2FB8A

Structure of the b-raf kinase domain bound to sb-590885
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
272
structure length
259
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-Raf proto-oncogene serine/threonine-protein kinase
publication title Demonstration of a genetic therapeutic index for tumors expressing oncogenic BRAF by the kinase inhibitor SB-590885.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 259
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2fb8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2fb8A01
3BHTA 3QGWA 3GCUA 4QOXA 2GHGA 1FPUA 2WQNA 4PP7A 3VJOA 5HORA 5LMKC 3I60A 3QD3A 3FEGA 4F7NA 2W1IA 2IZSA 4ZK5A 3DJ5A 3VNTA 5TE0A 4FZAB 2ITOA 4D1XA 5HVKA 2PPQA 3UC4A 5CQWA 1BKXA 3VUHA 3HRFA 5M09A 2OH4A 2A27A 4E93A 1IA9A 3VWAA 4C61A 3OUKA 4GU9A 4A4OA 3UZTA 1PYXA 4YJQA 3WF6A 4ACMA 5BUIA 4IVCA 3W32A 3GC9A 3PJ3A 3H0YA 1YI4A 2X8IA 3LFBA 4G5PA 2OXYA 4BDJA 1TQMA 2WNTA 1J7IA 3OWPA 3ZFXA 2QOBA 5DN3A 2HZNA 4ALUA 4J71A 5DR6A 2ZV8A 2HYYA 2UZEA 3MVJA 4R8QA 4YLLA 5CYIA 2R3IA 2C3JA 3ZC6A 3DDPA 4UV0A 3SQQA 1Q3DA 4EZ7A 4EH6A 3BBTB 4EOKA 3ACKA 4L7SA 3RBWA 4ANLA 1G5SA 3DCVA 5ANJA 4BBEA 3U87A 2R0UA 2Z7LA 4D2PA 4YZNA 1ERKA 2I6LA 4PDOA 2QOHA 3U6IA 4GYIA 5HBHA 3QL8A 4NL0A 5CSVA 1O6LA 4IQ6A 4JXFA 5M57A 2JKQA 5B2MA 4OTIA 4ZSAA 5AP2A 2WZJA 3MTFA 4H36A 5IISA 3D4QA 3NEWA 4NM0A 3FLWA 1QCFA 4RVTA 2LAVA 3TEIA 4AP7A 2Y4PA 3CLYA 4WRSA 3G0FA 5HD7A 4O7SA 3QWJA 2UW3A 5BVOA 3R9DA 1OECA 2VWXA 2C0IA 3R2YA 2EWAA 4PMTA 1YWVA 3VQUA 3MBLA 3RKBA 5GIPE 1RW8A 3LHJA 3QRIA 5EYKA 4AACA 4QPMA 2YM5A 4LUEA 3ORIA 2DYLA 2XBAA 5J5SA 4R7IA 1BX6A 3UC3A 2VO0A 1VYWA 3QQLA 3UO6A 4MNEB 2YLEA 5DWRA 2BRMA 4FYOA 3ZMMA 1KE9A 5I9YA 5J1VA 3AC3A 4IAKA 3EQRA 4DGMA 2CKOA 2YIYA 4YPDA 5LMKA 5KUPA 4V05A 3HP5A 3PIXA 3EYHA 4F9YA 3W2QA 5DH3A 4Z7GA 3HGKA 4Q9SA 2OK1A 4MHAA 3MVMA 1OITA 1P2AA 4FGBA 3TZMA 4TL0A 5KBRA 2GS6A 2E9NA 2VGOA 3TXOA 5IA1A 2H96A 3KK8A 2VU3A 2QR7A 4RMZA 2WMWA 3ORNA 4QQCA 3R9OA 5FP5A 4DFNA 2FSOX 3WARA 2WMAA 1V0PA 2VWIA 4NK9A 1E9HA 4MX9A 4EK3A 3RK7A 3PLAE 4MKCA 4DHFA 2QO9A 3C4EA 1YXSA 4E8AA 4DTKA 2YWVA 2WTJA 3Q9ZA 4GT5A 2ITXA 3PG1A 3E8NA 4KB8A 4O0TA 4X0MA 3W2PA 1J1CA 2XA4A 3IK3A 4KIPA 3MVLA 1ZMWA 4EONA 1ZAOA 3ORTA 3A8XA 4JIAA 5CY3A 3NCZA 2ZMDA 3OC1A 5DE2A 4F7JA 4I4EA 3FPQA 3LW0A 3MW1A 3WF8A 5BQ0A 2OZAB 4I5CA 3FXZA 4AFEA 2YWPA 4LL0A 3LFQA 4G1WA 1DI8A 4YJVA 5F95A 4AE6A 3KB7A 3B8RA 4GG7A 2BCJA 4H3PA 3PA5A 5E8TA 4R5YA 1URWA 4GFGA 4CTBA 5L3AA 4CD0A 4DINA 1UNGA 2GHLA 5EM5A 2R3HA 2YERA 3PJCA 1NVSA 4QMXA 4DEBA 1H24A 4F99A 2CCHA 3B8QA 2F7XE 4MWHA 4PPCA 4DH1A 4HVIA 2OIQA 4YR8A 2CGXA 2PMOX 1QPDA 5AWMA 4W4XA 4ZZMA 2J90A 1W7HA 3KRRA 3EQIA 3TV7A 3OFMA 4I23A 5CEQA 4ZS0A 4ZY4A 2G2HA 2XCKA 4QP1A 3ANRA 2FA2A 1Q8ZA 2FSTX 5EW8A 4RX8A 1VR2A 1MUOA 2EB3A 4ZY6A 4UYNA 5K0XA 4CKRA 1NXKA 5AR3A 2WKMA 3D2IA 3MB6A 3A60A 3FXXA 4NT4A 2PYWA 5FWKK 5FD2A 3LM5A 4QMPA 4L3PA 3NSZA 1B38A 4CZYB 3JVRA 4XG6A 3W8LA 5L4QA 4ANBA 1M2QA 5EKOA 4WIHA 5IA4A 4DGNA 3HA8A 1BLXA 2R5TA 1OPJA 2XNGA 3HEGA 4EOIA 3AT2A 5A9UA 5JFXA 1OKVA 3QF9A 4KRCA 4R7HA 4CFXA 3JY9A 3FLZA 3P23A 3Q9YA 3DQWA 3SX9A 4BTJA 3C0IA 3VS2A 2G1TA 3TNHA 4DC2A 3VBXA 3NNUA 3HECA 3P9JA 1IR3A 4N0SA 1W84A 5CF4A 2ITNA 2XK9A 1O6YA 3FL4A 1YXXA 2YJSA 3E62A 3PSDA 1UNLA 5M4FA 4NW5A 3DJ6A 3NW5A 4HZSA 3ULIA 2OXXA 3ZLSA 4TYHA 2WIHA 4U9AA 4DFUA 4RWLA 2XK8A 5BVFA 4ZMEA 3WE4A 3KA0A 1YVJA 4BDIA 4B0GA 4HNIA 5AV1A 2W1HA 3IECA 2O5KA 3OCTA 3PXQA 3W2SA 4NM7A 4JLCA 2OH0E 4MVFA 3ZLYA 3BX5A 1H1PA 4IEBA 5JFWA 1TVOA 5AAFA 4DG2E 3PUPA 1Y8GA 4CT2A 5E90A 2R9SA 3QZFA 4O2PA 4DEAA 4YBJA 2WIPA 2BTSA 4WNOA 4C4IA 4IM3A 4ASEA 4DFYA 3FPMA 4FSRA 1PXPA 3UIUA 3CSVA 2C0OA 3I5NA 3P86A 4F6SA 4YJOA 4EOMA 2X8EA 2ZJWA 1Q97A 4DH5A 5IQFA 3UQCA 1GZOA 4HCVA 2PVNA 5KNJA 4X6RA 3IDPA 3QXPA 4FV7A 3VS7A 3S4QA 4IJ9A 4D5KA 4CTCA 3O8PA 3IGOA 3MFTA 4ANNA 5BYLA 3PP1A 5I3OA 2VWWA 5IUGA 2IVUA 1SNXA 3FMHA 3NIEA 3KN5A 4AN3A 3ID6C 3P7CA 5CLPA 1Q4LA 4KWPA 4ZOGA 1WBNA 1CTPE 4IAYA 4IW0A 2QG5A 1M7QA 3LCOA 4C58A 2QQ7A 4A9UA 3EZVA 3FUPA 5AR2A 3SVVA 3O23A 3CQWA 2ZM4A 2BIKB 2OZOA 2PUUA 5CSHA 3G9NA 3GCVA 3QXOA 3ZO4A 2BRNA 4LGDA 4TT7A 5AMNA 3R8PA 1WBVA 5ANDA 1WMKA 2B1PA 5FBNC 3UTOA 4E4MA 2F4JA 3JPVA 2IZUA 2FVDA 3OMVA 3CPBA 5EM7A 4K6ZA 2XMYA 4GFMA 2OJFE 1W83A 2C68A 2G2FA 4ID7A 4O0YA 5HE3A 4FV1A 3VBYA 3FE3A 3LJ2A 3NUNA 2XYUA 4KBAA 3LIJA 2XJ0A 3K3JA 4M0ZA 5CF5A 3SOAA 4ZTNA 3F3VA 4XHKB 5CVHA 1H0VA 2XNPA 4H1JA 1IA8A 3BYUA 4HCTA 5EM8A 5GZ8A 1J3HA 4BY9E 3NGAA 4K33A 4CFUA 3P4KA 4BCQA 5BNJA 4ZP5A 3QYWA 4L43A 3Q2JA 4GIIA 2WTCA 4LV8A 3RTPA 2PVLA 4DH8A 5JGBA 3Q96A 2X6DA 3MY0A 3PXFA 1BYGA 1Q8UA 3OS3A 5CT7A 2OIBA 4F1OA 3W55A 4BIBA 4XX9A 3D83A 3QRUA 4YLJA 2IVTA 4EORA 3VUMA 2VTNA 3ETAA 4M69B 5JMSA 2DS1A 5DI1A 3LQ3A 3RHXA 3PTGA 4UX9A 2YCFA 2VAGA 2UW8A 3C4CA 4GS6A 5CVGA 5EDPA 2BKZA 4EHZA 5CZHA 1V1KA 3KREA 3RZBA 3SC1A 3CTHA 3DB8A 4AT5A 3DK7A 4G2FA 4I1ZA 5M55A 2W17A 3ZO3A 5ANOA 2C6TA 4C33A 3OWLA 4G9CA 3DFCB 5M4CA 4FEUA 2P33A 3LFAA 4HYSA 1YI6A 2BUJA 3FL5A 3NUSA 3LMHA 4GEOA 3HV5A 4U40A 3R7UA 5CEMA 3EKKA 3UOJA 1FGIA 3HMMA 4CQEA 3ZU7A 