 3NS9A 4KUJA 2X7FA 2X7OA 2IVVA 2YACA 4HJOA 4YTHA 3ZXZA 3C5UA 3A7JA 1YWNA 4EH9A 5AUVA 2OZAB 4PUZA 4RX8A 4HVDA 2XEYA 3KK9A 4EK6A 2FUMA 3UE4A 4BZOA 2X1NA 3COIA 4GVJA 4QO9A 4WHZA 3NUAA 2JIVA 3MESA 5I4NA 2B0QA 4EKLA 4ANSA 3RPYA 1REJA 1OKVA 5I9UA 3MH3A 4O86A 3ZU7A 4EOOA 5FEEA 1W84A 4FV0A 4L9IA 5CSWA 3RVGA 5AUTA 3EHAA 3WF7A 3SGCA 1SYKA 2WTWA 3VC4A 4AZVA 4FV5A 4ZLOA 2A1AB 4YTIA 4YZMA 1PXPA 4PTCA 4EORA 4YO6A 3QTQA 2V0DA 3EQCA 2BCJA 4FV9A 3NNXA 3DT1A 2BVAA 3DZQA 3PYYA 3EZRA 3QD2B 3G9LX 3F88A 1PY5A 3BYVA 4FOBA 3F9NA 4O0XA 2QOBA 3OXZA 4ANMA 3QTRA 3RPOA 3UVQA 3DNEA 5A46A 3POZA 3ZTXA 4DGNA 3RM6A 4QTDA 3QTXA 1WBOA 4G6OA 4KD1A 4DH3A 4N4SA 2QHNA 3QQFA 2UZNA 2EXMA 2VU3A 5EK7A 3PG1A 3ACJA 2G9XA 3C9WA 2Y6OA 3UYTA 2VTJA 4ALWA 2XNNA 5AFVA 3WF6A 3IW4A 2R7IA 4GVAA 4F7JA 4K33A 3BU6A 4OTWA 1Y6BA 4M14A 4FTOA 1XQZA 3ALNA 3R1QA 3LAUA 4OTIA 3K5VA 2UVXA 4YLLA 4E5AX 1O6YA 2OFUA 2PUUA 2WIPA 3CKWA 5E4HA 4HYUA 3FHRA 4AW1A 2JAVA 3KCKA 1V0OA 3EFWA 4FL1A 5JRSA 1V0BA 4L3JA 4MD9E 1NA7A 1DI8A 4M67A 4AFJA 3VUHA 2YIWA 5HVYA 2B9HA 2JKOA 3DQXA 3PPKA 4I41A 1SMHA 3Q96A 4MQ2A 2BHHA 3VBXA 1XBCA 3VQHA 5B2MA 3V5QA 4PDPA 3S1HA 1A9UA 2CHLA 4FSWA 1XO2B 3OFMA 5I3OA 4NCTA 1TKIA 4TYGA 3T3VA 5JEBA 5DEYA 2ZV7A 4WKQA 4GT5A 4XP0A 3H4JA 2CNUA 5CAUA 3VW6A 2OKRA 3I6WA 3Q4ZA 3LCOA 4IVDA 1QPJA 1IA9A 4E93A 2C3IB 5EDRA 4J7BA 2P33A 3MJ1A 4IM3A 3SVVA 3U51A 4S2ZA 5JMSA 2JLDA 2OBJA 4QP4A 4E5BA 1R78A 3LKMA 3NNUA 3QUEA 2Z02A 4AZEA 2FVDA 4BBMA 1WZYA 1M7NA 4DEEA 3H3CA 4G3GA 4A4OA 2NPQA 3WZUA 3UGCA 4EL9A 4DH1A 2V7AA 2C5NA 4X2NA 4AACA 3JR1A 3BHVA 4UMTA 3EQIA 5GHVA 3HA8A 1ZWSA 3L8PA 3QC4A 4IIRA 4PF4A 2F9GA 4BCOA 1YXXA 1H4LA 4L7FA 3EKKA 4JQEA 1YHWA 4LV5A 4P2KA 1HOWA 4PP9A 3ZYAA 2R3PA 4KIKB 5AV4A 2C0TA 3TKIA 2JGZA 4FZAB 4ENYA 1M52A 3MVHA 3G51A 4TZRA 3UPZA 5KHXA 3FLWA 4MNEB 5I9YA 1H0VA 3CC6A 2UW3A 5JZJA 1B39A 4JG6A 2UUEA 2X0GA 2BRNA 3Q52A 4O0YA 5AV3A 2LGCA 4IDVA 4JQ7A 3CEKA 4QPSA 2GU8A 4XJ0A 3GT8A 5IISA 5AR5A 4EH5A 2CGWA 2PZIA 3BEGA 3PZEA 5J9YA 3QCYA 2WMQA 5E90A 5HESA 4H1MA 3QBNA 2FSMX 2VWUA 3HV7A 4C4FA 3O8UA 4HYIA 4NKSA 2WMUA 3HGKA 5A54A 5GNKA 4PL5A 4BYIA 5A6NA 1BL7A 2W96B 4MHAA 5T6KA 3K2LA 4QT1A 4BHZA 2EUFB 4OTFA 5KE0A 3CP9A 4WNOA 2ITUA 4WUNA 4NFNA 2YERA 3HMOA 4DFYA 3PVGA 3E8DA 2P3GX 1AD5A 3O50A 3Q6WA 4EH2A 3BELA 2H34A 5H8GA 1H25A 3SRVA 4EHEA 4DFXE 5DT4A 2PHKA 5AR4A 4EUTA 4C62A 4EYMA 3N4VA 3I5NA 4I22A 1REKA 2RSVA 4O38A 4XBUA 1Z57A 4O91A 4TW9A 2Y4IB 4YJRA 3IDPA 1Q8YA 2CSNA 3PA4A 4QMSA 4C36A 2W1HA 4G6NA 4G3FA 3B2TA 4PY1A 3RNIA 1LUFA 2X7GA 1GZOA 3K3JA 1PXLA 2W06A 2BROA 4KKGA 4O81A 3CLYA 4BCMA 2WB8A 4AX8A 3DFAA 4AE9A 3TKHA 2ZVAA 3DAKA 2HXLA 4BVUA 4R7HA 3AGMA 3FAAA 3P5KA 2R7BA 2UW9A 4Y83A 2XBAA 4C59A 5M4UA 4KSPA 3IONA 3F2AA 3KQ7A 3GCVA 3QWKA 5JN2A 3Q9WA 3CJFA 4QD6A 4C57A 1E1XA 2W4JA 5EKNA 1OL6A 3KN5A 2PVHA 4QMMA 4ZSJA 3EQRA 4F6SA 5M55A 4RWIA 3VF8A 3TM0A 5A4TA 1GZNA 4JT3A 2WTIA 4HPTE 5GZAA 4W4VA 2GHLA 4A06A 5TKDA 5DG5A 3VUTA 1M2QA 1OBDA 2CKEA 1BKXA 4QP6A 3PXRA 5TE0A 2R3LA 1KOBA 3EQBA 4FZDB 4PMMA 3ZLWA 5AM7A 2Z7RA 5AR2A 1UNGA 3JS2A 1H01A 1MQBA 4J71A 5DVRA 1SVEA 1QCFA 4TKSA 2QR7A 3SHEA 2UZWE 4RIWB 3QQLA 1JSTA 4L6QA 5IQFA 5C8NA 3ATSA 5D9HA 4A9RA 4EWQA 5DR6A 3R7VA 4ASDA 1SZMA 5A4QA 2BIYA 2R3OA 2VRXA 2GNHA 1PXIA 2W5HA 2WMRA 3UG1A 3ZH8A 1QMZA 3QZFA 2WEIA 2VTOA 1UKIA 2XK3A 3LE6A 3Q5IA 5EM8A 3DFCB 3OOMA 4I3ZA 2YDKA 2QD9A 4JBVA 4BR3A 1OM1A 4GJ3A 2QOLA 2F49A 5AUYA 3PJ1A 1JVPP 4C38A 1J3HA 1NY3A 4UALA 5KUPA 3QLFA 2A2AA 4RJ4A 4PDYA 1OL2A 4HPUE 4NEUA 3RI1A 3LLTA 3PJ3A 3DLSA 4MEDA 2C6EA 3MWUA 1GIJA 4DEIA 4ITJA 4C3PA 4F64A 4BDIA 2ZM1A 3VUKA 5L2QA 4AGCA 2PUNA 4HVIA 3MH2A 3MFUA 3R1YA 3ZUTA 3GU7A 3M1SA 4BWXA 5IA2A 4A4XA 4B99A 4AT5A 3FY0A 3LOKA 3MIYA 3QQJA 3C13A 5E91A 2FSTX 2Y4PA 3S0OA 3GNIB 3GU4A 4FKPA 1BL6A 3ULZA 3QRIA 2O65A 4FV1A 3KXXA 3HRBA 2OG8A 4L00A 3SLSA 4DGMA 4AW5A 2IZRA 3QTIA 4CFXA 4EKKA 4YJSA 5CF5A 4BKZA 3E3BX 4N70A 3VWAA 3TZMA 4TNDA 5E9EA 3AC3A 4IMYA 3MY1A 4GT4A 4MVFA 4U41A 1WMKA 1FOTA 5FTOA 3TWJA 4XG2A 3LJ1A 3FKLA 4MXXA 2B4SB 2DS1A 1IAJA 3KRWA 4DCAA 2YISA 3LZBA 3OF0A 4MD8E 4RJ3A 5CEQA 2ITQA 3FZPA 4H3BA 4GUBA 2YCRA 2C5OA 2VWIA 3DTCA 3FQHA 5J9LA 2PK9A 1GZKA 4QYEA 1Q4LA 2YABA 3C4EA 3P79A 4QMYA 3P9JA 4TL0A 4BI0A 3P23A 4M7IA 5HTCA 4BKJA 4FL3A 4FE2A 2XKFA 4H3PA 2BFXA 2QQ7A 4I0SA 5ANEA 1OKYA 5L4QA 3AT3A 4AOJA 2OF2A 3BHYA 4Q5HA 3ZUVA 3DNDA 4GL9A 4F1TA 4F63A 4FKJA 3GB2A 4DLJA 4CFWA 3DBCA 4CKJA 4BL1A 5CY3A 3NUYA 4QTAA 2PMOX 3D7TA 3QTUA 5DNRA 1T45A 5JGDA 2WMSA 1PXOA 2OI4X 5TT7A 3FPQA 2WGJA 4RIXA 4KS8A 2P55A 1M7QA 4GFMA 3UP7A 3PXYA 4B6LA 3B8RA 4YMJA 4FV4A 1GZ8A 2QOIA 2XIRA 4JDHA 3VS5A 3UOHA 3ZFXA 3NX8A 3R30A 5FQDC 5CEKA 5EH0A 4CLIA 5HE1A 3HV6A 4ACHA 5HVKA 5JQ8A 1Z5MA 4YR8A 4FTNA 3GBZA 4N6ZA 1UNLA 4Z3VA 1OIUA 1T46A 2J2IB 2J0KA 2QODA 4BIBA 4MX9A 4EOMA 5E8VA 2VWXA 3R7UA 2I7QA 1UKHA 4W9XA 4WUAA 4ASEA 3BV2A 4O82A 4G3EA 4E3CA 2OXDA 2C1BA 3I4BA 1AGWA 3FL4A 3AC8A 