5HZNA

Structure of nvp-aew541 in complex with igf-1r kinase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
296
Chain Sequence
AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin-like growth factor 1 receptor
publication title Identification of a 5-[3-phenyl-(2-cyclic-ether)-methylether]-4-aminopyrrolo[2,3-d]pyrimidine series of IGF-1R inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 296
sequence length 304
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hznA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hznA01
3ZCLA 3D94A 3LQ3A 2VTJA 4ACCA 3KN6A 5BUEA 2X2LA 4CLJA 3UNKA 4IJ9A 3ZSGA 3PY0A 4NFNA 4KIOA 5C03A 3FBVA 5LCKA 1FBNA 4G3EA 3A4PA 1UU3A 3N4TA 4DTAA 4G6NA 5EI2A 5L6PA 3LMIA 3BGPA 3COMA 3EWHA 2ITNA 4WG3A 4QTAA 1G8AA 1OZ1A 3CY2A 1WCCA 3CPCA 2YM8A 4LUDA 3KQ7A 2ZV7A 1Q5KA 4RIYA 5TO8A 5M4CA 2YAKA 4EK4A 2JKKA 4S30A 2PZIA 4FZFB 5CAOA 3ATSA 2BKZA 3F66A 4IWPA 2XNMA 3ZZWA 4PP9A 2RIOA 3OWKA 3NVKI 1VYWA 2OJGA 4RVMA 1OL2A 3LCTA 5IQBA 4MBIA 3BHUA 4QMUA 4EHEA 3U87A 3KCKA 3MVHA 5GNKA 4PNKA 4M14A 1M7QA 1MP8A 1H25A 1QPDA 2R4BA 5LOHA 3WE4A 4DHFA 4MNFA 3K2LA 5AUXA 1TQMA 3TKIA 1JNKA 1CMKE 4FEWA 3NCGA 4C4JA 2ITXA 4M68A 4ANLA 2V62A 4PMSA 4PRJA 3W2SA 1Z5MA 3MIYA 4OTRA 3A2CA 3BZ3A 3FAAA 4U3ZA 1SYKA 4E5WA 4U81A 2J50A 2Q83A 4RJ7A 3NWWA 5HIEA 2DS1A 1G5SA 3ORXA 5KMOA 5DBXA 4CRLA 3W8QA 3QTXA 1OKVA 5I9UA 1FVVA 2ZB0A 3MFTA 4IDVA 4M0YA 1PKDA 3AC5A 5HU3A 3AOXA 5B2KA 4GKIA 4TXCA 3OUNB 3EIDA 4V05A 5A14A 2JDSA 4NM3A 4EONA 2PVRA 3CQUA 3M42A 4TTHB 2ETKA 4ZY5A 5FEQA 3D7ZA 4YC8A 4XHKB 3A4OX 5ANJA 4B9DA 4D1SA 2OJFE 1HCKA 3KXGA 3FZPA 3U51A 4RIWA 4KAOA 4C35A 4ZSAA 4ZTLA 3R7UA 4BZOA 1R1WA 3OCGA 1U5RA 4JDIA 3QD4A 3BLQA 4QMWA 2G2HA 3O8PA 5CVFA 4A9RA 4CD0A 5JFWA 3ZONA 3DOGA 4IM3A 2F7ZE 4HCVA 5B2MA 2YM6A 4MBJA 4NUSA 2BDWA 4ZJIA 1JPAA 4BZDA 1JSTA 2ZM3A 4FSWA 3AC1A 4CT2A 3QRTA 1DAWA 1SZMA 3SRVA 2YZAA 4M84A 4M97A 4I6BA 1DM2A 2HW7A 4NJDA 4NM0A 3BEGA 5IUHA 4DG3E 4NT4A 2OF4A 4GYGA 5HO8A 4IAIA 4X21A 4R3RA 3G51A 1KWPA 1PJKA 3EQIA 4OW8A 4A9UA 2XNOA 4WIHA 4ANNA 4IZ7A 4O0UA 5CANA 2OSCA 2VWUA 3VRZA 3FXZA 4KKGA 4GG5A 1GOLA 5AP6A 4BCJA 4HVDA 4NTSA 3IG7A 3VUKA 1L8TA 2JDTA 3PYYA 4L7FA 1IA9A 4RWKA 4FSQA 4FGRA 3ENHA 1NT2A 4MNEB 5BMSA 2Y8OA 5EYCA 4E26A 5E1EA 3GFEA 5AP1A 5M53A 4RIOA 4FTJA 3TNPC 4F4PA 2ITQA 4FSUA 4NKAA 2FSLX 4JOAA 4YLKA 4X2KA 5J5SA 3MWUA 4O38A 4WRGA 3JY0A 3KY2A 1JQHA 3ORNA 4L9IA 5M57A 2W05A 2X7GA 3NIZA 3IW5A 2VWBA 1M52A 2BPMA 2P4IA 3KEXA 3PZEA 4PDPA 3TUDA 3BLRA 3CGFA 4QMLA 3PE2A 1OBDA 4DGMA 4DE4A 2RFSA 5BX0A 3QBNA 4YZBA 2XNEA 4JR3A 5KKRB 3R1QA 1BUHA 4TWCA 5LCJA 4FBXA 4D2WA 4C37A 3W2CA 3GBZA 4IFCA 4YJOA 3PP1A 3U8WA 5L6WL 2IZTA 3V04A 5L4QA 3QD2B 2GTNA 3RCDA 4L7SA 2WQMA 5HNBA 3W1FA 3UOHA 4I1ZA 2ZB1A 4FTLA 5H9BA 2JFLA 3WYXA 2X8IA 3A99A 3KMMA 2OZAB 3QXPA 2C6IA 3ZDUA 4HVSA 5HOAA 3UGCA 5C01A 2P33A 4DGOA 3PY1A 3NDMA 5DE2A 3RBWA 4WD5A 1S9IA 1PHKA 4HGLA 3GC0A 3ZXZA 2Z7LA 5BQ0A 4S31A 3CP9A 2CNVA 2J9MA 4QPSA 2BRMA 1ZOGA 4J7BA 4JQEA 2J7TA 4FSTA 4EH2A 4O1PA 3LCKA 3DCVA 3MB6A 5HNGA 4UBAA 4DBXA 3Q4TA 3RCJA 4N57A 4AU8A 4IVDA 5EOBA 3TI1A 4BKJA 4LRMA 3QUDA 3SHEA 3KKVA 4MXOA 5HIBA 1YHSA 4CGAA 1OB3A 5FXSA 3OC1A 2OJ9A 1BMKA 3PY3A 4AE9A 3OW3A 3IDCA 3UMXA 3QYWA 4YHJA 4DEEA 4DFBA 4ALUA 3QQFA 3RHKA 4IHPA 2PMNX 5FXRA 4APCA 1J1CA 3SG9A 3SW7A 2BAKA 3CS9A 1FGIA 5KCVA 2XEYA 3HV7A 5AA9A 4DFNA 3K3IA 5AV2A 2XRWA 2WMXA 3PPKA 3UO4A 4A4XA 3LLAA 3COIA 4O7TA 2HCKA 3KMUA 4DF3A 2EUFB 3IGGA 3FMKA 3T3UA 1UKIA 3FZRA 5DH3A 2HZNA 3GFWA 2CN8A 4R7HA 2BKKA 3R2YA 3AMYA 3QYZA 3AD4A 3NNWA 4F08A 1GNGA 2ITOA 4RC4A 3A7IA 2WTWA 4K11A 3VULA 4GW8A 3C5UA 1T45A 2IVSA 2UW7A 3KU2A 2CNUA 1XBAA 3DLZA 2B9HA 1CKIA 4Z3VA 5DA3A 4ITHA 3G0EA 3ORMA 5KHXA 2HAKA 2XCKA 5CSPA 4TT7A 5EM7A 3RAIA 4YHFA 3ZEWA 4D2SA 4YUQA 2HOGA 5CEQA 3DKOA 3CD8A 3HP2A 3WF7A 4BDEA 3UYSA 4QQ5A 4AGDA 3HKOA 2V22A 4GG7A 4OBOA 5CU4A 1A9UA 1OIRA 4IQ6A 3T3VA 3TTJA 5BUIA 3RALA 5EQPA 4IW0A 2QVSE 3CKWA 3V01A 4BTFA 4ZP5A 1H1RA 4G6LA 3OCTA 4FSNA 4JRNA 4AZWA 4FKQA 2VTRA 5DR9A 5AWMA 2BZJA 4PMPA 2FB8A 3BRBA 2KTYA 1PF8A 2VO3A 4C0TA 5LJJA 5KHWA 4RX5A 3O0GA 3I5ZA 4RRVA 5HCXA 4GRBA 4LM5A 5GHVA 3RI1A 4BDAA 3DTWA 3PJ1A 1L3RE 3UIXA 4FUYA 2ZM4A 1H07A 2AC5A 1SNUA 3DB6A 3FKLA 4IB1A 1V0OA 2XKDA 3NYOA 3E7VA 4G16A 3UOKA 2I40A 5K4JA 3S95A 4FEQA 3DS6A 3WI6A 3TUCA 2I7QA 4FVQA 5M08A 2E2BA 5HBJA 1YI4A 3I6UA 1J7UA 4KUJA 4BCKA 4GCJA 3ZLSA 5J5TA 3OOMA 2XIRA 1IEPA 2C30A 3ATTA 4TYHA 4OTWA 5G6VA 5BNJA 5TT7A 4YJQA 2WZJA 1PW2A 3IOKA 4EUUA 2WMVA 3DLSA 2R0IA 4BDCA 3I60A 4XV2A 1H1SA 2G01A 4AQCA 4PMTA 4DH3A 4IB3A 4L8MA 2ZMCA 3UJGA 4EQUA 3DAEA 4GK4A 3S0OA 1OITA 1R0EA 4KKEA 3PXYA 2CKQA 3GUBA 4H3PA 4W4WA 4YSJA 1Z57A 3O2MA 4USDA 5CASA 3TKHA 3R6XA 3DV3A 3UVPA 3L8VA 4I21A 3HV5A 1Q24A 2WTKB 4M66A 4YO6A 3GC7A 3V3VA 4KBCA 3Q2JA 4MCVA 3Q3BA 5E1SA 2PWLA 2VAGA 1U54A 5AUYA 2C5XA 4YO4A 2XYNA 2XM9A 3OXTA 4L67A 4V0GA 4YJVA 5IA5A 3B8QA 3DAKA 3REPA 4C4IA 2WMRA 1YXVA 3C4FA 5GZAA 2ZAZA 5GJDA 4MK0A 3UZPA 4G31A 1OL1A 3RWPA 2VNYA 3R7EA 4LMUA 2GNFA 4D4VA 5F94A 5EKOA 4N6YA 4DCAA 3F3TA 5CAQA 2OF2A 2WMWA 2IPXA 4ZJJA 4H39A 