3V5JA 3W8QA 4UB7A 4DT8A 3NYOA 1UU3A 3O7LD 4AW2A 3QKMA 3HAVA 2F7EE 2WU6A 4IFGA 5IEYA 2H34A 3ZTXA 3ORZA 1OBGA 4M15A 5EI6A 2JDOA 1U54A 2GQGA 3LCTA 4JNWA 4YGAA 3RALA 2J9MA 1WFCA 5EYCA 4CMOA 3TZ7A 4LOQA 4HGEA 3OZ6A 2F49A 3SDJA 1YDSE 3NR9A 4PWNA 2BFXA 4I6HA 4EQMA 5I9VA 3EN4A 4CV9A 3SGCA 4KA3A 5KCVA 3SXFA 3BYOA 3R7GA 4EWHA 4YBKA 4GRBA 3EFWA 3FYKX 4ZJVA 4XG2A 3U9CA 1REKA 4OUCA 5FG8A 2HELA 4HVDA 3KK9A 4AOJA 4KS7A 3DDQA 5FEQA 4F6UA 4EH8A 4I94A 2PMIA 5EDRA 1CKPA 2OIDA 4FNWA 4QT1A 4WSQA 2RFNA 5AM6A 2UV2A 4AUAA 2QOKA 1HCKA 2OJ9A 2ZAZA 4FG7A 4IACA 1FVRA 4J97A 1HCLA 5DLSA 4CFMA 4IVAA 1DAWA 3DAJA 2X8DA 4CEGA 2B7AA 5LVLA 4YC8A 3NNWA 3V3VA 1ZOHA 2J5FA 3VJNA 4A06A 4NYEA 1WVYA 2HK5A 2J5EA 3QTRA 2BZIB 3KRLA 4IM0A 3KL8A 3F6XA 4RBLA 4YJTA 3TV4A 3A61A 1SMHA 2JIIA 2R7BA 1OPKA 4KRDA 1CMKE 4MH7A 5CU6A 4AZSA 4EH2A 4O0UA 5LCJA 3CR0A 4D28A 1IAJA 4UMRA 2R4BA 3FI2A 3W33A 5KMOA 3FMNA 5IH4A 2QURA 3VW6A 1P14A 5FBOA 4QP3A 5BYZA 5IH6A 3PWYA 4EOSA 4G3FA 2GU8A 4RWIA 3KQ7A 3FXWA 2V7OA 1XKKA 4KKGA 2J50A 5CNNA 4K18A 3T8OA 3W16A 4M7IA 2VTTA 5CI7A 4PPAA 5J5TA 2XIZA 3G6GA 4P90A 4YNEA 3ZLXA 4RVMA 1R0PA 2ETRA 2BAKA 3OEFX 4FK6A 4JG7A 3CD8A 4JG6A 4L52A 4YNOA 3DKGA 4IB3A 2YN8A 3V6SA 3VS5A 2YM3A 1OIYA 4ACHA 4AOIA 3UG1A 3NUYA 4HGTA 5HE1A 4CYIA 2YZAA 2OICA 1IEPA 5FXSA 3FSKA 2OZAA 4MBIA 2WMXA 5HG5A 5K0KA 3L1SA 1UU9A 2WMVA 1ZMVA 4NFMA 3UO5A 3DPKA 3UBDA 3BLQA 1P4FA 3DTWA 4G16A 4DYMA 3VIDA 4QNAA 3ZO2A 2ZM3A 4FKTA 3WYXA 3NAYA 5E1EA 3ZS5A 4AW0A 1UU8A 3FLQA 2YM6A 4H3QA 4IHPA 4QQJA 4UXLA 5IA3A 5K4JA 4CFFA 4ENYA 4L9IA 2X7OA 3LFCA 4IH8A 4L42A 4OTFA 5EI8A 4IVDA 3Q6UA 4XCUA 2OXDA 5HG7A 1M7NA 3K5UA 2BR1A 5GHVA 2V0DA 4OBQA 4UBAA 2ITVA 5CXHA 4I6BA 3KFAA 1GIJA 2JIVA 2RL5A 2PZ5A 3V04A 2ZMCA 4NW6A 4II5A 4AA4A 4IX6A 5E1SA 5DA3A 3HYHA 4WUAA 3EH9A 4A7CA 1JNKA 3FZRA 3V8WA 4R6VA 5HX8A 4RG0A 3ZSIA 3CP9A 2XH5A 4AW5A 4TYGA 2X0GA 2J0IA 3Q3BA 3LOKA 4E6AA 5LWMA 5J9LA 2CKEA 2CGUA 4E6CA 3C0GA 3REPA 3EFJA 2FH9A 3TACA 4D0WA 4CVAA 2ONLC 2YM4A 3HUBA 3OCGA 3HMIA 4IX4A 1ZY4A 1YWRA 1UWJA 2E9PA 3ZSGA 3HA6A 1OZ1A 1R1WA 3P7AA 5J7HA 3Q5IA 4WG3A 2BPMA 5L6OA 5FM3A 3VULA 5EI2A 2XKFA 3HUCA 4IB1A 4ZTHA 4EK4A 4BDFA 3HV7A 3BYVA 4LRMA 4Z7HA 2WOUA 5CSXA 4LRKA 3QUEA 1M2PA 2EUFB 2ETKA 3E92A 4FKPA 5AIRA 4RZWA 4AG8A 5IMXA 5AAGA 5E8SA 3FV8A 3E8EA 5AUYA 2E9OA 4F64A 4RIYA 4E4XA 2YJRA 4ZLZA 4ZZOA 4ZTQA 5J9ZA 4AWIA 3QD2B 4GK4A 3TUDA 4O7WA 3PJ8A 4FKGA 2OF4A 3DA6A 1YOLA 4FIIA 4CFVA 3S00A 3BQCA 5J8IA 1KOAA 3DU8A 4B8LA 4J8MA 3ZO1A 3Q2MA 4CV8A 1H01A 2W7XA 4RC2A 3QHRA 3E64A 3GXLA 4QPAA 4IJPA 4PUZA 2PMNX 5ANIA 2P4IA 3NRMA 4H1MA 3FJQE 3GCQA 4O96A 5AUVA 3R22A 2IVSA 3LCSA 3MA3A 3A7IA 5TKDA 5KMJA 3H4JA 3FMDA 1JKKA 4GIHA 4IWDA 3I6UA 2IZTA 4OW8A 4U43A 5FTOA 3G2FA 5HO7A 3NUPA 3KC3A 4WSYA 2WMUA 4APCA 3BV3A 2VTIA 3DKCA 3QKKA 5CALA 1REJA 2BILB 1W98A 2Y6OA 4XV9A 3ZC5A 4A4LA 4D2VA 5LVNA 1H26A 3EIDA 4L3JA 4YMJA 3MFUA 2W1EA 3DNEA 3KN6A 3ZXZA 3KVWA 4EYMA 4FL3A 4MYGA 2WAJA 1TQPA 4X3FC 3V5PA 1XH4A 3KF7A 3ZDIA 3KVXA 5CENA 3LKMA 3P5KA 2X7FA 4FR4A 4RQKA 5T3QA 4FF8A 4RA5A 4AE9A 1Z57A 2YCRA 4TWCA 3QQHA 4CGAA 2BMCA 1ZOGA 4TNBA 4AZEA 2C69A 1I44A 2ZVAA 4U81A 4XG3A 2XKCA 3DS6A 3TWJA 3MV5A 4TYHB 2ITPA 5AUXA 3EQHA 1PKDA 2BIYA 2C30A 4ALWA 1JKLA 5CU3A 4YJPA 4BI1A 3MN3A 2CSNA 3W18A 3IDCA 2YM8A 2B9JA 3SG8A 4BTFA 2HCKA 2PVMA 1XO2B 4E6QA 4ZSGA 1NVQA 3OCBA 5H2UA 1A9UA 5HTCA 4DEIA 2GTNA 3A7HA 1U5RA 5EM6A 4B7TA 3OY3A 4BCFA 2E9VA 5LVMA 1PXJA 1Y8YA 3FWQA 4Z3VA 2UZUE 2WEIA 2IW8A 4R78A 2FB8A 4FTLA 3AC8A 3RNIA 2RG5A 3QQJA 2F7ZE 3C4FA 3D7ZA 3II5A 3CPCA 3P0MA 4PRJA 5BPYA 1UA2A 3PIZA 1YHSA 4PTEA 4M69A 3I79A 3N4TA 4CMTA 4U7ZA 4L67A 4NH1A 3BU6A 1OIRA 3PPJA 4B99A 4U41A 4WBOA 1AD5A 3WF9A 3DLZA 4MF1A 4XOZA 4FKUA 2PU8A 5D7VA 3NMUF 2BZKB 5AADA 2JITA 1F3MC 3FSFA 1W0XC 3PJ2A 3QQKA 4QO9A 5DGZA 4BL1A 5KMKA 1QL6A 3FQHA 4RJ8A 3F3ZA 3LXLA 3E63A 3G51A 4MTAA 3LFFA 3VUIA 1XR1A 2P55A 2YEXA 4IDVA 4B9DA 5ETIA 5IQBA 2JDRA 3O0GA 3R04A 3IOKA 3D94A 4NKSA 5HU9A 4CG8A 4PMMA 1XH7A 4NZWB 1JKTA 1ZOEA 4AGCA 1YW2A 2A0CX 3HMNA 3OTVA 2GCDA 4H05A 3GCSA 3RWQA 2C6KA 2I7QA 4G3GA 2VTSA 3V5QA 3KCKA 4DE4A 4X3FA 3OBJA 1V0OA 4IX5A 3D5UA 4FX3A 2SRCA 2W9ZB 2XRUA 3H9RA 5CU2A 1E1XA 1GZKA 4I6QA 3D5WA 2JAMA 2F2UA 4JDJA 2XK7A 3A99A 3QX4A 5HG8A 3RK9A 2J0LA 3SAYA 5CXZA 5CU4A 3QGYA 4X21A 5AR5A 3VN9A 3Q9WA 2X9FA 5EHLA 2QD9A 4JJRA 3NCGA 3ORLA 5HNGA 3ERKA 4PP9A 4M8TA 3CY3A 5BVWA 3UNKA 3OY1A 4U42A 4LOOA 2G9XA 1G8SA 1Y57A 4BDGA 1GZNA 4FTIA 3DJ7A 4EUUA 3NAXA 2W5BA 2G01A 2VRXA 3RPRA 4IAZA 3HZTA 1DI9A 1Y6BA 3GVUA 2BAQA 2JFMA 4KNBA 3IPHA 4BGHA 1PF8A 2ITTA 4NTSA 5EG3A 5B0XA 4J7BA 4X2GA 4I5PA 5IG1A 4FSYA 3PRFA 4IVBA 5IQAA 4I3ZA 4L68A 3UDBA 5KO1A 2J0KA 3C7QA 2XP2A 1KOBA 2W9FB 3N4VA 3LPBA 3UZRA 4FSQA 4KINA 2CGWA 4R1VA 2PVJA 4HYIA 2Y9QA 4C37A 4EH9A 4EOPA 3THBA 4Z16A 2HY0A 3UP2A 3PWDA 4BB4A 2WOTA 4F0FA 4QMTA 5ITAA 2W1DA 3I5ZA 4MCVA 5EW3A 4JQ8A 3E88A 3QCYA 4JX3A 3HL7A 4PX6A 2X39A 2OWBA 4WG4A 3KXMA 2P2HA 2Q0BA 1YRPA 1U54B 3QZHA 4ZJIA 2X2MA 5HLWA 3W2OA 2C0TA 4FUXA 3I0QA 2X2LA 2CMWA 4K8AA 1MRUA 3QRKA 2XK6A 3OCSA 4M13A 5TO8A 1UV5A 2AC5A 1UU7A 4FL2A 2I0VA 4RGJA 2VTPA 