2UV2A 5HICA 2GS7A 1GAGA 5CTPA 3HAMA 1F3MC 4QOXA 4RVLA 5CEIA 4D2SA 5JK3A 5ETFA 4FNWA 2ONLA 4GUEA 5HU9A 3E64A 4D0XA 2C68A 3IGOA 4J98A 4XV3A 2WMXA 2BFYA 3LPBA 4LM5A 2PUPA 5HO7A 4EH3A 1A06A 5BUIA 4NIFB 3EN5A 4L7SA 2YLEA 4AZFA 5JGBA 4D0WA 4W8EA 3IW5A 5I9WA 1Q99A 2WD1A 3FC1X 3REPA 2ZMDA 3F7WA 2GSFA 3HEGA 3RAIA 4LG4A 2P2HA 4HGSA 3DKCA 3EIDA 5IQAA 4R7IA 3EOCA 4JIKA 5CU4A 5CSPA 3BGZA 4HVHA 5HX8A 4UX9A 3G9NA 5FDPA 1ZOEA 4EOPA 3W10A 1Y6AA 3LFEA 4F7SA 3V5LA 1W0XC 3R9RA 4HNIA 2QO9A 5E8ZA 4DG3E 4DTBA 4E4NA 4DF3A 2WMBA 4AN3A 3UOLA 3LIJA 3PJCA 1G3NA 4R6VA 4I93A 3RBWA 5T68A 2XEZA 4AE6A 4BHNA 3NSZA 4FI1A 4XG8A 3U9NA 5JKGA 2AC5A 3PPJA 4FSQA 5FEQA 1PYEA 1P5EA 3SV0A 3W2SA 1J7IA 2I1MA 5AV0A 1BUHA 5DBXA 2CLXA 5C27A 4ZLZA 3G6HA 2G2IA 5GIOE 4RWLA 2UZTA 2VTTA 3GC9A 4JX7A 2JEDA 1R3CA 2Y9QA 3KEXA 4C4IA 4C4JA 4BGQA 5A9UA 2FA2A 2RGPA 3ZBXA 3D94A 2RFDA 1PF8A 4ANNA 3NAYA 4KIPA 3R1SA 5HHWA 1KWPA 3PXFA 5AP7A 4UBAA 5EI8A 3FZOA 2PVYA 3HX4A 1WVYA 3QZGA 4FOCA 5AUXA 2W1DA 4EH6A 4F99A 4ZMFA 1WBTA 2WELA 4ZOGA 4MWIA 1XH7A 3CQEA 2JBOA 3N51A 4L52A 5CEPA 4IH8A 3OVVA 1KE8A 3F2NA 4J99A 2PY3A 4LRJA 5JRQA 1ZMUA 3OWLA 3MPTA 2DQ7X 4W4XA 4R78A 4XG6A 4DCEA 4EYJA 4Z7GA 5TOZA 2O0UA 3F5PA 3VULA 3UNKA 1OVEA 4TYEA 4FKTA 3MY0A 2A0CX 4AZSA 3GUBA 3OXIA 3WF9A 4EBWA 5JH6A 3MY5A 3W33A 2WEVA 3FYKX 4X2FA 3NCGA 3V01A 2UZDA 1KE5A 3A7IA 3LFSA 5HI2A 1PMEA 3O17A 3Q9XA 4USFA 3EFLA 3NLBA 4D55A 3LQ8A 3ELJA 4DFLA 3OCSA 4YC3A 4DFBA 1XH4A 2J6MA 5IA5A 4ERWA 4JG7A 2UW5A 4BI1A 4F9BA 3LHJA 1M17A 4PWNA 3MVLA 1UVRA 1XHAA 3KMWA 3Q9YA 4WD5A 3RNYA 1QPDA 2GTNA 4TWNA 3SOAA 4IBMA 2X4ZA 4D9UA 4IHPA 2WIHA 5JGAA 5EOLA 4K0YA 1Q8UA 4HVGA 3E92A 3MBLA 5AMNA 3VO3A 2R5TA 3BE9A 3VBYA 5CI6A 5LJJA 3C5IA 2VAGA 4C61A 3MPMA 3WE4A 3DXNA 3V8TA 3MW1A 4JDIA 3DDQA 4IAYA 4A9UA 3SG8A 4I24A 3NEWA 4CLJA 3VHKA 5J7HA 5K5NA 5IDPA 2CGXA 2E9UA 2WPAA 4C0TA 2QHMA 2ITPA 1H1QA 2B55A 1O6LA 2ZDUA 3SW4A 3AD6A 5L2IA 5AX9A 4ANLA 3KVWA 2J5FA 5DHJA 5CQUA 2VNYA 1GIHA 4XNEA 4FTKA 5L6WL 2VD5A 3VRYA 1Q8ZA 4X7QA 4PNKA 3BEAA 4K2RA 4OUCA 5AEPA 1J7LA 5BVEA 3AC2A 3TI1A 4B0GA 3TDWA 2QLUA 1ZZLA 5IA0A 1SM2A 3GQIA 4DGGA 2CLQA 3UJGA 3GU5A 4NJDA 3OZ6A 2BDJA 2YM3A 4S32A 5CEMA 3LCKA 3QXPA 3UZRA 2X2MA 1FINA 4AOIA 4HZRA 4ORKA 4JJRA 3K3IA 2Z2WA 2I0EA 1M2PA 2R3MA 3KK8A 5EFQA 1V0PA 3WARA 2JAMA 4XOYA 3DOGA 3FKNA 3ZO3A 4C3RA 4APPA 3MTFA 1XR1A 5AP5A 4YJOA 3ZHPC 1GJOA 2YAAA 3BYSA 2BHEA 2DUVA 4UXLA 4XP3A 3SOCA 5D10A 4F1OA 5LVMA 3FBVA 5KZ0A 5DOSA 2RG5A 2J4ZA 2V5QA 3FUPA 2PMNX 2OJ9A 4BDEA 4BCQA 4IJ9A 3F5XA 2PPQA 4ZZOA 5EQPA 1G5SA 2EU9A 4EC8A 5DPVA 5ANIA 4ANBA 2PULA 3GENA 4GKIA 4O1PA 3UNJA 4O2ZA 3QTZA 4GRBA 4MQ1A 5E8WA 4OTRA 4FIJA 4F0GA 2J0IA 1K9AA 3L9LA 3UIXA 3HRFA 3PIZA 4O7TA 1PMVA 4IWOA 3T9IA 2UZOA 2W4KA 3UVRA 3EQGA 4I5PA 3ORNA 1IG1A 2G2HA 2PVKA 3JY9A 2IW9A 3FI4A 3PP0A 4DG2E 3MVJA 3FMLA 4O0TA 3D2KA 4ZMEA 2OJFE 5I0BA 3I81A 3QD0A 3BWFA 3R21A 4EQCA 3NYXA 5I9VA 2NRYA 4JR7A 4JL9A 4JS8A 4LOPA 3UG2A 2IVUA 4RFYA 3D9VA 4L3LA 4ACMA 5IMXA 2WAJA 2ETRA 1P2AA 4AW0A 4BF2A 1UWJA 3MA3A 1U4DA 4RIYB 3HP5A 4KRDA 3U55A 2Z7LA 3D15A 3DKFA 2OH0E 4J1RA 4WSQA 1DM2A 5CXHA 4FC0A 4RT7A 1WAKA 2XM8A 3FZTA 4FA2A 5KHWA 1QPEA 3A60A 2V55A 4FTCA 5M44A 2VN9A 4XMOA 5FEDA 4I6FA 5CASA 4E4LA 2RIOA 4CSVA 4TYHB 4B9DA 2ZV9A 3PWYA 2IN6A 4WIHA 4CZYB 1GIIA 4L01A 4GIIA 4M69A 4JBPA 5EQEA 3LM0A 5CU6A 4R5YA 2IJMA 3ORLA 5IUIA 3UVPA 3ZRLA 4RG0A 3F7ZA 3DAJA 3MIAA 3OEZA 2B53A 2C6LA 4NFMA 4RWKA 4X21A 5HO6A 3U8WA 4AT3A 4D4VA 3H0YA 3U6JA 4FK6A 3EB0A 5AA9A 3FZ1A 5EHOA 3ENMA 2IZUA 1FBNA 3L9MA 3WOWA 2YEXA 4X3FB 1NVQA 4HCTA 2V22A 4FSTA 3TEIA 2PYWA 5B7VA 1ZAOA 4O6EA 4AGWA 2HK5A 1OBGA 3A8WA 5FXRA 4CRSA 3AMYA 3PVBA 1J7UA 3QALE 2IWIA 4YHTA 4X6RA 3FXWA 5HIEA 4PL4A 2P0CA 1O6KA 5AV2A 4KBCA 1KSWA 5AAGA 4QMZA 4U42A 3FZRA 4XRLA 1UV5A 3BRBA 2NNWB 3ZMMA 5KKRC 2BIKB 4IB0A 5I3RA 5LVLA 4PPBA 5H3QA 2IW6A 4JQ8A 4Q9SA 3QUDA 4NWMA 4TNBA 1YQJA 4TWOA 3FLYA 3EQDA 3DA6A 3ZO1A 3BKBA 4FKGA 1SVGA 3T9TA 5E8TA 4DYMA 4FIEA 1HCKA 5DRBA 1Q5KA 2W5AA 3ACKA 3NW7A 4FIHA 4YBJA 2YDIA 3TG1A 4FF8A 4C3FA 5M57A 4QP1A 3F3UA 1W82A 4O7LA 4YJQA 2BAJA 2OF4A 2WOTA 4QNYA 2VZ6A 3TNQB 3D14A 1ZYLA 2BPMA 3LFDA 3Q3BA 4ZTHA 4ZJJA 3UP2A 3KGAA 5J79A 1VEBA 2XK8A 4OR5A 4RFMA 4R3RA 5J1WA 1IEPA 2IVTA 4XCUA 4C4EA 4AF3A 2YIRA 4UMRA 5EW3A 4OBOA 3EFJA 4PDOA 2XMYA 4RZVA 4XHKB 1Q62A 3KF4A 4BCGA 4GH2A 3TIYA 4D4RA 4GT3A 2C3KA 3FMEA 3OD6X 5C26A 5H8EA 3IW8A 2R3KA 4YTFA 4LRMA 1XH8A 2ITNA 5AUWA 5HNGA 2PWLA 3TV7A 3GFWA 4FZ7A 1OUKA 2I0HA 3JVSA 4EOSA 3R83A 4H05A 3MS9A 2O8YA 4KNBA 5J7BA 2R3FA 3DY7A 3PLAE 4PTGA 1NVSA 3CQUA 2W9ZB 1JWHA 4GFGA 4D2VA 3W2PA 2JDRA 5K4IA 4KA3A 2E9OA 2RFNA 4FR4A 1U59A 4CVAA 2WMTA 2WMAA 3TIZA 3UQFA 1ZMVA 2R0IA 3NUUA 4JLCA 4YC8A 4MBJA 1YDRE 1MRVA 4FVPA 2W5BA 2PE0A 2ZV8A 1YHSA 3R22A 4DHFA 2X9EA 3QQGA 4RMZA 3UMXA 4C02A 2VO7A 4FT3A 5B2KA 2GNGA 3RK9A 1DAWA 3O2MA 3HP2A 4O1OA 4AQCA 4DFZE 4RIOA 4V0GA 4C2VA 5F4NA 4YJTA 3IS5A 