4FV0A

Crystal structure of the erk2 complexed with ek3
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
341
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKIDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Crystal Structure of the ERK2 complexed with EK3
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 341
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fv0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fv0A01
2PHKA 2XJ0A 2XNMA 3E93A 4W4VA 4OT6A 5DA3A 4XLVA 3LFDA 5KBRA 2C30A 2G2FA 4IZ7A 1PXOA 1YXXA 4DTAA 1TVOA 2X7GA 1OKVA 2XNOA 4IVDA 4L42A 4O7WA 3LFCA 3FYKX 3JVSA 2IWIA 5JQ5A 3KMMA 2UW0A 1GIIA 1PKDA 3MGYA 4FKLA 3PSBA 2YIYA 5FGKA 1VYZA 2CN5A 3MH1A 1BI7A 2FO0A 2WPAA 4JDJA 3QD3A 4J98A 3JXWA 4C36A 4ANMA 4OGRA 4PMMA 5D41A 4Z3VA 2EB3A 3WZEA 5HO6A 3RPYA 4RMZA 3ORIA 4YO4A 4CG8A 3O7LB 4FG7A 1BX6A 2J90A 2ZVAA 4H05A 4HGEA 4ANSA 2BHHA 4FTIA 5DT4A 4C7TA 5K5XA 3IK3A 3QQGA 3L9NA 3GCVA 2IZTA 4YGAA 1W98A 3O17A 4BIEA 2QHNA 2R3MA 4M0YA 4AFJA 5DR2A 2XBJA 5HIDA 4U45A 3CQEA 3NUXA 1PXLA 5HCYA 5LCJA 2OWBA 3EN6A 3FKNA 4ZTHA 4GS6A 4YPSA 1M2PA 2XK3A 1XKKA 2OJFE 3Q96A 4JT3A 4O6EA 4RFYA 2IW9A 3NYOA 2I0YA 4ASEA 1GZNA 4E4NA 4C3PA 5L2SA 5HVYA 5CU3A 4ENXA 4HJOA 2UZNA 3OBJA 4ACGA 4IIRA 3DCVA 3PDTA 4DFZE 2VO7A 2XKFA 3IO7A 4X2GA 4WNPA 4WRSA 2OJGA 4D2VA 4EHEA 4TWNA 4C0TA 4FSYA 5BMMA 4K8AA 4WNKA 2EUFB 2PMNX 3QYZA 4FF8A 3Q3BA 1LR4A 4IAKA 4JAJA 3LJ0A 5HIBA 5HNGA 4MCVA 2Q0NA 5D7AA 5HE1A 4BDBA 4E73A 4YSJA 2ZAZA 3DGKA 1APME 2H9VA 4GH2A 4HYUA 4BBMA 3EN9A 1R78A 2B55A 4UX9A 3WARA 4C4EA 2XMYA 4B8MA 2WTJA 4WOVA 5ETAA 5DT0A 5BUIA 3PIZA 5IA3A 3ALOA 2VWZA 3PXYA 2JIIA 4MNEA 4Q5EA 4C2WA 2VUWA 5J9YA 1J1BA 2IVTA 4N6ZA 1B38A 2J2IB 3HP2A 4MQ2A 3RPRA 3ZRMA 5CX9A 4F6SA 2EXMA 2WMWA 4CMTA 2WMTA 3QKKA 1SNXA 4V01A 5KO1A 4FL3A 2XEZA 3FMJA 4B9DA 4U79A 2W1GA 4AWIA 3SVVA 3Q60A 4YLKA 4YJPA 1H27A 3WYYA 3OG7A 5IA5A 1ND4A 2OZAA 5DI1A 3DAJA 5LMAA 2BDJA 2GSFA 5AR7A 3PVGA 5E1EA 4BWPA 4DCEA 4L3LA 3GFWA 3AMBA 3BBTB 3JY9A 3FL4A 3PY3A 2DUVA 4I6HA 3F3UA 5TF9A 4DINA 4R7BA 3P1AA 2VRXA 1YWRA 3PP0A 5HX8A 5M07A 1YDRE 1YI4A 2OH4A 3O51A 1IA9A 4BWKA 5ICPA 4C3FA 4NFMA 2HIWA 4AZSA 2SRCA 3A7HA 1GIHA 5HG9A 2W4JA 2GS7A 3WBLA 5GIPE 4MNEB 1GZ8A 4MBLA 1H08A 3H9OA 3RINA 3EFLA 3FYJX 1SM2A 4H58A 3DPKA 2HY81 3OD6X 4CSVA 3QX4A 1FMKA 3E3BX 4JDIA 1YDTE 4FL2A 3RHXA 2VTNA 3UG1A 3UTOA 3F88A 4XG4A 1XBCA 2W5HA 3OHTA 4G6LA 4PPBA 3QTIA 3TNIA 4AFEA 4CKIA 4E20A 5IH6A 4GU6A 4CQGA 3ZLXA 5GJGA 4EQUA 3U8WA 1NXKA 2OZAB 3DXNA 1J7LA 1OL5A 4FNWA 3RM6A 4QTBA 3ZUUA 2OO8X 5ANDA 5JK3A 5L3AA 1Q3DA 3BHYA 4UBAA 5FXQA 4E6QA 3UC3A 3IW6A 1I09A 4F7NA 4FZAB 5JEBA 2CCHA 4F1TA 2C5NA 4KA3A 3U4WA 2BRHA 2R0UA 4BDCA 4XOYA 5DNRA 2QKRA 4XUFA 4D1SA 3PIYA 4YC8A 1VJYA 1MRYA 3COKA 1FOTA 4BFMA 2QU5A 3EQCA 4F4PA 4LL0A 2C5XA 2Z60A 5BYLA 4GKIA 4EWQA 4I0SA 4L7SA 4M12A 4EK6A 3RZFA 3WYXA 2PL0A 2CMWA 4ZY5A 5IUHA 4CFWA 2JDSA 4MEDA 4IWQA 1KUTA 2UZEA 3QQHA 3LXLA 3HP5A 4QMYA 4FNZA 4U5JA 3TKUA 4MQ1A 5JFWA 4CFMA 3H10A 3R8MA 1PXIA 2UZOA 5C03A 4FEUA 2GTNA 4FZ7A 1UKIA 4AT5A 5EI2A 2LGCA 2WTDA 2VTMA 3OXZA 1YXUA 3UYSA 5B7VA 2B7AA 3W2SA 3QZFA 3CR0A 5AUZA 1JQHA 1OKWA 4OAVB 1Q8UA 2AC5A 3GT8A 1F0QA 1KWPA 4R3CA 5K4IA 3BIZA 5ANEA 4X3FA 4I92A 3OC1A 4FT3A 4WT6A 4KKGA 4D2RA 5HVJA 3TJCA 4YJNA 2LAVA 4CVAA 4TYHA 3OCGA 4ZJJA 1IEPA 4DLJA 5HO7A 4LRKA 2Y6MA 3BE2A 3UPXA 1R3CA 2UW5A 2WQEA 4USDA 2WQNA 3VS5A 1ZARA 1MQBA 1PY5A 3NR9A 1QPCA 4KNBA 5HO8A 3BE9A 3DLZA 4JDKA 4EEVA 2OFUA 3MA6A 5AV4A 4MXYA 3GVUA 5ACKA 1WVYA 3LQ5A 2C6MA 2Z7LA 3TXOA 2C6DA 4IZ5A 1CKPA 3FMKA 2C0TA 2RFSA 2W05A 3Q5ZA 3QZIA 3V5QA 3VS4A 4EYMA 2Y4PA 2B0QA 2X9EA 1M2QA 3A7JA 4OTGA 4DT9A 2C3KA 4FX3A 3AOXA 4NTSA 4QP3A 3NUAA 4V05A 5AUYA 3LE6A 2P0CA 4L53A 5FEDA 4CXAA 1JKTA 4X3FB 3CTJA 3EYGA 3SV0A 4O0RA 2W1FA 5EQYA 3LVPA 4ZLYA 4PMPA 3CXWA 3WE4A 3F5UA 4TYHB 3OVVA 2PTKA 4MF0A 2J51A 2P2HA 3HMNA 3CGOA 4G3GA 5CT0A 1R1WA 3A8XA 3ZEWA 4BYJA 3I4BA 4IM0A 4I6FA 2ZM1A 4I6QA 3HRBA 4AN2A 3LFFA 3FBVA 3ZU7A 5HTBA 2ETKA 3HA6A 3JPVA 3MFSA 3PXRA 5AV2A 4KKEA 4BDKA 3UQFA 4JNWA 5FG8A 1JSVA 4EK5A 4FSMA 2OIBA 3R1SA 3RWQA 5G1XA 2Z7SA 4ZMEA 3I6UA 2OJJA 5L8JA 4ZJVA 3AGMA 4EWHA 5BUEA 4PPCA 4C38A 3ZEPA 2BTSA 4J97A 4EH9A 3Q9ZA 4R77A 3E5AA 4BY9E 1WMKA 5F9EA 3QD4A 1Y6AA 3R71A 4BCNA 2RG6A 5EM7A 1JVPP 2I40A 3V5TA 4FV8A 4CZTA 2QHMA 2PUPA 2QOCA 3WILA 1MRVA 3VS1A 3E7OA 4RLKA 2RG5A 4FVRA 3CD3A 4EOIA 4L68A 4DGOA 4M69A 2FH9A 4YZNA 5AP1A 4AF3A 3P5KA 4IB0A 1FVVA 4IANA 2QU6A 5DRBA 2VD5A 2GNHA 3QCSA 5CSWA 3NUNA 5CLPA 4M66A 4Y46A 2FYSA 2YWPA 5HOAA 2RKUA 3AT2A 1Q99A 3HNGA 4JG7A 1YVJA 2XKDA 4PMTA 2WIPA 3R9RA 4UZHA 1B6CB 4IMYA 3VHKA 5KMJA 3KRLA 5C01A 3R9DA 5LOHA 3UJGA 3VBVA 2CHLA 4GV1A 3TNWA 2VTOA 5AP2A 2ZV8A 3TCPA 1H00A 5EDPA 3UNJA 3FEGA 5AUWA 4JIAA 3KRWA 4AN9A 3TG1A 4B8LA 2ZV7A 2RIOA 3WZJA 3F6XA 4FTMA 3RTPA 2ITPA 4PDPA 3FMHA 4JR3A 5A6OA 3RAWA 5CSHA 4M69B 3G9NA 4WG3A 1OIQA 5AR4A 5LCKA 2J0LA 2CNVA 3OY3A 4ZK5A 4BGHA 1VR2A 1G3NA 2QCSA 4NKAA 3VWAA 2OIQA 4QQTA 1PMUA 3MBLA 1OB3A 4LOOA 3I7CA 3SXSA 3FLSA 4G2FA 4G3CA 2W5BA 2C5VA 4B6LA 5HTIA 4G6NA 4LRMA 1OKYA 