3F3WA 4HNFA 4DG0E 1FBNA 5IQDA 3ZZWA 4RSSA 3KKVA 4O7VA 4LV5A 2PUIA 4FTKA 4AQCA 3GQIA 5E7RA 4F0IA 5A46A 5LOHA 4MBLA 1BI7A 1M52A 2C6LA 3DZOA 4O0WA 5HNBA 2VWYA 4RPVA 4F9CA 4PPBA 3I6WA 4EKLA 3Q9XA 5JK3A 5HICA 4E26A 4FKOA 3IW5A 4P7EA 2QLUA 3GFEA 4BCGA 1Q3WA 2Z8CA 4OTGA 3DT1A 5LCKA 3HLLA 2GQSA 3UOLA 3T3VA 2QG7A 3UMWA 3GU8A 5E92A 3IOPA 3COMA 3RPOA 4XNEA 2GNIA 4S2ZA 4S30A 5F4NA 4RZVA 4GMYA 1OKZA 4YTFA 3NVMB 1MRYA 1ZARA 5BUEA 2W06A 4FBXA 2QU6A 3PPZA 3WBLA 1YQJA 3DTCA 5KMIA 3ZOSA 2XNOA 4D4VA 2QKRA 4FSUA 1NA7A 4LMUA 3RAIA 1YHVA 3V5TA 2QCSA 2VGPA 2WMRA 3R6XA 2P2IA 4KBKA 5BVDA 4U80A 3GT8A 4ITIA 1GIIA 4GSBA 5CS6A 3RPSA 4EWQA 2X1NA 3K2LA 4NKAA 2YHVA 4YO4A 4GK2A 4M68A 5H3QA 3R8ZA 3O71A 4FKJA 2OG8A 2PVKA 2F9GA 3R63A 4L00A 4O7NA 5M06A 2FSMX 2OSCA 1WBWA 4G5JA 4LGHA 4MK0A 4C4HA 3WZDA 5DRBA 5BVNA 2BTRA 2H6DA 1H1RA 5F9EA 4FKLA 4AN2A 4YURA 3LLAA 1FMKA 2HWPA 3WZEA 4YLKA 2PTKA 4W9XA 5FXRA 5HBEA 4FIJA 2ERZE 4X2JA 3F2RA 3UG2A 2CN5A 3QD0A 5ANKA 4M3QA 2P3GX 4F9AA 2VZ6A 2O64A 2W1GA 3CKXA 2VNYA 4BBFA 5AP3A 4RIOA 3EFLA 3ZFMA 2CJMA 5M56A 3V6RA 2R3OA 4E6DA 3A4PA 5EKNA 4R3CA 3VS0A 4WO5A 4BR3A 5L2WA 2GPHA 3CE3A 4FKIA 2G2IA 4FTCA 3OXTA 1H4LA 4C3PA 1X8BA 1V0BA 1F5QA 1GIHA 3H10A 5FDXA 4QYGA 4WNKA 1MQ4A 3RZFA 5HNIX 4EZ5A 4U3YA 3V8TA 5A4TA 3SW7A 5EQYA 4WBBB 4YSJA 1RE8A 2JKKA 4IWOA 4WG5A 3SKCA 3U6HA 4YHFA 1XQZA 1Z5MA 2A1AB 3F2AA 5D12A 3VS6A 4C02A 3BZ3A 4ZLOA 3C4WA 3QX2A 4NU1A 4F65A 4B4LA 1LEWA 2YISA 2GHMA 4BN1A 3KMWA 5BYYA 1PYEA 3EMGA 3CC6A 1ZYJA 5AAEA 3O8TA 4D58A 2QR8A 3PXKA 4FEWA 3CTJA 4NJ3A 2BHHA 4U0IA 4G3EA 4PNIA 5HQ0A 3OXIA 3WILA 5L6WL 4X3JA 3SV0A 3ZRLA 1VZOA 2ZDUA 5AV0A 3FI8A 4FKWA 4FTOA 2VTRA 3QLFA 4FT3A 4UXQA 4FNYA 5A14A 1PMNA 2H9VA 3P1AA 3MJ2A 3VC4A 4ASDA 4EH5A 1CKJA 4IIRA 3E5AA 4XS2A 4L45A 1GNGA 1KE5A 3RGFA 2V55A 4C3FA 5CAPA 1XBAA 2YLFA 3DK3A 3GB2A 3LVPA 4GCJA 3CQEA 5DBXA 1JSVA 4GW8A 4QPSA 4RIYB 2X7GA 5D1JA 3EL7A 2O0UA 4I41A 4TZRA 1VEBA 2QHMA 4ACCA 4LQMA 4FKVA 4Z55A 4CQGA 4PMSA 4RFYA 4DFZE 4BDAA 4AGWA 4IZ7A 3NW6A 3RINA 2EXEA 2R3KA 3FC1X 4GUEA 4RRVA 4YZMA 2RFEA 2EVAA 4O7YA 3FY2A 4USDA 3UQGA 4PNKA 5F20A 4FKQA 4D9UA 4GJ3A 2WTVA 4MXOA 3U8WA 3NUAA 4KSQA 4BDBA 4BI2A 4UMQA 3OOMA 2GMXA 4O7LA 4ZY5A 4JQEA 3VAPA 4R7BA 5AP7A 2XKDA 2HWOA 2VTOA 3L9MA 3QQUA 5KMNA 5LWNA 2REIA 3KXHA 5C4KA 2WPAA 3FZSA 3R1YA 4TYJA 2HZIA 4MQ2A 4ANQA 3A62A 3FZTA 3V8SA 5F1ZA 4Y5QA 4G3CA 3LJ1A 3ZEWA 4AZTA 3PY0A 1Q5KA 4ZS4A 3TUBA 2PZYA 2UW4A 2I40A 2WXVA 2C47A 3ROCA 4TTHB 4EL9A 4QMVA 5DMZA 5IQHA 4I0SA 1OL6A 3DXNA 4KIKB 2V5QA 3BHHA 3D5VA 4HPTE 2UZNA 4YZ9A 5TR6A 4CCUA 5C8NA 4FMQA 5HTBA 4FV4A 5IU2A 2ITQA 3SHEA 4X6QC 2GTMA 2OI4X 2ZV9A 3TV6A 3UQFA 2QOFA 4G3DA 2EU9A 4C7TA 4XOYA 4EBVA 2GNLA 5L2QA 1GOLA 3P79A 3GOPA 2YIWA 2OJGA 4KAOA 2PY3A 1HOWA 4Q2AA 3R7IA 4FT5A 4A9RA 2GNGA 4D2RA 4PY1A 3TNIA 3NYVA 5J87A 3NPCA 4O27B 1UNHA 2QKWB 3PRIA 3PVGA 4AFJA 1GAGA 1CDKA 2R3JA 2CGVA 3EQPA 4D55A 2EXMA 4KIQA 4I24A 2PULA 4A9YA 2YAAA 3KCFA 4O0SA 5DVRA 4YUQA 5HTIA 3OROA 1FVVA 3F66A 4UY9A 4HVHA 4C4GA 4KBCA 4LGGA 4YHTA 4CLJA 2R3GA 1WZYA 4FIGA 3EWHA 3TIYA 3WF7A 1PRYA 3DAEA 3A8WA 3ITZA 4FIHA 3FDNA 2JAVA 5AX3A 3DBDA 3MPMA 4CSVA 3OW3A 2UW0A 3F7ZA 3GENA 3NYNA 3Q32A 4C3RA 4ERKA 3GU7A 4FI1A 4HOKA 4FZ6A 5TF9A 4DFXE 1UVRA 5GNKA 5EK7A 2PWLA 4OR5A 3R7VA 2O65A 3KXZA 3TZ9A 3BE2A 3MA6A 4O6EA 4QP4A 2IN6A 3LFEA 4QMUA 4EH7A 2EXCX 2GS2A 1U46A 5JRSA 1H8FA 5FEEA 2HENA 4XYFA 4DTBA 2XK4A 2CPKE 4J99A 5A3XA 4XH6A 2ESMA 3DFAA 1PMVA 1T45A 3F61A 1KV2A 4HJOA 4TY1A 3NVKI 3AC5A 2IG7A 4YO6A 5I0BA 4FNZA 2DWBA 4UWYA 4QMMA 2Y6MA 5FXQA 3V01A 4RVKA 4RJ5A 3TKIA 4FV2A 2QONA 3IS5A 3PVWA 3ELJA 3ULZA 4XLIA 2IJMA 2JFLA 2RGPA 2OLCA 2HIWA 4CT1A 3S1HA 1ATPE 3EN7A 2VTMA 3GUBA 3KMMA 1YOMA 4XRLA 3R8MA 3U4WA 3Q04A 3PVUA 4BDKA 1W8CA 3LXNA 4JBQA 4K2RA 3I0OA 3OHTA 2Z02A 4AT4A 3I1AA 3QCXA 1J1BA 4JS8A 3DBEA 3GU4A 2VX3A 4FG9A 4LOPA 1MRVA 2WQMA 3ANQA 4AZFA 3HDNA 3MSSA 4N57A 4WNPA 3GFWA 3CBLA 3MB7A 4X3FB 5I5ZA 5FLFA 4FEQA 5G6VA 2CLXA 2O2UA 2XNEA 3M42A 5CTPA 2VWBA 5M4IA 1O9UA 3QFVA 4CXAA 1KE8A 1WVWA 1UKHA 1WBPA 2B9HA 2OKRA 4AZWA 2V22A 4AU8A 5CT0A 2XIKA 4ANOA 3L8PA 4U3ZA 4H39A 4RX9A 4DA5A 4Q5HA 5HCXA 3FMEA 4YJSA 2JKOA 3NDMA 4AS0A 4K9YA 3AXWA 3TL8A 5A6NA 4I93A 4XP0A 4QP9A 3G0EA 3FMKA 4G6LA 3HNGA 3CTQA 2VTQA 5AM7A 4IAIA 4RT7A 5HIDA 2HAKA 1PXKA 3OP5A 1YHWA 2UW7A 4IC7A 3EN5A 2QHNA 4MD9E 1A06A 4MEDA 4P2KA 3WZKA 2HY81 4RWJA 5JEBA 2W4KA 1SYKA 2CCIA 3UPXA 4C4EA 1W82A 1URCA 5IA2A 4TYEA 5AP0A 3BU5A 5LMAA 3QZIA 1ZYDA 2XUUA 1H08A 3DOGA 4OTRA 4UALA 2OFUA 4X7QA 5IZFA 2QO2A 1BL7A 2VO3A 5EHYA 3WI6A 3JYAA 5JQ5A 5IMEA 2PMLX 1PJKA 5IKWA 1K3AA 2R3QA 3H30A 4BC6A 1YXUA 3BLHA 3BYMA 4LI5A 4BFMA 2ERKA 4QMLA 4FIEA 4AW1A 3QALE 4WD5A 5L8LA 3E7OA 2X4FA 5HI2A 2O63A 3D7TA 4BYIA 5KMMA 3LM0A 2GNHA 3TNQB 5CI6A 3ZRMA 4NSTA 1OMWA 3OVVA 5HE0A 5JZNA 4DFBA 3FI4A 1XJDA 3VS4A 3LJ0A 5DIAA 3A4OX 2WTKC 3EN6A 4QD6A 3R73A 2HXLA 3IGGA 3HAMA 2W05A 2VWUA 2HW7A 3O17A 3F3TA 4P4CA 3ZM9A 3CS9A 3TJCA 3FBVA 3ZRKA 5IA0A 3S3IA 4JOAA 3ZUTA 1Y91A 2WMBA 4PTCA 4FTMA 5IDPA 3CJGA 4JBOA 4YZDA 4QMNA 5BMSA 5CAUA 5HU3A 4FZDB 4J95A 4LMNA 4TWNA 5DR2A 3DKOA 4ACDA 2QI8A 