4ZS0A 4I20A 3SXSA 3PVWA 2BKZA 1I09A 2RF9A 3BWJA 3E8CA 1K3AA 5FXQA 2FO0A 3L8VA 3OROA 4ZZMA 4UMUA 4D2TA 2WMVA 2IW8A 3EN6A 4UEUA 4KIOA 3ODYX 4IWDA 3QA0A 2HCKA 3H30A 3QQUA 4TN6A 3OP5A 5FXSA 5L2SA 4BIEA 2WTJA 2VV9A 3A99A 3IG7A 5CSHA 3V51A 4BDJA 1FMOE 4L67A 3FI2A 3PVUA 3E8NA 4ZEGA 2CKOA 1GNGA 5GIPE 2YM6A 1STCE 4P5QA 2Q83A 3H9RA 3KB7A 4FKRA 2H8HA 3EYGA 4O84A 2QOQA 4U7ZA 2PZPA 1PKGA 2FGIA 2JD5A 3O7LB 5KMNA 2IO6A 3BV3A 3JYAA 4YLJA 5ANOA 4A7CA 2Z7SA 3ORXA 3MGYA 2AC3A 4U3YA 4CV9A 3ATTA 1PMUA 3I0OA 3CY3A 5HX6A 2BKKA 4IAIA 5DIAA 4H3QA 3UYSA 2BRHA 5LVOA 3R6XA 3VUGA 1UU3A 2B54A 4X2GA 4CMTA 5IUGA 3WZKA 4LOOA 1UU9A 2BTSA 2FSOX 4ZSAA 3I7BA 3HUBA 2F2UA 1PXJA 1H26A 4ALVA 2JDOA 2J0JA 4JX3A 3R8PA 3C7QA 4NL0A 3WZEA 4FSMA 2QOKA 4L43A 4DH7A 4A07A 4G9CA 3F6XA 4FT0A 4QPAA 3VJNA 1JOWB 3NUNA 4FTIA 2PMLX 3ZDUA 4KSQA 5HCYA 3CPCA 5JFVA 4LGDA 5CT7A 1OITA 1Y57A 4X3JA 2AYPA 2C30A 2PTKA 3FWQA 4RPVA 4CEGA 1ND4A 1ZY4A 2CKQA 3L9NA 3DJ6A 3I1AA 2HZ0A 4QMTA 4BFMA 3SA0A 1NXKA 5DA3A 3A62A 5LWMA 2VTRA 1YHVA 3R7OA 3ORKA 5DEWA 4USDA 3RJCA 1UNHA 1ZMWA 3BBWA 4NH1A 4Z7HA 2B9JA 2R3QA 1IASA 1E9HA 2YFXA 3VS3A 4GYGA 1ZYSA 4EH4A 3PFQA 4KKHA 2XZSA 2XNMA 3AMAA 4E4XA 2GHGA 4ZTNA 1OUYA 3V04A 2IG7A 3KXMA 3PPZA 3Q4TA 4LUEA 5CZHA 4NUSA 3ET7A 1XBAA 2HWOA 3V5TA 4FV8A 3Q2JA 3GEQA 4E8AA 3A8XA 3KFAA 4I6HA 2GQRA 4O21A 4XLIA 3FY2A 5CWZA 3OOGA 5IEVA 4TRLA 2R4BA 3PRIA 4EONA 2UW6A 3QHWA 4FIGA 4WA9A 5TR6A 2CN8A 3UIMA 5BVKA 3NIZA 2X2KA 3ZDIA 2JC6A 1Q24A 3D2IA 4LV8A 2YZLA 1IA8A 1PMNA 3AD5A 2CDZA 1OZ1A 4JDKA 5C03A 5BX0A 3CJGA 3OW3A 4EWHA 3UDBA 4GFOA 4RSSA 4DT9A 2C69A 3DCVA 3O96A 4QQTA 5EYDA 2HELA 4D1XA 4WNPA 4M68A 1TQIA 3R71A 2R3NA 3U6HA 4IX5A 5DH3A 4YNOA 4EZ3A 3AXWA 3MH1A 5HO8A 5J5TA 4O0RA 4ZTLA 3NNWA 4BDGA 1FVVA 2VTMA 3A4PA 4G16A 4OTDA 3TZ9A 2GNFA 1CKJA 2XNPA 5AP4A 5AUUA 3EJ1A 2GNJA 4XYFA 4L45A 3AD4A 3O8TA 4I5CA 3W32A 1F5QA 4G6LA 4NZWB 4U79A 5BVWA 2YM7A 4BCHA 2I0VA 5IQEA 3LQ5A 4ANQA 4UZDA 2F7EE 1CSNA 3AT4A 4KWPA 4XV1A 4CFFA 5EG3A 3TNHA 4LFIA 5IA1A 3EQFA 1U46A 1FGKA 4MD7E 4YP8A 3R7YA 3TKUA 3F5GA 2KULA 5IQGA 5HEZA 2YIYA 3DXPA 4FZ6A 4O7WA 5IQHA 5E8UA 3R9HA 5HTBA 2B9IA 5HORA 5IF1A 2R0UA 4IFGA 4UN0C 5IH6A 2OJIA 3EN4A 4FTAA 3UC4A 2ITXA 4D28A 4S30A 4DEBA 3I5ZA 2G01A 1XWSA 5JFXA 2PVFA 1MUOA 4CKIA 4ZTSA 3V6RA 3VAPA 4BWPA 5IQIA 4PMTA 4IB5A 2YDJA 4UZHA 4WRGA 3ZRKA 3BU3A 4DEAA 1B38A 5LMKC 2JKQA 3IW6A 4N6YA 1E1VA 3FMHA 2XNOA 3GI3A 4NTTA 4UWCA 4XG7A 3GOPA 3ROCA 3RZBA 4KBKA 5LCKA 3VUMA 4QYFA 3P1AA 4LMUA 5HLWA 4LQMA 4HOKA 2QOCA 2XS0A 2CKPA 3OY1A 4EEVA 2W9FB 4YHFA 1ZYDA 3O0GA 1Z9XA 1YOLA 3W8LA 4DG0E 3FE3A 4XRJA 3VVHA 4AOTA 2BZKB 1OIQA 4F1MA 4DGLC 3RPVA 4FSZA 4F65A 4IVBA 3FDNA 4M0ZA 4IZ5A 5CLPA 3V5JA 4XBRA 4M3QA 1JPAA 3SG9A 4O2PA 4QQJA 3NR9A 1RW8A 4APCA 4L42A 1H0WA 4X6QC 4AT4A 4BTFA 3IOPA 2SRCA 4X3FA 2GHMA 4E7WA 1Q3WA 1HCLA 5FDXA 3RAWA 4BCJA 4CKRA 4D1ZA 1MP8A 2WTKC 5D1JA 5M53A 4IANA 5J8IA 3QF9A 5D7AA 4YO4A 2XJ0A 3TACA 2OZAA 2VTAA 3G33A 2ERZE 4HGTA 4CT2A 1B6CB 4IM0A 4M97A 2ZOQA 5K3YA 2UZUE 5IH5A 2IVSA 3CD3A 4GKHA 3UOKA 4G2FA 3GCSA 1URCA 3OS3A 4AU8A 5HD4A 4GSBA 4RJ6A 4FNYA 2Q0NA 4TTHB 5CAQA 4NM3A 3ODZX 5FP6A 4TY1A 4Y85A 3KRJA 5K9IA 4DBXA 1U54B 3OWKA 5AR7A 3NMUF 3RPSA 3VBQA 4O7YA 4F6UA 3GC7A 4OAUC 3AC1A 2I0YA 3HMIA 3VS2A 2VX3A 3ZEPA 1J91A 3R8ZA 4E6DA 2YHVA 3RINA 5BQ0A 1TQPA 4YJVA 5F95A 4P7EA 3VQUA 3KULB 1FVRA 3IK3A 3TUCA 2CCHA 4IACA 3NIEA 2XYUA 3MA6A 4IQ6A 4ZSGA 2YN8A 3NVMB 3P7BA 4G31A 1GOLA 4FTTA 4S33A 3KXNA 2PVRA 1ZZ2A 3SKCA 2XUUA 4Y46A 4XV2A 5HG5A 3LMIA 4EI4A 1ZYCA 2W1CA 2H9VA 2QOHA 3LXKA 2BR1A 2PL0A 4M66A 5DMZA 2NRUA 3D83A 2O5KA 2YJRA 4Q2AA 4IFCA 4W9WA 3UTOA 2Q0BA 4DITA 4CZUA 3G0EA 3PIXA 4U5JA 3D5VA 1JKSA 1Q61A 3HMNA 4G9RA 5D41A 5TF9A 4C34A 3DKGA 1OECA 3OEFX 3BHHA 4Y5HA 4YZCA 2BDFA 2W1FA 1K2PA 4FTLA 5G6VA 4PMPA 5KBRA 4YTCA 1RJBA 2IPXA 3IQ7A 3FMNA 1YKRA 4FIFA 1U5RA 4QYHA 1JSVA 1YI3A 5L8KA 4ZY6A 3BLHA 3PXZA 2V62A 2BALA 1YWRA 2C1AA 2W1EA 3KCFA 3LCDA 3Q60A 4RJ7A 2UVZA 4DGOA 5IUHA 4LL0A 4C35A 4XX9A 3OW4A 4FTRA 3R00A 4H58A 2OLCA 4BN1A 3NVKI 2O2UA 4BKYA 4FNZA 3DQWA 4H36A 3OTUA 4WNKA 4DE4A 2J5EA 5FM2A 2OXYA 4PDSA 5GINE 2PZ5A 1CKIA 2FH9A 4JAJA 5IQDA 1VJYA 2X8IA 4AGUA 1OL5A 2JIUA 3NRMA 1G8AA 3NPCA 4HCUA 3TN8A 3SXRA 4HYSA 3BBTB 4YBKA 4EOIA 4R3PA 4RRVA 4XG4A 4CD0A 2R9SA 3QD4A 3WIKA 4NW5A 2J50A 1OIRA 4EJNA 3JY0A 1OL1A 1A48A 3D5UA 5AIKA 5I9ZA 3RZFA 3RWPA 1H1RA 4IB3A 4NCTC 3ZFYA 4FEVA 2HAKA 5EDPA 3RMFA 3CS9A 3P7CA 4J53A 4JG8A 2J90A 3A7FA 4C4GA 5HVJA 1V1KA 3WIGA 2AUHA 1JNKA 2B7AA 4ACCA 4QRCA 4BDCA 3QWJA 3FLQA 4KIKA 5CEOA 1YOJA 2QU6A 5IQCA 5FG8A 4RWJA 4O7RA 5EI6A 4JVGA 4UYAA 3RGFA 1H28A 4EK3A 4BCFA 4MNEA 4D1SA 4FIIA 3FSFA 2RL5A 3BGQA 4F70A 4LI5A 1PJKA 2X39A 3TNIA 4UYNA 3Q6UA 2GDOA 3WYYA 3FEGA 5IKWA 4JDJA 1XJDA 3GCUA 3OCTA 4NM0A 5DT3A 4FYNA 4AXAA 3QHRA 2BZHB 2QU5A 2HW7A 4I4EA 2V7OA 5CU3A 5HGIA 3Q32A 3P0MA 4ANOA 5AA8A 4QMLA 4LMNA 5HTIA 1JBPE 4GU9A 3CIKA 4TWCA 