3OG7A 1YVJA 4QQJA 5HE1A 3RPOA 4BL1A 1FVTA 2X7OA 4MX9A 3MVMA 4MD9E 3RZFA 3SXRA 3WILA 3GCSA 3PIZA 3AC8A 3E93A 4DT9A 1H28A 4D2VA 5EM6A 2ZJWA 2R3IA 1GIIA 5EDPA 5HG7A 2RF9A 3IECA 4UALA 4BDGA 3D5WA 5F1ZA 2A19B 4O0WA 4E3CA 3DZOA 4Z9LA 5IZFA 5J9LA 4YSMA 3PG1A 5IA1A 1STCE 2ZMDA 4LG4A 4AUAA 3RZBA 4IAKA 4I24A 3L9LA 2H96A 3HL7A 4LOQA 3KRLA 1OKZA 4XEYA 1PYXA 2HWOA 3RNIA 4JT3A 5A3XA 3SXSA 2OLCA 3I7CA 1V1KA 5IEVA 4L3LA 3E63A 5F95A 2WKMA 4E20A 3C4WA 4BR3A 2VGOA 2YM3A 4IAZA 2GPHA 5EW9A 4BB4A 5CX9A 3DGKA 4B7TA 4DBNA 3U9NA 4AZSA 5CALA 4RVTA 4EC8A 3WF6A 3LFDA 1CDKA 3PIYA 3OTVA 5GIPE 2R3GA 3WYYA 4EHVA 5AV3A 3E8DA 3SGCA 3PVBA 1GJOA 3CCNA 3PRIA 2JDRA 2VU3A 2Z7RA 4HJOA 4U3YA 3UQGA 3CSVA 3OW4A 4G34A 3OWJA 1Q8WA 1ZAOA 2G15A 4QP3A 4EOKA 5E7RA 1Q41A 2PMOX 3MY1A 3TJDA 3Q4CA 3FLQA 2UW3A 4IVAA 4NIFA 5HNIX 1IA8A 3UQCA 3R04A 2VWVA 2QR7A 4C2WA 3QC9A 1YXSA 4OT5A 3IKAA 3VF8A 5HU9A 3AT4A 2O65A 3OWLA 3P9JA 4JIKA 4F0GA 4UMTA 1CTPE 3QLFA 3ZSHA 1YOLA 4AW0A 2C3KA 3PA5A 3ZRKA 3NUAA 3H3CA 3VC4A 1KUTA 2E9VA 5HZNA 3VF9A 4W8DA 4E93A 2R3MA 4MXAA 4E6AA 1YXTA 3LMGA 5BVOA 1BL7A 4HGEA 3PSDA 3WZEA 5IU2A 4BCQA 2BHEA 2C1AA 3CPBA 3TEIA 1QMZA 3JVRA 3JY9A 3NUXA 3D9VA 2XNGA 4CCUA 3SG8A 4APPA 3ORTA 5F9EA 1A48A 5IKWA 4C62A 5T3QA 4TWNA 4I6HA 3K5VA 2RKUA 2CKOA 2XRUA 4O84A 2OWBA 4EL9A 4YZNA 3C0GA 4RZVA 4E8AA 3NR9A 4EQMA 5B2LA 5KZIA 1B38A 3Q32A 4RA5A 1UVRA 4EH3A 3LVPA 3E8NA 4FTCA 5CF8A 2AC3A 4AACA 5L2SA 4GK3A 3RPRA 2CDZA 4F65A 4ZZMA 2Y4IB 4BWPA 2QOHA 2VWZA 4XLVA 4C4EA 2VUWA 4LUEA 4PTEA 3SOAA 4EH6A 3NW7A 4II5A 4MXYA 4FTAA 3RKBA 5LWMA 5KMJA 1SM2A 3IONA 2I0EA 5JQ5A 5CVGA 4C38A 3BGZA 3OF0A 4E4MA 5J1WA 3EN9A 3ELJA 5CNNA 2BAJA 5C4LA 3R9HA 2UVZA 3NNUA 4F9BA 4J96A 1R39A 5DWRA 4RWIA 5HESA 5DR6A 1UU8A 1YHVA 2FSMX 1JAMA 3MH2A 2UVXA 3LCDA 1FPUA 3PTGA 3R9NA 2BILB 3ZMMA 1GIJA 4KBAA 3O23A 4AA4A 2QO9A 3U9CA 5DVRA 2X8EA 4AOIA 2W9ZB 4D0WA 2BZKB 4QMVA 2QG7A 1U4DA 4DFXE 4PWNA 4DFZE 1UV5A 4R78A 1H08A 1I44A 1P5EA 5CENA 4JJRA 3BCEA 3FL5A 2JDVA 2C3LA 2F4JA 2B1PA 2GNIA 4AGUA 3HECA 4ASXA 4CKIA 3LCOA 4WA9A 5IF1A 2R3HA 4G3DA 3V5QA 3D7TB 4KRCA 4TL0A 2OIBA 4H36A 1W84A 3KF4A 1ZMVA 2JKQA 4W4YA 4F63A 4PP7A 5IISA 2XIZA 3UODA 4DINA 5IQHA 5J1VA 5L8JA 3Q2MA 5ETCA 3V5TA 3VAPA 3UZRA 5M06A 3DJ7A 2XA4A 3LXPA 2CGVA 2ZDUA 2VN9A 3DXNA 4FKLA 3GP0A 3FZOA 4E6CA 5ANKA 3I5NA 1CSNA 5ETFA 2BMCA 4P7EA 4FTTA 3IK3A 4D9TA 4CVAA 1IAHA 1PXJA 4L68A 4C2VA 5EW3A 4FEVA 4O0SA 4A4LA 3QX2A 4M13A 3F88A 1QPCA 2GQGA 2YM7A 3HUCA 3NUSA 2XUUA 4K1BA 5TE0A 1T46A 4ASZA 2BZHB 2GCDA 4LFIA 5BVEA 3UP7A 3LZBA 4IAFA 1SMHA 4UY9A 2X2KA 4XUFA 3ZUUA 4P4CA 4MEDA 4C3PA 2J5FA 4RJ3A 4DGLC 1UNHA 4CMOA 2BR1A 4YPDA 4QMXA 4F9CA 3VS2A 4Y5HA 4RX7A 3E8CA 3DJ6A 3QZGA 4W8EA 5AMNA 4OTPA 1DI9A 3FMDA 4G9CA 1A06A 4D2PA 4ANQA 4K33A 3H9FA 1ZYLA 4WNKA 4AA0A 2BALA 5HLNA 3TNQB 3RNYA 3UIBA 5FWKK 2X4FA 4FV7A 3L8PA 4ACGA 4NYEA 2H6DA 4C33A 4EOQA 5HLWA 2R3PA 3ZTXA 5AIRA 2VGPA 4FKGA 1RJBA 3LM0A 2OJIA 2NP8A 3MJ1A 4CTBA 5IEXA 3RTPA 3F69A 5JGBA 1NXKA 4BTJA 4I4FA 4L53A 4MH7A 4FEXA 4LL5A 1YXUA 4K8AA 5C1QB 2ZYBA 4U6RA 4YLJA 5J7BA 3Q9YA 2IO6A 1QPJA 5A54A 4RMZA 3ALNA 3ODZX 3T8OA 1Q8YA 2V7OA 3V8SA 4D4SA 5AM7A 4RVLA 3SA0A 4FT9A 3HMPA 3LOKA 5AP5A 5HE0A 3H0YA 5AR8A 5FGKA 2BRGA 3TNIA 3CEKA 4M69B 2YITA 4TN6A 3PA4A 4KINA 5JT2A 1I09A 3FMMA 5I9XA 4FC0A 4DEDA 1TKIA 3P7CA 3W16A 4FA2A 4QO9A 4C3RA 5KO1A 3N9XA 1JSUA 4CRSA 4OTQA 5E8ZA 2WQNA 3SC1A 3ZSIA 5GJFA 2J0KA 4AFEA 3NIEA 5A9UA 3QQUA 2QHMA 2P0CA 3FLWA 3LQ8A 4WNOA 1JKSA 2UW4A 4TPTA 4YTHA 2RG5A 2X6DA 3ETAA 4KABA 4Y5QA 4RLLA 4YTIA 5HORA 2W1IA 5AADA 4HGSA 1R0PA 3PSCA 5FM3A 2W5BA 5FTQA 3POOA 5FXQA 3BU5A 1WBTA 3WIGA 4QP1A 1KOBA 5A4EA 2RFNA 4ONAA 1ZZ2A 4PUZA 4RQVA 3KRWA 3QL8A 3ZU7A 2OH4A 1F3MC 2BAQA 4U5JA 3PXZA 3N4UA 3FMHA 3R1YA 2G1TA 1ZWSA 1H4LA 3EKKA 4YBJA 3D5UA 2W5HA 3Q9ZA 2FH9A 4J8MA 3KK9A 5JMSA 3LFEA 4BCHA 2R3LA 3G9NA 5IG1A 5IQGA 3BYOA 3LFFA 3VVHA 4BDDA 1R78A 4NZWB 3QTRA 3GOPA 4YC3A 2BTRA 2FGIA 4BDFA 3IW4A 3KK8A 3HMNA 3VBVA 3BBTB 4R3PA 2QOQA 3LLTA 4QMSA 4RLKA 2GTMA 3LFBA 3OY1A 1M17A 3EQRA 4BTMA 3TNWA 3MTLA 2WTJA 4GS6A 2XBJA 2XIKA 3LW0A 3H9RA 3ZUVA 3EN6A 4E4LA 3G9LX 5FD2A 5HQ0A 2W96B 3EN7A 3V51A 4UV0A 4USFA 3FLYA 3ZM9A 1WBSA 5DT3A 2QOBA 4FZDB 4WUAA 4EYJA 4KNBA 3PWDA 3OZ6A 3MYGA 4YC6A 2W99B 1Q99A 4DEIA 4EUTA 4ERKA 3QX4A 2PZRA 3MSSA 2HY0A 3WZKA 3NGAA 4FV3A 2W1EA 2YJSA 3FHRA 4U80A 4GJ3A 4AWIA 5ANOA 2HELA 5CSXA 5I5ZA 1Y8YA 2R9SA 3PVWA 1OL7A 2C69A 5FTGA 2WB8A 4TNDA 4YPSA 4CZYB 2R2PA 4J97A 3R71A 1IRKA 4JQ8A 4JQ7A 5E8WA 3HRBA 5AR2A 4Z16A 4DGNA 5AM6A 4FL3A 3SQQA 4WBOA 3L8XA 5FBNC 3P7BA 5A6OA 4RJ5A 4FVPA 1H26A 4HOKA 3GCUA 4PDSA 3QTWA 4E73A 4JAIA 4BGHA 4IC7A 2V0DA 3E62A 3LFQA 5AR4A 4XP2A 3TZ9A 2J0MB 3P5KA 2FO0A 2GHMA 1RDQE 3MVLA 3CGOA 2CPKE 3EQHA 3NEWA 3Q9WA 2BCJA 2VTAA 4P5QA 3ZFMA 5L2WA 3QQLA 3ZZEA 1J7LA 2J0JA 4FTUA 3AC2A 5L3AA 2WMBA 4FKRA 4JIAA 1ZYDA 2UW6A 4FV8A 4PX6A 5EHYA 4EYMA 2BDJA 4G1WA 3VS5A 4NW5A 1ZYCA 2C6DA 3ITZA 2OJJA 3MPTA 3R73A 4RC3A 4F70A 3PXQA 1GZKA 5CYIA 2VWXA 3SW4A 3C51A 4MWHA 5TF9A 4HVHA 1YW2A 2C0TA 4IM2A 5KMMA 4Y85A 4EZ7A 4FV5A 5CEPA 3TDWA 2PHKA 2PSQA 4UMRA 5FP5A 2O3PA 