4AGUA 2Z7RA 1E1VA 1PXIA 4RLLA 3VS3A 1OB3A 5B2KA 4BIDA 1ND4A 4E1ZA 5IQEA 4FOCA 3UIMA 4LRJA 4XG7A 4YJRA 3M11A 3TUCA 3F3UA 5AA8A 3IONA 4XMOA 3PPKA 2NPQA 4ZSJA 3EZRA 4DLJA 3NNXA 3EQFA 5FTQA 4PMPA 3ACJA 2W5AA 4QYHA 3UIXA 3R21A 3DBFA 4BZDA 5BUJA 2E2BA 5J7BA 1JAMA 3HKOA 4OBOA 5CVFA 5JRQA 3N4UA 1H1SA 3AMAA 5K3YA 5HO6A 5J95A 3F5UA 4FEVA 5DYJA 3BRBA 1OL2A 4M66A 3EYGA 4F09A 5CF6A 5M4UA 4GL9A 4WUNA 3K54A 3AGMA 3OT3A 5B7VA 3KRWA 4CZTA 5J79A 1Q99A 1K2PA 4BCHA 4ZLYA 2HW6A 1STCE 3OEZA 4RIXA 3UOHA 4IAAA 4J52A 1OM1A 3BGQA 3R71A 1UWHA 2DUVA 1WBSA 2B52A 3ZYAA 2XRWA 4IDTA 4RLKA 4ZTRA 3WF5A 3SG9A 4JI9A 4UMTA 5EH0A 5FRIA 3MPTA 3D9VA 2BZJA 2CHLA 5GIOE 4HYHA 3ZDUA 3DLSA 3FKOA 4GK3A 5AP6A 2PL0A 1KUTA 5CEOA 2ZB0A 4BZOA 3PVBA 2ITUA 1P5EA 4CFNA 3EN9A 3R8LA 4O38A 3IW4A 4GVJA 5K5XA 4H58A 4L7FA 1H00A 5LMBA 3CEKA 2XYNA 4FT0A 4QTEA 1M17A 3KXNA 4DBNA 2R3RA 4BWKA 3GP0A 5ACKA 2KTYA 3DXQA 5CAOA 2BFYA 3LCKA 5KKRC 5CF8A 1WBOA 3AG9A 2VUWA 3OT8A 4ASXA 1WVXA 3TTIA 4FT9A 2PVYA 5B2LA 5JGAA 2WQOA 5JSMA 1EH4A 3FZOA 5HCZA 4BCJA 4IZYA 1GZ8A 3POZA 4GKIA 1O6KA 4Y85A 3VBWA 3ZSHA 2VTLA 3BGPA 3QKLA 3ZCLA 3RMFA 3S95A 4BDHA 3BQRA 4AN9A 1GY3A 1XH5A 2PK9A 5DPVA 5IF1A 5JH6A 4ZXTA 2O3PA 4KIKA 2WTDA 2I0HA 4EK6A 3A7GA 3CY2A 4XV1A 3GEQA 2PZPA 4AXAA 4QMYA 4DEHA 2YM7A 3MIAA 4E20A 1J7LA 4WKQA 2VWVA 2H8HA 3F2NA 3GBZA 5GZ9A 2B0QA 3TJDA 3CQUA 3OW4A 2C6DA 2XNNA 1H1QA 3QAME 4FTQA 1AQ1A 1DAYA 3PA3A 3KULB 4ITHA 2C1BA 5EFQA 5IH5A 4L46A 3AC2A 2UZVA 1H28A 3FLSA 2IWIA 5E4HA 2IZRA 3DV3A 4KKHA 5TOZA 1H0WA 3DQXA 4YTHA 5HX6A 3C0HA 4FT7A 2W0JA 3RCJA 1YXVA 4PTGA 3QBNA 5LJJA 1YI3A 2E9UA 2VV9A 5ANGA 2YACA 1FVTA 2ONLA 4E3CA 3TDVA 4K11A 4C38A 1XH9A 2UZBA 3I4BA 3ZH8A 3P08A 1Q8YA 3POOA 3ENMA 2BDFA 4HVGA 3HV3A 4IM2A 3FZPA 2VWZA 4FVQA 3ZHPC 1OL7A 2NRYA 3JXWA 3W10A 2WELA 4C4FA 1FQ1B 2RKUA 5C03A 4MAOA 2AUHA 2BHEA 1PW2A 1S9IA 4PF4A 1OKWA 3RPYA 4F9WA 4CG9A 4PV0A 3BEAA 3EKNA 4EH3A 2JDSA 4GG5A 4FV5A 4ZEGA 4EK8A 1J7UA 3C5IA 5GZAA 1JSUA 4C35A 5A6OA 4J8NA 3FQSA 3L9NA 3AD4A 4I0RA 4IANA 5ICPA 1G3NA 4HYUA 3VQHA 3ZBXA 4YZBA 4ZSLA 4F7LA 4ZZNA 3LCDA 4MF0A 2HZ4A 2YFXA 1Q62A 1Q8TA 4FTAA 3OWKA 3S0OA 5E8WA 4F6WA 3VW8A 4HVSA 3GC0A 5L2TA 2VX1A 4QQTA 1YOJA 4WA9A 5DG5A 2RG6A 4FL1A 3SW4A 3QA0A 5LVOA 1U4DA 2XF0A 3OG7A 3VRYA 4K77A 4E4NA 4JT3A 3E3BX 3FAAA 1LEZA 2JD5A 3VHEA 4WT6A 2R3PA 3ORKA 3EFKA 4TYIA 3RJCA 5EQEA 2UZWE 1XBCA 3R7YA 1U5QA 4B8MA 4DCAA 2QODA 4N70A 4USFA 5I4NA 5DT3A 2BVAA 4LM5A 5AP4A 2RFDA 4PL3A 1A48A 4FV3A 5A4EA 5HZNA 4GKHA 4MXZA 4D9TA 3LLTA 3PLSA 5KBQA 2I0YA 3GNIB 3AMYA 5CANA 3VS1A 2YCSA 4XBRA 3HVCA 2BZHB 3OOGA 3OUNB 1LR4A 3DKFA 4YHJA 4BCKA 5FP6A 1NW1A 1KE6A 4TNDA 3TDWA 3C4ZA 4XLVA 3RWPA 1YDTE 2QOOA 1XH6A 2C3LA 3MDYA 3F9NA 3Q60A 4RJ6A 3UZPA 4BCMA 5C26A 1FINA 4MQ1A 3GQLA 2FGIA 5LARA 3IO7A 2Y4IC 4TKSA 5DEWA 1ZXEA 3WZUA 3AD5A 4ZTMA 4GV1A 4A9SA 4CFWA 4DEDA 3O2MA 1XBBA 4FYNA 4Y73A 5A4QA 4AT3A 2YDKA 3JS2A 2JLDA 4N6YA 4RIWA 4EHEA 3IDBA 4G6OA 4LFIA 4FG8A 4XV2A 3VF9A 3CIKA 2UW6A 3LFDA 3ODZX 2WU7A 3BV2A 4BHNA 3MVHA 4L8MA 2CNUA 2UZDA 3F5XA 3O51A 3R30A 3DNDA 2XNMA 3QD4A 3IW6A 1XWSA 5FEDA 5KZ0A 5CWZA 4EJNA 2DQ7X 1YDRE 2KULA 4NTTA 4QP6A 3NW7A 4CMUA 2CKQA 3NS9A 4YC6A 5KHWA 3O96A 2X9EA 2JBOA 1KV1A 3BU3A 2UVZA 4I5HA 3U54A 1RQQA 3CKWA 4FSZA 1I09A 3K3IA 1Q41A 3TIZA 3PG3A 4IADA 1SVHA 3G33A 1H1WA 1NY3A 4BDEA 3UPZA 1OBDA 1OI9A 1OKYA 2J7TA 4Y5HA 1JOWB 3H9OA 3TZ8A 4D4RA 4DGOA 5HE2A 5AR4A 4QYEA 5HBJA 4ZAUA 3OWJA 5M08A 4YC3A 5HESA 5AIKA 2XIYA 3BHVA 4X2KA 2IW9A 4FC0A 1JSTA 3QRTA 2UZLA 4D5HA 5ETAA 3R83A 4CKJA 3SD0A 5K4IA 4NIFB 5C4LA 3E7VA 4M0YA 1JPAA 5D9HA 5CU0A 4EZ3A 3MESA 2JGZA 5DEYA 3ZZEA 4EUTA 3WOWA 3PY1A 4J1RA 3UIBA 5H8GA 3PY3A 3AT4A 4IE9A 3V51A 2C6OA 3FC2A 3PSCA 3AQVA 4XJ0A 4A07A 1KWPA 3FMMA 4BDCA 3C5UA 1JVPP 3MH3A 4FV8A 4FOBA 2XEYA 4I6FA 2Y8OA 5D10A 1SVGA 2XCHA 4QP8A 3ZUUA 5A54A 3PXZA 2GSFA 3LFNA 1AGWA 1YKRA 3PZEA 4C62A 4W4WA 1U59A 1YXTA 2BDWA 3KXGA 5BVKA 5I9UA 3BHYA 3UMXA 4ALVA 3U55A 3R1NA 2XVDA 2QOCA 3DB6A 3Q4CA 3QUPA 3UYSA 1IASA 4ENXA 5HO8A 1LUFA 4OTHA 3PE1A 4DH7A 4DFLA 3NNVA 4UEUA 4LG4A 3TM0A 3FY0A 5AUZA 4QNYA 4BTMA 4RQVA 4MXCA 4BYJA 3NIZA 1OL5A 3EB0A 3RM6A 2YAKA 4K0YA 2C6EA 2WHBA 5EYDA 5HVJA 1OVEA 3QLGA 4WRGA 5JFSA 1MQBA 2C5VA 3O50A 4RVLA 5CNOA 3V5LA 4MD8E 3D7TB 2OO8X 3F88A 2WMTA 4EYJA 4AF3A 1QPEA 5DFPA 5AA9A 2C5YA 4DH3A 1PXLA 1OIQA 2P0CA 3QA8A 5HKMA 3UOKA 2G15A 3UVRA 4QTAA 4F0GA 3HX4A 2PUPA 4U79A 1DM2A 3ALNA 3TKUA 4OGRA 3F5GA 4D2SA 3R9NA 3QCQA 4EOJA 5KE0A 3LAUA 4UWBA 3ZEPA 4AA5A 3MJ1A 4U6RA 4QQ5A 3TG1A 4U5JA 4EC9A 4O1OA 3NWWA 3GI3A 3VF8A 3ZXTA 3ORPA 4OTQA 2BAJA 4O7RA 2PZRA 4KUJA 2JDTA 1JWHA 2XBJA 2CN8A 2V62A 2OBJA 4O91A 5F94A 4BICA 4IB0A 3JUHA 2JIUA 3Q4ZA 3VUTA 2ZB1A 4X2FA 2X2KA 3HV4A 4EK5A 5A4CA 1QPJA 1Q8WA 3PE2A 2GDOA 3QQGA 1KE7A 3MPAA 4M14A 3WZJA 3VRZA 5M44A 5EQPA 2R3MA 5HGIA 4FK3A 5AV4A 2J51A 2PVHA 4JL9A 5FM2A 4ACGA 2OU7A 1BMKA 4O21A 4E7WA 5E8YA 3UNZA 5CQUA 4QMQA 4GUBA 4AZVA 4YTCA 3WIKA 3GC7A 3EQGA 4FVRA 4TWOA 2FUMA 3IW7A 2C1AA 4FTTA 4BKYA 3R1SA 5HHWA 3OBGA 5AV3A 4JRNA 5KX8A 3COKA 3E8DA 5DR9A 4G17A 4QP2A 2OFVA 3QYZA 2HXQA 1ZYCA 3H0ZA 4ZIMA 4EJ7A 