2OJJA 4PV0A 3KMUA 2F4JA 5FTGA 4KAOA 1R0PA 2W99B 3R63A 4PNIA 4OGRA 3F2RA 4BDKA 3BCEA 4MCVA 3LJ0A 2XRWA 4J52A 3DK7A 3H0ZA 5CANA 4Q5EA 4BWKA 5L6PA 4N57A 3FV8A 4FEWA 5ACBC 5HLNA 3COMA 3TV4A 2F2CB 3QD3A 5C1QB 2CNQA 2ITYA 3W2CA 3M2WA 4EHZA 5L3AA 5E8YA 2RFEA 4F6WA 2BZIB 2C6IA 2J0MB 4NJ3A 4QYGA 4U3ZA 4EK5A 5CF8A 3RCJA 2E9PA 2VWZA 5HE0A 4Y5QA 4IAKA 4QP7A 2R3IA 3CTJA 3FMMA 5CENA 2I40A 3K5UA 4DTAA 3R8MA 4IWPA 2F57A 3LFFA 4BCIA 3G2FA 4O27B 4BI2A 2XKEA 2WQNA 2HENA 4UXQA 3AC4A 3EZVA 2LAVA 4QQCA 3RKBA 4MF1A 4PL3A 2PZRA 4IZ7A 4U40A 2VO0A 3DPKA 1XH9A 4I0TA 4ITHA 1JKTA 2I6LA 3ULIA 5LXMA 3U6IA 4NT4A 5F9EA 4BDAA 1BI8A 4EQMA 1YI6A 2A19B 2OZOA 2PZYA 3VJOA 3QYZA 4AA0A 4TPTA 4EHGA 1VR2A 4K1BA 4FTQA 4FV6A 4FX3A 5ETAA 3JXWA 2ZV2A 3PXKA 4WO5A 4E1ZA 3Q4UA 2GFSA 2VTLA 3HDNA 3R02A 1YOMA 3RAHA 3P4KA 4MK0A 3MYGA 4U81A 4U44A 5CAPA 1W8CA 4UV0A 4FUXA 3NW6A 4U9AA 2UZVA 4QMNA 4JAIA 3C50A 3PA5A 4YZBA 3ZLSA 2XNEA 3LM5A 5AAEA 3EL7A 4QP2A 4Y95A 4FEUA 4GJ2A 4YJNA 3S2PA 4ACGA 3NUXA 4O0UA 5EM5A 1PHKA 2XK9A 4OBQA 3V3VA 3FI8A 1J1BA 2C5YA 2OU7A 3KRXA 2OWBA 3BQCA 3E7OA 2F7XE 3T8OA 4XUFA 3DXQA 3LLAA 4K18A 2GTMA 3M42A 1Y8GA 4KS7A 5HE2A 3UO4A 3GU6A 3ZLXA 2BTRA 3QQKA 3WI6A 4PPAA 4YJPA 3OG7A 2RG6A 3SRVB 3IOKA 3QL8A 4F08A 1OIYA 3QGWA 2OH4A 4N0SA 3TXOA 3VS6A 1DS5A 1YRPA 1BMKA 2A27A 3F3VA 3H9FA 1ERKA 4YHJA 2ITVA 4RIWA 4BBFA 2QLQA 5A4CA 5K5XA 3R73A 3ZM9A 4ZSEA 4RX9A 2E2BA 4CG8A 2XH5A 4BDFA 5C4KA 4ZK5A 2CCIA 4D4YA 4M84A 3UO5A 3OWPA 4CGAA 4M12A 2PVJA 3BPRA 4D58A 5IH4A 1MRUA 5CAVA 4YSJA 2C3LA 5TO8A 4MNFA 4U0IA 2VWWA 5FP5A 3BYUA 5DLSA 5BNJA 4USEA 5BYYA 3I79A 4CCUA 2BRBA 4YZ9A 4QP9A 3G5DA 2ZM3A 2C3JA 4G17A 1SVHA 4RFZA 5HNBA 2QVSE 2ACXA 5M06A 2HIWA 2UW7A 2GFCA 2UW8A 3ID6C 5BYZA 1X8BA 3QX2A 4OT5A 1YDTE 5AP0A 2C0OA 3E5AA 3WBLA 5CT0A 3CBLA 2GNIA 3LCTA 1ZOGA 4J96A 4RLLA 3H10A 2ZB0A 3SXFA 5FGKA 4F0IA 3QGYA 3GGFA 1J1CA 4MH7A 1S9IA 3S4QA 4ZAUA 3MH0A 1OPKA 3IDBA 2ZJWA 3V6SA 4BC6A 5C8KA 2VTPA 5LMAA 4MBIA 4OBPA 5EOBA 2XIXA 4J8NA 5E7RA 2WZJA 5AJQA 3MPAA 5BUJA 3V5WA 5HBJA 2WFYA 3VNTA 3BX5A 2JIIA 4TXCA 3TNWA 3HZTA 3HUCA 3LXNA 4CV8A 5GJFA 3ZO2A 2GQSA 4GG5A 4F9AA 3EN9A 4QYYA 3NNVA 5ANKA 5KMIA 2ZMCA 4EHVA 2QKWB 4YU2A 3VHEA 3LCSA 2JDVA 4R8QA 2ERKA 3O71A 4FV3A 1ZRZA 1M14A 4Y73A 3MFSA 3TT0A 2PSQA 2EXCX 3ROYA 5IPJA 4WT6A 1XKKA 2YITA 4YPSA 3LJ2A 3DLZA 2RKUA 3NWWA 2WQEA 5LOHA 1ZXEA 1O9UA 3C1XA 3LFQA 1LPUA 2XIKA 4FV2A 5JZNA 3VS0A 5DWRA 2QG7A 2QO2A 1WBNA 1PXKA 4AS0A 2O64A 4IEBA 3T3UA 5B0XA 2XKCA 1NT2A 4DEGA 4FV7A 1XBBA 3PSDA 4RJ5A 4F09A 2HXQA 2JITA 3U4WA 3UBDA 2Y8OA 1TVOA 2XP2A 3QQHA 2KTYA 2VTHA 2VGOA 3BIZA 3RK5A 4CMOA 5B2LA 1LR4A 5A6OA 3DAEA 3RHXA 3JUHA 3MSSA 3ENHA 3DTWA 4TWPA 4MAOA 2VUWA 4BCKA 5D11A 2BZJA 3QCXA 1SNXA 3ZOSA 4L46A 3ZXTA 4O96A 5EW8A 4ZS4A 2HYYA 5EDQA 5KMLA 4O22A 1Q41A 4RBLA 5M09A 5CNNA 3V5PA 4HVSA 5AM6A 4UY9A 3BE2A 5EQYA 3DK6A 1KE6A 3ITZA 5HD7A 2VX1A 2ITTA 4M8TA 3SX9A 2P4IA 4BDDA 5JQ5A 3HV4A 4V01A 5C01A 4ASXA 4NTSA 4AUAA 4RC3A 3SC1A 3COHA 2FYSA 2G1TA 3FLNC 2ZM4A 4ITIA 2UZLA 4P90A 2B9FA 3EYHA 5KMJA 4YJUA 4LOQA 3KREA 4OW8A 2C6KA 3BHUA 4XG3A 4YZNA 1Q8WA 4ZP5A 5T3QA 2XBJA 3C0IA 3OUNB 2ITZA 3DJ7A 3CQWA 4L44A 3W55A 1Y91A 2VX0A 2XNBA 5DE2A 4A9SA 4AN2A 5BVNA 4AG8A 3PIYA 3ZZEA 5M4CA 2XYNA 4EBVA 5EYMA 3UOJA 2PUIA 4FICA 5A14A 3PE1A 1YW2A 2BUJA 4CFUA 2OSCA 4FK3A 3LXLA 2GPHA 4NIFA 2DWBA 4FG7A 4GK2A 2WXVA 2PVLA 3QCQA 4FKVA 4FVRA 5AP6A 3I60A 3QRJA 4I1ZA 4UWBA 2JFMA 3D4QA 3FYJX 3CY2A 4MXYA 3CTHA 3ZUUA 5KKRB 3D7TB 4R77A 3LQ3A 5GZ9A 5CAOA 3ERKA 4A9YA 2ONLC 4RIXB 4AFEA 4EZ5A 2XK7A 3B2WA 3QKLA 5ANDA 2X6DA 4FL2A 3EMGA 3U54A 2GNLA 3Q53A 3AGLA 5ITAA 4U43A 3BHTA 2W05A 4FKSA 4LYNA 2OO8X 5AAFA 4AA5A 4BZDA 4PP7A 2BILB 3I6UA 5E92A 2GS6A 4BGGA 2ETMA 4D2PA 3E7VA 2ZDTA 3KRRA 3A7GA 2B1PA 3R0TA 3OHTA 1W98A 4IC8A 2C6DA 5HBEA 3PZHA 3ZM4A 3C4XA 5ICPA 3R8VA 3AOXA 3PA3A 4KABA 2PVNA 1L8TA 3QZIA 3FSKA 5ETIA 1Y8YA 5HG9A 3SDJA 5JT2A 3KMMA 1LEZA 4CNHA 4BYJA 3A61A 1BYGA 3BI6A 3MB7A 1UU8A 4LGHA 5DR9A 4O7VA 1RE8A 4U80A 1GY3A 1BLXA 4C7TA 4FTUA 3C4FA 4YLKA 3R9DA 3CKXA 4EH7A 4ERKA 5BVFA 4IJPA 3IO7A 5AP1A 4D5HA 4ARKA 3FJQE 3LFNA 3S3IA 3PUPA 4FKLA 4CT1A 1IRKA 1LEWA 3DKOA 3QA8A 3EN7A 4PQNA 3DS6A 3TTJA 3W1FA 2Y0AA 1FGIA 3DDPA 1MQ4A 2XCHA 1NVRA 3GOKA 3VN9A 1KUTA 1YXVA 3R7EA 4BTMA 4MXZA 4O7SA 2CGVA 2R64A 4I5MA 2JBPA 2WU6A 4X0MA 3VBVA 5HQ0A 1YXTA 4H1JA 5IA3A 2FB8A 1WCCA 1R0EA 3VS1A 3OCGA 3C4CA 3I0QA 3QXOA 4J97A 3U87A 4BZNA 2GMXA 1KE7A 3QYWA 2Z60A 1PKDA 2WQBA 3B8QA 3LXPA 4IVAA 3TZ7A 5JFWA 4ID7A 2GS2A 3O7LD 1WBPA 4DH8A 2X2LA 3PG3A 4IM2A 4BDHA 1CKPA 2NO3A 4O7NA 4KIQA 4ZSLA 2CPKE 4LL5A 4I92A 3LMGA 4KINA 4K6ZA 3UPXA 3OXTA 3GC8A 1FMKA 3QUPA 3VUIA 3DB6A 4G34A 1PRYA 2OW3A 4RZWA 1JQHA 4AA4A 4FT7A 5E8SA 5AP2A 2WTVA 3R7GA 3DB8A 4FTJA 4I5HA 3TDVA 3CGFA 4FBXA 1JAMA 5C8MA 2Y4IC 2R3HA 2QOOA 5FWKK 3WILA 5E1EA 3WYXA 3ZLYA 2VTNA 2XK4A 3F66A 3ALOA 3PY1A 4AWIA 5BUEA 1CDKA 4FEXA 3PY3A 3EKNA 1RQQA 