5HKMA 3QCSA 2R64A 4U45A 3CIKA 3NYXA 3RMFA 3FMJA 1H1WA 2A0CX 3AD5A 3A7GA 3LM5A 3R22A 4H3QA 3VRYA 3R21A 4AZFA 4D55A 3DJ5A 5ETAA 1YHWA 4UWBA 5CI7A 4DLJA 3GXLA 1J1BA 2VTLA 5J8IA 4I0SA 4X3JA 4ZAUA 3IOPA 3TL8A 2CHLA 3OT3A 3H10A 4FNYA 3VJOA 3FI4A 3QGWA 3SX9A 3DBFA 1OIUA 3VIDA 2C6KA 3FUPA 4L46A 3HP5A 4IE9A 4MYGA 4YLLA 4BCNA 4G3GA 3HA6A 3MI9A 3QD3A 5EH0A 1Q8UA 3C50A 5AR3A 4IAYA 4K18A 3ZLWA 3P23A 4EOPA 1ZRZA 4O0VA 5CVHA 4UYNA 3UG1A 4BF2A 3EMGA 1FMKA 4OBPA 1YDSE 3VUIA 3C4EA 3O8TA 5IUGA 3QQHA 3U6HA 3KCFA 2ZVAA 3EQGA 3HVCA 1WAKA 3HA8A 3NYVA 4DG2E 3CLYA 3RHXA 2OXDA 4ACDA 4EZ3A 3FV8A 5HD4A 5DEWA 3MA6A 1ZXEA 3BI6A 3KRJA 3EN4A 4OBQA 2EU9A 2CGXA 4X3FA 2JKMA 3FDNA 3HV4A 3PRFA 5CSHA 5CEIA 2UZLA 1XR1A 4XMOA 3UBDA 2X7FA 3B8RA 4ZSGA 4HYUA 5DFPA 1FVRA 4BBEA 4FF8A 4CZUA 4YTFA 3G90X 1NY3A 3ZFXA 2PVLA 4ZSJA 2YIRA 5H2UA 2CKPA 2HXLA 4G2FA 4OGRA 2HIWA 3ZFYA 5HVJA 5AX9A 5EM8A 4YZDA 3UOJA 1ZY5A 4QTBA 3QRUA 5EK7A 5BVFA 5EQYA 3RK9A 1BI7A 2X6EA 2BZIB 3E3BX 2PE0A 3QGYA 4QQCA 4WG4A 3DDPA 4OLIA 4LGDA 2ZV9A 3FQHA 3DBDA 3AGLA 4UWYA 2Y6OA 4BIDA 3F2AA 4JX3A 3MGYA 3EB0A 3OWPA 4GFGA 4ZZOA 4D2RA 3IDBA 3W2RA 5CF5A 3BWFA 3MY5A 5HVYA 3QZFA 4L00A 2UZUE 4ZS0A 3EHAA 3GCQA 3O8UA 4AZVA 5AEPA 1W0XC 3EN5A 3SDJA 4L45A 2Z02A 3DA6A 2CJMA 4GJ2A 3Q4ZA 4I94A 1YXXA 1XKKA 5GIOE 3FWQA 2W1CA 4O81A 5LVNA 5E8SA 4NJ3A 1RE8A 3MFUA 4U44A 4IWQA 3AMBA 3V5PA 3IDPA 4OTGA 4XG2A 2R7IA 3QALE 3O7LD 4RVKA 1YI3A 2YCFA 2O0UA 1MRVA 4M0ZA 5JSMA 5CWZA 1JWHA 3A62A 4CLIA 1WBNA 1B39A 1W7HA 3G5DA 4RT7A 4AZTA 3FJQE 3LJ2A 1Q8TA 5IUIA 3MJ2A 4FIHA 4USEA 2WO6A 1XHAA 2E9NA 3HAMA 3G0FA 2ZM1A 1FINA 3OVVA 3TIYA 4AN3A 4FG7A 4JBVA 5DEYA 4AT3A 2DWBA 3GU4A 4I0RA 4K0YA 4XP3A 4CG8A 4AW2A 4FYNA 4IMYA 3TZMA 4GV1A 4J52A 4D4RA 3FMNA 4ZJVA 2VWIA 4QP8A 2EB3A 4AE6A 1J91A 4MD7E 3NLBA 5M4UA 1VJYA 4F1OA 4OTDA 1HOWA 4ZS4A 2H8HA 4ASEA 4I3ZA 2SRCA 2YDKA 3GU8A 1KE5A 4O7WA 5E8UA 4CV9A 4EOOA 5IA2A 3VHEA 4R7IA 5F20A 4FT5A 3QLGA 5EOLA 3KFAA 3RAKA 2JC6A 1H24A 3HDMA 4QNAA 3TCPA 4BHZA 4LRKA 4PDOA 3MIAA 4GT4A 2VTPA 4I5HA 2Y4PA 5K9IA 5KKRC 2WMTA 4FVRA 3ACJA 3UO5A 5DT4A 2PU8A 4EOJA 1MRYA 3OBGA 5BUJA 2UZTA 3CTQA 3RJCA 3RM7A 4U8ZA 3EFJA 4FMQA 4QQTA 4LGHA 1NVRA 2ITYA 3EQCA 4BC6A 2BHHA 4BWKA 3LAUA 4ENXA 4DH8A 3BU6A 5L8LA 2CNQA 2NRUA 3V6RA 4ZIMA 1JSVA 3D2KA 5GZ8A 3UPZA 1OL5A 3Q6UA 2ETRA 1RQQA 1KV2A 3C7QA 4YJRA 5IDPA 2QLQA 3DKCA 3F3ZA 1XWSA 3QTSA 5IMEA 3QU0A 3QFVA 4QNYA 5BYZA 3CR0A 2VWWA 3E88A 3FXXA 5BMMA 3OXIA 3P7AA 3D83A 4EBVA 5CNOA 2P2HA 4I6FA 5EDRA 1SVEA 2XYUA 2QNJA 2XNPA 4O27B 4UZDA 5LVMA 4BKZA 3DXPA 2ACXA 3KULA 3PVUA 1ZMWA 2WOUA 3A7JA 3SAYA 2HZ4A 2F57A 5L2IA 4NL0A 5LWNA 4EH9A 4IJPA 4XBRA 4YHTA 3T9TA 4I5MA 2J0IA 4A9YA 4AN9A 3ORZA 3D15A 3QQJA 5LVPA 1OUYA 2AUHA 3O71A 4MXCA 1KE7A 1XBBA 4XH6A 2W1ZA 3RAWA 3VW8A 4AP7A 2EXEA 3RK7A 4U79A 3ZM4A 4F7NA 5JFXA 2BIYA 2WPAA 1BI8A 2EVAA 3JYAA 4R1VA 5DI1A 4FNXA 2XF0A 2YCQA 2NNWB 4DT8A 4MXXA 5CQUA 1MQBA 3FC1X 4FYOA 1QPEA 4YJTA 1KE8A 3CC6A 3QKKA 4GK2A 4H05A 3QC4A 5L8KA 4I4EA 3MESA 2W9FB 3F2NA 5AUWA 4EWQA 4W9WA 3LE6A 3BX5A 5EM5A 1H0WA 1OUKA 2NRYA 2C0OA 2PVFA 3H9OA 3HYHA 3NYNA 4UWCA 2X39A 3TTIA 1PMVA 3KRRA 4HNFA 1F5QA 1YI6A 2HZIA 3H0ZA 2QCSA 2W7XA 4JNWA 4HCTA 4ITJA 4KIKB 4UX9A 3VBWA 3VNTA 2XK4A 3HRCA 4FK3A 4ZSLA 3FLSA 3ODYX 3DKFA 1GZOA 3CE3A 4N4SA 5JRSA 2PULA 3NUUA 5I9WA 4YJUA 1JLUE 3WZJA 2XZSA 3D5VA 4RIXA 5H8EA 4DEBA 2YZLA 1LR4A 2B53A 5HX8A 4DTKA 5LVOA 1JKTA 5DHJA 1OMWA 4K77A 2YLEA 1OIQA 4TNBA 3NUPA 2VTMA 1O6YA 4I23A 4XV1A 4I41A 4J8NA 2GHLA 3V8WA 4FIIA 5IQDA 4WUNA 5K0XA 5IQAA 2OI4X 3G2FA 5HO7A 3BWJA 2R3OA 3HMIA 4BCFA 3UPXA 1YRPA 3VUTA 2HW6A 2X1NA 4Q9ZA 2JLDA 4JXFA 2PE1A 4FSRA 2FA2A 3DTCA 4Q2AA 1KE6A 5CSWA 3R83A 3GENA 3LJ0A 2XK6A 3VUDA 1XO2B 4FT3A 4YJSA 3MS9A 4C61A 2VZ6A 4JDJA 4FKOA 1PXOA 1XH6A 2P55A 4Q5HA 4I6QA 4WNMA 1U46A 4O21A 4RGJA 4ANBA 3QRKA 4FT7A 3FQEA 4G6OA 2R3RA 3PSBA 2JIUA 2C5NA 4I5PA 4WG5A 4KSQA 3R8VA 3NW5A 3Q53A 3MA3A 3I7BA 3NCZA 2HY81 3WF8A 3RPYA 2VO0A 3I1AA 4TW9A 5EYMA 3ANRA 2Z8CA 2YDIA 2W1GA 3BHHA 1OVEA 2O8YA 4NH1A 5DRDA 3CD3A 4Z55A 2JKOA 2GS2A 3BPRA 5FEDA 5AV1A 1APME 3TV6A 5J95A 2WMAA 2X0GA 4RIYB 3LFSA 4ERWA 4GMYA 1BYGA 3SLSA 2C5YA 1BKXA 2R3KA 2JGZA 2J0LA 2VTSA 3ENMA 2VV9A 3R7GA 4NFMA 4NKSA 1WVWA 4GUBA 1VR2A 3TZ7A 4OTIA 4QP6A 3CBLA 5CXHA 3UE4A 4Q9SA 1LUFA 3L9MA 3VUHA 2R3FA 4Q5EA 1YWRA 4BDKA 4EORA 3FI2A 3DT1A 2V55A 3MY0A 4FOCA 4IXPA 4HNIA 3QQKA 3CTJA 3H30A 5EYDA 5J9YA 2B0QA 4K9YA 4TY1A 1WVXA 2WMQA 2WTKC 3F3UA 3JS2A 5BPYA 4C3FA 4HYSA 3UNZA 3CJFA 3IGOA 3KRXA 4WOVA 5AP4A 4F9YA 4NK9A 2BUJA 4PMMA 1IG1A 4LL0A 1RW8A 3TDVA 3R63A 4AFJA 2G2IA 5J79A 3DAJA 5ANIA 1SNXA 4GL9A 1CM8A 4HYHA 4QTEA 5M4IA 4YU2A 1ZMUA 3E92A 3DFCB 3DK3A 3TN8A 3C5IA 4D5HA 2C6LA 3TNHA 4FE2A 2UZDA 3VS4A 3KVXA 4FKVA 3QKLA 4AZEA 1ZY4A 2VNWA 3I79A 4MHAA 4PV0A 5I3RA 3UNJA 3OY3A 2ITTA 4N70A 5M55A 2OICA 3MFSA 4XX9A 4YP8A 1Q62A 3H4JA 5HHWA 3AGMA 4XYFA 3R7OA 2YFXA 1H1QA 4I20A 2XK3A 3PA3A 3LXNA 5IH6A 1WBPA 2RG6A 4RIWB 3AXWA 4BRXA 5IQFA 4AOTA 5B7VA 2FSTX 2WU6A 3EQDA 2JIIA 4ENYA 4YJPA 5DLSA 4BI1A 1M2RA 4U40A 4LQMA 3I0OA 4YJNA 2WEIA 5KMKA 4BI2A 3PDTA 2RL5A 4HPTE 4CMUA 