3UGCA 4ASDA 5CU4A 4DFLA 4JJRA 5LVOA 1H07A 3EYHA 2PVHA 4R7HA 5EOLA 4XJ0A 1HCLA 2O0UA 3R04A 2WMSA 4KD1A 4O0TA 3GU4A 1XO2B 1ERKA 2ESMA 4IQ6A 3QRTA 2CDZA 3FL5A 3GOKA 1YXTA 3DQXA 4J71A 2X4ZA 3VUDA 3SXFA 2XNPA 4XG9A 4FBXA 1QL6A 4I3ZA 5C8KA 3CQUA 5A6NA 4HPUE 4F0GA 3U54A 3GGFA 3RHKA 5CAOA 3O71A 2WTKB 3ENMA 4I0TA 3HYHA 2PVMA 2BFXA 2W06A 3OBGA 3KULA 4IVBA 2W9FB 4PX6A 1J7UA 2PZPA 2A0CX 4W4WA 4EH4A 3R83A 3PP1A 1UNHA 5L2WA 3TM0A 4FTCA 3E3PA 5L6PA 5D7VA 5IQGA 2C5OA 3TV7A 1BMKA 3FXWA 1SNUA 5DG5A 2X39A 4R78A 3V8TA 4Y85A 4WUAA 4OBQA 2ERKA 3LZBA 4MF1A 4DGLC 3QALE 2XJ1A 2GU8A 3MPMA 3P86A 4IX4A 4TRLA 3VJOA 4U7ZA 2H6DA 4XG6A 1E9HA 4ZP5A 1KV1A 2VNYA 4L7FA 1I44A 3FLNC 2CN8A 3CKWA 3PPZA 3VW8A 2QVSE 2WAJA 5EYCA 5IQFA 1YOLA 3NW5A 3IG7A 4A4OA 1M17A 4ID7A 5IA2A 2RFEA 3I7BA 3FPMA 3KULB 3PVUA 4YZDA 5H2UA 4I24A 3EFJA 5AP3A 4ZY4A 4R1YA 3EQIA 5TKDA 3QUPA 2P55A 5DWRA 3LFAA 4LFIA 5LVNA 4U80A 2OICA 2ETRA 2JGZA 4O7VA 4II5A 4CFXA 5IQHA 5DPVA 1QCFA 3DTWA 3MPAA 5EHLA 3QL8A 4I4FA 4PDOA 2VX0A 3LW0A 2JD5A 4O2ZA 5J7HA 4U97A 2QURA 3TNPC 3VQHA 2JKKA 2NPQA 4KIKB 4HVIA 3QWJA 3BYOA 3GCQA 3QA0A 3OWLA 4G9CA 2B9HA 1J91A 1XH8A 4HOKA 5HKMA 2JDRA 4FV1A 2C3JA 3Q9YA 4Z7HA 2XP2A 4KS7A 4RIWA 2R3GA 3FKLA 5B2LA 4GVJA 4XS2A 1RJBA 2X8IA 4EZ5A 4ZJIA 3A8WA 1KV2A 2B9IA 2VGOA 3KREA 3I5NA 4ZTLA 4ZS0A 2BRBA 2XYNA 4I4EA 4L3PA 4M0ZA 3IKAA 3HLLA 4BKZA 4GEOA 3ORZA 1OBDA 2Y6OA 5KKRB 2FB8A 4GFGA 4YJSA 2W7XA 3TZ9A 4R3RA 4U6RA 4DBNA 4PL4A 3VULA 3BYSA 5AUUA 4JBQA 4QTEA 3O2MA 3BKBA 3LCSA 1UWHA 4MBIA 4AAAA 3AC8A 4IC8A 4OTPA 1WBWA 2YCSA 4ASZA 5CI7A 2NO3A 5K0XA 4C4FA 2QR8A 3HX4A 4CFNA 1NVRA 1WCCA 4U8ZA 3QTSA 2VAGA 4I20A 1NA7A 2OZOA 3H9FA 2IN6A 4BICA 3KF7A 4F6UA 4CNHA 1OBGA 4D5KA 5JGAA 2WXVA 1WVWA 1Q4LA 3OS3A 2C6OA 1H1SA 2JDVA 3BYVA 3CJFA 3O8TA 4PP9A 5FBNC 3VN9A 1Q8TA 5ETCA 3P0MA 3CTHA 4GG7A 4X2NA 4BYIA 5ETIA 2BIYA 2B54A 3R1YA 3F7ZA 3QCQA 4JX3A 4RIWB 5KHXA 3FI3A 4TL0A 5KUPA 3LKMA 2OG8A 4IAYA 4BHZA 5IQEA 4U3ZA 3S95A 3II5A 4JOAA 2VTIA 4O22A 5AADA 2WTWA 3BU5A 3R21A 4FIFA 2VWBA 1XHAA 5CSXA 3IDCA 4N6YA 4TTHB 4V0GA 4HPTE 2PUUA 3IPHA 4KRDA 4C8BA 4E3CA 3FUPA 2VGPA 3UIBA 5AM7A 4NW5A 4FKGA 5CYIA 5CAUA 3EQDA 4NZWB 4JRNA 1OM1A 4LV5A 3W1FA 4ONAA 2GQRA 4UMRA 2BAKA 2AUHA 2J4ZA 3MH3A 3ENHA 4DFUA 4FKJA 2BUJA 1R39A 4RC2A 5G6VA 5EKNA 3QKMA 1W83A 4ASXA 3DB6A 3DJ6A 1PMNA 4GFMA 4E4LA 3HAMA 3M11A 3R2BA 1JPAA 2OXXA 2O64A 2R3LA 3CIKA 2FSOX 3D15A 2OI4X 3DXPA 4IC7A 4EK8A 3CPBA 3RJCA 3DZOA 3ZO4A 1MQ4A 3PJ2A 3ZS5A 4E6AA 5E90A 3Q2JA 2B9JA 1K9AA 4EOJA 2QO2A 3C50A 1TQIA 2IVUA 3FLQA 3QTWA 4RSSA 2XNEA 5J87A 5LMKA 4FV5A 3ROCA 3VUHA 3KK8A 3S0OA 2ITVA 3GXLA 4N70A 1PXPA 3S00A 2WOTA 1XWSA 4P5ZA 2UW8A 4OLIA 4V0GB 1GIJA 2OGVA 3FZRA 4AP7A 4MTAA 1DS5A 2Q83A 5CZHA 2E2BA 4FKQA 4RFZA 4LUDA 1NVSA 4YZMA 4AW5A 5IU2A 4S34A 5J1WA 1OPJA 3NW7A 4RBLA 3CQWA 3HDNA 4RC4A 4Z9LA 4FODA 4U3YA 3P78A 4ZY6A 3RGFA 2ONLA 1LEZA 3DJ5A 2BILB 2X7OA 3I0OA 3ATTA 3R7EA 4XRJA 5AR5A 4A4LA 3GI3A 4NT4A 4E5AX 2BR1A 2WHBA 1Y91A 4FZFB 2OXDA 5IQDA 3GCPA 3A4PA 3GENA 4IVAA 3UIUA 1ZOHA 2BPMA 2IO6A 2VWXA 5LVLA 2HOGA 4DTBA 3FV8A 5I9VA 1H25A 3WI6A 3I1AA 2HK5A 2FSTX 3UMXA 5I3RA 2YM3A 3LPBA 2VTHA 5CANA 2I0HA 4AA4A 2ITXA 5KX8A 4IADA 2DYLA 3R9OA 2PMOX 3MFRA 3NSZA 4R1VA 2UZVA 3TIYA 2GFCA 3SKCA 3Q4TA 4Y72A 4FA2A 3U6HA 4HYHA 3ZDUA 4QNAA 4FNYA 2NNWB 3HV6A 3NZ0A 2CGVA 1JKSA 5AEPA 3MFTA 5EHOA 2YM7A 5A4TA 3B8RA 3ZDIA 3E8CA 4MXXA 3W8LA 3TEIA 1VEBA 3KN6A 2BRGA 3DS6A 3E8DA 4KIQA 4WIHA 4CZUA 2P2IA 3JYAA 3PFQA 1TKIA 1PYXA 4MXZA 4OBOA 4YJUA 5L6OA 4AUAA 5LWNA 3ORKA 3ODZX 4XP2A 2DS1A 3PJ8A 4C2VA 3VHEA 4Y5QA 2BKKA 4R6VA 4YZ9A 4BRXA 3PLSA 2X0GA 4C4IA 4EHZA 3SXRA 1G8SA 3BELA 2R3QA 5LMBA 4FYOA 2BTRA 3BX5A 3O8PA 2W99B 4KBCA 4I23A 2X2KA 1Z9XA 4FSWA 4BZOA 2CLXA 4DYMA 2GQGA 4FZ6A 2JEDA 3TN8A 3MI9A 3HDMA 3OP5A 3PZHA 4IW0A 5L2TA 3UOHA 2R3NA 4GT3A 2QR7A 2WMUA 4IACA 4LM5A 3HMOA 2VTPA 2J50A 5LVMA 2BRMA 3NAXA 5HHWA 3D83A 5DLSA 4D2PA 3QTRA 2UZLA 4IB5A 4D4VA 3T3UA 3ZH8A 2XK9A 3CSVA 2XIZA 4TZRA 4KAOA 4GT4A 5EW8A 5LJJA 4IFGA 4C4HA 4Y73A 3QLGA 1JNKA 5FTGA 3KXNA 2ITWA 3F2AA 3KXXA 5ITAA 1U54A 4FSNA 3C1XA 5KMMA 3LOKA 2W1EA 3IS5A 4D1XA 4G5PA 3RNIA 5AM6A 4DITA 4ITHA 3EN7A 5CT7A 4EOLA 1UV5A 3EKKA 3MYGA 3R1QA 4I6BA 4AXAA 5L8KA 2P33A 4DGNA 4EBWA 4ERKA 5CSPA 3W2QA 4C58A 2J0IA 4FSQA 4L00A 3O23A 5DT3A 4HNFA 3FXXA 2PWLA 4DFNA 4FTQA 4ERWA 3REPA 4PNKA 3MJ2A 3PA4A 1W8CA 3GC8A 4C61A 2R3KA 2PULA 3QTUA 3QF9A 5HNBA 2F9GA 4FIIA 3EB0A 1IA8A 3O8UA 3CPCA 1E1VA 2DQ7X 3NUYA 4IDVA 4QMPA 5HESA 4JLCA 5E8YA 2BZKB 5KBQA 4APPA 3NIZA 1UNLA 2WTIA 4K77A 4BTMA 1H8FA 3KXZA 3MPTA 1WBNA 3KU2A 3D2IA 4MKCA 3RK5A 2JLDA 4F7JA 5IA0A 3UO5A 2GDOA 4C62A 4XG8A 5FWKK 4RX7A 2JFMA 2X2LA 3WF6A 4CZYB 3ZFMA 3EQFA 4K2RA 1JBPE 2F2CB 2HZ4A 3RP9A 3F2RA 4GJ2A 4WO5A 3DT1A 3PE1A 4O7RA 3F9NA 4FSRA 4FV3A 5AP6A 5EDQA 5J5SA 3RALA 2VWWA 2WB8A 4EOQA 2X8EA 5AP4A 4EH3A 3QD2B 4ZSJA 4IJPA 1ZAOA 2W1HA 4UYAA 3DAEA 3F3TA 5DIAA 3RI1A 2ITZA 4HCVA 5CF4A 5DMZA 1Q61A 5AJQA 4KABA 5FEQA 3V8SA 3F66A 3ZRLA 4BR3A 1LUFA 3F2NA 5IUIA 3V5LA 2QO9A 3TV6A 4C4GA 5EI8A 5JGDA 1ZXEA 3ACJA 3OMVA 4F1OA 3AC1A 3HZTA 