3HAVA 2C0IA 5CSXA 5LQFA 4H39A 5CX9A 3P78A 2F7ZE 3HRCA 3BYOA 2Z8CA 2W0JA 4JRNA 3W8QA 1WFCA 4FSRA 3LW0A 3NAXA 3VW8A 3U9CA 3OCBA 4U97A 3R9OA 3CSVA 3FC2A 3MB6A 3WZJA 5AIRA 1JKLA 2J0LA 3ZO4A 4WSYA 5FLFA 3R7IA 2GCDA 3E88A 1Q97A 4HGEA 2J9MA 4O7ZA 4P5ZA 4O83A 4DFUA 2YWVA 2W4OA 1H1PA 3R28A 3IPHA 4DH5A 4EK8A 5EW9A 2E9NA 3II5A 5C4LA 2W1IA 5CF4A 3QTWA 4IC7A 3FXZA 1W83A 3NUSA 2YZAA 5ANGA 2X81A 3CXWA 2HY81 4F9YA 4ZTRA 3R8UA 3WF5A 4F9CA 2C47A 4G1WA 4B4LA 1WBWA 3P86A 4HZSA 1PXMA 4KRCA 3GFEA 2OICA 4X2KA 4OT6A 4R1VA 4U45A 4OTPA 5DN3A 3O51A 3HKOA 4E6QA 1FQ1B 3L8SA 4I4FA 3UZPA 4BDBA 3FI3A 4K9YA 4ALUA 1UA2A 3TL8A 1ZYJA 3KY2A 3EWHA 4O0WA 3PJ2A 4UWYA 5C9CA 4Q9ZA 2YM4A 4EZ7A 3Q04A 2G2FA 3IDCA 5IG1A 1OPJA 3FQSA 4QPMA 3ORTA 5BMMA 4CG9A 2HY0A 3PXQA 3TUDA 4CTBA 3KRLA 3ORPA 4EOJA 4CYIA 4DAWA 1H07A 3AQVA 3UQGA 2VNWA 3GCPA 3VS7A 4DBNA 5HNIX 4U6RA 4FT5A 5HBHA 2XVDA 1AQ1A 2Z7QA 4WBOA 2C6OA 3KU2A 4PPCA 3V8SA 4BIDA 3TJDA 4DINA 5CALA 3CPBA 4JI9A 3UNZA 4HCVA 2OIDA 3ZSHA 3GP0A 4I94A 1CM8A 3VIDA 4E5WA 1JLUE 3FMKA 5CU2A 2YA9A 3OWJA 5FBOA 4PX6A 4F9WA 3CGOA 5JSMA 2OIQA 3DU8A 2YCSA 3S00A 4I0RA 5GZ8A 5DYJA 1PYXA 3HLLA 5FM3A 5CYIA 1H27A 5L2WA 2ESMA 5EHYA 3PRFA 4CFMA 5FD2A 2R3JA 2IZTA 4D9TA 4FSYA 5JFSA 4BCNA 4RC2A 4QNAA 1APME 2C4GA 3MI9A 5H8BA 1UWHA 2R3RA 5CNOA 4EK4A 3NGAA 5A4LA 3CE3A 4RIYA 4BRXA 5CVHA 2UVYA 3E3PA 3UMWA 2YCFA 5HIBA 4F7NA 3LVPA 3AC5A 3COKA 1P4OA 5GJDA 4IAZA 4UMQA 4EQUA 5KO1A 2JKMA 1BI7A 2ZAZA 5EI2A 4JOAA 3C51A 4GEOA 4NW6A 3R8LA 4AZWA 5BPYA 1WBSA 2XJ2A 4CFNA 4WG3A 5EYKA 3DBQA 5BVDA 4TYHA 3PLSA 2P2IA 2GQGA 2WHBA 1F0QA 4PMSA 1I44A 4G5PA 3TNPC 2VTSA 2BAKA 2VWBA 3QRUA 4G3DA 1YI4A 1OL7A 4YPDA 4D2WA 4RGJA 2XM9A 1PXNA 3C0HA 4CQGA 2YCQA 3BU5A 3UIBA 3OC1A 3FMJA 5HG8A 3GCQA 4TYJA 2OK1A 2OXXA 3FPMA 3QLGA 3FLZA 3ZBFA 4MBLA 3RPRA 3CR0A 5IMEA 3HA6A 4E6CA 3A7HA 1U5QA 2C5VA 1WBVA 2PE2A 5CQWA 4RC4A 5J87A 2R2PA 3IKAA 5H9BA 4EUUA 3HMPA 4ONAA 3NW5A 4C4HA 5M56A 5EHLA 1G8SA 4FGBA 4CYJA 3HMMA 5CI7A 2UW4A 4FKOA 2JFLA 4ZJIA 4Z16A 1URWA 2J51A 3THBA 4ACDA 1NW1A 5DGZA 3Q2MA 4X2JA 3C0GA 4P4CA 3QKKA 2PVMA 5IZFA 4BY9E 5KNJA 2UW0A 2XKDA 3VUDA 4DEHA 4E4MA 4A4LA 3I7CA 3OY3A 3OUKA 3IGGA 4NKAA 4B7TA 2XK6A 4QQ5A 3U4UA 4O0VA 3FL5A 5IEXA 3F3WA 3G6GA 3Q5ZA 3ZC6A 4EH8A 5FTQA 5IA4A 3ZCLA 4FNXA 4FEQA 3VBWA 3DZOA 3V8WA 2EWAA 5GJGA 1BX6A 3DV3A 5LWNA 1Q8TA 1YVJA 3NZ0A 2BRMA 1KOAA 2R3GA 3R04A 3L8XA 4M69B 4AP7A 3OBGA 1IAHA 3HNGA 1FPUA 4YGAA 2WTKB 3EQPA 4WRSA 5HCXA 5LVNA 4D2RA 4I23A 3RCDA 4JR3A 2X8EA 5L2TA 4MWHA 4O6LA 5LMBA 1YDSE 5IQBA 4LRKA 4IX6A 4BGHA 3MFTA 4XEYA 3O23A 4FVQA 4F7LA 2JDSA 3DBFA 4WOVA 4S34A 5AP3A 5HG7A 4GK3A 3RHKA 3NYOA 3G90X 4I6QA 3DK3A 4ENXA 2ETKA 1H1WA 3TCPA 4AW2A 5E1SA 4YUQA 4GIHA 2UZEA 2HZIA 4RVTA 4AN9A 2ITOA 5IEYA 3RALA 4DTKA 5HCZA 3OMVA 5CVFA 3FHIA 4LUDA 2BMCA 3ORZA 4Y8DA 3P08A 3A2CA 1RDQE 3PWDA 4TT7A 3W2QA 4CFVA 3G0FA 4ZTMA 4C58A 3BQRA 4IAAA 3NYVA 4RLKA 5FUTA 3NDMA 4MXAA 4QTBA 4ZJVA 3KXHA 3RWQA 4NYEA 5F20A 4QMVA 3GU8A 4HGLA 4QMXA 3LFBA 3WE8A 3OT8A 3NYNA 2REIA 4QTCA 3RTPA 2W7XA 4W8DA 4ZIMA 3DGKA 3GXLA 5LARA 4QMWA 1ZY5A 5HE3A 4JBQA 4OLIA 4G5JA 5E8XA 2O3PA 4WNMA 3KA0A 3CD8A 1P14A 3MVMA 4FKQA 3LFCA 4G3CA 5DFPA 4CTCA 4RA4A 5J95A 4BICA 3QC9A 3H9OA 4AZTA 2QCSA 4QP3A 4NSTA 5IU2A 3BYMA 2YJSA 3UIUA 3UO6A 4Z55A 2VGPA 4M15A 4FYOA 3W2RA 4GU6A 2OJGA 3E87A 4B8MA 2WNTA 2NP8A 4IX3A 4PRJA 5K0XA 2CNVA 2FSLX 4DA5A 3D0EA 3HVCA 3KVXA 4XOZA 4MKCA 5H2UA 2YIXA 4E73A 4AAAA 4UMPA 4EOLA 3E62A 4JBOA 4IB1A 3HECA 3MDYA 4HYHA 4RJ8A 5HU3A 2IZSA 3F3TA 3QAME 3G15A 2XRUA 1OKWA 3KF7A 3KL8A 1DAYA 4JIAA 4L8MA 3OTVA 4E26A 5BYLA 1P4FA 4RVMA 5FRIA 5A3XA 5HIDA 2QC6A 2C5XA 4R1YA 5L8JA 4R7BA 2XIYA 4YURA 4ZTQA 3MJ2A 3ORMA 4K11A 3GC0A 2CJMA 2VWYA 1M2RA 4ZXTA 5KCVA 4FODA 4KB8A 5HZNA 4J8MA 3UODA 3QZHA 4UB7A 3HDMA 4V0GB 5IDNA 1VYWA 2YM5A 4JRVA 4GYIA 3FLSA 3TV6A 2YM8A 3RP9A 3SQQA 3ZEWA 3MFRA 4CMUA 5M51A 4FG8A 3F82A 1OI9A 3ANRA 1OGUA 3OT3A 4MF0A 1WVXA 3C4ZA 4V05A 3VF9A 3ZFMA 2C6TA 5KMMA 2WKMA 2DYLA 4XLVA 2VO6A 2X4FA 3AMBA 2CN5A 3TTIA 2WQMA 5KX8A 2XF0A 3KXGA 2H96A 5CU0A 3DBEA 2H6DA 3Q9ZA 2ZB1A 1W7HA 1JSUA 2E9VA 2Y7JA 1PW2A 3ZRMA 4FMQA 1LP4A 2EXEA 3ZSGA 5M08A 2C6MA 1L3RE 4RA5A 1XH5A 2WMWA 4L53A 3FQEA 1KE9A 4ZY4A 1QPCA 4EOQA 1YXSA 2XJ1A 3ZS5A 3RM7A 4EOKA 1KV2A 3F61A 3QTSA 5EM6A 2X9FA 3BLQA 3TZ8A 4MYGA 4CCBA 3QRKA 4XG9A 1JKKA 3QX4A 4WBBB 4BB4A 4CQEA 1Q3DA 1OPLA 2WQOA 1TQMA 2BAQA 1VYZA 2HWPA 2OFVA 5CS6A 3W18A 3FMDA 4O0SA 3LFAA 3HYHA 4IWQA 5DRDA 4ASZA 2PU8A 4IXPA 5D12A 1SNUA 3SAYA 3PP1A 3FXXA 3TJCA 1CTPE 4QMOA 1H24A 3BLRA 3SD0A 3PTGA 2W1GA 4MXOA 4AGDA 4FKWA 2X8DA 1R1WA 2EB3A 4FUYA 5HLPA 2QNJA 3DJ5A 4IADA 5KMOA 4EJ7A 4C33A 4D4SA 3M11A 3FZSA 2HZ4A 4L3PA 1OMWA 4GCJA 4R5SA 5AR8A 2PMIA 4MTAA 4II5A 4BCPA 2XNGA 4C2WA 5I9XA 4FGRA 2X6EA 5AX3A 4JNWA 4YZDA 3HL7A 4OTGA 4I21A 3N4TA 1ZOHA 2J7TA 4RQVA 3ZC5A 4GV1A 3ZONA 5AUZA 4IX4A 3ZZWA 1FVTA 2B52A 2XCKA 3E93A 3IECA 1OKZA 4C8BA 