5I9YA 5IH5A 5E90A 2I0VA 2O5KA 3O17A 4DGGA 2XKEA 4PL4A 4YZMA 4MTAA 4RJ6A 3ID6C 1XH5A 1REKA 4GT5A 3GI3A 3DY7A 3OP5A 3SRVB 2C6MA 2YIQA 5A6NA 1W83A 1QCFA 3D4QA 1P4FA 5ACKA 3UG2A 3ZO2A 4X6QC 5AP7A 4DYMA 4XNEA 4BDIA 4E5AX 4Y8DA 4ZK5A 2CCHA 3DQWA 4N6ZA 2C0IA 2OIQA 2RSVA 4MNEA 2F7XE 3Q04A 2KULA 3BGQA 4ZTHA 2YABA 3V5LA 1OPJA 4FL2A 4BIBA 5A4TA 5CF4A 1UNLA 5DMZA 4QMPA 2JAVA 4DLIA 4ID7A 3Q60A 2GSFA 4EK5A 1PXIA 3HGKA 3P1AA 4XOZA 3TZ8A 3DKGA 2H34A 3F5XA 4FV0A 5BVWA 3GCPA 4B99A 5HIDA 3D2IA 3MPAA 4S33A 3ET7A 4CYIA 2ITUA 2Y0AA 5C8NA 4FIGA 1ATPE 1NA7A 2B9IA 4ANOA 5ETIA 4D9UA 2V5QA 4IWDA 4YTCA 3I0QA 2WOTA 4PL3A 4XG4A 4C36A 3PJ2A 2FSOX 2OXYA 1PKGA 2YIWA 1E1XA 4DCEA 5LARA 4C8BA 3GGFA 2QKRA 2XB7A 3HV6A 4LMNA 5DN3A 1AGWA 5DYJA 4NCTC 4C4GA 2IG7A 2OZAA 1AD5A 4P5ZA 3UDBA 3PJCA 5CEOA 2YACA 4NU1A 4B8LA 2I0HA 2OKRA 3BEAA 4KIQA 5CZHA 3JR1A 5ANEA 1WVYA 3OROA 4IM0A 4PQNA 2YM5A 2OW3A 1WBOA 1X8BA 4R5YA 3DK6A 3HDNA 2XIXA 4YR8A 3QWJA 2PPQA 4S2ZA 3TG1A 1PMUA 5TR6A 4RX8A 5E8VA 1Y91A 2OH0E 2OIDA 3HMMA 4PNIA 4MD8E 4XRLA 4H3BA 3R9RA 2QU5A 3UIMA 4PF4A 4HZRA 3ZO3A 3FC2A 1URWA 1UWHA 3IW7A 5HBEA 1WZYA 4PTCA 3M2WA 3ZOSA 3U6IA 5E92A 1KE9A 1FQ1B 4CFFA 5IQCA 4O82A 1KOAA 1WBWA 2WIHA 4HZSA 4LV5A 3QTUA 3BYVA 4XOYA 4WHZA 5KX8A 2UZEA 2QOCA 4K2RA 4P2KA 1BL6A 5AA8A 3HUBA 4ZTNA 3F82A 4O96A 1MRUA 4JBOA 2QKWB 3WZDA 5M4FA 2PUPA 2Z60A 2QR8A 2G9XA 4EOMA 2Y4IC 3LIJA 4GEOA 2UUEA 1P2AA 1GZ8A 3QCQA 4AN2A 4C7TA 2JEDA 3RWQA 3LHJA 3JPVA 3P86A 2PK9A 3Q5ZA 3EYHA 4X0MA 4RG0A 4CFNA 5HD7A 2R3JA 2YJRA 4O0XA 5IA0A 3F2RA 2FVDA 3FHIA 4U7ZA 2HZ0A 4TZRA 5JEBA 1ZOHA 3EH9A 4X2FA 5JGDA 2GFCA 4N0SA 4CFVA 3TKUA 2CSNA 3O51A 3BHVA 2XJ0A 3L8SA 2ONLC 3O50A 3G15A 4CFXA 4BDJA 3KC3A 3OD6X 4ZTRA 4JAJA 4AGCA 1ERKA 4D1ZA 4A06A 3FY2A 4EC9A 3FL4A 4JG8A 4YNOA 3V5JA 4M8TA 4XJ0A 2VTTA 4DTBA 4XG3A 4AOJA 4E7WA 3IW6A 5JQ8A 5AR7A 3QTIA 4OAUC 2YWPA 2J90A 2Z7QA 3P79A 4EKLA 3N4VA 4AA5A 3TV7A 4RBLA 2XS0A 4JG7A 1JKKA 5LXMA 4XP0A 3FPMA 4F1TA 4QMOA 2WEVA 1JVPP 4U41A 4F09A 4RSSA 3FSFA 3KL8A 2QI8A 5KNJA 3EFKA 4BVUA 3FEGA 2VRXA 2WGJA 5F4NA 2JITA 3G33A 3D0EA 4GU6A 3A8XA 3KVWA 4PPAA 4XBUA 5D11A 4A7CA 5HTBA 3UP2A 2QLUA 3CTHA 4CZTA 3RPVA 4EK3A 3FZSA 3QUPA 2C3IB 4XCUA 3Q9XA 5CY3A 4YGAA 3I4BA 2HYYA 5I4NA 4F0FA 4BTKA 2WIPA 3JXWA 3QD0A 1OPLA 4KIPA 4OT6A 2WAJA 4O7SA 2X9EA 2EB2A 1WBVA 1ZLTA 2PVMA 3R01A 1UNGA 4NSTA 5FTOA 4B6LA 4DH5A 4C4HA 4E1ZA 3S1HA 3WBLA 3RINA 2A4LA 4U43A 4S34A 3FE3A 2XK8A 4QTDA 5D10A 3BYMA 3RGFA 4F99A 5L2TA 1LP4A 3ZUTA 4QPAA 5L2QA 2ERKA 2WD1A 1SVHA 4GFOA 3LJ1A 2GNLA 3ZH8A 4XG9A 1B6CB 1H27A 1Y57A 2PE2A 3VW6A 5E91A 2GFSA 4FG9A 4EKKA 2VD5A 4FIEA 4QYFA 5AV4A 4R7BA 1H0VA 3PP0A 1XJDA 4AT4A 5FG8A 4FTKA 1NVQA 4TKSA 1Q8ZA 4PPCA 2R7BA 5FRIA 4CEGA 2A1AB 5CU3A 3R8PA 4TYHB 3L1SA 4U97A 4TYEA 4I93A 1JKLA 5AP0A 4BICA 3R8UA 4DH7A 4HVIA 3ACKA 3VUGA 5BVDA 3I6WA 5DPVA 5CXZA 5CS6A 3FSKA 3HRFA 5BVKA 4KKHA 3BV2A 5KBQA 4ASDA 1YWNA 2YEXA 4IB0A 1J7IA 3MPMA 4TYJA 4QYYA 4YZCA 4GH2A 4O7NA 1TVOA 1UU9A 4M12A 2AYPA 3ZRLA 3BE2A 3C13A 2R3QA 2W06A 4RZWA 3SD0A 4B4LA 4CQGA 2BIKB 1PYEA 3F9NA 1SVGA 1UU7A 2XJ1A 4GIHA 4JS8A 4S32A 2UW5A 4IX6A 4QTCA 1PXPA 3V8TA 3VN9A 4DAWA 1Q3DA 2BRNA 1U54B 3ULIA 3BBWA 2QURA 5CAVA 1K3AA 4G5JA 4V0GB 4ZOGA 3PWYA 2X8DA 5E8YA 5DOSA 2QC6A 3GNIB 3E8EA 3PPJA 3TWJA 4IDTA 4MVFA 3ROYA 3GC8A 3OT8A 2QODA 3C4ZA 3PXRA 3BYUA 4EI4A 4O7RA 1YWVA 4DA5A 3S4QA 4R6VA 4BYJA 2IW6A 4L01A 3W2QA 4B8MA 4Y73A 2XBAA 4DH1A 5E9EA 2O64A 2C5OA 4IZ5A 4KWPA 3COHA 1OECA 4FG8A 4EJNA 5IDNA 2VTOA 5DRBA 3POZA 1M2PA 3COKA 5JN2A 2WTDA 3FYJX 3QKMA 2IN6A 1Q4LA 2IW8A 3BHYA 1XH7A 4FKPA 4QYGA 4LV8A 5M44A 4BCIA 4O91A 1E9HA 3DQXA 1FOTA 2ITWA 2YIXA 3OBJA 5KZ0A 4FUXA 1BLXA 3ZLXA 1JOWB 1M7NA 1Q3WA 5CEMA 5DGZA 3IPHA 2C4GA 1DAYA 3A7HA 3BE9A 4JG6A 5CAPA 4I22A 3R9DA 3TM0A 4GIIA 3TIZA 2BRHA 5D41A 4O2PA 5AV0A 2IJMA 5JFVA 3ZC6A 4U42A 2VX3A 2F49A 1O9UA 2C68A 4G3CA 4YURA 4WSQA 2IWIA 4JLCA 2QO7A 1UWJA 3WZUA 2PY3A 3R0TA 4BFMA 5FUTA 3FMEA 4IZAA 5BYLA 1K9AA 4I5CA 4GKHA 4J1RA 2LGCA 2QOLA 2DUVA 3BELA 3UIUA 1M2QA 5ANGA 3NX8A 2RFEA 3R8MA 3R8LA 2NO3A 3GCVA 1XQZA 3LMHA 3NRMA 4NW6A 4C59A 4CFUA 2C5VA 2UV2A 2WTVA 2C6TA 4AG8A 5HTIA 4ZLYA 3A7FA 4OAVB 4DFUA 1IR3A 4R1YA 5I0BA 1OBGA 4BY9E 3ROCA 2G2FA 5IPJA 2PZ5A 5FBOA 1O6KA 3F3WA 2EWAA 1Z9XA 3F3VA 4KS7A 4M67A 4PY1A 1YKRA 2BFYA 4NCTA 2OZOA 3EQBA 4NIFB 4UZHA 3QXOA 3LFNA 1W8CA 4ZY4A 3B2WA 2E9OA 2QG5A 4OTFA 4O86A 3QCYA 3EZRA 2JFMA 3PE1A 4MQ2A 3SOCA 5AAFA 3HMOA 4V01A 4E4NA 3PLAE 2Q0NA 2B4SB 3KF7A 4GYIA 5CU2A 2XM8A 4IVCA 5D9HA 3C4XA 3O7LB 1UA2A 2XJ2A 4DC2A 3HAVA 5M51A 3AT2A 3QUEA 2NPQA 3QF9A 5D7AA 5ACBC 2R5TA 3NAXA 2R0UA 2YCRA 3VBTA 4GSBA 4DEAA 2CMWA 4F9AA 2WELA 3FLNC 4L3PA 3ZO1A 3NAYA 2YIYA 3G6HA 4RJ4A 3FKNA 5DG5A 2WU7A 2PVJA 3MBLA 3P08A 3NMUF 4E6QA 3NNXA 4EK6A 4ZLZA 3JUHA 3QCXA 2I1MA 1J3HA 1H01A 4FTQA 4ARKA 4O7YA 4QMNA 2HENA 3VQUA 2IVVA 3MW1A 3IS5A 1AQ1A 3KXZA 3LQ5A 4FKTA 5CTPA 4ANSA 3M11A 4FTMA 2OK1A 2JIVA 4O6EA 3K54A 1Y8GA 3ZO4A 3TUBA 3SKCA 4TWPA 2FUMA 2XNBA 4FL1A 5CT7A 3R28A 2OBJA 3LXLA 4Z7HA 4EOIA 2GDOA 4QP9A 2CN5A 1URCA 1YDTE 4IACA 2UVYA 3RAHA 2WTIA 4IC8A 5B0XA 3EL7A 4H58A 