2IG7A 4W8DA 3WZKA 3DOGA 4IX6A 2X8DA 1OGUA 5IEXA 2FSMX 4FYNA 2YDIA 3R8PA 3ZXZA 4FVQA 4GL9A 1ZRZA 4UV0A 4EQMA 5I9ZA 5JQ8A 2WNTA 1V0PA 3PXQA 4CKJA 1W82A 1WBSA 2GNFA 3GB2A 4FTUA 5H8BA 5EQEA 4YNOA 3LFEA 4HVDA 4L8MA 3DV3A 2ETMA 5J5TA 2IVVA 1Q41A 4QD6A 4I21A 4PNIA 3N4TA 1M14A 4WBOA 5CENA 4FSUA 3GU7A 4RFMA 3AT3A 3BQRA 3C4EA 3GQIA 4F08A 2Z7RA 2OK1A 5CNOA 4MYGA 2ZMDA 3L8PA 4F09A 5C4LA 4JI9A 2XIXA 4D58A 4CYJA 2J0MB 3PUPA 3ZOSA 3QTZA 4B0GA 1URCA 3B2WA 4Q5HA 4EH8A 4QMZA 2JKQA 4LGDA 3W2CA 2OU7A 2ZMCA 2YM6A 4GIIA 3C9WA 3DTCA 5CVHA 4UWBA 2IW6A 1Q5KA 3KK9A 5BVFA 4F63A 3EQGA 4Y8DA 2YWVA 3THBA 3ZM9A 3Q9WA 3E87A 4PL5A 3S2PA 4AX8A 4FEQA 4S30A 5DRDA 4IM2A 4MXAA 4F6WA 5IEVA 1YWNA 2EVAA 2W0JA 3TNHA 2I1MA 3NYVA 5HCZA 3HA8A 4AW2A 4GYGA 3E63A 3LJ2A 3CGFA 1PXJA 4Z16A 4J8NA 3HMPA 2JBOA 5I9WA 4L01A 2W17A 2IW8A 3UVRA 4FR4A 4QMSA 3PPKA 4UMUA 5M4CA 1O6LA 3CE3A 1JWHA 3FI4A 2RL5A 3SGCA 3C4CA 4JR7A 1V1KA 2VTJA 5FXRA 4WG4A 3QFVA 3SC1A 1K3AA 5CVGA 3EQPA 5E4HA 4TY1A 2W4KA 1XH7A 1O6KA 1XQZA 3D7TA 1SVGA 2YA9A 2ITYA 2YM8A 4M7IA 1J3HA 4PQNA 3VS2A 5EYMA 4K11A 4RVMA 4UMPA 5E8XA 3G5DA 3QZGA 4QO9A 2F7EE 5EFQA 3R9NA 2X1NA 1M52A 5CEMA 2W9ZB 4YSMA 2ZDTA 3EN5A 4WKQA 5F20A 5GHVA 4YU2A 2WU6A 1CDKA 1WBTA 3ETAA 4TYIA 3NGAA 4K1BA 2ZV9A 2BROA 5BVOA 4OTDA 4GK2A 3TI1A 4P4CA 3BPRA 4Y5HA 3A62A 4CLJA 4EJ7A 4BCKA 3FMMA 3BEGA 3DKFA 3DDQA 3FLZA 2H96A 4XLIA 3W33A 3BGZA 4RWJA 3ORPA 4JQ8A 3QXPA 1TQMA 5K5NA 5DVRA 5KZ0A 5C9CA 4O0VA 1DI9A 2B9FA 1SMHA 3OTVA 1RDQE 4M67A 3MA3A 1OI9A 2AYPA 4PY1A 2RF9A 3D7TB 4I22A 2P3GX 4P7EA 4G3DA 4QQJA 3HUBA 2YM5A 4I5PA 5F4NA 4C3RA 3ID6C 3SG9A 3ORTA 3Q32A 3KGAA 1FPUA 1ZZLA 3W55A 3H30A 3ET7A 4ZXTA 3O0GA 3RCDA 3NUPA 1W0XC 2F57A 3NRMA 4QMLA 4F99A 2PVFA 2XIYA 4UXQA 3E8NA 3UZPA 4BDIA 1PYEA 1IG1A 2VO6A 4EI4A 5HNIX 3DBCA 4GRBA 1PHKA 4NSTA 4RPVA 3R7IA 2VTLA 2HYYA 5CNNA 3R8LA 3V6RA 4EZ3A 2Q0BA 2FGIA 4ZAUA 1NW1A 3I0QA 3FQHA 4GG5A 2X4FA 4GK4A 3W8QA 2JFLA 1JKLA 5CWZA 1H0WA 3GU5A 3ZCLA 4USEA 3BWJA 4U0IA 4FKTA 2WD1A 4DFXE 4QT1A 3N9XA 4OT5A 4EBVA 5HZNA 3JVRA 4BB4A 3TDVA 3WF5A 5C1QB 3EH9A 3QRKA 4QP2A 4DH7A 4G1WA 4JBVA 4MH7A 4ZTMA 5JSMA 4FUYA 2UW7A 4NU1A 3PY1A 3C51A 4W9XA 2X9FA 4W9WA 3ZUVA 4D0XA 4X7QA 2GNJA 2P4IA 4XG2A 5HGIA 3R2YA 5M53A 5HVKA 2F7ZE 3TJDA 1FBNA 4YJVA 4RT7A 4Z55A 1JAMA 3K5VA 1FMOE 4O2PA 3FAAA 4S32A 1FVTA 4KS8A 5IH4A 4FEWA 4LMUA 4RG0A 3IDPA 3LXNA 1M2RA 2GCDA 2WMBA 5M4FA 3NNXA 3Q6UA 3QU0A 5D1JA 3RWPA 3OW3A 3G2FA 2RGPA 3GU8A 1G5SA 4YC3A 5H8EA 3MVLA 4LGGA 5JGBA 4G6OA 4L3JA 4EONA 5DR9A 2PE1A 5J7BA 3D5VA 3AT4A 4GU9A 5E91A 3Q6WA 3QRIA 3MIYA 1TQPA 3C0GA 5DEYA 1UA2A 4AZFA 5AV1A 2HXLA 1LPUA 3DKOA 3IOPA 3MSSA 3P7CA 3QC9A 2YLEA 4LUEA 4WRGA 1PF8A 3MFUA 4K0YA 1A06A 3VF8A 4M15A 4ZSAA 3W2PA 1ZYSA 4J95A 4QP7A 4FMQA 4XNEA 4QMWA 3ZYAA 4TKSA 4BCGA 4DHFA 3GC7A 3F82A 2XVDA 2V22A 4IDTA 4DAWA 5JRQA 2YACA 2E9PA 3PXZA 5KE0A 2R3IA 3Q2MA 3CCNA 4XP3A 4IVCA 3VW6A 3D5UA 2R7BA 3TL8A 4JS8A 3WF7A 2WQBA 5JRSA 2XNBA 4K33A 5AV3A 4YZBA 3VIDA 4A9SA 1M7NA 2WTCA 4O7YA 5FM3A 4CMUA 4UALA 4FTAA 2YDKA 2HWOA 4NM3A 5K4JA 2XEYA 3IONA 4FIHA 3UOJA 5HG7A 3SHEA 3PVBA 4JQ7A 3AXWA 4FGBA 5HD7A 1QMZA 2YJSA 5AP7A 4JQEA 4ZSGA 2C6TA 3FLWA 3U4UA 4BCMA 4XHKB 4Y83A 3TUBA 1AD5A 2HXQA 3G0FA 3OUKA 3R7GA 3HV5A 4X6QC 5EOBA 3IW7A 4A9TA 3C0IA 3QA8A 3E8EA 4WNMA 2E9UA 3V8WA 4BTFA 4JG8A 4PUZA 5TE0A 1NVQA 4HZSA 4H1JA 1WFCA 2VO0A 3JUHA 3WE8A 4ANNA 2C0OA 5T6KA 4D5HA 3TIZA 5HLWA 5AP5A 2WMQA 1JSUA 3UVPA 4XOZA 4ZZNA 2C6EA 2CPKE 4O7NA 3L9LA 1ZZ2A 3QQKA 4PRJA 4TN6A 3R8UA 3TZ8A 4AGDA 4EORA 3BHHA 4XMOA 2JITA 4UWYA 2BFYA 5F94A 1R0EA 3QQLA 5KCVA 4GSBA 1FVRA 2XF0A 4MD9E 3PYYA 3KXGA 3FZ1A 4BI0A 4O83A 1YKRA 2HCKA 1ZOEA 3GCSA 3FHIA 3V04A 3Q53A 4MNFA 3KF4A 3RPSA 4JAIA 1H1QA 2V0DA 4PTEA 5AP0A 5B0XA 4EH5A 3E62A 4EOMA 4P5QA 4XCUA 1Q8ZA 4D2TA 5ANJA 4FC0A 2XRUA 4O7SA 4HGLA 3ZZWA 2WU7A 4FNXA 3FY0A 4NK9A 4TWPA 4FZDB 2OKRA 1OPKA 4MWIA 2YIQA 1S9IA 4X6RA 3AD6A 3MW1A 3M42A 3NCZA 5GNKA 3ZO2A 3LIJA 1PXKA 3KFAA 2ITNA 4FSZA 4RZWA 3LMIA 2ZM4A 2XBAA 3ZC6A 2PMLX 2YAAA 4PPAA 1IAJA 4XP0A 3KN5A 5EYDA 3A7IA 3TKIA 2BDFA 3KA0A 3PVWA 5EQPA 3RK9A 2CGUA 5E9EA 3FMNA 3TWJA 2HENA 2PZIA 2OH0E 3W2OA 3ZMMA 3UO6A 4BBFA 3LXPA 1BLXA 3D7ZA 4O0YA 4O0SA 3FZTA 3SX9A 4OTFA 4G5JA 3ZO3A 1YRPA 4ZS4A 1PRYA 4XX9A 4OTHA 3OEZA 3RZBA 3DK7A 4TW9A 4U41A 1BL7A 2UZDA 4TYEA 3O96A 3ZZEA 2VX1A 4RJ8A 3N4UA 4S33A 4E6CA 4GFOA 3DBFA 3R8ZA 4DEDA 3IW8A 3DLSA 3LJ1A 3K2LA 2ITOA 5F95A 2PZ5A 3SW7A 2XZSA 3LFNA 5AUTA 4PDYA 1Q24A 4JX7A 2FSLX 2C6KA 4FOBA 3WF8A 2XK4A 3EFKA 3ZTXA 2UZWE 3MTFA 4AT4A 1YDSE 4MWHA 1MP8A 4OTIA 3E64A 2PU8A 4IEBA 2O63A 2VWVA 1LP4A 1S9JA 4YJTA 3BQCA 3AMYA 3A4OX 3BYMA 3T8OA 1KOBA 1KE5A 5L2IA 2QG7A 1BI8A 3O7LD 4ARKA 4FI1A 5DE2A 3V3VA 4QMUA 4O84A 2UVZA 4MHAA 5FTQA 2G2IA 2V5QA 3LCTA 4FKPA 2YEXA 3QGYA 4GIHA 3UE4A 2JBPA 2VTRA 4AGWA 1Y6BA 4AGCA 2I7QA 3FY2A 1ZYCA 1VYWA 4RA4A 3VBQA 3LAUA 3R22A 5L4QA 2UZBA 2ACXA 3RCJA 2NRYA 3LM0A 4W4XA 3ZONA 1SVHA 3LHJA 2J0JA 4ZMFA 3HUCA 3LXKA 4O21A 3OEFX 3PIXA 4BDEA 5D10A 4GCJA 4FK3A 4AOJA 5LXMA 3R8VA 4QMXA 1H1PA 4UB7A 4RRVA 2IZUA 2PMIA 3R1NA 3CBLA 4IX5A 1YI6A 4DH5A 