5HZNA

Structure of nvp-aew541 in complex with igf-1r kinase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
296
Chain Sequence
AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of a 5-[3-phenyl-(2-cyclic-ether)-methylether]-4-aminopyrrolo[2,3-d]pyrimidine series of IGF-1R inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Insulin-like growth factor 1 receptor
total genus 93
structure length 296
sequence length 304
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hznA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hznA01
2VGOA 2WO6A 2ZM4A 3R1NA 3Q9ZA 5E8UA 1FMOE 5F4NA 3UIMA 5IEYA 3H3CA 4GCJA 3LW0A 4QP7A 3TT0A 5IUGA 2WTKB 3QTUA 3FKNA 3NVMB 1F5QA 4MYGA 2YFXA 4FZFB 3UNZA 3UVRA 4O7VA 2WMRA 2EXMA 2BZIB 2UW9A 3COHA 2IZTA 4RFMA 2BZHB 3GOPA 5CXHA 3EIDA 3W1FA 4Y83A 3EN5A 3FYJX 3VUGA 2YLFA 5AV1A 3R83A 2AC3A 4F9AA 2Y6MA 5KZ0A 5EHYA 5ETCA 2GNFA 4I5HA 4J96A 2QI8A 4QMWA 3UG1A 4B9DA 4X2FA 2DWBA 1Q41A 4G31A 5AAEA 3KRLA 2F2UA 4BDAA 4MD8E 3TKUA 1J3HA 2UW8A 2AUHA 3OD6X 3H4JA 5KNJA 5GJFA 4AT3A 2IW8A 3GCQA 2B0QA 4ZY5A 3HMOA 4QYYA 5C27A 5C9CA 3MFSA 4TYGA 3ZDUA 4TT7A 3TV4A 4XV1A 4ALVA 2A19B 1F0QA 5AP2A 3OWLA 3P0MA 3U8WA 4C61A 3AT2A 5HGIA 4G5JA 4R8QA 2QCSA 3F88A 4DITA 5LARA 3TACA 3F5UA 4M12A 4RRVA 4D2WA 3UP7A 4BDKA 4C7TA 3EN9A 2XBJA 1YXSA 3MB6A 4UMTA 2DUVA 3FKOA 5JKGA 3TZMA 2VTRA 4I24A 1ND4A 5EQYA 1UU7A 4AN2A 3FLWA 3HA6A 2WTDA 2UZLA 3OEZA 4CRSA 3VBTA 4EKLA 3KXZA 3VHKA 4P5ZA 3WYXA 4AOJA 4EOQA 1U4DA 4BHNA 3EN4A 5CAVA 1BI8A 4J97A 4RVMA 4DN5A 2O65A 2W17A 3KRJA 4IAIA 5BNJA 2PYWA 4B8LA 5HQ0A 3FEGA 2ACXA 4B6LA 2W1HA 3AD5A 1DAWA 3Q4ZA 4MH7A 1E9HA 4AGDA 3OCGA 3NPCA 3QQFA 3NZ0A 3VS1A 4EZ7A 2OH4A 3NVKI 4GFMA 4QNYA 3IGGA 2XBAA 2I1MA 5DI1A 3E88A 4XCUA 4F7JA 3U9CA 5ANOA 2ITYA 3BX5A 1TQIA 2XUUA 1UU3A 4JNWA 3FMMA 4IM3A 3D7ZA 3DBQA 3F5GA 3GC8A 5T68A 3SW7A 3OW4A 3L9NA 3MV5A 1PXIA 4FV8A 3A7FA 3LFQA 5K5XA 3BHVA 3EWHA 1NA7A 4XEYA 5A3XA 4E3CA 1ATPE 3FI3A 4I6HA 3MH2A 2VTOA 4JG8A 4KBCA 3NGAA 4AT4A 3LFAA 3ZCLA 4HVDA 3LIJA 3F5XA 4EQUA 2XNPA 2WQOA 4KUJA 4IZ5A 4I3ZA 2ITUA 4GJ2A 3EFWA 3VAPA 1LPUA 3EQCA 4YHJA 4EOIA 4PDOA 3MVMA 2F9GA 4FK3A 4LYNA 4B8MA 4OT5A 4PTGA 4YJVA 4AZTA 5LWNA 4O22A 5HBEA 1CKPA 3IDBA 4M14A 3ZRKA 4F09A 4CG9A 3GU8A 4Q5HA 5HZNA 4GSBA 2BR1A 3OUNB 2XKEA 3PWDA 2BRHA 4IAKA 3ZUVA 4WO5A 3MDYA 5BVOA 4NZWB 3PRFA 4A9UA 3UMXA 3NS9A 3TJDA 5E4HA 1I44A 2J50A 2VTPA 3BV2A 3RI1A 3IOPA 4DEEA 3VRYA 1JSUA 1MRVA 3VUHA 4ZZOA 2X6DA 4QTCA 3FZPA 1FPUA 4C02A 2W4KA 