4X6RA 2ONLA 2QOOA 4J99A 4BCMA 4E5BA 4UMUA 2XH5A 4F0IA 3LFCA 2I0YA 2BROA 2QONA 1PMEA 4CKRA 3RK5A 4ACHA 4MXZA 4FV4A 1WMKA 3GU6A 4HYIA 1VZOA 2PVNA 3HZTA 4EQCA 1GY3A 3K5UA 2VO7A 2J4ZA 1PMNA 3U4WA 2J6MA 4JBPA 3OEZA 3U6JA 1GZNA 4DFLA 3MH3A 2OG8A 3HEGA 5ITAA 3EQPA 3W2PA 5AAEA 3PG3A 1G3NA 5FM2A 2J5EA 2GMXA 5H8GA 3U4UA 4DEHA 4D2TA 3PXKA 3S3IA 3WF9A 5KBRA 4QMTA 3C4CA 2XKFA 5HEZA 3KGAA 3VS1A 2ZV8A 3KMWA 3R30A 5BVNA 4AT5A 4BHNA 4KBKA 5JH6A 4ZTQA 4DG0E 2DYLA 3EKNA 4EH7A 4F7SA 4NM7A 3D7TA 5K5NA 5AUUA 3LFAA 3PPZA 2XVDA 3GVUA 3KXNA 4C58A 4GVJA 4Z7GA 3LPBA 3DB8A 3QZHA 3M1SA 2VO6A 4MAOA 3E5AA 4OR5A 1XH8A 2GNGA 4EH4A 5C26A 4BIEA 5H3QA 2PUUA 1FGKA 2XCHA 2A27A 3CQEA 2JDOA 3MVJA 3T9IA 5ANDA 2CLQA 4A9TA 3WIKA 2GNJA 4L42A 4PDYA 4YZ9A 3S2PA 1LEZA 2UZVA 4FKJA 5FDPA 2P3GX 2WQOA 5HG5A 2Z2WA 4JBQA 3F61A 2XP2A 4ZMFA 1OGUA 2Q0BA 3ZEPA 5I9VA 4CV8A 5AAGA 4O7ZA 5K0KA 3BYSA 4O6LA 2YLFA 1MQ4A 5KMIA 5K4IA 1F0QA 4DITA 3R7IA 4FEUA 5FEEA 4KB8A 3P0MA 4LRJA 3VJNA 4CCBA 4CQEA 1NW1A 5EQEA 4X2GA 4EH8A 3IO7A 3ZC5A 2ZV2A 3ALOA 2Y6MA 3QHWA 2IZSA 4O0TA 4AX8A 1CKPA 4JX7A 3GC9A 3K3JA 3VBXA 4EBWA 3AC3A 3F5PA 2QD9A 3BLHA 3LXKA 3HX4A 5HE3A 1P4OA 2F7EE 2DQ7X 3W32A 1QL6A 3FKOA 1BX6A 4FSYA 4DEGA 3P4KA 2W4OA 3OOGA 4IH8A 2GQSA 3OUKA 4OTHA 2EXMA 3KXMA 5AUVA 5C8MA 4B0GA 5A4CA 4RA4A 4FTOA 2VX1A 5EW8A 1XH9A 2XKCA 5D12A 3NZ0A 3NUYA 2C3JA 4MKCA 2IVUA 2V7AA 4IFGA 3CXWA 3FY0A 1O6LA 3ZRMA 4E6DA 4WSYA 3VHKA 4JDHA 5IEYA 3Q96A 1H8FA 3HLLA 4G9RA 2VTQA 4LOOA 5EFQA 3IQ7A 4TWOA 3MFRA 3UOLA 1CKJA 1VYZA 1DS5A 2CGUA 5DR2A 4QP2A 3AC4A 2YERA 4M69A 3UZTA 2E9UA 2PL0A 2W1HA 2BVAA 1XH4A 4PL5A 3AQVA 3VUMA 4ANMA 4DFYA 4HW7A 2HK5A 3LCSA 5HE2A 2F2UA 2PZYA 4A07A 4V04A 1TQPA 3DFAA 3F5GA 4M7IA 4WBBB 5H8BA 1LPUA 4BKYA 4XS2A 1S9JA 3FPQA 4GVAA 1U59A 4YBKA 5HICA 5KE0A 5CI6A 2OXXA 5HCYA 4UXQA 3S00A 3R2BA 3L9NA 3HNGA 3UC3A 1G8SA 2QO2A 3N51A 4UB7A 4ZSEA 5ICPA 1KV1A 3EL8A 3Q4UA 1M14A 3PZHA 4GUEA 2FYSA 2YM4A 4KRDA 1UKHA 5K3YA 3ULZA 1PY5A 3NPCA 2OFVA 2PMLX 4ZXTA 2UZNA 2VTIA 2Y9QA 3DBQA 5IQIA 5EHLA 4J95A 4JL9A 4NWMA 2QQ7A 2PVKA 3NW6A 2ITPA 3PVGA 4RX9A 2YAAA 4BDHA 4EEVA 3GB2A 3RP9A 2QHNA 4F6WA 1ND4A 3MH0A 4OUCA 2PVHA 2PYWA 2QU6A 4UEUA 2WMSA 1Y6AA 4FV2A 1OKYA 4ACMA 4ZTSA 1VEBA 3G6GA 4FODA 5D7VA 4WT6A 2WFYA 3II5A 4L43A 2B52A 5KUPA 3GEQA 3ANQA 4UN0C 4ZEGA 5E4HA 3PJ3A 1OKWA 3U55A 5M07A 4AW5A 5JKGA 4M3QA 2I6LA 3FZTA 4L44A 4WKQA 3UC4A 5EYKA 1TQIA 1PXNA 2YDJA 3E7OA 4BCOA 5EG3A 4EHGA 4CKJA 5LMKC 2JBPA 2C47A 3QTZA 4JRVA 4FTNA 4G5PA 4J53A 2UZBA 4D28A 3GU7A 2B54A 4FKWA 4IX4A 2GS7A 3HV3A 3VS0A 5AUTA 2EXCX 3BQRA 3IW8A 5C27A 4D0XA 2OGVA 3ORLA 4XRJA 2GHGA 2W4KA 2YA9A 3ZBXA 3MB7A 4CTCA 3KREA 1ZYJA 5AFVA 2YCSA 2ERZE 3DZQA 5AIKA 3FMLA 5HBHA 4W4VA 3AD6A 4WNPA 3BV3A 5JK3A 1P14A 2PZPA 3QHRA 4BDBA 3NVMB 4KD1A 4K6ZA 5CU0A 4O7VA 3R1SA 4Y72A 1W98A 3CJGA 3TACA 2J2IB 5GZ9A 4FV9A 5KMLA 3TT0A 3KN5A 4CFMA 4IVBA 3SXFA 5BYYA 4C34A 1PXLA 5J7HA 3AG9A 2YHVA 3PJ8A 1H1PA 4YMJA 4F9WA 2PUNA 3TV4A 3ORKA 2W17A 3W55A 4R77A 3PFQA 5HI2A 4IAAA 3OXZA 3O96A 4KA3A 3D5XA 3NS9A 1DI8A 3KB7A 3D14A 2VTHA 4U0IA 1WFCA 3GU5A 3CQWA 4A4OA 2GQRA 4KS8A 2UW8A 5A4QA 3OEFX 3UTOA 4RFYA 3Q5IA 2XEZA 4FKIA 2B9FA 5FP6A 3VS3A 3WF5A 2OFUA 4XG8A 3OMVA 5DT0A 4F64A 2REIA 4FIFA 4X2NA 5E8TA 4BCGA 4JVGA 5I3OA 4HPUE 2XK9A 3FZ1A 4XV3A 4BCPA 2C1BA 1PRYA 5A46A 2PVYA 4FKUA 4C4FA 5T6KA 4MF1A 2OU7A 1ZZLA 2PMIA 5L6OA 3QTQA 5FDXA 3NUNA 3EOCA 4O0RA 3KA0A 3CKXA 1OM1A 5EKNA 4X7QA 4HVGA 4L52A 4KSPA 3F5UA 4FV1A 4EK8A 5AP2A 3VS6A 4CXAA 2WQEA 3E87A 1KSWA 4EHZA 4AXAA 4CNHA 3UVRA 2PTKA 4GU9A 4IX3A 3C1XA 4UMQA 4A9SA 5DNRA 4BGQA 1YOMA 4QPMA 2GS6A 3CY3A 2B9JA 4G17A 3B2TA 4FTIA 3EFWA 5TKDA 3OCSA 5HG8A 2WMUA 4QMYA 4FZ7A 3THBA 4BBFA 2J51A 4F6SA 4FX3A 1ZOEA 5AJQA 1FMOE 2F9GA 3ZHPC 1REJA 3I81A 4AW1A 4D1XA 5HVKA 4FNWA 3NNVA 3DXQA 3PIXA 4RWLA 4R5SA 4GT3A 4O7LA 4QP4A 3W8LA 4ZTMA 2W4JA 5M56A 2X9FA 2O63A 5C4KA 4JR7A 4EJ7A 3GOKA 5EI6A 4IANA 4XV9A 3TJCA 5E8XA 4WRSA 4XG7A 5CEKA 3WOWA 3W10A 2VTNA 1V0BA 4IX5A 4CT1A 5IA4A 1OI9A 3DBEA 2JBOA 3UO6A 5AR5A 2A2AA 3A61A 1ZARA 1GIHA 3FI3A 3FLZA 3R7VA 3F7WA 4FNZA 4IBMA 4BYIA 4EH5A 3UQFA 4IADA 4X3FB 3DNEA 4O0YA 3R00A 3QA8A 4EWHA 5JGAA 2JAMA 4IEBA 2WTCA 3VWAA 3ZYAA 3QQGA 3VS7A 3WARA 5C9CA 3EJ1A 4XG6A 1NVSA 1MUOA 3C0IA 4EOSA 2JD5A 3BU3A 3DNDA 4FTRA 5AUZA 5J87A 5JZNA 2ZDTA 3GQLA 2W1FA 4H1JA 4CMTA 2X2MA 4FI1A 4W4XA 3ERKA 2IVTA 2WXVA 4ITIA 2YISA 3P78A 3ORPA 3R7YA 1IASA 1XBCA 2GU8A 2QOIA 3QWKA 4QD6A 3FI8A 1LEWA 2IZUA 2C6EA 5TOZA 4FGBA 2VWYA 3W2OA 4LOPA 4RWJA 4CG9A 2CLXA 3FQSA 5M09A 4QMZA 3R9OA 2HXQA 3RPSA 2C6OA 4C02A 5JRQA 4L3JA 1GAGA 4QMQA 2RFDA 4FSZA 3UYTA 5A4LA 4D5KA 1YOJA 3BHTA 3PXFA 4NTTA 1IAJA 3VBQA 2E9PA 2W0JA 4NEUA 5LMBA 2UZWE 5I9ZA 2XK7A 4MWIA 5LVLA 4AS0A 4O22A 4G3FA 1PXMA 2QOFA 1V0PA 3DBCA 4FZ6A 5LQFA 5CT0A 5K5XA 2CCIA 2UW0A 4HGTA 4RFMA 5FLFA 3BQCA 2QOKA 3EZVA 2WQBA 3JVSA 4IB5A 4BBMA 3U54A 3C0HA 2WHBA 5HGIA 4CSVA 3QZIA 3WE8A 2LAVA 4JI9A 3W18A 3E3PA 2XMYA 4QT1A 4BGGA 5CF6A 3R02A 3KXHA 4X3FC 1OIYA 3LKMA 3R1NA 4W9XA 5D1JA 2ETMA 5HCZA 1Q97A 3PUPA 3SV0A 3OCBA 1U5QA 4FIJA 2VX0A 5LMAA 4LYNA 1Q61A 3C9WA 