3AGLA 3QC9A 4MXYA 1PXOA 2UW5A 2VNWA 3AC1A 3HV6A 3P7BA 2QVSE 4JDKA 4AAAA 4BCPA 3N9XA 1P4OA 2A19B 3IQ7A 3K5VA 5IDNA 2AYPA 4RIXB 1QMZA 1CSNA 3KULA 4FSNA 4OTWA 5EYMA 2JEDA 3C50A 5CSWA 4EH4A 3CGFA 2NP8A 5LXMA 3LXPA 4NCTC 2YIQA 3G15A 3MGYA 4OT5A 1WBTA 3FI3A 3BYSA 4GT4A 4TPTA 4I92A 3D0EA 4GFOA 4D1ZA 4DT9A 3SLSA 5D7AA 3MH0A 1OGUA 1PHKA 2XS0A 4BCOA 2ITWA 1ZWSA 3ZONA 4FTRA 2WQBA 4RJ3A 1SVEA 1Q24A 2YITA 3KY2A 3EQBA 3HMPA 1M14A 4HPUE 4V01A 4YZCA 3EHAA 1ZYSA 5IPJA 1IG1A 4U45A 4W4VA 4XG9A 4BWPA 4DN5A 2WTKB 4YTIA 3OF0A 4I0TA 2IPXA 5HLPA 4APPA 3ZFYA 4MWIA 2WFYA 3QC4A 2C4GA 4UN0C 2QU5A 4O2ZA 4DLIA 3I81A 1UKIA 3KXXA 4I5MA 4BWXA 3R0TA 4FUYA 5E8XA 3RCDA 4XG8A 4BZNA 4YJUA 3VBVA 3SRVA 5IA5A 4EOOA 2IO6A 3MFSA 4NM3A 4Z9LA 5DT4A 2GNJA 2QO7A 4HW7A 3FYJX 4S33A 1VJYA 1ZRZA 3O8UA 2A4LA 2OJJA 2R2PA 3PYYA 4FSMA 4ASZA 4IFCA 4R5SA 3MI9A 5L2IA 1FOTA 5AV2A 5C1QB 2RIOA 3MS9A 4F08A 3C1XA 3IG7A 4JR3A 4V0GB 2BRBA 2PSQA 4UYAA 4C2WA 4ANSA 3QTZA 3RK5A 4C34A 2XZSA 3C9WA 1Q61A 3M2WA 2I1MA 2X81A 5IUIA 5IQCA 4UZHA 4R1YA 2VD5A 2B55A 4M84A 4BF2A 3VUGA 3QHWA 4FVPA 4P5QA 3QTIA 2YCQA 3RI1A 3KU2A 5C01A 4E5WA 3QTUA 4AA0A 4GU6A 2CKPA 3FQEA 2Z7QA 3FKNA 3L8XA 2HOGA 4RX7A 3UE4A 5JT2A 2X4ZA 3L8SA 3BWJA 4W4YA 4G31A 3LE6A 3WE8A 1M2RA 4OT6A 3BGZA 5L8KA 4BDDA 2PVFA 4LUDA 3NUUA 2QC6A 4IC8A 3PXYA 1FGKA 3P78A 5C9CA 5LVPA 4Y83A 4M67A 3BE9A 4BRXA 2GQRA 3GU5A 4UMUA 4Y8DA 1PXNA 3T9TA 3LQ8A 4NCTA 3EQCA 3A7JA 3DK6A 3CD3A 4YJNA 4PDPA 5DT0A 3HDMA 3T3UA 5I9XA 4IZ5A 5C8KA 5C27A 3OTUA 2B4SB 3QZGA 3DBQA 3O7LB 4FKRA 5GJFA 4O1PA 4PL5A 4GJ2A 3H9FA 3NX8A 4Q9ZA 3DXPA 4JAIA 4L44A 3BPRA 3U6JA 4W8EA 4BHZA 3FLYA 4RC3A 4QYFA 3QUDA 5M07A 3QTSA 1PMUA 1ZZLA 5KKRB 3B2TA 4MXAA 4ITJA 5ETFA 4ANMA 1F0QA 1APME 3B2WA 2GFCA 3SXSA 1SZMA 1ZY5A 2XM8A 4QMWA 2CNVA 4W8DA 5JQ8A 3JY0A 2C5OA 4OTDA 4QMOA 3VBTA 3FMLA 3KF4A 4DEGA 5TT7A 2NO3A 4D1SA 3I7CA 3M1SA 5GINE 3RHKA 3DZQA 2BKKA 4G6NA 4D4SA 3A7FA 3TT0A 1XH8A 4RA4A 2VTHA 4F70A 5L6PA 5EW9A 3G5DA 2BALA 3E8CA 4IWPA 4FICA 4M97A 4TWPA 4AGDA 4UMPA 5ANEA 4CNHA 2W1ZA 1DS5A 2LGCA 4OLIA 2VO7A 1WCCA 2FYSA 3F69A 3BCEA 3R9RA 2RF9A 5DHJA 3BI6A 1OUYA 5E91A 3EL8A 2W99B 4U97A 4YU2A 3BLRA 2OJIA 3CCNA 5M53A 2W4OA 2WD1A 3Q52A 4L53A 4MNFA 2R64A 4QTDA 3CJFA 4ZTLA 3F82A 3KEXA 3BELA 4FTNA 1WAKA 1Z9XA 5AX9A 3UO4A 3ZBFA 5CEPA 4BVUA 4F7SA 3MYGA 4DG3E 4NIFA 4FA2A 3PP0A 5FQDC 2R0IA 1BUHA 2W96B 2ITYA 4NFNA 1R3CA 4B6LA 2EB2A 1H25A 3ORXA 3UGCA 3E3PA 2WTIA 4C8BA 4EKKA 5H8BA 4OAVB 5ACBC 5HD4A 5K5NA 3Q5ZA 1H27A 2JKMA 3N51A 4HZRA 5AJQA 4Y95A 5E8ZA 1SM2A 3NYXA 4GVAA 4D4YA 5IUHA 4I4FA 3HRBA 3E87A 4U8ZA 2C5XA 3RVGA 2X6EA 4XG4A 5T68A 4IB5A 4A9TA 5L2SA 4JG8A 4RIWB 4C0TA 4EI4A 4DBXA 4DF3A 4TW9A 4BKZA 4FIFA 5BMMA 4L3LA 3VO3A 4ORKA 5M51A 4M12A 4YSMA 5AFVA 2PUNA 2WMQA 3W2RA 3CGOA 4O81A 4MNEA 3JVSA 4I21A 5DRDA 2PE1A 5IEXA 3HRCA 3NZ0A 2WB8A 4O7ZA 4RJ4A 2IVVA 4EQUA 4XBUA 2Y0AA 5HVYA 1R78A 3VVHA 4RFMA 3ENHA 2JC6A 4GYGA 4Y72A 2Z2WA 1LPUA 3FHRA 3MIYA 2C5NA 4MD7E 4QMZA 3PDTA 4CRSA 5BX0A 3LQ5A 5EOBA 3TN8A 4F4PA 5GJGA 5HEZA 1OPLA 5BVEA 3FHIA 4E73A 2XIRA 4O6LA 2ITZA 3F5PA 4I22A 1JLUE 2WGJA 3BIZA 3G9LX 4QTCA 3R2BA 4GT3A 4MXXA 4X2NA 4FKSA 3SA0A 3BKBA 4FEXA 1R39A 3F7WA 1R0EA 1BI8A 2C3IB 3FLNC 3PZHA 4FE2A 4IMYA 3ZLWA 3ODYX 3TNPC 4CYJA 4F1MA 1G8AA 2OF2A 3W1FA 1TKIA 2O8YA 4MBJA 2Y7JA 3OXZA 4F1TA 2C6IA 2VTJA 2XKEA 3HMOA 4H3BA 4WHZA 5JN2A 2XJ2A 1ZYLA 1YWNA 2Q0NA 3COHA 3MTLA 4FV9A 3W2CA 4D2TA 2WMSA 4EHGA 1J91A 2R3LA 4XV3A 2YABA 4TN6A 1RJBA 1H07A 4F9BA 5JZJA 2Z60A 4J53A 3D5XA 4NWMA 4PDSA 3QWKA 3UODA 4RC4A 1LP4A 2XJ1A 4J96A 4BGQA 5HIEA 1NT2A 4FODA 4NJDA 5E8UA 1OUKA 4NUSA 2OGVA 4IBMA 2QNJA 1JBPE 1ZZ2A 3EOCA 2JDVA 3MY5A 3R01A 4O22A 4C4JA 4R77A 2FO0A 4AX8A 5AP5A 4HCUA 4JIKA 1JKSA 4BBMA 3UP7A 5FTGA 4FTJA 3TKHA 2C3KA 2J2IB 3L9LA 3GOKA 2Y4IB 5K9IA 3RAHA 3DGKA 3MY1A 3COIA 4KD1A 2UW9A 5IEVA 2R3NA 4HGLA 5H8EA 4JDHA 3QQFA 1CKIA 4BGGA 3QTXA 1VYZA 3VHKA 4JQ7A 5JKGA 2ZOQA 4FGRA 5IQIA 4FNXA 1CM8A 1TQIA 4QRCA 4JBVA 1IRKA 3ATSA 3Q4UA 4EBWA 5EHOA 4QTBA 5HIBA 4NEUA 2UVXA 4GH2A 2GS7A 3R7EA 5FDPA 2W1CA 1QPCA 4J98A 4CKIA 2Q83A 3SOCA 4BCNA 4EOQA 5T6KA 1S9JA 3AT3A 2YDIA 2WQEA 3PSBA 5CSPA 3AMBA 3U9NA 1SNUA 1PKGA 4CCBA 5I9ZA 5ETCA 3PIYA 4FTUA 4D0XA 4KKEA 4S32A 3ZM4A 3ORMA 3DBCA 3JR1A 4ZMFA 2PVRA 4O0XA 4JVGA 4BKJA 3BWFA 4R3RA 4KS8A 3IKAA 2XB7A 4L01A 2YIXA 3ZUVA 3QRJA 5CASA 4IAFA 2W4JA 3A2CA 4S34A 3TI1A 4A4XA 3KRJA 4F63A 2YZLA 2XM9A 2UZTA 3KGAA 3LFSA 4I20A 5CZIA 2W5HA 5EOLA 5E8VA 3U4UA 4DGLC 2ZV7A 2BDJA 2VO6A 2WO6A 3ROYA 3CXWA 4DAWA 4EC8A 5KHXA 4LL5A 3WYYA 4O83A 2UZOA 2XK3A 5H9BA 2J0JA 3L9PA 2B53A 4BIEA 4BCIA 4YPSA 4JAJA 2QOQA 3Q6WA 4ZSEA 4E4LA 2PE2A 3R28A 4JR7A 2UVYA 2WTWA 4E5BA 4P5ZA 5CEKA 2GNFA 2J0MB 3G6HA 3I7BA 4D2WA 2XNBA 1Y6AA 4IX3A 2V7AA 5CX9A 3VUDA 4CZUA 3QTWA 3D2KA 3NUXA 4K1BA 4NM5A 4O82A 2J6MA 2R3FA 4V0GA 4RX5A 5I9WA 1OIUA 2NNWB 3L8VA 1JQHA 2ETMA 2RFSA 2UUEA 4KIOA 4KSPA 2FSLX 5CAVA 1L8TA 3U51A 2CDZA 3BEGA 2QOLA 5G1XA 3PJ1A 3DAKA 3PFQA 3KMUA 1BL6A 2BRGA 4ERWA 4XUFA 4UZDA 2A2AA 3KRXA 3T9IA 1ZLTA 4S31A 4N4SA 2IW6A 4EEVA 3BHUA 3ET7A 3MWUA 3IW8A 4UWCA 4IWQA 3R9HA 3S2PA 2C6MA 