3MN3A 3R01A 1R39A 4QMUA 3E8EA 2CMWA 4KBAA 3HV5A 4K77A 4M0YA 3QFVA 4FSUA 5CZIA 4FG9A 5ANJA 4BBEA 5M4FA 4J95A 5J9ZA 3F3ZA 2WU7A 5DI1A 3AT2A 4GG7A 5DR2A 1EH4A 4FZFB 3VRZA 3ZSIA 4YC6A 3AG9A 3JVRA 3GVUA 2QKRA 4WG4A 4CXAA 1H1SA 3BGPA 2ITWA 1WVWA 2XB7A 3NCZA 4HNFA 4IDTA 4YNEA 4E20A 3GQLA 2QO7A 1UU7A 2QURA 3KXZA 3NUPA 4FKIA 1QL6A 4IZYA 4R3CA 4ZZNA 5KBQA 4OTHA 3UQCA 3UZTA 4ZLYA 4FTMA 2YLFA 1ZARA 4RVKA 2HOGA 4W4WA 3VBTA 5M4IA 3TUBA 5I5ZA 2A4LA 4FKUA 4GW8A 5D7VA 4KKEA 5EYCA 3RAKA 2YAKA 3D7ZA 3EL8A 3EH9A 3HV3A 4FT9A 5ETCA 5K0KA 4A9TA 4QMQA 1YWVA 5M07A 4S31A 3CTQA 3KC3A 3POOA 2Y6MA 3PSCA 3A4OX 4QMPA 5EM7A 3W16A 4LGGA 2WOUA 3PE2A 3R1NA 4IAFA 5BVOA 1VZOA 2PE1A 4EC9A 5K4JA 3D5WA 2W1ZA 4CRLA 1ATPE 2VO3A 5CSVA 2RFSA 4IZAA 2UZBA 3E63A 1S9JA 3QCSA 3IW7A 4GK4A 5A4EA 2XA4A 4GMYA 2QG5A 4GS6A 5L8LA 2XIZA 2QONA 5G1XA 3SW7A 3ORIA 2G15A 3PY0A 3R2BA 2JDTA
chains in the Genus database with same CATH superfamily
4IE9A 4OTQA 4RQKA 3QRTA 5L6OA 3R9NA 4HW7A 3UC3A 4DN5A 3R2YA 5F1ZA 3PUFC 3N9XA 1XH6A 2O63A 5HOAA 2YWPA 3PSBA 1YXUA 2OGVA 3PJ8A 4ZY5A 5HKMA 4NK9A 5FBNC 4BTJA 4DFNA 5CF6A 5CXZA 4L68A 2QR8A 4W4YA 2WO6A 4M13A 5LCJA 3DBDA 4FSNA 4XV9A 4BTKA 5LMKA 4V04A 4WG5A 3L9PA 4IVCA 4TYIA 3LMHA 4RX7A 4MXCA 3K54A 5F94A 1CMKE 5AV1A 5EKOA 4DDIA 3PDTA 1H08A 3Q4CA 3KKVA 5J1VA 4X3FC 4B8LA 3EFKA 3JPVA 1H8FA 4NU1A 4Y72A 1IR3A 3BZ3A 4K8AA 3WZDA 4CZTA 2QOFA 3ANQA 1U54A 5ACKA 3MTLA 2VWVA 3F5UA 3ETAA 4Z9LA 1DI9A 5J5SA 3W0PA 3FKOA 3NFGB 2WTDA 3F69A 1H00A 2WTCA 2CGUA 3VS4A 4DEDA 2HW6A 4PTEA 4QTEA 3KULA 5KMKA 2BRGA 3MV5A 4D5KA 5BMSA 3RK7A 3W2OA 3P7AA 4XH6A 5KZIA 1ZLTA 2VTQA 4IW0A 4C37A 2ZYBA 4JXFA 2EB2A 4E6AA 4RX5A 1KV1A 5DT0A 3CCNA 2JKKA 2BDWA 4XP2A 4DC2A 4U8ZA 2HZNA 3O8PA 4YSMA 5AWMA 3WF8A 4F0FA 3OBJA 4F4PA 3L1SA 5LVPA 3QU0A 3D5XA 2OIBA 2QI8A 3C4WA 3KN6A 1MRYA 4I6BA 4XS2A 1OB3A 3EQHA 5AR3A 2VTIA 3QKMA 4DLIA 5AADA 4NM7A 4QP8A 2EVAA 2YIQA 4NM5A 5CVGA 3S95A 4OAVB 3N4UA 4DT8A 2W17A 3NS9A 4KUJA 2X7FA 2X7OA 2IVVA 2YACA 4HJOA 4YTHA 3ZXZA 3C5UA 3A7JA 1YWNA 4EH9A 5AUVA 2OZAB 4PUZA 4RX8A 4HVDA 2XEYA 3KK9A 4EK6A 2FUMA 3UE4A 4BZOA 2X1NA 3COIA 4GVJA 4QO9A 4WHZA 3NUAA 2JIVA 3MESA 5I4NA 2B0QA 4EKLA 4ANSA 3RPYA 1REJA 1OKVA 4LV7A 5I9UA 3MH3A 4O86A 3ZU7A 4EOOA 5FEEA 1W84A 4FV0A 4L9IA 5CSWA 3RVGA 4EOJA 5AUTA 3EHAA 3WF7A 3SGCA 1SYKA 2WTWA 3VC4A 4AZVA 4FV5A 4ZLOA 2A1AB 4YTIA 4YZMA 1PXPA 4PTCA 4EORA 4YO6A 3QTQA 2V0DA 3EQCA 2BCJA 4FV9A 3NNXA 3DT1A 2BVAA 3DZQA 3PYYA 3EZRA 3QD2B 3G9LX 4DHIB 3F88A 1PY5A 3BYVA 4FOBA 3F9NA 4O0XA 2QOBA 3OXZA 4ANMA 3QTRA 3RPOA 3UVQA 3DNEA 5A46A 3POZA 3ZTXA 4DGNA 3RM6A 4QTDA 3QTXA 1WBOA 4G6OA 4KD1A 4DH3A 4N4SA 2QHNA 3QQFA 2UZNA 2EXMA 2VU3A 5EK7A 3PG1A 3ACJA 2G9XA 4DHZA 3C9WA 2Y6OA 3UYTA 2VTJA 4ALWA 2XNNA 5AFVA 3WF6A 3IW4A 2R7IA 4GVAA 4F7JA 4K33A 3BU6A 4OTWA 1Y6BA 4M14A 4FTOA 1XQZA 3ALNA 3R1QA 3LAUA 4OTIA 3K5VA 2UVXA 4YLLA 4E5AX 1O6YA 2OFUA 2PUUA 2WIPA 3CKWA 5E4HA 4HYUA 3FHRA 4AW1A 2JAVA 3KCKA 1V0OA 3EFWA 4FL1A 5JRSA 1V0BA 4L3JA 4MD9E 1NA7A 1DI8A 4M67A 4AFJA 3VUHA 2YIWA 3W0SA 5HVYA 2B9HA 2JKOA 3DQXA 3PPKA 4I41A 1SMHA 3Q96A 4MQ2A 2BHHA 3VBXA 1XBCA 3VQHA 5B2MA 3V5QA 4PDPA 3S1HA 1A9UA 2CHLA 4FSWA 1XO2B 3OFMA 4AXCA 5I3OA 4NCTA 1TKIA 4TYGA 3T3VA 5JEBA 5DEYA 2ZV7A 4WKQA 4GT5A 4XP0A 3H4JA 2CNUA 5CAUA 3VW6A 2OKRA 4O4EA 3I6WA 3Q4ZA 3LCOA 4IVDA 1QPJA 1IA9A 4E93A 2C3IB 5EDRA 4J7BA 2P33A 3MJ1A 4IM3A 3SVVA 3U51A 4S2ZA 5JMSA 2JLDA 2OBJA 4QP4A 4E5BA 1R78A 3LKMA 3NNUA 3QUEA 2Z02A 4AZEA 2FVDA 4BBMA 1WZYA 1M7NA 4DEEA 3H3CA 4G3GA 4A4OA 2NPQA 3WZUA 3UGCA 4EL9A 4DH1A 2V7AA 2C5NA 4X2NA 4AACA 3JR1A 3BHVA 4UMTA 3EQIA 5GHVA 3HA8A 1ZWSA 3L8PA 3QC4A 4IIRA 4PF4A 2F9GA 4BCOA 1YXXA 1H4LA 4L7FA 3EKKA 4JQEA 1YHWA 4LV5A 4P2KA 1HOWA 4PP9A 3ZYAA 2R3PA 4KIKB 5AV4A 2C0TA 3TKIA 2JGZA 4FZAB 4ENYA 1M52A 3MVHA 3G51A 4TZRA 3UPZA 5KHXA 3FLWA 4MNEB 5I9YA 1H0VA 3CC6A 2UW3A 5JZJA 1B39A 4JG6A 2UUEA 2X0GA 2BRNA 3Q52A 4O0YA 1XMLA 5AV3A 2LGCA 4IDVA 4JQ7A 3CEKA 4QPSA 2GU8A 4XJ0A 3GT8A 5IISA 5AR5A 4EH5A 2CGWA 2PZIA 3BEGA 3PZEA 5J9YA 3QCYA 2WMQA 5E90A 5HESA 4H1MA 3QBNA 2FSMX 2VWUA 3HV7A 4C4FA 3O8UA 4HYIA 4NKSA 2WMUA 3HGKA 5A54A 3W0OA 5GNKA 4PL5A 4BYIA 5A6NA 1BL7A 2W96B 4MHAA 5T6KA 3K2LA 4QT1A 4BHZA 2EUFB 4OTFA 5KE0A 3CP9A 4WNOA 2ITUA 4WUNA 4NFNA 2YERA 3HMOA 4DFYA 3PVGA 3E8DA 2P3GX 1AD5A 3O50A 3Q6WA 4EH2A 3BELA 2H34A 5H8GA 1H25A 3SRVA 4EHEA 4DFXE 5DT4A 2PHKA 5AR4A 4EUTA 4C62A 4EYMA 3N4VA 1TZDA 3I5NA 4I22A 1REKA 2RSVA 4O38A 4XBUA 1Z57A 4O91A 4TW9A 2Y4IB 4YJRA 3IDPA 1Q8YA 2CSNA 3PA4A 4QMSA 4C36A 2W1HA 4G6NA 4G3FA 3B2TA 4PY1A 3RNIA 1LUFA 2X7GA 1GZOA 3K3JA 1PXLA 2W06A 2BROA 4KKGA 4O81A 3CLYA 4BCMA 2WB8A 4AX8A 3DFAA 4AE9A 3TKHA 2ZVAA 3DAKA 2HXLA 4BVUA 4R7HA 3AGMA 3FAAA 3P5KA 2R7BA 2UW9A 4Y83A 4AXFA 2XBAA 4C59A 5M4UA 4KSPA 3IONA 3F2AA 3KQ7A 3GCVA 4MUQA 3QWKA 5JN2A 3Q9WA 3CJFA 4QD6A 4C57A 1E1XA 2W4JA 5EKNA 1OL6A 3KN5A 2PVHA 4QMMA 4ZSJA 3EQRA 4F6SA 5M55A 4RWIA 3VF8A 