4FK6A 4F7LA 5C8KA 3QA0A 3V5WA 2CKEA 5CLPA 5EHOA 1YDRE 3PLSA 4AF3A 5HTCA 5T68A 1Y6BA 5CU6A 3RVGA 3QRIA 4JDKA 4TRLA 4BI0A 4CFWA 5JFSA 3EYGA 4UMPA 4RQKA 5CAUA 3V6SA 4HCUA 3R8ZA 5HG9A 3ZXTA 3L9PA 5HX6A 3A8WA 5CSVA 4XLIA 4AAAA 1PXKA 4MF0A 4TYIA 4UXLA 4Y46A 5KMNA 4RJ8A 2O2UA 3OTUA 4TYGA 4BWXA 4RFZA 1E1VA 2X4ZA 4BN1A 3BIZA 3A60A 3DU8A 3GT8A 4AGWA 3Q52A 4UYAA 3VQHA 5AP3A 4U9AA 3AMAA 2YWVA 2ZOQA 4E4XA 2CGWA 3MTFA 4ORKA 4R3CA 4Y83A 3BKBA 4GFMA 4QMMA 5LMKA 2RGPA 4F6UA 4FT0A 4C57A 3DDQA 4I0TA 3MDYA 4PTGA 3OS3A 3RM6A 4MBLA 2R3NA 4O1OA 2B55A 2BDFA 3KULB 4FICA 3FYKX 4J71A 4M15A 3ZS5A 1EH4A 4LGGA 2BFXA 4RPVA 1YQJA 2XNNA 4L6QA 3TXOA 2X81A 5GINE 3UMWA 3UVQA 3SVVA 4EOLA 1OPKA 2ESMA 4MQ1A 3ZBFA 3F6XA 4R8QA 4ZZNA 2WNTA 4D4YA 4H1MA 4I92A 4NM5A 5CZIA 4CYJA 4ZLOA 4D58A 4YNEA 1K2PA 3ZLYA 4F7JA 4J98A 4FV6A 5HLPA 3F7ZA 4BZNA 2UZOA 2XIYA 2IW9A 2W1DA 4IZYA 1JBPE 4O2ZA 1H00A 3MV5A 5DIAA 3DK7A 1W82A 2BTSA 1HCLA 4QOXA 2Y7JA 4ALVA 2UW9A 5IMXA 5CQWA 3DPKA 4FSMA 4KIKA 3Q6WA 5IH4A 2BRBA 2Z7SA 4IWOA 4RC2A 5EDQA 3AT3A 5IA3A 2B7AA 3E64A 4FZAB 2OO8X 5FQDC 4F1MA 3QRJA 1R3CA 4FOBA 5G1XA 2W5AA 2ITZA 3EQFA 4QP7A 5EI8A 4Y95A 5GJGA 4ALWA 4ZMEA 2P2IA 3MH1A 3VBYA 3VO3A 3ZDIA 3QAME 4EZ5A 5IQEA 1OL6A 4FKSA 2ITVA 4IIRA 4O83A 3FXWA 5J9ZA 4LI5A 2PUIA 5AX3A 3GQIA 4RIXB 2H9VA 4QYEA 5HO6A 3W33A 3OFMA 2YN8A 4X2JA 1ZYSA 2GNHA 3MN3A 4P90A 3OHTA 2IZRA 4FR4A 2F2CB 2HWPA 4ZY6A 5JZJA 4WO5A 3NSZA 4QYHA 3KXXA 3ORIA 3EFLA 4QRCA 4PPBA 4DN5A
chains in the Genus database with same CATH superfamily
3ZCLA 3D94A 3LQ3A 2VTJA 4ACCA 3KN6A 5BUEA 2X2LA 4CLJA 3UNKA 4IJ9A 3ZSGA 3PY0A 4NFNA 4KIOA 5C03A 3FBVA 5LCKA 1FBNA 4G3EA 3A4PA 1UU3A 3N4TA 4DTAA 4G6NA 5EI2A 5L6PA 3LMIA 3BGPA 3COMA 3EWHA 2ITNA 4WG3A 4QTAA 1G8AA 1OZ1A 3CY2A 1WCCA 3CPCA 2YM8A 4LUDA 3KQ7A 2ZV7A 1Q5KA 4RIYA 5TO8A 5M4CA 2YAKA 4EK4A 2JKKA 4S30A 2PZIA 4FZFB 5CAOA 3ATSA 2BKZA 3F66A 4IWPA 2XNMA 3ZZWA 4PP9A 2RIOA 3OWKA 3NVKI 1VYWA 2OJGA 4RVMA 1OL2A 3LCTA 5IQBA 4MBIA 3BHUA 4QMUA 3TYKA 4EHEA 4O4CA 3U87A 3KCKA 3MVHA 5GNKA 4PNKA 4M14A 1M7QA 1MP8A 1H25A 1QPDA 2R4BA 5LOHA 3WE4A 4DHFA 4MNFA 3K2LA 5AUXA 1TQMA 3TKIA 1JNKA 1CMKE 4FEWA 3NCGA 4C4JA 2ITXA 4M68A 4ANLA 2V62A 4PMSA 4PRJA 3W2SA 1Z5MA 3MIYA 4OTRA 3A2CA 3BZ3A 3FAAA 4U3ZA 1SYKA 4E5WA 4U81A 2J50A 2Q83A 4RJ7A 3NWWA 5HIEA 2DS1A 1G5SA 3ORXA 5KMOA 5DBXA 4CRLA 3W8QA 3QTXA 1OKVA 5I9UA 1FVVA 2ZB0A 3MFTA 4IDVA 4M0YA 1PKDA 3AC5A 5HU3A 3AOXA 5B2KA 4GKIA 4TXCA 3OUNB 3EIDA 4V05A 5A14A 2JDSA 4NM3A 4EONA 2PVRA 3CQUA 3M42A 4TTHB 2ETKA 4ZY5A 5FEQA 3D7ZA 4YC8A 4XHKB 3A4OX 5ANJA 4B9DA 4D1SA 2OJFE 1HCKA 3KXGA 3FZPA 3U51A 4RIWA 4KAOA 4C35A 4ZSAA 4ZTLA 3R7UA 4BZOA 1R1WA 3OCGA 1U5RA 4JDIA 3QD4A 3BLQA 4QMWA 2G2HA 2A98A 3O8PA 5CVFA 4A9RA 4CD0A 5JFWA 3ZONA 3DOGA 4IM3A 2F7ZE 4HCVA 5B2MA 2NYAA 2YM6A 4MBJA 4NUSA 2BDWA 4ZJIA 1JPAA 4BZDA 1JSTA 2ZM3A 4FSWA 3AC1A 4CT2A 3QRTA 1DAWA 1SZMA 3SRVA 2YZAA 4M84A 4M97A 4I6BA 1DM2A 2HW7A 4NJDA 4NM0A 3BEGA 5IUHA 4DG3E 4NT4A 2OF4A 4GYGA 5HO8A 4IAIA 4X21A 4R3RA 3G51A 1KWPA 1PJKA 3EQIA 4OW8A 4A9UA 2XNOA 4WIHA 4ANNA 4IZ7A 4O0UA 5CANA 2OSCA 2VWUA 3VRZA 3FXZA 4KKGA 4GG5A 1GOLA 5AP6A 4BCJA 4HVDA 4NTSA 3IG7A 3VUKA 1L8TA 2JDTA 3PYYA 4L7FA 1IA9A 4RWKA 4FSQA 4FGRA 3ENHA 1NT2A 4MNEB 5BMSA 2Y8OA 5EYCA 4E26A 5E1EA 3GFEA 5AP1A 5M53A 4RIOA 4FTJA 3TNPC 3O5AA 4F4PA 1TZDA 2ITQA 4FSUA 4NKAA 2FSLX 4JOAA 4YLKA 4X2KA 5J5SA 3MWUA 4O38A 4WRGA 3JY0A 3KY2A 1JQHA 3ORNA 4L9IA 5M57A 3NFGB 2W05A 2X7GA 3NIZA 3IW5A 2VWBA 1M52A 2BPMA 2P4IA 3KEXA 3PZEA 4PDPA 3TUDA 3BLRA 3CGFA 4QMLA 3PE2A 1OBDA 4DGMA 4DE4A 2RFSA 5BX0A 3QBNA 4YZBA 2XNEA 4JR3A 5KKRB 3R1QA 1BUHA 4TWCA 5LCJA 4FBXA 4D2WA 4C37A 3W2CA 3GBZA 4IFCA 4YJOA 3PP1A 3U8WA 5L6WL 2IZTA 3V04A 5L4QA 3QD2B 2GTNA 3RCDA 4L7SA 2WQMA 5HNBA 3W1FA 3UOHA 4I1ZA 2ZB1A 4FTLA 5H9BA 2JFLA 3WYXA 2X8IA 3A99A 3KMMA 2OZAB 3QXPA 2C6IA 3ZDUA 4HVSA 5HOAA 3UGCA 5C01A 2P33A 4DGOA 3PY1A 3NDMA 5DE2A 3RBWA 4WD5A 1S9IA 1PHKA 4HGLA 3GC0A 3ZXZA 2Z7LA 5BQ0A 4S31A 3CP9A 2CNVA 2J9MA 4QPSA 2BRMA 1ZOGA 4J7BA 4JQEA 2J7TA 4FSTA 4EH2A 4O1PA 3LCKA 3DCVA 3MB6A 5HNGA 4UBAA 4DBXA 3Q4TA 3RCJA 4N57A 4AU8A 4IVDA 5EOBA 3TI1A 4BKJA 4LRMA 3QUDA 3SHEA 3KKVA 4MXOA 5HIBA 1YHSA 4CGAA 1OB3A 5FXSA 3OC1A 2OJ9A 1BMKA 3PY3A 4AE9A 3OW3A 3IDCA 3UMXA 3QYWA 4YHJA 4DEEA 4DFBA 4ALUA 3QQFA 3RHKA 4IHPA 2PMNX 5FXRA 4APCA 1J1CA 3SG9A 3SW7A 2BAKA 3CS9A 1FGIA 5KCVA 2XEYA 3HV7A 5AA9A 4DFNA 3K3IA 5AV2A 2XRWA 2WMXA 3PPKA 3UO4A 4A4XA 3LLAA 3COIA 4O7TA 2HCKA 3KMUA 4DF3A 2EUFB 3IGGA 3FMKA 3T3UA 1UKIA 3FZRA 5DH3A 2HZNA 3GFWA 2CN8A 4R7HA 2BKKA 3R2YA 3AMYA 3QYZA 3UDTA 3AD4A 3NNWA 4F08A 1GNGA 2ITOA 4O4BB 4RC4A 3A7IA 2WTWA 4K11A 2XAMA 3VULA 4GW8A 3C5UA 1T45A 2IVSA 2UW7A 3KU2A 2CNUA 1XBAA 3DLZA 2B9HA 1CKIA 4Z3VA 5DA3A 4ITHA 3G0EA 3ORMA 5KHXA 2HAKA 2XCKA 5CSPA 4TT7A 5EM7A 3RAIA 4YHFA 3ZEWA 4D2SA 4YUQA 2HOGA 5CEQA 3DKOA 3CD8A 3HP2A 3WF7A 4BDEA 3UYSA 4QQ5A 4AGDA 3HKOA 2V22A 4GG7A 4OBOA 5CU4A 1A9UA 1OIRA 4IQ6A 3T3VA 3TTJA 5BUIA 3RALA 5EQPA 4IW0A 2QVSE 3CKWA 3V01A 4BTFA 4ZP5A 1H1RA 4G6LA 3OCTA 4FSNA 4JRNA 4AZWA 4FKQA 2VTRA 5DR9A 5AWMA 2BZJA 4PMPA 2FB8A 3BRBA 2KTYA 1PF8A 