5FUTA 2VN9A 4KABA 1B39A 4L6QA 3RP9A 3ALOA 5D41A 5EDQA 2YA9A 3E93A 3QCSA 2WEVA 3OD6X 2B54A 4EHVA 1NVRA 3R1QA 4G9RA 4LYNA 4R3PA 4ARKA 4BTKA 4E5AX 4XP3A 3UNJA 5CAQA 5AR7A 3EJ1A 2F57A 5GJDA 3MFRA 4Y46A 5FGKA 5D11A 3VUKA 1PMEA 3PXRA 2ZV2A 1XHAA 4OTPA 5AUWA 2HZ0A 3UVPA 3LZBA 5DNRA 1IAHA 5AR8A 5JGDA 3ATTA 2R7IA 2YDJA 1L3RE 5AEPA 2B9IA 2F2CB 4BI0A 2ZM1A 3C4XA 2ZDTA 3LXKA 4RJ7A 4O0VA 4RWKA 3R8VA 2ACXA 3AOXA 5KZIA 5AUTA 4DTAA 5I3RA 3NLBA 4IXPA 2JBPA 4V04A 4WOVA 5HCYA 5IQGA 4ZJJA 3Q4TA 2PHKA 4QMSA 3GC8A 2OW3A 4XEYA 4XRJA 3SRVB 4YP8A 3BBWA 3RM7A 4FSTA 3TCPA 3G90X 5HOAA 5E9EA 2Z7SA 2B9FA 2CLQA 2PE0A 4QYYA 4EOLA 3D14A 2ZYBA 2VTAA 2BRHA 3DY7A 4JBPA 2W1FA 1FMOE 5J9YA 3RAWA 1PY5A 3LMIA 2BROA 3VBQA 3LMGA 3EQDA 4O0RA 4HGSA 4OBPA 1MP8A 4PL4A 2RSVA 5JFVA 2I0EA 3R00A 1KSWA 5L8JA 3SXRA 4N6ZA 3FMJA 3GGFA 4FZFB 3AD6A 4JX7A 5AUUA 2J4ZA 4C2VA 2NRUA 3PA4A 1OL1A 4DITA 4USEA 3MH2A 3D15A 3C13A 5C8MA 3RPVA 3H3CA 4TXCA 2PZIA 3TNWA 3GU6A 4U44A 3R7OA 2QLQA 3UVQA 3UYTA 3UJGA 4C36A 4PDYA 1B6CB 3FKLA 2AC3A 1GJOA 4WNMA 4CRLA 2CNQA 4G34A 4CLIA 4FSWA 4XP2A 4QP7A 2XEZA 5A4LA 2QOIA 4ONAA 1RDQE 3GCPA 4RFZA 1ZMUA 4JRVA 4FZ7A 4FV6A 5KMLA 3WIGA 5J1WA 3C51A 4AOTA 3R02A 4OAUC 4C57A 3RNYA 3V5WA 5DOSA 4PQNA 4FV0A 3MH1A 4DCEA 5HG9A 5CEIA 3R8UA 5HLNA 1K9AA 1PXMA 2YIRA 3TTJA 4DEEA 3QU0A 5LQFA 2VX0A 2GFSA 3HP2A 3QTQA 4Q5EA 4JDIA 4TRLA 3RAKA 1T46A 4O84A 2XIXA 4W9WA 4EQCA 4O7TA 4C59A 5AP1A 4DGGA 3AC4A 4O86A 4IZAA 3FZ1A 3Q53A 4ZTSA
chains in the Genus database with same CATH superfamily
3BHTA 3QGWA 3GCUA 4QOXA 2GHGA 1FPUA 2WQNA 4PP7A 1G8KA 3VJOA 5HORA 5LMKC 3I60A 3QD3A 3FEGA 4F7NA 2W1IA 2IZSA 4ZK5A 3DJ5A 3VNTA 5TE0A 4FZAB 2ITOA 4D1XA 5HVKA 2PPQA 3UC4A 5CQWA 1BKXA 3VUHA 3HRFA 5M09A 2OH4A 2A27A 4E93A 1IA9A 3VWAA 4C61A 3OUKA 4GU9A 4A4OA 3UZTA 1PYXA 4YJQA 3WF6A 4ACMA 5BUIA 4IVCA 3W32A 3GC9A 3PJ3A 3H0YA 1YI4A 2X8IA 3LFBA 4G5PA 2OXYA 4BDJA 1TQMA 2WNTA 4LDTA 1J7IA 3OWPA 3ZFXA 2QOBA 5DN3A 2HZNA 4ALUA 4J71A 5DR6A 2ZV8A 2HYYA 2UZEA 3MVJA 4R8QA 4YLLA 5CYIA 2R3IA 2C3JA 3ZC6A 3DDPA 4UV0A 3SQQA 1Q3DA 4EZ7A 4EH6A 3BBTB 4EOKA 3ACKA 4L7SA 3RBWA 4ANLA 3UDTA 1G5SA 3DCVA 5ANJA 4BBEA 3U87A 2R0UA 2Z7LA 4D2PA 4YZNA 1ERKA 2I6LA 4PDOA 2QOHA 3U6IA 4GYIA 5HBHA 3QL8A 4NL0A 5CSVA 1O6LA 4IQ6A 4JXFA 3W0MA 5M57A 2JKQA 5B2MA 4OTIA 4ZSAA 5AP2A 2WZJA 3MTFA 4H36A 5IISA 3D4QA 3NEWA 4NM0A 3FLWA 1QCFA 4RVTA 2LAVA 3TEIA 4AP7A 2Y4PA 3CLYA 4WRSA 3G0FA 5HD7A 4O7SA 3QWJA 2UW3A 5BVOA 3R9DA 1OECA 2VWXA 2C0IA 3R2YA 2EWAA 4PMTA 1YWVA 3VQUA 3MBLA 3RKBA 5GIPE 1RW8A 3LHJA 3QRIA 5EYKA 4AACA 4QPMA 2YM5A 4LUEA 3ORIA 2DYLA 2XBAA 5J5SA 4R7IA 3TYKA 1BX6A 3UC3A 2VO0A 4F78A 1VYWA 1ST0A 3QQLA 3UO6A 4MNEB 2YLEA 5DWRA 2BRMA 4FYOA 3ZMMA 1KE9A 5I9YA 5J1VA 3AC3A 4IAKA 4O4DA 3EQRA 4DGMA 2CKOA 2YIYA 4YPDA 5LMKA 5KUPA 4V05A 3HP5A 3PIXA 3EYHA 4F9YA 3W2QA 5DH3A 4Z7GA 3HGKA 4Q9SA 2OK1A 4MHAA 3MVMA 1OITA 1P2AA 4FGBA 3TZMA 4TL0A 5KBRA 2GS6A 2E9NA 2VGOA 3TXOA 5IA1A 2H96A 3KK8A 2VU3A 2QR7A 4RMZA 2WMWA 3ORNA 4QQCA 3R9OA 5FP5A 4DFNA 2FSOX 3WARA 2WMAA 1V0PA 2VWIA 4NK9A 1E9HA 4MX9A 4EK3A 3RK7A 3PLAE 4MKCA 4DHFA 2QO9A 3C4EA 1YXSA 4E8AA 4DTKA 2YWVA 2WTJA 3Q9ZA 4GT5A 2ITXA 3PG1A 3E8NA 4KB8A 4O0TA 4X0MA 3W2PA 1J1CA 2XA4A 3IK3A 4KIPA 3MVLA 1ZMWA 4EONA 1ZAOA 3ORTA 3A8XA 4JIAA 5CY3A 3NCZA 2ZMDA 3OC1A 5DE2A 4F7JA 4I4EA 3FPQA 3LW0A 3MW1A 3WF8A 5BQ0A 2OZAB 4I5CA 3FXZA 4AFEA 2YWPA 4LL0A 3LFQA 4G1WA 1DI8A 4YJVA 5F95A 4AE6A 3KB7A 3B8RA 4GG7A 2BCJA 1W2CA 4H3PA 3PA5A 5E8TA 4R5YA 1URWA 4GFGA 4CTBA 5L3AA 4CD0A 4DINA 1UNGA 2GHLA 5EM5A 2R3HA 2YERA 3PJCA 1NVSA 4QMXA 4DEBA 1H24A 4F99A 2CCHA 3B8QA 2F7XE 4MWHA 4PPCA 4DH1A 4HVIA 2OIQA 4YR8A 2CGXA 2PMOX 1QPDA 5AWMA 4W4XA 4ZZMA 2J90A 1W7HA 3KRRA 3EQIA 3TV7A 3OFMA 4I23A 5CEQA 4ZS0A 4ZY4A 2G2HA 2XCKA 4QP1A 3ANRA 2FA2A 1Q8ZA 2FSTX 5EW8A 4RX8A 1VR2A 1MUOA 2EB3A 4ZY6A 4UYNA 5K0XA 4CKRA 3W0QA 1NXKA 5AR3A 2WKMA 3D2IA 3MB6A 3A60A 3FXXA 4NT4A 2PYWA 5FWKK 5FD2A 3LM5A 4QMPA 4L3PA 3NSZA 1B38A 4CZYB 3JVRA 4XG6A 3W8LA 5L4QA 4ANBA 1M2QA 5EKOA 4WIHA 5IA4A 4DGNA 3HA8A 1BLXA 2R5TA 1OPJA 2XNGA 3HEGA 4EOIA 3AT2A 5A9UA 5JFXA 1OKVA 3QF9A 4KRCA 4R7HA 4CFXA 3JY9A 3FLZA 3P23A 3Q9YA 3DQWA 3SX9A 4BTJA 3C0IA 3VS2A 2G1TA 3TNHA 4DC2A 3VBXA 3NNUA 3HECA 3P9JA 1IR3A 4N0SA 1W84A 5CF4A 4DHZA 2ITNA 2XK9A 1O6YA 3FL4A 3AKJA 1YXXA 2YJSA 3E62A 3PSDA 1UNLA 5M4FA 4NW5A 3DJ6A 3NW5A 4HZSA 3ULIA 2OXXA 3ZLSA 4TYHA 2WIHA 4U9AA 4DFUA 4RWLA 2XK8A 5BVFA 4ZMEA 3WE4A 3KA0A 1YVJA 4BDIA 4B0GA 4HNIA 5AV1A 2W1HA 3IECA 2O5KA 3OCTA 3PXQA 3W2SA 4NM7A 4JLCA 2OH0E 4MVFA 3ZLYA 3BX5A 1H1PA 4IEBA 5JFWA 1TVOA 5AAFA 4DG2E 3PUPA 1Y8GA 4CT2A 5E90A 2XALA 2R9SA 3QZFA 4O2PA 4DEAA 4YBJA 2WIPA 2BTSA 4WNOA 4C4IA 4IM3A 4ASEA 4DFYA 3FPMA 4FSRA 1PXPA 3UIUA 3CSVA 2C0OA 3I5NA 3P86A 4F6SA 4YJOA 4EOMA 2X8EA 2ZJWA 1Q97A 4DH5A 5IQFA 4DHJA 3UQCA 1GZOA 4HCVA 3W0OA 2PVNA 5KNJA 4X6RA 3IDPA 3QXPA 4FV7A 3VS7A 3S4QA 4IJ9A 4D5KA 4CTCA 3O8PA 3IGOA 3MFTA 4ANNA 5BYLA 3PP1A 5I3OA 2VWWA 5IUGA 2IVUA 1SNXA 3FMHA 3NIEA 3KN5A 4AN3A 3ID6C 3P7CA 5CLPA 1Q4LA 4KWPA 4ZOGA 3BL9A 1WBNA 1CTPE 4IAYA 4IW0A 2QG5A 1M7QA 3LCOA 4C58A 2QQ7A 4A9UA 3EZVA 3FUPA 