4EJNA 2YM4A 4U42A 1OITA 4EKLA 1UU9A 3I60A 1SVEA 4QTCA 4A9RA 4AZEA 4E1ZA 5FUTA 3K54A 1CM8A 4DF3A 3BLRA 3ZSIA 2O2UA 1YXVA 3VBTA 3BGQA 4DA5A 3FWQA 1GAGA 4XV2A 4AN3A 2HY0A 3KRJA 3OY1A 5HCXA 3UOLA 3OT3A 2VV9A 3QZHA 4EYJA 1GJOA 2Y4IC 1RW8A 4NCTA 5CF5A 5I0BA 4DEBA 5FDPA 4MD7E 4YTIA 5HG5A 4U40A 4KBKA 4KUJA 4RZVA 3ZM4A 4APCA 4X2FA 4E4XA 4CLIA 5HE2A 3OXTA 5CXHA 3SRVA 3HAVA 4DEAA 3NIEA 3UP7A 4AGUA 4IH8A 3MVJA 4GW8A 5JZNA 4AS0A 4NW6A 1REJA 3H4JA 4QMQA 2H34A 4XG3A 4LOQA 4RX9A 5B2KA 4QQCA 1VZOA 2F4JA 4A9YA 1DM2A 3DU8A 3MB7A 3P79A 4BZDA 3NUSA 2WOUA 4F65A 2BKZA 3QCXA 4QYEA 3AGLA 4QMTA 4I0RA 3TTIA 5E8ZA 2QNJA 3RK7A 5EM5A 4MXOA 3NNWA 1YQJA 2JKOA 5JT2A 2CSNA 5AMNA 4L6QA 2VWYA 2PVLA 4BIDA 3DB8A 2ZJWA 5H8GA 3GCUA 3FC1X 3R73A 2GMXA 4FK6A 1RE8A 1UKHA 3A2CA 3MTLA 1OKZA 3EL7A 4JRVA 3TKHA 1E1XA 2BZIB 4GUEA 3C4ZA 1WAKA 3PTGA 5AAGA 5J1VA 2BDWA 3KMWA 1GZKA 4H36A 4L52A 5BPYA 2QOHA 5CAQA 3B8QA 3MB6A 2BAJA 4PL3A 4AQCA 5HTCA 3HMMA 1PW2A 5D11A 3MIAA 4CV8A 3SRVB 4AA0A 4HVSA 4D0WA 4M97A 3QBNA 2R0IA 4X3JA 1PXMA 5LMKC 3NPCA 2WMAA 1ZYJA 3MESA 3KEXA 1P4FA 3PSDA 2C6LA 3C4XA 4FKOA 3D5WA 4UMTA 3NEWA 5FEEA 4BBEA 3DK3A 4QYYA 5A9UA 3DK6A 2B4SB 5E8SA 5BVDA 3JR1A 2YIWA 4FTKA 3IQ7A 4O81A 2FA2A 3R02A 3SAYA 4HVGA 4UEUA 5AFVA 2HW7A 4ORKA 2R3RA 5IF1A 3NWWA 2BIKB 2YIXA 4H3BA 5E1SA 3UODA 4GUBA 4FGRA 3HECA 1O9UA 4YHFA 5HICA 3WZUA 1V0OA 4AZTA 5KMKA 2PVRA 1P5EA 4IB1A 1XH5A 5D9HA 5H9BA 5CU0A 2C3LA 4MXCA 3FI2A 4YLLA 4HYSA 4EQCA 2OFVA 3PSCA 5E92A 1KE8A 5L2QA 3NMUF 3R7YA 4D1ZA 5JFVA 4YBKA 5DBXA 4R3PA 4XV3A 5FTOA 2A2AA 3NVMB 3MH0A 1U5QA 1JKKA 2O65A 3MVHA 2V62A 1IASA 3DQWA 4GK3A 1B39A 4H3QA 3VUMA 4D28A 5A4LA 2W1DA 5M08A 1T45A 5FRIA 4EC9A 1BL6A 4O0UA 2REIA 3NNVA 4QTAA 4LG4A 5EHYA 2R7IA 4XBUA 2EU9A 4BCPA 2YABA 2X81A 4CYIA 2PE2A 1XH9A 4NTTA 4QMOA 3BCEA 5JMSA 3UDBA 3L8VA 5CU6A 4FIGA 4ZTRA 4UYNA 4CG9A 2WTVA 1CMKE 1YHWA 4KWPA 4R8QA 4WHZA 2PVKA 4RJ4A 2X6EA 3U6IA 3UNZA 4N57A 3UBDA 5CU2A 5IA4A 1MUOA 3EFWA 5KMLA 2FVDA 3GFEA 2X6DA 3FKOA 4BTJA 5M44A 4E5BA 5DYJA 4TYGA 3MY5A 5IMXA 2YAKA 4M13A 4A4XA 3QKLA 3L9PA 4KSPA 2YZAA 1A9UA 1YHVA 4MX9A 5M55A 4EOKA 5IG1A 5AAFA 1Y57A 3EQRA 3CS9A 1KE7A 3TZ7A 3KL8A 4C37A 5FD2A 3R63A 4DC2A 2YITA 3C0HA 2I6LA 3CD8A 2VTAA 3TV4A 4FEXA 4O96A 2GNLA 3R01A 2QLUA 3ALNA 3PE2A 4YTCA 2OF4A 4FE2A 3PJCA 2WZJA 4HW7A 2ITTA 4FKWA 3LFQA 2VTSA 2RFNA 4I94A 3NYNA 5IKWA 2F7XE 5GIOE 4FV6A 4OBPA 4R5SA 2WIHA 3S4QA 2PPQA 2ZB1A 3WIKA 2C6IA 4F7SA 1OL6A 3VS7A 1XH4A 4I1ZA 3CKXA 1J1CA 2UW3A 3HVCA 2JC6A 3DAKA 3P7AA 3ZRKA 4RIYA 4DEGA 3OCTA 5HX6A 2Z2WA 4IAAA 4LYNA 5C27A 3K5UA 3RAIA 4AE6A 1NY3A 2A19B 3G90X 5CASA 1Q8WA 3F3WA 4TT7A 3F3VA 3RM7A 4B99A 3E92A 3FMEA 4KINA 4QYHA 1RQQA 5EH0A 3UVQA 5DHJA 3FPQA 5M4IA 3R0TA 4BKYA 3TT0A 3UPZA 3AMAA 3P23A 4G3FA 3NAYA 1W84A 4HZRA 3ANQA 3D0EA 3PZEA 4A7CA 3PA5A 2J6MA 4TNBA 1QPDA 5LARA 3TACA 3ORNA 3SG8A 3ZLYA 2WO6A 3GU6A 4D55A 2X2MA 2QODA 4XRLA 3VRZA 5HU9A 3FE3A 4O7TA 2A27A 4QNYA 3KXHA 1XBBA 5CF6A 1STCE 4S2ZA 5DR6A 3MH2A 5F1ZA 3IOKA 4FV2A 5HEZA 4J1RA 3TUDA 4NJ3A 1ZWSA 4ANBA 3KCKA 1HCKA 4D4RA 5M06A 3RPOA 3V5PA 4RIYB 1U54B 2XH5A 5LVPA 3RPVA 3BHTA 5HIEA 4I5CA 4DEHA 2A4LA 2WELA 4FTTA 4RGJA 5LWMA 3TZMA 1YOMA 5IQAA 2YISA 2XNNA 4F9BA 3HRCA 3ORXA 1H26A 3ZSHA 3MJ1A 4DH8A 2F49A 4PWNA 5CSVA 3MWUA 4EHVA 4FV4A 5C26A 1H4LA 2W1IA 4OTQA 1Z5MA 4PTGA 3UIMA 3DKCA 3D5XA 2XJ2A 3FDNA 3OT8A 4ITIA 2YJRA 4YLJA 4E7WA 3FHRA 4F0FA 1UNGA 2PK9A 3QWKA 4FVPA 5H3QA 3W32A 3BHVA 4DFBA 3GEQA 5AR8A 2C5YA 5DGZA 1U4DA 2VX3A 2HELA 1UWJA 3G51A 2ERZE 2G01A 3T9TA 2AC3A 4AW0A 4EOPA 3UNKA 1IAHA 4IAFA 2I0EA 5CS6A 5M56A 3VBXA 4ALUA 4J52A 5FP6A 3QLFA 4WSQA 5I4NA 3BU3A 4IHPA 5CQWA 2UUEA 4F70A 4L43A 5J95A 2WEVA 4KIPA 4G31A 4S31A 3Q9XA 4HCUA 5AWMA 5HQ0A 2OLCA 4GYIA 3AD5A 4WG5A 5HE0A 4BCQA 2WMXA 4D2WA 2JKMA 4AE9A 2YLFA 3VJNA 3L8XA 5FP5A 2GHMA 3F3ZA 3UQCA 4F0IA 4O91A 2VWIA 5L8LA 3NCGA 3N51A 3VUIA 1Q3WA 2ZM3A 1H1WA 4R5YA 3ROYA 4EZ7A 4EC8A 3A99A 3QRUA 4DE4A 2GNIA 2R3OA 3SQQA 2ZB0A 3FMLA 3FQEA 5IUGA 4JG6A 2XYUA 4C35A 3LM5A 2RSVA 5K3YA 5I9YA 3COMA 1U5RA 3LCDA 4H1MA 5C8MA 5CEQA 3V6SA 4ANOA 3RAKA 3EZRA 4CT1A 4AU8A 2ZV2A 4DG2E 3SD0A 1YW2A 3KVXA 1CKJA 4ALWA 1OECA 2C0IA 4ZEGA 1OL1A 2PSQA 3BI6A 4RLLA 5HG8A 2CKPA 4YTHA 3UG2A 3VS6A 4A06A 3H9RA 4G34A 4EOSA 2OJIA 2OSCA 4C4JA 5BVNA 4LQMA 4NKSA 4E26A 3LLAA 3OFMA 2JAMA 2B1PA 3WIGA 2V55A 5B2MA 1W7HA 4HYIA 3FMDA 4QPAA 4WA9A 3UQGA 4EUTA 5J8IA 4QP6A 3I79A 4WNOA 3ZSGA 4IZYA 3BBWA 5EW9A 5J79A 3EKNA 3QQUA 3UZRA 4L45A 3M2WA 3AQVA 3POOA 3K3JA 2IZRA 3L8SA 4Y95A 4EK3A 1FGIA 2QI8A 2UW9A 4KRCA 4RQKA 4XBRA 3W18A 2HZNA 3QQJA 3CTQA 2DWBA 3I81A 2UZTA 4BHNA 2GS2A 5DFPA 3PG1A 3ULZA 4BVUA 3OWPA 4EH2A 4EOOA 4F9CA 2YN8A 2IPXA 3RMFA 3DA6A 4M3QA 2E9NA 5IDPA 3QD0A 3RKBA 3QTQA 4X0MA 2W1CA 2W1ZA 5HI2A 3R00A 3WOWA 2VTQA 4QRCA 3ORLA 2W5AA 5ANKA 3S3IA 2KTYA 4QQ5A 1QPEA 1F5QA 4YJOA 4BF2A 4ZSEA 4OUCA 5CAPA 4FOCA 2UZUE 3H0YA 5KMIA 2C1AA 3AC5A 4BDFA 5AIKA 3DY7A 3F5XA 3F69A 1FINA 1OMWA 4FV9A 4YBJA 4PTCA 3T3VA 5CY3A 2XNGA 1DAYA 4FT7A 3HGKA 5AX9A 4C02A 4BCOA 4DGGA 1J7IA 1T46A 3B2TA 2Y8OA 4FG9A 4KBAA 3UZTA 5I9UA 3C13A 