2VO3A 4C0TA 4O4EA 5LJJA 5KHWA 4RX5A 3O0GA 3I5ZA 4RRVA 5HCXA 4GRBA 4LM5A 5GHVA 3RI1A 4BDAA 3CSVA 3DTWA 3PJ1A 1L3RE 3UIXA 4FUYA 2ZM4A 1H07A 2AC5A 1SNUA 3DB6A 3FKLA 4IB1A 1V0OA 2XKDA 3NYOA 3E7VA 4G16A 3UOKA 2I40A 5K4JA 3S95A 4FEQA 3DS6A 3WI6A 3TUCA 2I7QA 4FVQA 5M08A 2E2BA 5HBJA 1YI4A 3I6UA 1J7UA 4KUJA 4BCKA 4GCJA 3ZLSA 5J5TA 3OOMA 2XIRA 1IEPA 2C30A 3ATTA 4TYHA 4OTWA 5G6VA 5BNJA 3UDSA 5TT7A 4YJQA 2WZJA 1PW2A 2X0PA 3IOKA 2WMVA 4EUUA 3DLSA 2R0IA 4BDCA 3I60A 4XV2A 1H1SA 2G01A 4AQCA 4PMTA 4DH3A 4IB3A 4L8MA 2ZMCA 3UJGA 4EQUA 3DAEA 4GK4A 3S0OA 1OITA 1R0EA 4KKEA 3PXYA 1W2FA 2CKQA 3GUBA 4H3PA 4W4WA 4YSJA 1Z57A 3O2MA 4USDA 5CASA 3TKHA 3R6XA 3DV3A 3UVPA 3L8VA 4I21A 3HV5A 1Q24A 2WTKB 4M66A 4YO6A 3GC7A 3V3VA 4KBCA 3Q2JA 4MCVA 3Q3BA 5E1SA 2PWLA 2VAGA 1U54A 5AUYA 2C5XA 4YO4A 2XYNA 2XM9A 3OXTA 4L67A 4V0GA 4YJVA 5IA5A 3B8QA 3DAKA 3REPA 4C4IA 2WMRA 1YXVA 3C4FA 5GZAA 2ZAZA 5GJDA 4MK0A 3UZPA 4G31A 1OL1A 3RWPA 2VNYA 3R7EA 4LMUA 2GNFA 4D4VA 5F94A 5EKOA 4N6YA 4DCAA 3F3TA 5CAQA 2OF2A 2WMWA 2IPXA 4ZJJA 4H39A 3OG7A 1YVJA 4QQJA 5HE1A 3RPOA 4BL1A 1FVTA 2X7OA 4MX9A 3MVMA 4MD9E 3RZFA 3SXRA 3WILA 3GCSA 3PIZA 3AC8A 3E93A 4DT9A 1H28A 4D2VA 5EM6A 2ZJWA 2R3IA 1GIIA 5EDPA 5HG7A 2RF9A 3IECA 4UALA 4BDGA 3D5WA 5F1ZA 2A19B 4O0WA 4E3CA 3DZOA 4Z9LA 5IZFA 5J9LA 4YSMA 3PG1A 5IA1A 1STCE 2ZMDA 4LG4A 4AUAA 3RZBA 4IAKA 4I24A 3L9LA 2H96A 3HL7A 4LOQA 3KRLA 1OKZA 4XEYA 1PYXA 2HWOA 3RNIA 4JT3A 5A3XA 3SXSA 2OLCA 3I7CA 1V1KA 5IEVA 4L3LA 3E63A 2IF8A 5F95A 2WKMA 4E20A 3C4WA 4BR3A 2VGOA 2YM3A 4IAZA 2GPHA 5EW9A 4BB4A 5CX9A 3DGKA 4B7TA 4DBNA 3U9NA 4AZSA 5CALA 4RVTA 4EC8A 3WF6A 3LFDA 1CDKA 3PIYA 3OTVA 5GIPE 2R3GA 3WYYA 4EHVA 5AV3A 3E8DA 3SGCA 3PVBA 1GJOA 3CCNA 3PRIA 2JDRA 2VU3A 1W2CA 2Z7RA 4HJOA 4U3YA 3UQGA 3OW4A 4G34A 3OWJA 1Q8WA 1ZAOA 2G15A 4QP3A 4EOKA 5E7RA 1Q41A 2PMOX 3MY1A 3TJDA 3Q4CA 3FLQA 2UW3A 4IVAA 4NIFA 5HNIX 1IA8A 3UQCA 3R04A 2VWVA 2QR7A 4C2WA 3QC9A 1YXSA 4OT5A 3IKAA 3VF8A 5HU9A 3AT4A 2O65A 3OWLA 3P9JA 4JIKA 4F0GA 4UMTA 1CTPE 3QLFA 3ZSHA 1YOLA 4AW0A 2C3KA 3PA5A 3ZRKA 3NUAA 3H3CA 3VC4A 1KUTA 2E9VA 5HZNA 3VF9A 4W8DA 4E93A 2R3MA 4MXAA 4E6AA 1YXTA 3LMGA 5BVOA 1BL7A 4HGEA 3PSDA 3WZEA 5IU2A 4BCQA 2BHEA 2C1AA 3CPBA 3TEIA 1QMZA 3JVRA 3JY9A 3NUXA 3D9VA 2XNGA 4CCUA 3SG8A 4APPA 3ORTA 5F9EA 1A48A 5IKWA 4C62A 5T3QA 4TWNA 3BL9A 4I6HA 3K5VA 2RKUA 2CKOA 2XRUA 4O84A 2OWBA 4EL9A 4YZNA 3C0GA 4RZVA 4E8AA 3NR9A 4EQMA 5B2LA 5KZIA 1B38A 3Q32A 3PFYA 4RA5A 1UVRA 4AXDA 4EH3A 3LVPA 3E8NA 4FTCA 5CF8A 2AC3A 4AACA 5L2SA 4GK3A 3RPRA 2CDZA 4F65A 4ZZMA 2Y4IB 4BWPA 2QOHA 2VWZA 4XLVA 4C4EA 2VUWA 4LUEA 4PTEA 3SOAA 4EH6A 3NW7A 4II5A 4MXYA 4FTAA 3RKBA 5LWMA 5KMJA 1SM2A 3IONA 2I0EA 5JQ5A 5CVGA 4C38A 3BGZA 3OF0A 4E4MA 5J1WA 3EN9A 3ELJA 5CNNA 2BAJA 5C4LA 3R9HA 2UVZA 3NNUA 4F9BA 4J96A 1R39A 5DWRA 4RWIA 5HESA 5DR6A 1OGYA 1UU8A 1YHVA 2FSMX 1JAMA 3MH2A 2UVXA 3LCDA 1FPUA 3PTGA 4BJJB 3R9NA 2BILB 3ZMMA 1GIJA 4KBAA 3O23A 4AA4A 2QO9A 3U9CA 5DVRA 2X8EA 4AOIA 2W9ZB 4D0WA 2BZKB 4QMVA 2QG7A 1U4DA 4DFXE 4PWNA 4DFZE 1UV5A 4R78A 1H08A 1I44A 1P5EA 5CENA 4JJRA 3BCEA 3FL5A 2JDVA 2C3LA 2F4JA 2B1PA 2GNIA 4AGUA 3HECA 4ASXA 4CKIA 3LCOA 4WA9A 5IF1A 2R3HA 4G3DA 3V5QA 3D7TB 4KRCA 4TL0A 2OIBA 4H36A 1W84A 3KF4A 1ZMVA 2JKQA 4W4YA 4F63A 4PP7A 5IISA 2XIZA 3UODA 4DINA 5IQHA 5J1VA 5L8JA 3Q2MA 5ETCA 3V5TA 3VAPA 3UZRA 5M06A 3DJ7A 2XA4A 3LXPA 2CGVA 2ZDUA 2VN9A 3DXNA 4FKLA 3GP0A 3FZOA 4E6CA 5ANKA 3I5NA 1CSNA 5ETFA 2BMCA 4P7EA 4FTTA 3IK3A 4D9TA 4CVAA 1IAHA 1PXJA 4L68A 4C2VA 5EW3A 4FEVA 4O0SA 4A4LA 3QX2A 4M13A 3F88A 1QPCA 2GQGA 2YM7A 3HUCA 3NUSA 2XUUA 4K1BA 5TE0A 1T46A 4ASZA 2BZHB 2GCDA 4LFIA 5BVEA 3UP7A 3LZBA 4IAFA 1SMHA 4UY9A 2X2KA 4XUFA 3ZUUA 4P4CA 4MEDA 4C3PA 2J5FA 4RJ3A 4DGLC 1UNHA 4CMOA 2BR1A 4YPDA 4QMXA 4F9CA 3VS2A 4Y5HA 4RX7A 3E8CA 3DJ6A 3QZGA 4W8EA 5AMNA 4OTPA 1DI9A 3FMDA 4G9CA 1A06A 4D2PA 4ANQA 4K33A 3H9FA 1ZYLA 4WNKA 4AA0A 2BALA 5HLNA 3TNQB 3RNYA 3UIBA 5FWKK 2X4FA 4FV7A 3L8PA 4ACGA 4NYEA 2H6DA 4C33A 4EOQA 5HLWA 2R3PA 3ZTXA 5AIRA 2VGPA 4FKGA 1RJBA 3LM0A 2OJIA 2NP8A 3MJ1A 4CTBA 5IEXA 3RTPA 3F69A 5JGBA 1NXKA 4BTJA 4I4FA 4L53A 4MH7A 4FEXA 4LL5A 1YXUA 4K8AA 5C1QB 2ZYBA 4U6RA 4YLJA 5J7BA 3Q9YA 2IO6A 1QPJA 5A54A 4RMZA 3ALNA 3ODZX 3T8OA 1Q8YA 2V7OA 3V8SA 4D4SA 5AM7A 4RVLA 3SA0A 4FT9A 3HMPA 2AEGA 3LOKA 5AP5A 5HE0A 3H0YA 5AR8A 5FGKA 2BRGA 3TNIA 3CEKA 4M69B 2YITA 4TN6A 3PA4A 4KINA 5JT2A 1I09A 3FMMA 5I9XA 4FC0A 4DEDA 1TKIA 3P7CA 3W16A 4FA2A 4QO9A 4C3RA 5KO1A 3N9XA 1JSUA 4CRSA 4OTQA 5E8ZA 2WQNA 3SC1A 3ZSIA 5GJFA 2J0KA 4AFEA 3NIEA 5A9UA 3QQUA 2QHMA 2P0CA 3FLWA 3LQ8A 4WNOA 1JKSA 2UW4A 4TPTA 4YTHA 2RG5A 2X6DA 3ETAA 4KABA 4Y5QA 4RLLA 4YTIA 5HORA 2W1IA 5AADA 4HGSA 1R0PA 3PSCA 5FM3A 2W5BA 5FTQA 3POOA 5FXQA 3BU5A 1WBTA 3WIGA 4QP1A 1KOBA 5A4EA 2RFNA 4ONAA 1ZZ2A 4PUZA 4DHJA 4RQVA 3KRWA 3QL8A 3ZU7A 2OH4A 1F3MC 2BAQA 4U5JA 3PXZA 3N4UA 3FMHA 3R1YA 2G1TA 1ZWSA 1H4LA 3EKKA 4YBJA 3D5UA 2W5HA 3Q9ZA 2FH9A 4J8MA 3KK9A 5JMSA 3LFEA 4BCHA 2R3LA 3G9NA 5IG1A 5IQGA 3BYOA 3LFFA 3VVHA 4BDDA 1R78A 4NZWB 3QTRA 3GOPA 4YC3A 2BTRA 2FGIA 4BDFA 3IW4A 3KK8A 3HMNA 3VBVA 3BBTB 4R3PA 2QOQA 3LLTA 4QMSA 