5AR2A 3SVVA 3W0SA 3O23A 3CQWA 2ZM4A 2BIKB 2OZOA 2PUUA 5CSHA 3G9NA 3GCVA 3QXOA 3ZO4A 2BRNA 4LGDA 4TT7A 5AMNA 3R8PA 1WBVA 5ANDA 1WMKA 2B1PA 5FBNC 3UTOA 4E4MA 2F4JA 3JPVA 2IZUA 2FVDA 3OMVA 3CPBA 5EM7A 4K6ZA 2XMYA 4GFMA 2OJFE 1W83A 2C68A 2G2FA 4ID7A 4O0YA 5HE3A 4FV1A 3VBYA 3FE3A 3LJ2A 3NUNA 2XYUA 4KBAA 3LIJA 2XJ0A 3K3JA 4M0ZA 5CF5A 3SOAA 4ZTNA 3F3VA 4XHKB 5CVHA 1H0VA 2XNPA 4H1JA 1IA8A 3BYUA 4HCTA 5EM8A 5GZ8A 1J3HA 4BY9E 3NGAA 4K33A 4CFUA 3P4KA 4BCQA 5BNJA 4ZP5A 3QYWA 4L43A 3Q2JA 4GIIA 2WTCA 4LV8A 3RTPA 2PVLA 4DH8A 5JGBA 3Q96A 2X6DA 3MY0A 3PXFA 1BYGA 1Q8UA 3OS3A 5CT7A 2OIBA 4F1OA 3W55A 4BIBA 4XX9A 3D83A 3QRUA 4YLJA 2IVTA 4EORA 3VUMA 2VTNA 3ETAA 4M69B 5JMSA 2DS1A 5DI1A 3LQ3A 3RHXA 3PTGA 4UX9A 2YCFA 2VAGA 2UW8A 3C4CA 4GS6A 5CVGA 5EDPA 2BKZA 4EHZA 5CZHA 1V1KA 3KREA 3RZBA 3SC1A 3CTHA 3DB8A 4AT5A 3DK7A 4G2FA 4I1ZA 5M55A 2W17A 3ZO3A 5ANOA 2C6TA 4C33A 3OWLA 4G9CA 4QEBA 3DFCB 5M4CA 4FEUA 2P33A 3LFAA 4HYSA 1YI6A 2BUJA 3FL5A 3NUSA 3LMHA 4GEOA 3HV5A 4U40A 3R7UA 5CEMA 3EKKA 3UOJA 1FGIA 3HMMA 4CQEA 3ZU7A 3V5JA 3W8QA 4UB7A 4DT8A 3NYOA 1UU3A 3O7LD 4AW2A 3QKMA 3HAVA 2F7EE 2WU6A 4IFGA 5IEYA 2H34A 3ZTXA 3ORZA 1OBGA 3PUFC 4M15A 5EI6A 2JDOA 1U54A 2GQGA 3LCTA 4JNWA 4YGAA 3RALA 2J9MA 1WFCA 5EYCA 4CMOA 3TZ7A 4LOQA 4HGEA 3OZ6A 2F49A 3SDJA 1YDSE 3NR9A 4PWNA 2BFXA 4I6HA 4EQMA 5I9VA 3EN4A 4CV9A 3SGCA 4KA3A 5KCVA 3SXFA 3BYOA 3R7GA 4EWHA 4YBKA 4GRBA 3EFWA 3FYKX 4ZJVA 4XG2A 3U9CA 1REKA 4OUCA 5FG8A 2HELA 4HVDA 3KK9A 4AOJA 4KS7A 3DDQA 5FEQA 4F6UA 4EH8A 4I94A 2PMIA 5EDRA 1CKPA 2OIDA 4FNWA 4QT1A 4WSQA 2RFNA 5AM6A 2UV2A 4AUAA 5BV3A 2QOKA 1HCKA 2OJ9A 2ZAZA 4FG7A 4IACA 3NFGB 1FVRA 4J97A 1HCLA 5DLSA 4CFMA 4IVAA 1DAWA 3DAJA 2X8DA 4CEGA 3AKLA 2B7AA 5LVLA 4YC8A 3NNWA 3V3VA 1ZOHA 2J5FA 3VJNA 4A06A 4NYEA 1WVYA 2HK5A 2J5EA 3QTRA 2BZIB 3KRLA 4IM0A 3KL8A 3F6XA 4RBLA 4YJTA 3TV4A 3A61A 1SMHA 2JIIA 2R7BA 1OPKA 4KRDA 1CMKE 4MH7A 5CU6A 4AZSA 4EH2A 4O0UA 5LCJA 3CR0A 4D28A 1IAJA 4UMRA 2R4BA 3FI2A 3W33A 5KMOA 3W0PA 3FMNA 5IH4A 2QURA 3VW6A 1P14A 5FBOA 4QP3A 5BYZA 5IH6A 3PWYA 4EOSA 4G3FA 2GU8A 4RWIA 3KQ7A 3FXWA 2V7OA 1XKKA 4KKGA 2J50A 5CNNA 4K18A 3T8OA 3W16A 4M7IA 2VTTA 5CI7A 4PPAA 5J5TA 2XIZA 3G6GA 4P90A 4YNEA 3ZLXA 4RVMA 1R0PA 2ETRA 2BAKA 3OEFX 4FK6A 4JG7A 3CD8A 4JG6A 4L52A 4YNOA 3DKGA 4IB3A 2YN8A 3V6SA 3VS5A 2YM3A 1OIYA 4ACHA 4AOIA 3UG1A 3NUYA 4HGTA 5HE1A 4CYIA 2YZAA 2OICA 1IEPA 5FXSA 3FSKA 2OZAA 4MBIA 2WMXA 5HG5A 5K0KA 3L1SA 1UU9A 2WMVA 1ZMVA 4NFMA 3UO5A 3DPKA 3UBDA 3BLQA 1P4FA 3DTWA 4G16A 4DYMA 3VIDA 4QNAA 3ZO2A 2ZM3A 4FKTA 3WYXA 3NAYA 5E1EA 3ZS5A 4AW0A 1UU8A 3FLQA 2YM6A 4H3QA 4IHPA 4QQJA 4UXLA 5IA3A 5K4JA 4CFFA 4ENYA 4L9IA 2X7OA 3LFCA 4IH8A 4L42A 4OTFA 5EI8A 4IVDA 3Q6UA 4XCUA 2OXDA 5HG7A 1M7NA 3K5UA 2XANA 2BR1A 5GHVA 2V0DA 4OBQA 4UBAA 2ITVA 5CXHA 4I6BA 3KFAA 1GIJA 2JIVA 2RL5A 2PZ5A 3V04A 2ZMCA 4NW6A 4II5A 4AA4A 4IX6A 5E1SA 5DA3A 3HYHA 4WUAA 3EH9A 4A7CA 1JNKA 3FZRA 3V8WA 4R6VA 5HX8A 4RG0A 3ZSIA 3CP9A 2XH5A 4AW5A 4TYGA 2X0GA 2J0IA 3Q3BA 3LOKA 4E6AA 5LWMA 5J9LA 2CKEA 2CGUA 4E6CA 3C0GA 3REPA 3EFJA 2FH9A 3TACA 4D0WA 4CVAA 2ONLC 2YM4A 3HUBA 3OCGA 3HMIA 4IX4A 1ZY4A 1YWRA 1UWJA 2E9PA 3ZSGA 3HA6A 1OZ1A 1R1WA 3P7AA 5J7HA 3Q5IA 4WG3A 2BPMA 5L6OA 5FM3A 3VULA 5EI2A 2XKFA 3HUCA 4IB1A 4ZTHA 4EK4A 4BDFA 3HV7A 3BYVA 4LRMA 4Z7HA 2WOUA 5CSXA 4LRKA 3QUEA 1M2PA 2EUFB 2ETKA 3E92A 4FKPA 5AIRA 4RZWA 4AG8A 5IMXA 5AAGA 5E8SA 4LV7A 3FV8A 3E8EA 5AUYA 2E9OA 4F64A 4RIYA 4E4XA 2YJRA 4ZLZA 4ZZOA 4ZTQA 5J9ZA 4AWIA 3QD2B 4GK4A 3TUDA 4O7WA 3PJ8A 4FKGA 2OF4A 3DA6A 1YOLA 4FIIA 4CFVA 3S00A 3BQCA 5J8IA 1KOAA 3DU8A 2X0PA 4B8LA 4J8MA 3ZO1A 3Q2MA 4CV8A 1H01A 2W7XA 4RC2A 3QHRA 3W0NA 3E64A 3GXLA 4QPAA 4IJPA 4PUZA 2PMNX 5ANIA 2P4IA 3NRMA 4H1MA 3FJQE 3GCQA 4O96A 5AUVA 3R22A 2IVSA 3LCSA 3MA3A 3A7IA 5TKDA 5KMJA 3H4JA 3FMDA 1JKKA 4GIHA 4IWDA 3I6UA 2IZTA 4OW8A 4U43A 5FTOA 3G2FA 5HO7A 3NUPA 3KC3A 4WSYA 2WMUA 4APCA 3BV3A 2VTIA 3DKCA 3QKKA 5CALA 1REJA 2BILB 1W98A 2Y6OA 4XV9A 3ZC5A 4A4LA 4D2VA 5LVNA 1H26A 3EIDA 4L3JA 4YMJA 3MFUA 2W1EA 3DNEA 3KN6A 3ZXZA 3KVWA 4EYMA 4FL3A 4MYGA 2WAJA 1TQPA 4X3FC 3V5PA 1XH4A 3KF7A 3ZDIA 3KVXA 5CENA 3LKMA 1W2DA 3P5KA 2X7FA 4FR4A 4RQKA 5T3QA 4FF8A 4RA5A 4AE9A 1Z57A 2YCRA 4TWCA 3QQHA 4CGAA 2BMCA 1ZOGA 4TNBA 4AZEA 2C69A 1I44A 2ZVAA 4U81A 4XG3A 2XKCA 3DS6A 3TWJA 3MV5A 4TYHB 2ITPA 5AUXA 3EQHA 1PKDA 2BIYA 2C30A 4ALWA 1JKLA 5CU3A 1W2FA 4YJPA 4BI1A 3MN3A 2CSNA 3W18A 3IDCA 2YM8A 2B9JA 3SG8A 4BTFA 2HCKA 2PVMA 1XO2B 4E6QA 4ZSGA 1NVQA 3OCBA 5H2UA 1A9UA 5HTCA 4DEIA 2GTNA 3A7HA 1U5RA 5EM6A 4B7TA 3OY3A 4BCFA 2E9VA 5LVMA 1PXJA 1Y8YA 3FWQA 2AQXA 4Z3VA 2UZUE 2WEIA 2IW8A 4R78A 2FB8A 4FTLA 3AC8A 3RNIA 2RG5A 3QQJA 2F7ZE 3C4FA 3D7ZA 3II5A 3CPCA 3P0MA 4PRJA 5BPYA 1UA2A 3PIZA 1YHSA 4PTEA 4M69A 3I79A 3N4TA 4CMTA 4U7ZA 4L67A 4NH1A 3BU6A 1OIRA 3PPJA 4B99A 4U41A 4WBOA 1AD5A 3WF9A 3DLZA 4MF1A 4XOZA 4FKUA 2PU8A 5D7VA 3NMUF 2BZKB 5AADA 2JITA 1F3MC 3FSFA 1W0XC 3PJ2A 3QQKA 4QO9A 5DGZA 4BL1A 5KMKA 1QL6A 3FQHA 4RJ8A 4AXFA 3F3ZA 3LXLA 3E63A 3G51A 4MTAA 3LFFA 3VUIA 1XR1A 2P55A 2YEXA 4IDVA 4B9DA 5ETIA 5IQBA 2JDRA 3O0GA 3R04A 3IOKA 3D94A 4NKSA 5HU9A 