5AV0A 4YO6A 3ACKA 4F1MA 4FTNA 1WBOA 2C3IB 4BDGA 4X3FC 5CTPA 3FZPA 1WZYA 3V5JA 1Q8YA 1YHSA 1IRKA 2ZYBA 4FT0A 5HLNA 4X2JA 2QO7A 1EH4A 4FKVA 4OR5A 4WD5A 2XIRA 3E88A 4Q9SA 2GHLA 4IWOA 5T3QA 2YCRA 3GC0A 4N4SA 2CGWA 5BQ0A 5K0KA 4FTRA 1R0PA 3OCSA 2GNGA 2OIDA 4CRLA 3NNUA 4X21A 2ZOQA 4ZTQA 1CKIA 4LV8A 5HBEA 4LI5A 5IQBA 4CGAA 3JY0A 4BC6A 2XRWA 3ZLWA 4QPSA 1P14A 4CRSA 3P4KA 1JOWB 3ZFYA 4U81A 3FQSA 1H0VA 2WKMA 3H3CA 3R28A 3PRFA 4FV0A 5TT7A 5CEPA 2CGXA 4FKIA 3HV3A 5IQCA 4FTOA 4YPDA 4AA5A 4F9AA 2BHEA 5EDRA 4IBMA 3DBQA 5FDXA 3U9CA 4QTDA 1H28A 2CCIA 5HE3A 1GOLA 4RVLA 2C4GA 4E6DA 4L9IA 3VC4A 5J9ZA 2EXEA 3DBEA 4AT3A 4BWXA 4GT5A 3OOMA 1MRUA 3QGWA 4E4MA 5ANOA 2PUIA 1Z57A 2BALA 4HCTA 4QP8A 1KSWA 4O7LA 2C68A 3AC4A 3QYWA 5E8VA 5E8WA 2R3FA 3COHA 5CVFA 1L8TA 2WQOA 4FTJA 3FXZA 1V0BA 3D2KA 5IH5A 4BCFA 3ORMA 3ELJA 1P2AA 2XA4A 5I5ZA 3H0ZA 3IGOA 2CJMA 4H3PA 4LMNA 4ZSLA 3OF0A 3COIA 2E9VA 3R9HA 3POZA 4NWMA 4FT9A 2VWUA 3VUGA 5BMSA 5DH3A 4BDDA 2YCQA 4O1PA 2XK6A 3PPJA 1ZMWA 2WEIA 2XCKA 4D4SA 4DN5A 2QG5A 3ZXTA 3DNDA 2OJ9A 2YZLA 4KB8A 5IA1A 3HV7A 4BGQA 2CKOA 4D9UA 4DG0E 5KHWA 4B4LA 4YR8A 3LLTA 5GINE 4RWLA 2RFDA 5CZIA 3DFCB 5EW3A 5GZ9A 3LQ3A 2R4BA 4QOXA 4ALVA 4D2SA 4JVGA 5AR2A 3VBWA 4RJ6A 4W8EA 4RWIA 4CFUA 3KQ7A 1UU8A 2UVXA 4ZTSA 1H24A 1OIRA 2R64A 1F3MC 4RJ7A 5CALA 4XV1A 4I5MA 3U87A 2R9SA 2OF2A 4OW8A 3PY0A 4J96A 3VBYA 3C4WA 4IFCA 4R7IA 3AG9A 5KNJA 2IJMA 2QC6A 2H8HA 2PUNA 1JSTA 2UV2A 4NIFA 4NUSA 2Y0AA 3VS3A 2BCJA 1OL7A 3DJ7A 1FGKA 3QC4A 2G9XA 1NT2A 1Q97A 4XEYA 3C4FA 4K18A 1FQ1B 3BEAA 4MBJA 4G17A 3BLQA 4QPMA 3FC2A 3FZSA 4BTKA 4D9TA 5IPJA 4C59A 3I6WA 3OTUA 4RX8A 4HVHA 4RA5A 3C5IA 4RJ5A 5A3XA 5BVEA 2WQMA 3D94A 3SW4A 3DKGA 3QUDA 5CEIA 5JN2A 3MY0A 3OCBA 4I5HA 4IAIA 4CTCA 4EH7A 4IAZA 1YWVA 4O82A 3QHRA 2C1BA 3A61A 3KB7A 4KSQA 2JDOA 4ANQA 3C7QA 4CCUA 3GOPA 4RIOA 3NS9A 3BLHA 2VN9A 3K3IA 4IE9A 1K2PA 2V7AA 3A60A 3BWFA 3V01A 1KOAA 3TTJA 3GNIB 4I41A 1ZYDA 3UYTA 5AAEA 2HW6A 2JAVA 4IXPA 2WTKC 3EHAA 4NM7A 5EM6A 3ODYX 3BV3A 3HRFA 4CD0A 3R6XA 3IGGA 3CY3A 3VUTA 2I0VA 3NX8A 1ZY4A 2JIUA 2YERA 4NIFB 1OVEA 4G16A 5JZJA 3HL7A 3PG3A 5A4CA 3BRBA 5EYKA 1ZMUA 4BI1A 1OPLA 1UU7A 4DFYA 3AC3A 4ITJA 2FUMA 4U43A 4QMMA 3EOCA 1YXSA 3QTXA 3RBWA 2CNUA 4ZZMA 2HZ0A 3TNQB 2VO3A 5AX3A 2CKQA 4IB3A 2O3PA 1AGWA 4N0SA 5TR6A 4M14A 1H01A 3FSFA 5HBJA 4TXCA 4TNDA 4NH1A 4PV0A 3W2RA 4Q9ZA 5CEKA 2QLQA 5JFSA 1GNGA 4XG7A 3MS9A 3DXQA 4DEIA 2HWPA 4IWPA 3ZHPC 4L46A 5HORA 4FG8A 4UXLA 3OROA 4QYFA 4J7BA 5M4UA 3Q04A 5A4EA 2BAQA 2QOOA 3MVMA 4FEVA 1PMVA 3PRIA 3R7VA 2ZDUA 3I5ZA 3EIDA 4V04A 5DN3A 4HGSA 4AZVA 3HV4A 1U59A 1WBPA 4P2KA 2EWAA 4PP7A 3LFSA 3PLAE 2QOQA 4CQEA 5TO8A 1CSNA 3EZVA 2PYWA 4E93A 1QPJA 4DGMA 3LMHA 5FLFA 5FXSA 2QD9A 1OUYA 3F5PA 2WGJA 4YMJA 3KCFA 2QQ7A 2J5EA 3U6JA 2J9MA 1M7QA 4P90A 5CI6A 4YJQA 3QAME 4CCBA 5A54A 4PDSA 4C33A 2IZSA 4JXFA 4YURA 4M68A 2GS6A 3QX2A 4CV9A 4DTKA 3QQFA 3KMUA 4LGHA 5IQIA 2BZJA 5FM2A 3UP2A 3OWKA 4BN1A 4E5WA 5AUXA 2GPHA 3VRYA 3NYXA 3IECA 4JIKA 3UO4A 4AW1A 2ITQA 1BUHA 2PY3A 4L67A 5KKRC 4IZAA 4O7ZA 1U46A 3EWHA 3DDPA 4FL1A 3NDMA 2IVSA 2EB2A 3ERKA 4LOPA 3L1SA 2R3HA 2BRNA 4KIKA 3HEGA 2VU3A 5L6WL 4BL1A 5M57A 2Z8CA 2V7OA 4J99A 5DOSA 3BZ3A 2XIKA 5D12A 3C5UA 1GZOA 2G2HA 3QXOA 4J8MA 5ACBC 3D4QA 4USFA 1Y8YA 2Z7QA 2R3JA 3AD4A 5EM8A 4C34A 2CNQA 3FI8A 4DEEA 4UWCA 5E8TA 3WF9A 3LMGA 3D9VA 4FKRA 4O38A 4F64A 2Z02A 1KE6A 2A1AB 3OUNB 4KIOA 4QP4A 3QHWA 2NP8A 1OL2A 3SA0A 4I93A 3F61A 3R30A 3BHUA 4IX3A 4A07A 4AG8A 2EXCX 4BIBA 2J0KA 3CY2A 3OXIA 1O6YA 4RWKA 5A4QA 2BMCA 3MDYA 5HBHA 4BCJA 5AIRA 4ZTNA 1IR3A 4EL9A 3TDWA 3MN3A 4O0XA 3Q4ZA 2YHVA 4FV7A 2J7TA 2QOIA 2E9OA 2WMRA 3ZBFA 2PZRA 4H39A 4ZLOA 5FBOA 4ENYA 5GJFA 4PMSA 5CXZA 2YIRA 1PMEA 1JLUE 3G15A 2R3PA 2UVYA 2OBJA 2Y7JA 3NUUA 3HKOA 4QP1A 4BDJA 5CF8A 3KKVA 4NCTC 4O27B 4CEGA 3S1HA 2JDTA 2YFXA 4W4YA 4GKHA 1ZOGA 5IZFA 3ZBXA 5IMEA 3KC3A 3QUEA 4RVKA 3VO3A 4B7TA 4YTFA 4CMOA 3E7VA 2XKEA 4BKJA 4IJ9A 5BVKA 4RQVA 5BYYA 2KULA 1PJKA 2NRUA 5A46A 3ANRA 5JH6A 3N4VA 4Q2AA 4U44A 3L9MA 3LFBA 4KKHA 3V51A 4YUQA 5AA8A 3GBZA 3WZDA 1XR1A 2QOKA 5ANGA 2CLQA 2F2UA 3RVGA 1GY3A 3ZO1A 2QONA 3ATSA 5CQUA 2ITUA 3EJ1A 3IW4A 3TUCA 2GHGA 4O86A 3IW5A 3ZUTA 4ZLZA 5EK7A 5CEOA 1OIUA 3FSKA 4IWDA 3G33A 5IDNA 4YP8A 3UIXA 4IM3A 2QOBA 3PWYA 5T68A 4BCIA 1YOJA 3VVHA 1X8BA 3G9LX 4NM0A 4AACA 5DEWA 3VF9A 4TPTA 2W96B 2Y9QA 3FZOA 3P7BA 5KMOA 4BI2A 4DH3A 1UVRA 4FKUA 4YNEA 4E8AA 3SDJA 3EQHA 3DZQA 3KRXA 3KY2A 3R7OA 3CEKA 1WVXA 3Q5IA 4CFVA 2XK7A 4G9RA 4QMNA 5K9IA 5ANIA 4RIXA 3ZLSA 4AOTA 4MK0A 4RJ3A 2B53A 2PVJA 2XB7A 3EN4A 5GJDA 3GQLA 3KVWA 4TWCA 3ZFXA 4ANLA 2OW3A 2QOLA 4CFFA 2W4OA 3BGPA 3A7FA 4XV9A 1YI3A 4FT5A 3T9IA 1CTPE 2QOFA 4F7LA 5IISA 5BX0A 1Q62A 5E7RA 4DCAA 2QKWB 3KXMA 1ZY5A 3BYUA 5AR3A 1ZLTA 4ACHA 1UU3A 1DI8A 2X7FA 1KE9A 3AC2A 3BU6A 3RAHA 5CAVA 3PJ3A 4FKSA 3A7GA 1OZ1A 2VTTA 2Y4IB 3RNYA 2J5FA 4J53A 5I3OA 4Z7GA 2HAKA 3CLYA 4G3EA 5C4KA 2CKEA 3DNEA 2XCHA 5KMNA 2ONLC 2PVYA 2BVAA 3Q52A 1BYGA 3G0EA 5AA9A 3F5GA 4C57A 1SZMA 4UY9A 1DAWA 2B52A 2PVNA 4NFNA 3LCKA 2O8YA 3G6GA 2PE0A 3EQBA 1SYKA 4AOIA 3MY1A 4RX5A 3EL8A 3PXFA 