4RLKA 2GTMA 3LFBA 3OY1A 1M17A 3EQRA 4BTMA 3TNWA 3MTLA 2WTJA 4GS6A 2XBJA 2XIKA 3LW0A 3H9RA 3ZUVA 4DHIB 3EN6A 4E4LA 3G9LX 5FD2A 5HQ0A 2W96B 3EN7A 3V51A 4UV0A 4USFA 3FLYA 3ZM9A 1WBSA 5DT3A 2QOBA 4FZDB 4WUAA 4EYJA 4KNBA 3PWDA 3OZ6A 3MYGA 4YC6A 2W99B 1Q99A 4DEIA 4EUTA 4ERKA 3QX4A 2PZRA 3MSSA 2HY0A 3WZKA 3NGAA 4FV3A 2W1EA 2YJSA 3FHRA 4U80A 4GJ3A 4AWIA 5ANOA 2HELA 5CSXA 5I5ZA 1Y8YA 2R9SA 3PVWA 1OL7A 2C69A 5FTGA 2WB8A 4TNDA 4YPSA 4CZYB 2R2PA 4J97A 3R71A 1IRKA 4JQ8A 4JQ7A 5E8WA 3HRBA 5AR2A 4Z16A 4DGNA 5AM6A 4FL3A 3SQQA 4WBOA 3L8XA 5FBNC 3P7BA 5A6OA 4RJ5A 4FVPA 1H26A 4HOKA 3GCUA 4PDSA 3QTWA 4E73A 4JAIA 4BGHA 4IC7A 2V0DA 3E62A 3LFQA 5AR4A 4XP2A 3TZ9A 2J0MB 3P5KA 2FO0A 2GHMA 1RDQE 3MVLA 3CGOA 2CPKE 3EQHA 3NEWA 3Q9WA 2BCJA 2VTAA 4P5QA 3ZFMA 5L2WA 3QQLA 3ZZEA 1J7LA 2J0JA 4FTUA 3AC2A 3P5JC 5L3AA 2WMBA 4FKRA 4JIAA 1ZYDA 2UW6A 4FV8A 4PX6A 5EHYA 4EYMA 2BDJA 4G1WA 3VS5A 4NW5A 1ZYCA 2C6DA 3ITZA 2OJJA 3MPTA 3R73A 4RC3A 4F70A 3PXQA 1GZKA 5CYIA 2VWXA 3SW4A 3C51A 4MWHA 5TF9A 4HVHA 1YW2A 2C0TA 4IM2A 5KMMA 4Y85A 4EZ7A 3PUFC 4FV5A 5CEPA 3TDWA 2PHKA 1W2DA 2PSQA 4UMRA 5FP5A 2O3PA 5HKMA 3QCSA 2R64A 4U45A 3CIKA 3NYXA 3RMFA 3FMJA 1H1WA 2A0CX 3AD5A 3A7GA 3LM5A 3R22A 4H3QA 3VRYA 3R21A 4AZFA 4D55A 3DJ5A 5ETAA 1YHWA 4UWBA 5CI7A 4DLJA 3GXLA 1J1BA 2VTLA 5J8IA 4I0SA 4X3JA 4ZAUA 3IOPA 3TL8A 2CHLA 3OT3A 3H10A 4FNYA 3VJOA 3FI4A 3QGWA 3SX9A 3DBFA 1OIUA 3VIDA 2C6KA 3FUPA 4L46A 3HP5A 4IE9A 4MYGA 4YLLA 4BCNA 4G3GA 3HA6A 3MI9A 3QD3A 5EH0A 1Q8UA 3C50A 5AR3A 4IAYA 4K18A 3ZLWA 3P23A 4EOPA 1ZRZA 4O0VA 5CVHA 4UYNA 3UG1A 4BF2A 3EMGA 1FMKA 4OBPA 1YDSE 3VUIA 3C4EA 3O8TA 5IUGA 3QQHA 3U6HA 3KCFA 2ZVAA 3EQGA 3HVCA 1WAKA 3HA8A 3NYVA 2XANA 4DG2E 3CLYA 3RHXA 2OXDA 4ACDA 4EZ3A 3FV8A 3NFFB 5HD4A 5DEWA 3MA6A 1ZXEA 3BI6A 3KRJA 3EN4A 4OBQA 2EU9A 2CGXA 4X3FA 2JKMA 3FDNA 3HV4A 3PRFA 5CSHA 5CEIA 2UZLA 1XR1A 4XMOA 3UBDA 2X7FA 3B8RA 4ZSGA 4HYUA 5DFPA 1FVRA 4BBEA 4FF8A 4CZUA 4YTFA 3G90X 1NY3A 3ZFXA 2PVLA 4ZSJA 2YIRA 5H2UA 2CKPA 2HXLA 4G2FA 4OGRA 2HIWA 3ZFYA 5HVJA 5AX9A 5EM8A 4YZDA 3UOJA 1ZY5A 4QTBA 3QRUA 5EK7A 5BVFA 5EQYA 3RK9A 1BI7A 2X6EA 2BZIB 3E3BX 2PE0A 3QGYA 4QQCA 4WG4A 3DDPA 4OLIA 4LGDA 2ZV9A 3FQHA 3DBDA 3AGLA 4UWYA 2Y6OA 4BIDA 3F2AA 4JX3A 3MGYA 3EB0A 3OWPA 4GFGA 4ZZOA 4D2RA 3IDBA 3W2RA 5CF5A 3BWFA 3MY5A 5HVYA 3QZFA 4L00A 2UZUE 4ZS0A 3EHAA 3GCQA 3O8UA 4AZVA 5AEPA 1W0XC 3EN5A 3SDJA 4L45A 2Z02A 3DA6A 2CJMA 4GJ2A 3Q4ZA 4I94A 1YXXA 1XKKA 5GIOE 3FWQA 2W1CA 4O81A 5LVNA 5E8SA 4NJ3A 1RE8A 3MFUA 4U44A 4IWQA 3AMBA 3V5PA 3IDPA 4OTGA 4XG2A 2R7IA 3QALE 3O7LD 4RVKA 1YI3A 2YCFA 2O0UA 1MRVA 4M0ZA 5JSMA 5CWZA 1JWHA 3A62A 4CLIA 1WBNA 1B39A 1W7HA 3G5DA 4RT7A 4AZTA 3FJQE 3LJ2A 1Q8TA 5IUIA 3MJ2A 4FIHA 4USEA 2WO6A 1XHAA 2E9NA 3HAMA 3G0FA 2ZM1A 1FINA 3OVVA 3TIYA 4AN3A 4FG7A 4JBVA 5DEYA 4AT3A 2DWBA 3GU4A 4I0RA 4K0YA 4XP3A 4QEBA 4CG8A 4AW2A 4FYNA 4IMYA 3TZMA 4GV1A 4J52A 4D4RA 3FMNA 4ZJVA 2VWIA 4QP8A 2EB3A 4AE6A 1J91A 4MD7E 3NLBA 5M4UA 1VJYA 4F1OA 4OTDA 1HOWA 4ZS4A 2H8HA 4AQKA 4ASEA 4I3ZA 2SRCA 2YDKA 3GU8A 1KE5A 4O7WA 5E8UA 4CV9A 4EOOA 5IA2A 3VHEA 4R7IA 5F20A 4FT5A 3W0MA 3QLGA 5EOLA 3KFAA 3RAKA 2JC6A 1H24A 3HDMA 4QNAA 3TCPA 4BHZA 3ML1A 4LRKA 4PDOA 3MIAA 4GT4A 2VTPA 4I5HA 2Y4PA 5K9IA 4O4FA 5KKRC 2WMTA 4FVRA 3ACJA 3UO5A 5DT4A 2PU8A 4EOJA 1MRYA 3OBGA 5BUJA 2UZTA 3CTQA 3RJCA 3RM7A 4U8ZA 3EFJA 4FMQA 4QQTA 4LGHA 1NVRA 2ITYA 3EQCA 4BC6A 2BHHA 4BWKA 3LAUA 4ENXA 4DH8A 3BU6A 5L8LA 2CNQA 2NRUA 3V6RA 4ZIMA 1JSVA 3D2KA 5GZ8A 3UPZA 1OL5A 3Q6UA 2ETRA 1RQQA 1KV2A 3C7QA 4YJRA 5IDPA 2QLQA 3DKCA 3F3ZA 1ST0A 1XWSA 3QTSA 5IMEA 3QU0A 3QFVA 4QNYA 5BYZA 1ST4A 3CR0A 2VWWA 3E88A 3FXXA 5BMMA 3OXIA 3P7AA 3D83A 4EBVA 5CNOA 2P2HA 4I6FA 5EDRA 1SVEA 2XYUA 2QNJA 2XNPA 4O27B 4UZDA 5LVMA 4BKZA 3DXPA 2ACXA 3KULA 3PVUA 1ZMWA 2WOUA 3A7JA 3SAYA 2HZ4A 2F57A 5L2IA 4NL0A 3W0SA 5LWNA 4EH9A 4IJPA 4XBRA 4YHTA 3T9TA 4I5MA 2J0IA 4A9YA 4AN9A 3ORZA 3D15A 3QQJA 5LVPA 1OUYA 2AUHA 3O71A 4MXCA 1KE7A 1XBBA 4XH6A 2W1ZA 3RAWA 3VW8A 4AP7A 2EXEA 3RK7A 4U79A 3ZM4A 4F7NA 5JFXA 2BIYA 2WPAA 1BI8A 2EVAA 3JYAA 4R1VA 5DI1A 4FNXA 2XF0A 2YCQA 2NNWB 4DT8A 4MXXA 5CQUA 1MQBA 3FC1X 4FYOA 1QPEA 4YJTA 1KE8A 3CC6A 3QKKA 4GK2A 4H05A 3QC4A 5L8KA 4I4EA 3MESA 2W9FB 3F2NA 5AUWA 4EWQA 4W9WA 3LE6A 3BX5A 5EM5A 1H0WA 1OUKA 2NRYA 2C0OA 2PVFA 3H9OA 3HYHA 3NYNA 4UWCA 2X39A 3TTIA 1PMVA 3KRRA 4HNFA 1F5QA 1YI6A 2HZIA 3H0ZA 2QCSA 2W7XA 4JNWA 4HCTA 4ITJA 4KIKB 4UX9A 3VBWA 3VNTA 2XK4A 3HRCA 4FK3A 4ZSLA 3FLSA 3ODYX 3DKFA 3W0RA 1GZOA 3CE3A 4N4SA 5JRSA 2PULA 3NUUA 5I9WA 4YJUA 4F78A 1JLUE 3WZJA 2XZSA 3D5VA 4RIXA 5H8EA 4DEBA 2YZLA 1LR4A 2B53A 5HX8A 4DTKA 5LVOA 1JKTA 5DHJA 1OMWA 4K77A 2YLEA 1OIQA 4TNBA 3NUPA 4AXEA 2VTMA 1O6YA 4I23A 4XV1A 4I41A 4J8NA 2GHLA 3V8WA 4FIIA 5IQDA 4WUNA 5K0XA 5IQAA 2OI4X 3G2FA 5HO7A 3BWJA 2R3OA 3HMIA 4BCFA 3UPXA 1YRPA 3VUTA 2HW6A 2X1NA 4Q9ZA 2JLDA 4JXFA 2PE1A 4FSRA 2FA2A 3DTCA 4Q2AA 1KE6A 5CSWA 3R83A 3GENA 3LJ0A 2XK6A 3VUDA 1XO2B 4FT3A 4YJSA 3MS9A 4C61A 2VZ6A 4JMQA 4JDJA 4FKOA 1PXOA 1XH6A 2P55A 4Q5HA 4I6QA 4WNMA 1U46A 4O21A 4RGJA 4ANBA 3QRKA 4FT7A 3FQEA 4G6OA 2R3RA 3PSBA 2JIUA 2C5NA 4I5PA 4WG5A