4CG8A 4PMMA 2XAOA 1XH7A 4NZWB 1JKTA 1ZOEA 4AGCA 1YW2A 2A0CX 3HMNA 3OTVA 2GCDA 4H05A 3GCSA 3RWQA 2C6KA 2I7QA 4G3GA 2VTSA 3V5QA 3KCKA 4DE4A 4X3FA 3OBJA 1V0OA 4IX5A 3D5UA 4FX3A 2SRCA 2W9ZB 2XRUA 3H9RA 5CU2A 1E1XA 1GZKA 4I6QA 3D5WA 2JAMA 2F2UA 4JDJA 2XK7A 3A99A 3QX4A 5HG8A 3RK9A 2J0LA 3SAYA 5CXZA 5CU4A 3QGYA 4X21A 5AR5A 3VN9A 3Q9WA 2X9FA 5EHLA 2QD9A 4JJRA 3NCGA 3ORLA 5HNGA 3ERKA 4PP9A 4M8TA 3CY3A 5BVWA 3UNKA 3OY1A 4U42A 4LOOA 2G9XA 1G8SA 1Y57A 4BDGA 1GZNA 4FTIA 3DJ7A 4EUUA 3NAXA 2W5BA 2G01A 2VRXA 3RPRA 3UDZA 4IAZA 3HZTA 1DI9A 1Y6BA 3GVUA 2BAQA 2JFMA 4KNBA 3IPHA 4BGHA 1PF8A 2ITTA 2X0QA 4NTSA 5EG3A 5B0XA 4J7BA 4X2GA 4I5PA 5IG1A 4FSYA 3PRFA 4IVBA 5IQAA 4I3ZA 4L68A 3UDBA 5KO1A 2J0KA 3C7QA 2XP2A 1KOBA 2W9FB 3N4VA 3LPBA 3UZRA 4FSQA 4KINA 2CGWA 4R1VA 2PVJA 4HYIA 2Y9QA 4C37A 4EH9A 4EOPA 3THBA 4Z16A 2HY0A 3UP2A 3PWDA 4BB4A 2WOTA 4F0FA 4QMTA 5ITAA 2W1DA 3I5ZA 4MCVA 5EW3A 4JQ8A 3E88A 3QCYA 4JX3A 3HL7A 4PX6A 2X39A 2OWBA 4WG4A 3KXMA 2P2HA 2Q0BA 1YRPA 1U54B 3QZHA 4ZJIA 2X2MA 5HLWA 3W2OA 2C0TA 4FUXA 1OGYA 3I0QA 2X2LA 2CMWA 4K8AA 1MRUA 3QRKA 2XK6A 3OCSA 4M13A 5TO8A 1UV5A 2AC5A 1UU7A 4FL2A 2I0VA 4RGJA 2VTPA 3F3WA 4HNFA 4DG0E 1FBNA 5IQDA 3ZZWA 4RSSA 3KKVA 4O7VA 4LV5A 2PUIA 4FTKA 4AQCA 3GQIA 5E7RA 4F0IA 5A46A 5LOHA 4MBLA 1BI7A 1M52A 2C6LA 3DZOA 4O0WA 5HNBA 3P5JC 2VWYA 4RPVA 4F9CA 4PPBA 3I6WA 4EKLA 3Q9XA 5JK3A 5HICA 4E26A 4FKOA 3IW5A 4P7EA 2QLUA 3GFEA 4BCGA 1Q3WA 2Z8CA 4OTGA 3DT1A 5LCKA 3HLLA 2GQSA 3UOLA 3T3VA 2QG7A 3UMWA 3GU8A 5E92A 3IOPA 3COMA 3RPOA 4XNEA 2GNIA 4S2ZA 4S30A 5F4NA 4RZVA 4GMYA 1OKZA 4YTFA 3NVMB 1MRYA 1ZARA 5BUEA 2W06A 4FBXA 2QU6A 3PPZA 3WBLA 1YQJA 3DTCA 5KMIA 3ZOSA 2XARA 2XNOA 4D4VA 2QKRA 4FSUA 1NA7A 4LMUA 3RAIA 1YHVA 3V5TA 2QCSA 2VGPA 2WMRA 3R6XA 2P2IA 4KBKA 5BVDA 4U80A 3GT8A 4ITIA 1GIIA 4GSBA 5CS6A 3RPSA 4EWQA 2X1NA 3K2LA 4NKAA 2YHVA 4YO4A 4GK2A 4M68A 5H3QA 3R8ZA 3O71A 4FKJA 2OG8A 2PVKA 2F9GA 3R63A 4L00A 4O7NA 5M06A 2FSMX 2OSCA 1WBWA 4G5JA 4LGHA 4MK0A 4C4HA 3WZDA 5DRBA 5BVNA 2BTRA 2H6DA 1H1RA 5F9EA 4FKLA 2ZFYA 4AN2A 4YURA 3LLAA 1FMKA 2HWPA 3WZEA 4YLKA 2PTKA 4W9XA 5FXRA 5HBEA 4FIJA 2ERZE 4X2JA 3F2RA 3UG2A 2CN5A 3QD0A 5ANKA 4M3QA 2P3GX 4F9AA 2VZ6A 2O64A 2W1GA 3CKXA 2VNYA 4BBFA 5AP3A 4RIOA 3EFLA 3ZFMA 2CJMA 5M56A 3V6RA 2R3OA 4E6DA 3A4PA 5EKNA 4R3CA 3VS0A 4WO5A 4BR3A 5L2WA 2GPHA 3CE3A 4FKIA 2G2IA 4FTCA 3OXTA 1H4LA 1TZDA 4C3PA 1X8BA 1V0BA 1F5QA 1GIHA 3H10A 5FDXA 4QYGA 4WNKA 1MQ4A 3RZFA 5HNIX 4EZ5A 4U3YA 3V8TA 5A4TA 3SW7A 5EQYA 4WBBB 4YSJA 1RE8A 2JKKA 4IWOA 4WG5A 3SKCA 3U6HA 4YHFA 4AXDA 1XQZA 1Z5MA 2A1AB 3F2AA 5D12A 3VS6A 4C02A 3BZ3A 4ZLOA 3C4WA 3QX2A 4NU1A 4F65A 4B4LA 1LEWA 2YISA 2GHMA 4BN1A 3KMWA 5BYYA 1PYEA 3EMGA 3CC6A 1ZYJA 5AAEA 3O8TA 4D58A 2QR8A 3PXKA 4FEWA 3CTJA 4NJ3A 2BHHA 4U0IA 4G3EA 4PNIA 5HQ0A 2IEWA 3OXIA 3WILA 5L6WL 4X3JA 3SV0A 3ZRLA 1VZOA 3BLAA 2ZDUA 5AV0A 3FI8A 4FKWA 4FTOA 4JMQA 2VTRA 3QLFA 4FT3A 4UXQA 4FNYA 5A14A 1PMNA 2H9VA 3P1AA 3MJ2A 3VC4A 4ASDA 4EH5A 1CKJA 4IIRA 3E5AA 4XS2A 4L45A 1GNGA 1KE5A 3RGFA 2V55A 4C3FA 5CAPA 1XBAA 2YLFA 3DK3A 3GB2A 3LVPA 4GCJA 3CQEA 5DBXA 1JSVA 4GW8A 4QPSA 4RIYB 2X7GA 5D1JA 3EL7A 2O0UA 4I41A 4TZRA 1VEBA 2QHMA 4ACCA 4LQMA 4FKVA 4Z55A 4CQGA 4PMSA 4RFYA 4DFZE 4BDAA 4AGWA 4IZ7A 3NW6A 3RINA 2EXEA 2R3KA 3FC1X 4GUEA 4RRVA 4YZMA 2RFEA 2EVAA 4O7YA 3FY2A 4USDA 3UQGA 4PNKA 4MUQA 5F20A 4FKQA 4D9UA 4GJ3A 2WTVA 4MXOA 3U8WA 3NUAA 4KSQA 4BDBA 1XMLA 4BI2A 4UMQA 3OOMA 2GMXA 4O7LA 4ZY5A 4JQEA 3VAPA 4R7BA 5AP7A 2XKDA 2HWOA 2VTOA 3L9MA 3QQUA 5KMNA 5LWNA 2REIA 3KXHA 5C4KA 2WPAA 3FZSA 3R1YA 4TYJA 2HZIA 4MQ2A 4ANQA 3A62A 3FZTA 3V8SA 5F1ZA 4Y5QA 4G3CA 3LJ1A 3ZEWA 4AZTA 3PY0A 1Q5KA 4ZS4A 3TUBA 2PZYA 2UW4A 2I40A 2WXVA 2C47A 3ROCA 4TTHB 4EL9A 4QMVA 5DMZA 5IQHA 4I0SA 1OL6A 3DXNA 4KIKB 2V5QA 3BHHA 3D5VA 4HPTE 2UZNA 4YZ9A 5TR6A 4CCUA 5C8NA 4FMQA 5HTBA 4FV4A 5IU2A 2ITQA 3SHEA 4X6QC 2GTMA 2OI4X 2ZV9A 3TV6A 3UQFA 2QOFA 4G3DA 2EU9A 4C7TA 4XOYA 4EBVA 2GNLA 5L2QA 1GOLA 3P79A 3GOPA 2YIWA 2OJGA 4KAOA 2PY3A 1HOWA 4Q2AA 3R7IA 4FT5A 4A9RA 2GNGA 4D2RA 4PY1A 3TNIA 3NYVA 5J87A 3NPCA 4O27B 1UNHA 2QKWB 3PRIA 3PVGA 4AFJA 1GAGA 1CDKA 2R3JA 2CGVA 3EQPA 4D55A 2EXMA 4KIQA 4I24A 2PULA 4A9YA 2YAAA 3KCFA 3AKKA 4O0SA 5DVRA 4YUQA 5HTIA 3OROA 1FVVA 3F66A 4UY9A 4HVHA 4C4GA 4KBCA 4LGGA 4YHTA 4CLJA 2R3GA 1WZYA 4FIGA 3EWHA 3TIYA 3WF7A 1PRYA 3DAEA 3A8WA 3ITZA 4FIHA 3FDNA 2JAVA 5AX3A 3DBDA 3MPMA 4CSVA 3OW3A 2UW0A 3F7ZA 3GENA 3NYNA 3Q32A 4C3RA 4ERKA 3GU7A 4FI1A 4HOKA 4FZ6A 5TF9A 4DFXE 4DDGA 1UVRA 5GNKA 5EK7A 2PWLA 4OR5A 3R7VA 2O65A 3KXZA 3TZ9A 3BE2A 3MA6A 4O6EA 4QP4A 2IN6A 3LFEA 4QMUA 4EH7A 2EXCX 2GS2A 1U46A 5JRSA 1H8FA 3O5AA 5FEEA 2HENA 4XYFA 4DTBA 2XK4A 2CPKE 4J99A 5A3XA 4XH6A 2ESMA 3DFAA 1PMVA 1T45A 3F61A 1KV2A 4HJOA 4TY1A 3NVKI 3AC5A 2IG7A 4YO6A 5I0BA 4FNZA 2DWBA 4UWYA 4QMMA 2Y6MA 5FXQA 3V01A 4RVKA 4RJ5A 3TKIA 4FV2A 2QONA 3IS5A 3PVWA 3ELJA 3ULZA 4XLIA 2IJMA 2JFLA 2RGPA 2OLCA 2HIWA 4CT1A 3S1HA 1ATPE 3EN7A 2VTMA 3GUBA 3KMMA 1YOMA 4XRLA 3R8MA 3U4WA 3Q04A 3PVUA 4BDKA 1W8CA 3LXNA 4JBQA 4K2RA 3I0OA 3OHTA 2Z02A 4AT4A 3I1AA 3QCXA 1J1BA 4O4EA 4JS8A 3DBEA 3GU4A 2VX3A 4FG9A <