1ZMVA 4O1OA 5BYZA 5M51A 1G8AA 2R5TA 5A14A 3PXKA 3CJGA 1ZYLA 4TWOA 4ZOGA 4QP9A 4XH6A 4GJ3A 4RIXB 3U9NA 4A9UA 5J9LA 2O5KA 3VNTA 5EG3A 4YZCA 4ZZOA 3VAPA 3SOCA 4BGGA 4X2KA 2XM8A 2HZIA 4GMYA 3P9JA 2XS0A 3PJ1A 5HU3A 1XJDA 3FLYA 2VNWA 4QMVA 3VQUA 4YJRA 4EK4A 4BDAA 4EH6A 4OTWA 2GTMA 3GUBA 4LL5A 4FUXA 5GZ8A 4NEUA 3PA3A 3OOGA 2OXYA 3U51A 4D4YA 3LCOA 4PF4A 4DH1A 4HNIA 4JDHA 4DG3E 5LQFA 1A48A 3UMWA 3V5WA 3UC4A 2XK8A 1L3RE 4BZNA 2C47A 4EHGA 4JBOA 3F7WA 3PWDA 4FTLA 1XBAA 2XKCA 4OTRA 3VUKA 3OW4A 3KRRA 4F9YA 4O6LA 3BV2A 3W10A 2UW4A 3P08A 4BDHA 2G1TA 3NLBA 4OAUC 4K9YA 5BVWA 5JFXA 5EKOA 2GQSA 4WSYA 3ULIA 5M09A 3M1SA 3MV5A 5E8UA 5ETFA 2YDJA 4LRJA 2R2PA 5BNJA 4DLIA 3ITZA 3G6HA 4K6ZA 4XYFA 1H1RA 4YHJA 3HMIA 3W16A 4NJDA 4WBBB 4CKRA 5I9XA 1HOWA 3GC9A 3LQ8A 1ATPE 2XUUA 4F9WA 4MVFA 1WBVA 5JKGA 4EUUA 3FJQE 1XH6A 2GFSA 4CTBA 3U55A 4WUNA 5BUJA 4EKKA 4DBXA 4UN0C 4ACMA 3QRJA 5TOZA 2XM9A 1REKA 1BKXA 1AQ1A 3JS2A 3O50A 1OIYA 3CP9A 2YCFA 3ZC5A 1Y8GA 3IDBA 3CC6A 4CT2A 2UW6A 4AZWA 4MAOA 4GVAA 3Q4UA 2C69A 3QCYA 4FICA 3DFAA 2JIVA 4L44A 5IEYA 4MD8E 2WFYA 2PZYA 5GZAA 3OWJA 5C8NA 4RVTA 3SOAA 4JL9A 4FIEA 4QYGA 1PXNA 4U9AA 3OZ6A 5FQDC 4M8TA 4RC3A 3UOKA 5AUVA 4DT8A 2G15A 3DBDA 1LEWA 4FIJA 4M84A 4UZDA 1URWA 4NYEA 4ZIMA 1OUKA 4JBPA 3VS0A 4NM5A 4YC6A 4TYJA 4NL0A 4FSTA 3Q4CA 1P4OA 2WMVA 3D14A 5HLPA 2VZ6A 4ACDA 4ACCA 3SLSA 3NVKI 4O0WA 2BZHB 3EMGA 5KZIA 4UMQA 5HD4A 4HGTA 5EI6A 3NW6A 3GP0A 4BCHA 1PKGA 3R7UA 4YHTA
chains in the Genus database with same CATH superfamily
2PHKA 2XJ0A 2XNMA 3E93A 4W4VA 4OT6A 5DA3A 4XLVA 3LFDA 1G8KA 5KBRA 2C30A 2G2FA 4IZ7A 1PXOA 1YXXA 4DTAA 1TVOA 2X7GA 1OKVA 2XNOA 4IVDA 4L42A 4O7WA 3LFCA 3FYKX 3JVSA 2IWIA 5JQ5A 3KMMA 2UW0A 1GIIA 1G8JA 1PKDA 3MGYA 4FKLA 3PSBA 2YIYA 5FGKA 1VYZA 2CN5A 3MH1A 1BI7A 2FO0A 2WPAA 4JDJA 3QD3A 4J98A 3JXWA 4C36A 4ANMA 4OGRA 4PMMA 5D41A 4Z3VA 2EB3A 3WZEA 5HO6A 3RPYA 4RMZA 3ORIA 4YO4A 4CG8A 3O7LB 4FG7A 1BX6A 2J90A 4I6LA 2ZVAA 4H05A 4HGEA 4ANSA 2BHHA 4FTIA 5DT4A 4C7TA 5K5XA 3IK3A 3QQGA 3L9NA 3GCVA 2IZTA 4YGAA 1W98A 3O17A 4BIEA 2QHNA 2R3MA 4M0YA 4AFJA 5DR2A 2XBJA 5HIDA 4U45A 3CQEA 3NUXA 1PXLA 5HCYA 5LCJA 2OWBA 3EN6A 3FKNA 4ZTHA 4GS6A 4YPSA 1M2PA 2XK3A 1XKKA 2OJFE 3Q96A 4JT3A 4O6EA 4RFYA 2IW9A 3NYOA 2I0YA 4ASEA 1GZNA 4E4NA 4C3PA 5L2SA 5HVYA 5CU3A 4ENXA 4HJOA 2UZNA 3OBJA 4ACGA 4IIRA 3DCVA 3PDTA 4DFZE 2VO7A 2XKFA 3IO7A 4X2GA 4WNPA 4WRSA 2OJGA 4D2VA 4EHEA 4TWNA 4C0TA 4FSYA 5BMMA 4K8AA 4WNKA 2EUFB 2PMNX 3QYZA 4FF8A 3Q3BA 1LR4A 4IAKA 4JAJA 3LJ0A 5HIBA 5HNGA 4MCVA 2Q0NA 5D7AA 5HE1A 4BDBA 4E73A 4YSJA 2ZAZA 3DGKA 1APME 2H9VA 4GH2A 4HYUA 4BBMA 3EN9A 1R78A 2B55A 4UX9A 3WARA 4C4EA 2XMYA 4B8MA 2WTJA 4WOVA 5ETAA 5DT0A 5BUIA 3PIZA 5IA3A 3ALOA 2VWZA 3PXYA 2JIIA 4MNEA 4Q5EA 4C2WA 2VUWA 5J9YA 1J1BA 2IVTA 4N6ZA 1B38A 2J2IB 3HP2A 4MQ2A 3RPRA 3ZRMA 5CX9A 4F6SA 2EXMA 2WMWA 4CMTA 2WMTA 3QKKA 1SNXA 4V01A 5KO1A 4FL3A 2XEZA 3FMJA 4B9DA 4U79A 2W1GA 4AWIA 3SVVA 3Q60A 3W0QA 4YLKA 4YJPA 1H27A 3WYYA 3OG7A 5IA5A 1ND4A 2OZAA 5DI1A 3DAJA 5LMAA 2BDJA 2GSFA 5AR7A 3PVGA 5E1EA 4BWPA 4DCEA 4L3LA 3GFWA 3AMBA 3BBTB 3JY9A 3FL4A 3PY3A 2DUVA 4I6HA 3F3UA 5TF9A 4DINA 4R7BA 3P1AA 2VRXA 1YWRA 3PP0A 5HX8A 5M07A 1YDRE 1YI4A 2OH4A 3O51A 1IA9A 4BWKA 5ICPA 4C3FA 4NFMA 2HIWA 4AZSA 2SRCA 3A7HA 1GIHA 5HG9A 2W4JA 2GS7A 3WBLA 5GIPE 4MNEB 1GZ8A 4MBLA 1H08A 3H9OA 3RINA 3EFLA 3FYJX 1SM2A 4H58A 3DPKA 2HY81 3OD6X 4CSVA 4F78A 3QX4A 1FMKA 3E3BX 4JDIA 1YDTE 4FL2A 3RHXA 2VTNA 3UG1A 3UTOA 3F88A 4XG4A 1XBCA 2W5HA 3OHTA 4G6LA 4PPBA 3QTIA 3TNIA 4AFEA 4CKIA 4E20A 5IH6A 4GU6A 4CQGA 3TYKA 3ZLXA 5GJGA 4EQUA 3U8WA 1NXKA 2OZAB 3DXNA 1J7LA 1OL5A 4FNWA 3RM6A 4QTBA 3ZUUA 2OO8X 5ANDA 5JK3A 5L3AA 1Q3DA 3BHYA 4UBAA 5FXQA 4E6QA 3UC3A 3IW6A 1I09A 4F7NA 4FZAB 5JEBA 2CCHA 4F1TA 2C5NA 4KA3A 3U4WA 3VONA 2BRHA 2R0UA 4BDCA 4XOYA 5DNRA 2QKRA 4XUFA 4D1SA 3PIYA 4YC8A 1VJYA 1MRYA 3COKA 1FOTA 4BFMA 2QU5A 3EQCA 4F4PA 4LL0A 2C5XA 2Z60A 5BYLA 4GKIA 4EWQA 4I0SA 4L7SA 4M12A 4EK6A 3RZFA 3WYXA 2PL0A 2CMWA 4ZY5A 5IUHA 4CFWA 2JDSA 4MEDA 4IWQA 1KUTA 2UZEA 3QQHA 3LXLA 3HP5A 4QMYA 4FNZA 4U5JA 3TKUA 4MQ1A 5JFWA 4CFMA 3H10A 3R8MA 1PXIA 2UZOA 5C03A 4FEUA 2GTNA 4FZ7A 1UKIA 4AT5A 5EI2A 3NFFB 2LGCA 2WTDA 2VTMA 3OXZA 1YXUA 3UYSA 5B7VA 2B7AA 3W2SA 3QZFA 3CR0A 5AUZA 1JQHA 1OKWA 4OAVB 1Q8UA 2AC5A 3GT8A 1F0QA 1KWPA 4R3CA 5K4IA 3BIZA 5ANEA 4X3FA 4I92A 3OC1A 4FT3A 4WT6A 4KKGA 4D2RA 5HVJA 1XMLA 3TJCA 4YJNA 2LAVA 4CVAA 4TYHA 3OCGA 4ZJJA 1IEPA 4DLJA 5HO7A 4LRKA 2Y6MA 3BE2A 3UPXA 1R3CA 2UW5A 2WQEA 4USDA 2WQNA 3VS5A 1ZARA 1MQBA 1PY5A 3NR9A 1QPCA 4KNBA 5HO8A 3BE9A 3DLZA 4JDKA 4EEVA 2OFUA 3MA6A 5AV4A 4MXYA 3GVUA 5ACKA 1WVYA 3LQ5A 2C6MA 2Z7LA 3TXOA 2C6DA 4IZ5A 1CKPA 3FMKA 2C0TA 2RFSA 2W05A 3Q5ZA 3QZIA 3V5QA 3VS4A 4EYMA 2Y4PA 2B0QA 2X9EA 1M2QA 3A7JA 4OTGA 4DT9A 2C3KA 4FX3A 3AOXA 4NTSA 4QP3A 3NUAA 4V05A 5AUYA 3LE6A 2P0CA 4L53A 5FEDA 4CXAA 1JKTA 4X3FB 3CTJA 3EYGA 3SV0A 4O0RA 2W1FA 5EQYA 3LVPA 4ZLYA 4PMPA 3CXWA 3WE4A 3F5UA 4TYHB 3OVVA 2PTKA 4MF0A 2J51A 2P2HA 3HMNA 3CGOA 4G3GA 5CT0A 1R1WA 3A8XA 3ZEWA 4BYJA 3I4BA 4IM0A 4I6FA 2ZM1A 4I6QA 3HRBA 4AN2A 