3TM0A 5A4TA 1GZNA 4JT3A 2WTIA 4HPTE 5GZAA 4W4VA 2GHLA 4A06A 5TKDA 5DG5A 3VUTA 1M2QA 1OBDA 2CKEA 1BKXA 4QP6A 3TYKA 3PXRA 5TE0A 2R3LA 1KOBA 3EQBA 4FZDB 4PMMA 3ZLWA 5AM7A 2Z7RA 5AR2A 1UNGA 3JS2A 1H01A 1MQBA 4J71A 5DVRA 1SVEA 1QCFA 4TKSA 2QR7A 3SHEA 2UZWE 4RIWB 3QQLA 1JSTA 4L6QA 5IQFA 5C8NA 3ATSA 5D9HA 4A9RA 4EWQA 5DR6A 3R7VA 4ASDA 1SZMA 5A4QA 2BIYA 2R3OA 2VRXA 2GNHA 1PXIA 2W5HA 2WMRA 3UG1A 3ZH8A 1QMZA 3QZFA 2WEIA 2VTOA 1UKIA 2XK3A 3LE6A 3Q5IA 5EM8A 3DFCB 3OOMA 4I3ZA 2YDKA 2QD9A 4JBVA 4BR3A 1OM1A 4GJ3A 2QOLA 2F49A 5AUYA 3PJ1A 1JVPP 4C38A 1J3HA 1NY3A 4UALA 5KUPA 3QLFA 2A2AA 4RJ4A 4PDYA 1OL2A 4HPUE 4NEUA 3RI1A 3LLTA 3PJ3A 3DLSA 4MEDA 2C6EA 3MWUA 1GIJA 4DEIA 4ITJA 4C3PA 4F64A 4BDIA 2ZM1A 3VUKA 5L2QA 4AGCA 2PUNA 4HVIA 3MH2A 3MFUA 3O5AA 3R1YA 3ZUTA 3GU7A 3M1SA 4BWXA 5IA2A 4A4XA 1OGYA 4B99A 4AT5A 3FY0A 3LOKA 3MIYA 3QQJA 3C13A 5E91A 2FSTX 2Y4PA 3S0OA 3GNIB 3GU4A 4FKPA 1BL6A 3ULZA 3QRIA 2O65A 4FV1A 3KXXA 3HRBA 2OG8A 4L00A 3SLSA 4DGMA 4AW5A 2IZRA 3QTIA 4CFXA 4EKKA 4YJSA 5CF5A 4BKZA 3E3BX 4N70A 3VWAA 3TZMA 4TNDA 5E9EA 3AC3A 4IMYA 3MY1A 4GT4A 4MVFA 4U41A 1WMKA 1FOTA 5FTOA 3TWJA 4XG2A 3LJ1A 3FKLA 4MXXA 2B4SB 2DS1A 1IAJA 3KRWA 4DCAA 2YISA 3LZBA 3OF0A 4MD8E 4RJ3A 5CEQA 2ITQA 3FZPA 4H3BA 4GUBA 2YCRA 2C5OA 2VWIA 3DTCA 3FQHA 5J9LA 2PK9A 1GZKA 4QYEA 1Q4LA 2YABA 3C4EA 3P79A 4QMYA 3P9JA 4TL0A 4BI0A 3P23A 4M7IA 5HTCA 4BKJA 4FL3A 4FE2A 2XKFA 4H3PA 2BFXA 2QQ7A 4I0SA 5ANEA 1OKYA 5L4QA 3AT3A 4AOJA 2OF2A 3BHYA 4Q5HA 3ZUVA 3DNDA 4GL9A 4F1TA 4F63A 4FKJA 3P5JC 3GB2A 4DLJA 4CFWA 3DBCA 4CKJA 4BL1A 5CY3A 3NUYA 4QTAA 2PMOX 3D7TA 3QTUA 5DNRA 1T45A 5JGDA 2WMSA 1PXOA 2OI4X 5TT7A 3FPQA 2WGJA 4RIXA 4KS8A 2P55A 1M7QA 4GFMA 3UP7A 3PXYA 4B6LA 3B8RA 4YMJA 4FV4A 1GZ8A 2QOIA 2XIRA 4JDHA 3VS5A 3UOHA 3ZFXA 3NX8A 3R30A 5FQDC 5CEKA 5EH0A 4CLIA 5HE1A 3HV6A 4ACHA 5HVKA 5JQ8A 1Z5MA 4YR8A 4FTNA 3GBZA 4N6ZA 1UNLA 4Z3VA 1OIUA 1T46A 2J2IB 2J0KA 2QODA 4BIBA 4MX9A 4EOMA 5E8VA 2VWXA 3R7UA 2I7QA 1UKHA 4W9XA 4WUAA 4ASEA 3BV2A 4O82A 4G3EA 4E3CA 2OXDA 2C1BA 3I4BA 1AGWA 3FL4A 3AC8A 2UV2A 5HICA 2GS7A 1GAGA 5CTPA 3HAMA 1F3MC 4QOXA 4RVLA 5CEIA 4D2SA 5JK3A 5ETFA 4FNWA 2ONLA 4GUEA 5HU9A 3E64A 4D0XA 2C68A 3IGOA 4J98A 4XV3A 2WMXA 2BFYA 3LPBA 4LM5A 2PUPA 5HO7A 4EH3A 1A06A 5BUIA 4NIFB 3EN5A 4L7SA 2YLEA 4AZFA 5JGBA 4D0WA 4W8EA 3IW5A 5I9WA 1Q99A 2WD1A 3FC1X 3REPA 2ZMDA 3F7WA 2GSFA 3HEGA 3RAIA 4LG4A 2P2HA 4HGSA 3DKCA 3EIDA 5IQAA 4R7IA 3EOCA 4JIKA 5CU4A 5CSPA 3BGZA 4HVHA 5HX8A 4UX9A 3G9NA 5FDPA 1ZOEA 3W0NA 4EOPA 3W10A 1Y6AA 3LFEA 4F7SA 3V5LA 1W0XC 3R9RA 4HNIA 2QO9A 5E8ZA 4DG3E 4DTBA 4E4NA 4DF3A 2WMBA 4AN3A 3UOLA 3LIJA 3PJCA 1G3NA 4R6VA 4I93A 3RBWA 5T68A 2XEZA 4AE6A 4BHNA 3NSZA 4FI1A 4XG8A 3U9NA 5JKGA 2AC5A 3PPJA 4FSQA 5FEQA 1PYEA 1P5EA 3SV0A 3W2SA 1J7IA 2I1MA 5AV0A 1BUHA 5DBXA 2CLXA 5C27A 4ZLZA 3G6HA 2G2IA 5GIOE 4RWLA 2UZTA 2VTTA 3GC9A 4JX7A 2JEDA 1R3CA 2Y9QA 3KEXA 4C4IA 4C4JA 4BGQA 5A9UA 2FA2A 2RGPA 3ZBXA 3D94A 2RFDA 1PF8A 4ANNA 3NAYA 1G8KA 2A98A 4KIPA 3R1SA 5HHWA 1KWPA 3PXFA 5AP7A 4UBAA 5EI8A 3FZOA 2PVYA 3HX4A 1WVYA 3QZGA 4FOCA 5AUXA 2W1DA 4EH6A 4F99A 4ZMFA 1WBTA 2WELA 4ZOGA 4MWIA 1XH7A 3CQEA 2JBOA 3N51A 4L52A 5CEPA 4IH8A 3OVVA 1KE8A 3F2NA 4J99A 2PY3A 4LRJA 5JRQA 1ZMUA 3OWLA 3MPTA 2DQ7X 4W4XA 4R78A 4XG6A 4DCEA 4EYJA 4Z7GA 5TOZA 2O0UA 3F5PA 3VULA 3UNKA 1OVEA 4TYEA 4FKTA 3MY0A 2A0CX 4AZSA 3GUBA 3OXIA 3WF9A 4EBWA 5JH6A 3MY5A 3W33A 2WEVA 3FYKX 4X2FA 3NCGA 3V01A 2UZDA 1KE5A 3A7IA 3LFSA 5HI2A 1PMEA 3O17A 3Q9XA 4USFA 3EFLA 3NLBA 4D55A 3LQ8A 3ELJA 4DFLA 3OCSA 4YC3A 4DFBA 1XH4A 2J6MA 5IA5A 4ERWA 4JG7A 2UW5A 4BI1A 4F9BA 3LHJA 1M17A 4PWNA 3MVLA 1UVRA 1XHAA 3KMWA 3Q9YA 4WD5A 3RNYA 1QPDA 2GTNA 4TWNA 3SOAA 4IBMA 2X4ZA 4D9UA 4IHPA 2WIHA 5JGAA 5EOLA 4K0YA 1Q8UA 4HVGA 3E92A 3MBLA 5AMNA 1G8JA 3VO3A 2R5TA 3BE9A 3VBYA 5CI6A 5LJJA 3C5IA 2VAGA 4C61A 3MPMA 3WE4A 3DXNA 3V8TA 3MW1A 4JDIA 3DDQA 4IAYA 4A9UA 3SG8A 4I24A 3NEWA 4CLJA 3VHKA 5J7HA 5K5NA 5IDPA 2CGXA 2E9UA 2WPAA 4C0TA 2QHMA 2ITPA 1H1QA 2B55A 1O6LA 2ZDUA 3SW4A 3AD6A 5L2IA 5AX9A 4ANLA 3KVWA 2J5FA 5DHJA 5CQUA 2VNYA 1GIHA 4XNEA 4FTKA 5L6WL 2VD5A 3VRYA 1Q8ZA 4X7QA 4PNKA 3BEAA 4K2RA 4OUCA 5AEPA 1J7LA 5BVEA 3AC2A 3TI1A 4B0GA 3TDWA 2QLUA 1ZZLA 5IA0A 1SM2A 3GQIA 4DGGA 2CLQA 3UJGA 3GU5A 4NJDA 3OZ6A 2BDJA 2YM3A 4S32A 5CEMA 3LCKA 3QXPA 3UZRA 2X2MA 1FINA 4AOIA 4HZRA 4ORKA 4JJRA 3K3IA 2Z2WA 2I0EA 1M2PA 2R3MA 3KK8A 5EFQA 1V0PA 3WARA 2JAMA 4XOYA 3DOGA 3FKNA 3ZO3A 4C3RA 4APPA 3MTFA 1XR1A 5AP5A 4YJOA 3ZHPC 1GJOA 2YAAA 3BYSA 2BHEA 2DUVA 4UXLA 4XP3A 3SOCA 5D10A 4F1OA 5LVMA 3FBVA 5KZ0A 5DOSA 2RG5A 2J4ZA 2V5QA 3FUPA 2PMNX 2OJ9A 4BDEA 4BCQA 4IJ9A 3F5XA 2PPQA 4ZZOA 5EQPA 3BL9A 1G5SA 2EU9A 4EC8A 5DPVA 5ANIA 4ANBA 2PULA 3GENA 4GKIA 4O1PA 3UNJA 4O2ZA 3QTZA 4GRBA 4MQ1A 5E8WA 4OTRA 4FIJA 4F0GA 2J0IA 1K9AA 3L9LA 3UIXA 3HRFA 3PIZA 4O7TA 1PMVA 4IWOA 3T9IA 2UZOA 2W4KA 3UVRA 3EQGA 4I5PA 3ORNA 1IG1A 2G2HA 2PVKA 3JY9A 2IW9A 3FI4A 