3LFFA 3FBVA 3ZU7A 5HTBA 2ETKA 3HA6A 3JPVA 3MFSA 3PXRA 5AV2A 4KKEA 4BDKA 3UQFA 4JNWA 5FG8A 1JSVA 4EK5A 4FSMA 2OIBA 3R1SA 3RWQA 5G1XA 2Z7SA 4ZMEA 3I6UA 2OJJA 5L8JA 4ZJVA 3AGMA 4EWHA 5BUEA 4PPCA 4C38A 3ZEPA 2BTSA 4J97A 4EH9A 3Q9ZA 4R77A 3E5AA 4BY9E 1WMKA 5F9EA 3QD4A 1Y6AA 3R71A 4BCNA 2RG6A 5EM7A 1JVPP 2I40A 3V5TA 4FV8A 4CZTA 2QHMA 2PUPA 2QOCA 3WILA 1MRVA 3VS1A 3E7OA 4RLKA 2RG5A 4FVRA 3CD3A 4EOIA 4L68A 4DGOA 4M69A 2FH9A 4YZNA 5AP1A 4AF3A 3P5KA 4IB0A 1FVVA 4IANA 2QU6A 5DRBA 2VD5A 2GNHA 3QCSA 5CSWA 3NUNA 5CLPA 4M66A 4Y46A 2FYSA 2YWPA 5HOAA 2RKUA 3AT2A 1Q99A 3HNGA 4JG7A 1YVJA 2XKDA 4PMTA 2WIPA 3R9RA 4UZHA 1B6CB 4IMYA 3VHKA 5KMJA 3KRLA 5C01A 3R9DA 5LOHA 3UJGA 3VBVA 2CHLA 4GV1A 4QDVA 3TNWA 2VTOA 5AP2A 2ZV8A 3TCPA 1H00A 5EDPA 3UNJA 4O4EA 3FEGA 5AUWA 4JIAA 3KRWA 4AN9A 3TG1A 4B8LA 2ZV7A 2RIOA 3WZJA 3F6XA 4FTMA 3RTPA 2ITPA 4PDPA 3PFYA 3FMHA 4JR3A 5A6OA 3RAWA 5CSHA 4M69B 3G9NA 4WG3A 1OIQA 5AR4A 5LCKA 2J0LA 2CNVA 3OY3A 4ZK5A 4BGHA 1VR2A 1G3NA 2QCSA 4NKAA 3VWAA 2OIQA 4QQTA 1PMUA 3MBLA 1OB3A 4LOOA 3I7CA 3SXSA 3FLSA 4G2FA 4G3CA 2W5BA 2C5VA 4B6LA 5HTIA 4G6NA 4LRMA 1OKYA 3UGCA 4ASDA 5CU4A 4DFLA 4JJRA 5LVOA 1H07A 3EYHA 2PVHA 4R7HA 5EOLA 4XJ0A 1HCLA 2O0UA 3R04A 2WMSA 4KD1A 4O0TA 3GU4A 1XO2B 1ERKA 2ESMA 4IQ6A 3QRTA 2CDZA 3FL5A 3GOKA 1YXTA 3DQXA 4J71A 2X4ZA 3VUDA 3SXFA 2XNPA 4XG9A 4FBXA 1QL6A 4I3ZA 5C8KA 3CQUA 5A6NA 4HPUE 4F0GA 3U54A 3GGFA 3RHKA 5CAOA 3O71A 2WTKB 3ENMA 4I0TA 3HYHA 2PVMA 2BFXA 2W06A 3OBGA 3KULA 4IVBA 2W9FB 4PX6A 1J7UA 2PZPA 2A0CX 4W4WA 4EH4A 3R83A 3PP1A 1UNHA 5L2WA 3TM0A 4FTCA 3E3PA 5L6PA 5D7VA 5IQGA 2C5OA 3TV7A 1BMKA 3FXWA 1SNUA 5DG5A 2X39A 4R78A 3V8TA 4Y85A 4BJJA 4WUAA 4OBQA 2ERKA 3LZBA 4MF1A 4DGLC 3QALE 2XJ1A 2GU8A 3MPMA 3P86A 4IX4A 4TRLA 3VJOA 4U7ZA 2H6DA 4XG6A 1E9HA 4ZP5A 1KV1A 2VNYA 2XALA 4L7FA 1I44A 3FLNC 2CN8A 3CKWA 3PPZA 3VW8A 2QVSE 2WAJA 5EYCA 5IQFA 1YOLA 3NW5A 3IG7A 4A4OA 1M17A 4ID7A 5IA2A 2RFEA 3I7BA 3FPMA 3KULB 3PVUA 4YZDA 5H2UA 4I24A 3EFJA 5AP3A 4ZY4A 4R1YA 3EQIA 5TKDA 3QUPA 2P55A 5DWRA 3LFAA 4LFIA 5LVNA 4U80A 2OICA 2ETRA 2JGZA 4O7VA 4II5A 4CFXA 5IQHA 5DPVA 1QCFA 3DTWA 3MPAA 5EHLA 3QL8A 4I4FA 4PDOA 2VX0A 3LW0A 2JD5A 4O2ZA 5J7HA 4U97A 2QURA 3TNPC 3VQHA 2JKKA 2NPQA 4KIKB 4HVIA 3QWJA 3BYOA 3GCQA 3QA0A 3OWLA 4BJJB 4G9CA 2B9HA 1J91A 1XH8A 4HOKA 5HKMA 2JDRA 4FV1A 2C3JA 3Q9YA 4Z7HA 2XP2A 4KS7A 4RIWA 2R3GA 3FKLA 5B2LA 4GVJA 4XS2A 1RJBA 2X8IA 4EZ5A 4ZJIA 3A8WA 1KV2A 2B9IA 2VGOA 3KREA 3I5NA 4ZTLA 4ZS0A 2BRBA 2XYNA 4I4EA 4L3PA 4M0ZA 3IKAA 3HLLA 4BKZA 1ST0A 4GEOA 3ORZA 1OBDA 2Y6OA 5KKRB 2FB8A 4GFGA 4YJSA 2W7XA 3TZ9A 4R3RA 4U6RA 4DBNA 4PL4A 3VULA 3BYSA 5AUUA 4JBQA 4QTEA 3O2MA 3BKBA 3LCSA 1UWHA 4MBIA 4AAAA 3AC8A 4IC8A 4OTPA 1WBWA 2YCSA 4ASZA 5CI7A 2NO3A 5K0XA 4C4FA 2QR8A 3HX4A 4CFNA 1NVRA 1WCCA 2IEWA 4U8ZA 3QTSA 2VAGA 4I20A 1NA7A 2OZOA 3H9FA 2IN6A 4BICA 3KF7A 4F6UA 4CNHA 1OBGA 4D5KA 5JGAA 2WXVA 1WVWA 1Q4LA 3OS3A 2C6OA 1H1SA 2JDVA 3BYVA 3CJFA 3O8TA 4PP9A 5FBNC 3VN9A 1Q8TA 5ETCA 3P0MA 3CTHA 4GG7A 4X2NA 4BYIA 5ETIA 2BIYA 2B54A 3R1YA 3F7ZA 3QCQA 4JX3A 4RIWB 5KHXA 3FI3A 4TL0A 5KUPA 3LKMA 2OG8A 4IAYA 4BHZA 5IQEA 4U3ZA 3S95A 3II5A 4JOAA 2VTIA 4O22A 5AADA 2WTWA 3BU5A 3R21A 4FIFA 2VWBA 3UDSA 1XHAA 5CSXA 3IDCA 4N6YA 4TTHB 4V0GA 4HPTE 2PUUA 3IPHA 4KRDA 4C8BA 4E3CA 3FUPA 2VGPA 3UIBA 5AM7A 4NW5A 4FKGA 5CYIA 5CAUA 3EQDA 4NZWB 4JRNA 1OM1A 4LV5A 3W1FA 4ONAA 2GQRA 4UMRA 2BAKA 2AUHA 2J4ZA 2X0PA 3ENHA 3MH3A 4FKJA 4DFUA 2BUJA 1R39A 4RC2A 5G6VA 5EKNA 3QKMA 1W83A 4ASXA 3DB6A 3DJ6A 1PMNA 4GFMA 4E4LA 3HAMA 3M11A 3R2BA 1JPAA 2OXXA 2O64A 2R3LA 3CIKA 2FSOX 3D15A 2OI4X 3DXPA 4IC7A 4EK8A 3CPBA 3RJCA 3DZOA 3ZO4A 1MQ4A 3PJ2A 3ZS5A 4E6AA 5E90A 3Q2JA 2B9JA 1K9AA 4EOJA 2QO2A 3C50A 1TQIA 2IVUA 3FLQA 3QTWA 4RSSA 2XNEA 5J87A 5LMKA 4FV5A 3ROCA 3VUHA 3KK8A 3S0OA 2ITVA 3GXLA 4N70A 1PXPA 3S00A 2WOTA 1XWSA 4P5ZA 2UW8A 4OLIA 4V0GB 1GIJA 2OGVA 3FZRA 4AP7A 4MTAA 3PUFC 1DS5A 2Q83A 5CZHA 2E2BA 4FKQA 4RFZA 4LUDA 1NVSA 4YZMA 4AW5A 5IU2A 4S34A 5J1WA 1OPJA 3NW7A 4RBLA 3CQWA 3HDNA 4RC4A 4Z9LA 4FODA 4U3YA 3P78A 4ZY6A 3RGFA 2ONLA 1LEZA 3DJ5A 2BILB 2X7OA 3I0OA 3ATTA 3R7EA 4XRJA 5AR5A 4A4LA 3GI3A 4NT4A 4E5AX 2BR1A 2WHBA 1Y91A 4FZFB 2OXDA 5IQDA 3GCPA 3A4PA 3GENA 4IVAA 3UIUA 1ZOHA 2BPMA 2IO6A 1OGYA 2VWXA 3W0OA 5LVLA 2HOGA 4DTBA 3FV8A 5I9VA 1H25A 3WI6A 3I1AA 2HK5A 2FSTX 3UMXA 5I3RA 2YM3A 3LPBA 2VTHA 5CANA 2I0HA 4AA4A 2ITXA 5KX8A 4IADA 2DYLA 3R9OA 2PMOX 3MFRA 3NSZA 4R1VA 2UZVA 3TIYA 2GFCA 3SKCA 3Q4TA 4Y72A 4FA2A 3U6HA 4HYHA 3ZDUA 4QNAA 4FNYA 2NNWB 3HV6A 3NZ0A 2CGVA 1JKSA 5AEPA 3MFTA 5EHOA 2YM7A 5A4TA 3B8RA 3ZDIA 3E8CA 4MXXA 3W8LA 3TEIA 1VEBA 3KN6A 2BRGA 3DS6A 3E8DA 4KIQA 4WIHA 4CZUA 2P2IA 3JYAA 3PFQA 1TKIA 1PYXA 4MXZA 4OBOA 4YJUA 5L6OA 4AUAA 5LWNA 3ORKA 3ODZX 4XP2A 2DS1A 3PJ8A 4C2VA 3VHEA 4Y5QA 2BKKA 4R6VA 4YZ9A 4BRXA 3PLSA 2X0GA 4C4IA 4EHZA 3SXRA 1G8SA 3BELA 2R3QA 5LMBA 4FYOA 2BTRA 3BX5A 3O8PA 2W99B 4KBCA 4I23A 2X2KA 1Z9XA 4FSWA 4BZOA 2CLXA 4AXEA 4DYMA 2GQGA 4FZ6A 2JEDA 3TN8A 3MI9A 3HDMA 3OP5A 3PZHA 4IW0A 5L2TA 3UOHA 2R3NA 4GT3A 2QR7A 2WMUA 4IACA 4LM5A 3HMOA 2VTPA 2J50A 5LVMA 2BRMA 3NAXA 5HHWA 3D83A 5DLSA 4D2PA 1VLRA 3QTRA 2UZLA 4IB5A 4D4VA 3T3UA 3ZH8A 2XK9A 3CSVA 2XIZA 4TZRA 4KAOA 4GT4A 5EW8A 5LJJA 4IFGA 4C4HA 4Y73A 3QLGA 1JNKA 5FTGA 3KXNA 2ITWA 3F2AA 3KXXA 5ITAA 1U54A 4FSNA 3C1XA 5KMMA 3BL9A 3LOKA 2W1EA 3IS5A 4D1XA 4G5PA 3RNIA 5AM6A 4DITA 4ITHA 3EN7A 5CT7A 4EOLA 1UV5A 3EKKA 3MYGA 3R1QA 4I6BA 4AXAA 5L8KA 2P33A 4DGNA 4EBWA 4ERKA 5CSPA 3W2QA 4C58A 2J0IA 4FSQA 4L00A 3O23A 5DT3A 4HNFA 3FXXA 2PWLA 4DFNA 4FTQA 4ERWA 3REPA 4PNKA 3MJ2A 3PA4A 1W8CA 3GC8A 4C61A 2R3KA 2PULA 3QTUA 3QF9A 5HNBA 2F9GA 4FIIA 3EB0A 1IA8A 3O8UA 3CPCA 1E1VA 2DQ7X 3NUYA 4IDVA 4QMPA 5HESA 4JLCA 4FRFA 5E8YA 2BZKB 5KBQA 4APPA 3NIZA 1UNLA 2WTIA 4K77A 4BTMA 1H8FA 3KXZA 3MPTA 1WBNA 3KU2A 3D2IA 4MKCA 3RK5A 2JLDA 4F7JA 5IA0A 3UO5A 2GDOA 4C62A 4XG8A 5FWKK 4RX7A 2JFMA 2X2LA 3WF6A 4CZYB 3ZFMA 3EQFA 4K2RA 1JBPE 2F2CB 2HZ4A 3RP9A 3F2RA 4GJ2A 4WO5A 3DT1A 3PE1A 4O7RA 3F9NA 4FSRA 4FV3A 5AP6A 5EDQA 5J5SA 3RALA 2VWWA 2WB8A 4EOQA 2X8EA 5AP4A 4EH3A 3QD2B 4ZSJA 4IJPA 1ZAOA 2W1HA 4UYAA 3DAEA 3F3TA 5DIAA 3RI1A 2ITZA 4HCVA 5CF4A 4DHJA 5DMZA 1Q61A 5AJQA 4KABA 5FEQA 3V8SA 3F66A 3ZRLA 4BR3A 1LUFA 3F2NA 5IUIA 3V5LA 2QO9A 3TV6A 4C4GA 5EI8A 5JGDA 1ZXEA 3ACJA 3OMVA 4F1OA 3AC1A 3HZTA 2IG7A 4W8DA 3W0PA 3WZKA 3DOGA 4IX6A 2X8DA 1OGUA 5IEXA 2FSMX 4FYNA 2YDIA 3R8PA 3ZXZA 4FVQA 4GL9A 1ZRZA 4UV0A 4EQMA 5I9ZA 5JQ8A 2WNTA 1V0PA 3PXQA 4CKJA 1W82A 1WBSA 2GNFA 3GB2A 4FTUA 5H8BA 5EQEA 4YNOA 3LFEA 4HVDA 4L8MA 3DV3A 2ETMA 5J5TA 2IVVA 1Q41A 4QD6A 4I21A 4LV7A 4PNIA 3N4TA 1M14A 4WBOA 5CENA 4FSUA 3GU7A 4RFMA 3AT3A 3BQRA 3C4EA 3GQIA 4F08A 2Z7RA 2OK1A 5CNOA 4MYGA 2ZMDA 3L8PA 4F09A 5C4LA 4JI9A 2XIXA 4D58A 4CYJA 1TZDA 2J0MB 3PUPA 3ZOSA 2XAOA 3QTZA 4B0GA 1URCA 3B2WA 4Q5HA 4EH8A 1XMMA 4QMZA 2JKQA 4LGDA 3W2CA 2OU7A 2ZMCA 2YM6A 4GIIA 3C9WA 3DTCA 5CVHA 4UWBA 2IW6A 1Q5KA 3KK9A 5BVFA 4F63A 3EQGA 4Y8DA 2YWVA 3THBA 3ZM9A 3Q9WA 3E87A 4PL5A 3S2PA 4AX8A 4FEQA 4S30A 5DRDA 4IM2A 4MXAA 4F6WA 5IEVA 1YWNA 2EVAA 2W0JA 3TNHA 2I1MA 3NYVA 5HCZA 3HA8A 4AW2A 4GYGA 3E63A 3LJ2A 3CGFA 1PXJA 4Z16A 4J8NA 3HMPA 2JBOA 5I9WA 4L01A 2W17A 2IW8A 3UVRA 4FR4A 4QMSA 3PPKA 4UMUA 5M4CA 1O6LA 3CE3A 1JWHA 3FI4A 2RL5A 3SGCA 3C4CA 4JR7A 1V1KA 2VTJA 5FXRA 4WG4A 3QFVA 3SC1A 1K3AA 5CVGA 2NYAA 3EQPA 5E4HA 4TY1A 2W4KA 1XH7A 1O6KA 1XQZA 3D7TA 1TFFA 1SVGA 2YA9A 2ITYA 2YM8A 4M7IA 1J3HA 4PQNA 3VS2A 5EYMA 4K11A 4RVMA 4UMPA 5E8XA 3G5DA 3QZGA 4QO9A 2F7EE 5EFQA 3R9NA 2X1NA 1M52A 5CEMA 2W9ZB 4YSMA 2ZDTA 3EN5A 4WKQA 5F20A 5GHVA 4YU2A 2WU6A 1CDKA 1WBTA 3ETAA 4TYIA 3NGAA 4K1BA 2ZV9A 2BROA 5BVOA 4OTDA 4GK2A 3TI1A 4P4CA 4AXDA 3BPRA 4Y5HA 3A62A 4CLJA 4EJ7A 4BCKA 3FMMA 3BEGA 3DKFA 3DDQA 3FLZA 2H96A 4XLIA 3W33A 3BGZA 4RWJA 3ORPA 4JQ8A 3QXPA 1TQMA 5K5NA 5DVRA 5KZ0A 5C9CA 4O0VA 1DI9A 2B9FA 1SMHA 3OTVA 1RDQE 4M67A 3MA3A 1OI9A 2AYPA 4PY1A 2RF9A 3D7TB 4I22A 2P3GX 4P7EA 4G3DA 4QQJA 3HUBA 2YM5A 4I5PA 5F4NA 4C3RA 3ID6C 3SG9A 3ORTA 3Q32A 3KGAA 1FPUA 1ZZLA 3W55A 3H30A 3ET7A 4ZXTA 3O0GA 3RCDA 3NUPA 1W0XC 2F57A 3NRMA 4QMLA 4F99A 2PVFA 2XIYA 4UXQA 3E8NA 3UZPA 4BDIA 1PYEA 1IG1A 2VO6A 4EI4A 5HNIX 3DBCA 4GRBA 1PHKA 4NSTA 4RPVA 3R7IA 2VTLA 2HYYA 5CNNA 3R8LA 3V6RA 4EZ3A 2Q0BA 2FGIA 4ZAUA 1NW1A 3I0QA 3FQHA 4GG5A 2X4FA 4GK4A 3W8QA 2JFLA 1JKLA 5CWZA 1H0WA 3GU5A 3ZCLA 4USEA 3BWJA 4U0IA 4FKTA 2WD1A 4DFXE 4QT1A 3N9XA 4OT5A 4EBVA 5HZNA 3JVRA 4BB4A 3TDVA 3WF5A 5C1QB 3EH9A 3QRKA 4QP2A 4DH7A 4G1WA 4JBVA 4MH7A 4ZTMA 5JSMA 4FUYA 2UW7A 4NU1A 3PY1A 3C51A 4W9XA 2X9FA 4W9WA 3ZUVA 4D0XA 4X7QA 2GNJA 2P4IA 4XG2A 5HGIA 3R2YA 3AKJA 5M53A 5HVKA 2F7ZE 3TJDA 1FBNA 4YJVA 4RT7A 4Z55A 1JAMA 3K5VA 1FMOE 4O2PA 3FAAA 4S32A 1FVTA 4KS8A 5IH4A 4FEWA 4LMUA 4RG0A 3IDPA 3LXNA 1M2RA 2GCDA 2WMBA 5M4FA 4AXFA 3NNXA 3Q6UA 3QU0A 5D1JA 3RWPA 3OW3A 3G2FA 2RGPA 3GU8A 1G5SA 4YC3A 5H8EA 3MVLA 4LGGA 5JGBA 4G6OA 4L3JA 4EONA 5DR9A 2PE1A 5J7BA 4QEBA 3D5VA 3W0SA 3AT4A 4GU9A 5E91A 3Q6WA 3QRIA 3MIYA 1TQPA 3C0GA 5DEYA 1UA2A 4AZFA 5AV1A 2HXLA 1LPUA 3DKOA 3IOPA 3MSSA 3P7CA 3QC9A 2YLEA 4LUEA 4WRGA 1PF8A 3MFUA 4K0YA 1A06A 3VF8A 4M15A 4ZSAA 3W2PA 1ZYSA 4J95A 4QP7A 4FMQA 4XNEA 4QMWA 3ZYAA 4TKSA 4BCGA 4DHFA 3GC7A 3F82A 2XVDA 2V22A 4IDTA 4DAWA 5JRQA 2YACA 2E9PA 3PXZA 5KE0A 2R3IA 3Q2MA 3CCNA 4XP3A 4IVCA 3VW6A 3D5UA 2R7BA 3TL8A 4JS8A 3WF7A 2WQBA 5JRSA 2XNBA 4K33A 5AV3A 4YZBA 3VIDA 4A9SA 1M7NA 2WTCA 4O7YA 5FM3A 4CMUA 4UALA 4FTAA 2YDKA 2HWOA 4NM3A 5K4JA 2XEYA 3IONA 4FIHA 3UOJA 5HG7A 3SHEA 3PVBA 4JQ7A 3AXWA 4FGBA 5HD7A 1QMZA 2YJSA 5AP7A 4JQEA 4ZSGA 2C6TA 3FLWA 3U4UA 4BCMA 4XHKB 4Y83A 3TUBA 1AD5A 2HXQA 3G0FA 3OUKA 3R7GA 3HV5A 4X6QC 5EOBA 3IW7A 4A9TA 3C0IA 3QA8A 3E8EA 4WNMA 2E9UA 3V8WA 4BTFA 4JG8A 4PUZA 5TE0A 1NVQA 4HZSA 4H1JA 1WFCA 2VO0A 3JUHA 4AXCA 3WE8A 4ANNA 2C0OA 5T6KA 4D5HA 3TIZA 5HLWA 5AP5A 4DDGA 2WMQA 1JSUA 3UVPA 4XOZA 4ZZNA 2C6EA 2CPKE 4O7NA 3L9LA 1ZZ2A 3QQKA 4PRJA 4TN6A 3R8UA 3TZ8A 4AGDA 4EORA 4DDIA 3BHHA 4XMOA 2JITA 4UWYA 2BFYA 5F94A 1R0EA 3QQLA 5KCVA 4GSBA 1FVRA 2XF0A 4MD9E 3PYYA 3KXGA 3FZ1A 4BI0A 4O83A 1YKRA 2HCKA 1ZOEA 3GCSA 3FHIA 3V04A 3Q53A 4MNFA 3KF4A 3RPSA 4JAIA 1H1QA 2V0DA 4PTEA 5AP0A 5B0XA 4EH5A 3E62A 4EOMA 4P5QA