3PP0A 4DG2E 3MVJA 3FMLA 4O0TA 3D2KA 4ZMEA 2OJFE 5I0BA 3I81A 3QD0A 3BWFA 3R21A 4EQCA 3NYXA 5I9VA 2NRYA 4JR7A 4JL9A 4JS8A 4LOPA 3UG2A 2IVUA 4RFYA 3D9VA 4L3LA 4ACMA 5IMXA 2WAJA 2ETRA 1P2AA 4AW0A 4BF2A 1UWJA 3MA3A 1U4DA 4RIYB 2XAOA 3HP5A 4KRDA 3U55A 2Z7LA 3D15A 3DKFA 2OH0E 4J1RA 4WSQA 1DM2A 5CXHA 4FC0A 4RT7A 1WAKA 2XM8A 3FZTA 4FA2A 5KHWA 1QPEA 3A60A 2V55A 4FTCA 5M44A 2VN9A 4XMOA 5FEDA 4I6FA 5CASA 4E4LA 2RIOA 4CSVA 4TYHB 4B9DA 2ZV9A 3PWYA 2IN6A 4WIHA 4CZYB 1GIIA 4L01A 4GIIA 4M69A 4JBPA 5EQEA 3LM0A 5CU6A 4R5YA 2IJMA 3ORLA 5IUIA 3UVPA 3ZRLA 4RG0A 3F7ZA 3DAJA 3MIAA 3OEZA 2B53A 2C6LA 4NFMA 4RWKA 4X21A 5HO6A 3U8WA 4AT3A 4D4VA 3H0YA 3U6JA 4FK6A 3EB0A 1TFFA 5AA9A 3FZ1A 5EHOA 3ENMA 2IZUA 1FBNA 3L9MA 3WOWA 2YEXA 4X3FB 1NVQA 4HCTA 2V22A 4FSTA 3TEIA 2PYWA 5B7VA 1ZAOA 4O6EA 4AGWA 2HK5A 1OBGA 3A8WA 5FXRA 4CRSA 3AMYA 3PVBA 1J7UA 3QALE 2IWIA 4YHTA 4X6RA 3FXWA 5HIEA 4PL4A 2P0CA 3TMOA 1O6KA 5AV2A 4KBCA 1KSWA 5AAGA 4QMZA 4U42A 3FZRA 4XRLA 1UV5A 3BRBA 2NNWB 3ZMMA 5KKRC 2BIKB 4IB0A 5I3RA 4F78A 5LVLA 4PPBA 5H3QA 2IW6A 4JQ8A 4Q9SA 3QUDA 4NWMA 4TNBA 1YQJA 4TWOA 3FLYA 3EQDA 3DA6A 3ZO1A 3BKBA 4FKGA 1SVGA 4AXEA 3T9TA 5E8TA 4DYMA 4FIEA 1HCKA 5DRBA 1Q5KA 2W5AA 3ACKA 3NW7A 4FIHA 4YBJA 2YDIA 3TG1A 4FF8A 4C3FA 5M57A 4QP1A 3F3UA 1W82A 4O7LA 4YJQA 2BAJA 2OF4A 2WOTA 4QNYA 2VZ6A 3TNQB 3D14A 1ZYLA 2BPMA 3LFDA 3Q3BA 4ZTHA 4ZJJA 3UP2A 3KGAA 5J79A 1VEBA 2XK8A 4OR5A 4RFMA 4R3RA 5J1WA 1IEPA 2IVTA 4XCUA 4C4EA 4AF3A 2YIRA 4UMRA 5EW3A 4OBOA 3EFJA 4PDOA 2XMYA 4RZVA 4XHKB 1Q62A 3KF4A 4BCGA 4GH2A 3TIYA 4D4RA 4GT3A 2C3KA 3FMEA 3OD6X 5C26A 5H8EA 3IW8A 2R3KA 4YTFA 4LRMA 1XH8A 2ITNA 5AUWA 5HNGA 2PWLA 3TV7A 3GFWA 4FZ7A 1OUKA 2I0HA 3JVSA 4EOSA 3R83A 4H05A 3MS9A 2O8YA 4KNBA 5J7BA 2R3FA 3DY7A 3PLAE 4PTGA 1NVSA 3CQUA 2W9ZB 4BJJB 1JWHA 4GFGA 4D2VA 3W2PA 2JDRA 5K4IA 4KA3A 2E9OA 2RFNA 4FR4A 1U59A 4CVAA 4AXDA 2WMTA 2WMAA 3TIZA 3UQFA 1ZMVA 2R0IA 3NUUA 4JLCA 4YC8A 4MBJA 1YDRE 1MRVA 4FVPA 2W5BA 2PE0A 2ZV8A 1YHSA 3R22A 4DHFA 2X9EA 3QQGA 4RMZA 3UMXA 4C02A 2VO7A 4FT3A 5B2KA 2GNGA 3RK9A 1DAWA 3O2MA 3HP2A 4O1OA 4AQCA 4DFZE 4RIOA 4V0GA 4C2VA 5F4NA 4YJTA 3IS5A 4ZS0A 4I20A 3SXSA 3PVWA 2BKZA 1I09A 2RF9A 3BWJA 3E8CA 1K3AA 5FXQA 2FO0A 3L8VA 3OROA 4ZZMA 4UMUA 4D2TA 2WMVA 2IW8A 3EN6A 4UEUA 4KIOA 3ODYX 4IWDA 3QA0A 2HCKA 3H30A 3QQUA 4TN6A 3OP5A 5FXSA 5L2SA 4BIEA 2WTJA 2VV9A 3A99A 3IG7A 5CSHA 3V51A 4BDJA 1FMOE 4L67A 3FI2A 3PVUA 3E8NA 4ZEGA 2CKOA 1GNGA 5GIPE 2YM6A 1STCE 4P5QA 2Q83A 3H9RA 3KB7A 4FKRA 2H8HA 3EYGA 4O84A 4DHJA 2QOQA 4U7ZA 2PZPA 1PKGA 2FGIA 2JD5A 3O7LB 5KMNA 2IO6A 3BV3A 3JYAA 4YLJA 5ANOA 4A7CA 2Z7SA 3ORXA 3MGYA 2AC3A 4U3YA 4CV9A 3ATTA 1PMUA 3I0OA 3CY3A 5HX6A 2BKKA 4IAIA 5DIAA 4H3QA 3UYSA 2BRHA 5LVOA 3R6XA 3VUGA 1UU3A 2B54A 4X2GA 4CMTA 5IUGA 3WZKA 4LOOA 1UU9A 2BTSA 2FSOX 4ZSAA 3I7BA 3HUBA 2F2UA 1PXJA 1H26A 4ALVA 2JDOA 2J0JA 4JX3A 3R8PA 3C7QA 4NL0A 3WZEA 4FSMA 2QOKA 4L43A 4DH7A 4A07A 4G9CA 3F6XA 4FT0A 4QPAA 3VJNA 1JOWB 3NUNA 4FTIA 2PMLX 3ZDUA 4KSQA 5HCYA 3CPCA 5JFVA 4LGDA 5CT7A 1OITA 1Y57A 4X3JA 2AYPA 2C30A 2PTKA 3FWQA 4RPVA 4CEGA 1ND4A 1ZY4A 2CKQA 3L9NA 3DJ6A 3I1AA 2HZ0A 4QMTA 4BFMA 3SA0A 1NXKA 5DA3A 3A62A 5LWMA 2VTRA 1YHVA 3R7OA 3ORKA 5DEWA 4USDA 3RJCA 1UNHA 1ZMWA 3BBWA 4NH1A 4Z7HA 2B9JA 2R3QA 1IASA 1E9HA 2YFXA 3VS3A 4GYGA 1ZYSA 4EH4A 3PFQA 4KKHA 2XZSA 2XNMA 3AMAA 4E4XA 2GHGA 4ZTNA 1OUYA 3V04A 2IG7A 3KXMA 3PPZA 3Q4TA 4LUEA 5CZHA 4NUSA 3ET7A 1XBAA 2HWOA 3V5TA 4FV8A 3Q2JA 3GEQA 4E8AA 3A8XA 3KFAA 4I6HA 2GQRA 4O21A 4XLIA 3FY2A 5CWZA 3OOGA 5IEVA 4TRLA 2R4BA 3PRIA 4EONA 2UW6A 3QHWA 4FIGA 4WA9A 5TR6A 2CN8A 3UIMA 5BVKA 3NIZA 2X2KA 3ZDIA 2JC6A 1Q24A 3D2IA 4LV8A 2YZLA 1IA8A 1PMNA 3AD5A 2CDZA 1OZ1A 4JDKA 5C03A 5BX0A 3CJGA 3OW3A 4EWHA 3UDBA 4GFOA 4LDTA 4RSSA 4DT9A 2C69A 3DCVA 3O96A 4QQTA 5EYDA 2HELA 4D1XA 4WNPA 4M68A 1TQIA 3R71A 2R3NA 3U6HA 4IX5A 5DH3A 4YNOA 4EZ3A 3AXWA 3MH1A 5HO8A 5J5TA 4O0RA 4ZTLA 3NNWA 4BDGA 1FVVA 3W0RA 2VTMA 3A4PA 4G16A 4OTDA 3TZ9A 2GNFA 1CKJA 2XNPA 5AP4A 5AUUA 3EJ1A 2GNJA 4XYFA 4L45A 3AD4A 3O8TA 4I5CA 3W32A 1F5QA 4G6LA 4NZWB 4U79A 5BVWA 2YM7A 4BCHA 2I0VA 1ST4A 5IQEA 3LQ5A 4ANQA 4UZDA 2F7EE 1CSNA 3AT4A 4KWPA 4XV1A 4CFFA 1ST0A 5EG3A 3TNHA 4LFIA 5IA1A 3EQFA 1U46A 1FGKA 4MD7E 4YP8A 3R7YA 3TKUA 3F5GA 2KULA 5IQGA 5HEZA 2YIYA 3DXPA 4FZ6A 4O7WA 5IQHA 5E8UA 3R9HA 5HTBA 2B9IA 5HORA 5IF1A 2R0UA 4IFGA 4UN0C 5IH6A 2OJIA 3EN4A 4FTAA 3UC4A 2ITXA 4D28A 4S30A 4DEBA 3I5ZA 2G01A 1XWSA 5JFXA 2PVFA 1MUOA 4CKIA 4ZTSA 3V6RA 3VAPA 4BWPA 5IQIA 4PMTA 4IB5A 2YDJA 4UZHA 4WRGA 3ZRKA 3BU3A 4DEAA 1B38A 5LMKC 2JKQA 3IW6A 4N6YA 1E1VA 3FMHA 2XNOA 3GI3A 4NTTA 4UWCA 4XG7A 3GOPA 3ROCA 3RZBA 4KBKA 5LCKA 3VUMA 4QYFA 3P1AA 4LMUA 5HLWA 4LQMA 4HOKA 2QOCA 2XS0A 2CKPA 3OY1A 5BV3A 4EEVA 2W9FB 4YHFA 1ZYDA 3O0GA 1Z9XA 1YOLA 3W8LA 4DG0E 3FE3A 4XRJA 3VVHA 4AOTA 2BZKB 4O4BB 1OIQA 4F1MA 4DGLC 3RPVA 4FSZA 4F65A 4IVBA 3FDNA 4M0ZA 4IZ5A 5CLPA 3V5JA 4XBRA 4M3QA 1JPAA