4O0RA 2YDJA 1OKZA 1WVWA 2HELA 3C0IA 3RPSA 4HOKA 1W82A 3RCJA 4AA4A 2RFSA 5CF8A 1JWHA 1KE9A 3A8WA 2C0IA 3Q9YA 4ZS4A 5BX0A 5KMIA 3OWPA 3Q9XA 4AN9A 4V04A 1KV2A 5IQFA 2C5XA 3E64A 5DH3A 4CQGA 3PIXA 2X0GA 5AUWA 3MVHA 3VUKA 3KXGA 4AFEA 4F65A 3VJOA 3UOKA 3AMBA 5EYKA 4AGWA 2C1AA 4FTLA 4MXYA 3PY3A 4WA9A 5HVYA 4RC3A 3ZHPC 2WMAA 4XBRA 3JY9A 4Y85A 4RQVA 2C0OA 5LVNA 1S9JA 5FXSA 4IWQA 3NUPA 4E1ZA 4DEIA 4FT3A 2P3GX 4D9UA 3R7VA 3NSZA 2WEVA 2XA4A 3ZYAA 4P7EA 1H26A 3FXWA 3ZSHA 2VWYA 4YC8A 5H9BA 3PA5A 1H24A 1UU8A 3KK8A 4LI5A 3ZLYA 4H1MA 4ZY6A 4DE4A 4XP0A 5CF4A 5FUTA 4ANNA 1SM2A 5I9XA 4BCQA 4PMPA 5DBXA 4NSTA 3PUPA 3GI3A 3R04A 4TWOA 5EDQA 4C34A 1KV1A 1YVJA 4EWHA 2VTLA 4FKJA 3V8TA 2Y9QA 4LGDA 2JDSA 4DEGA 5IA0A 4G6NA 3UYSA 1PXOA 4X2NA 5IQGA 4APPA 2VTJA 2P0CA 3SV0A 3W2CA 3CTHA 3ZBXA 5E8ZA 5J5TA 3IW8A 5HVJA 4D5HA 3GFWA 3OCBA 3MI9A 3CD3A 5AR2A 3FZRA 2JGZA 1T45A 3ZOSA 1M2PA 5CEKA 4ID7A 3PLSA 3TTIA 2VWVA 3ZBFA 2OJIA 3HMIA 5HIEA 5JT2A 4RJ6A 3C4ZA 4NTSA 2VU3A 4DTKA 5J95A 1PXLA 4IX6A 4K2RA 4MQ2A 2W9FB 3V5LA 2H8HA 1ZAOA 5AUYA 4F0FA 5FXRA 3L9MA 2A0CX 4LRKA 1Q61A 3NIEA 5FBOA 4YC6A 5M55A 1Y6AA 2XK8A 2Q83A 2VTHA 2VX1A 3TZ9A 2QVSE 3EFKA 3EQGA 3PJ3A 4YZCA 3I79A 2HIWA 4L00A 3WARA 4FSUA 3E3PA 2C6IA 2YIRA 4JDJA 1XO2B 3VQHA 1P5EA 3L8PA 4RC4A 4FV4A 5CT7A 5D7AA 5J7BA 5M56A 4YBJA 4HYIA 3Q52A 4M97A 3P1AA 5CNOA 4DBNA 4FVPA 2E9OA 3MH0A 4IVAA 4BBFA 4BCIA 1A48A 2FSLX 4PL5A 2C3LA 3VBWA 3QQHA 5HLPA 5DT0A 4QMZA 5AUXA 3KGAA 3GXLA 2PU8A 4GKIA 3DB8A 4FV6A 4FV0A 4ARKA 2GCDA 4R1VA 4AZVA 5JZJA 2WEIA 3TWJA 3UO6A 3BGQA 2Q0NA 5LQFA 3CP9A 3QWKA 3HV4A 2YLEA 4R7BA 1XH4A 2G2IA 3I1AA 4MEDA 3FLQA 3BWFA 4RX8A 5A4LA 5CI6A 3FZ1A 1WVYA 2BHEA 3LOKA 1MQ4A 4JRNA 5H2UA 4MWHA 3TCPA 3ZO1A 4DFLA 5HVKA 3VUTA 2HZ4A 4RT7A 3Q5IA 4BZOA 3CJFA 5M4FA 4CCBA 4CQEA 5LCJA 1YDRE 3MBLA 1X8BA 3LJ1A 3V8SA 4WKQA 4C36A 4C4EA 4IC8A 2R3QA 2XIYA 2GTMA 4CNHA 3TV6A 4DG2E 1IEPA 1H1WA 5FBNC 3VNTA 3F82A 3DBEA 4PPBA 5KZIA 3LPBA 4O7ZA 3RVGA 4DC2A 4FOCA 4NFNA 4R78A 1VJYA 4FSTA 4E4NA 4YTCA 5L2SA 2QC6A 3C51A 4ITHA 4BWPA 2BHHA 4G17A 3BKBA 3UO5A 3FLYA 2GHGA 4IIRA 5G1XA 4JG6A 4FIFA 4CLIA 4J1RA 4KINA 2BFXA 4RFZA 4ZLZA 3MTFA 1UNHA 3DLZA 4BVUA 1LEWA 3FMNA 3ACJA 4FKIA 5E8TA 4ZIMA 2WTVA 3FKLA 3BBTB 4RA4A 3FYKX 4GH2A 2B4SB 4Y46A 3B2WA 3COMA 1Q4LA 1H25A 4D4VA 1QPDA 4V05A 2PE1A 3WZDA 2HY0A 4GT3A 1XHAA 5AV4A 1SMHA 4YZNA 5A54A 1IAHA 3AGMA 4KABA 3PIYA 5BYYA 1UA2A 3TIZA 4WNMA 2PVLA 2CCIA 4JLCA 3ORLA 4O1OA 5M09A 5CF6A 4EBWA 2BRGA 1BL6A 3LXKA 3PFQA 5BUJA 2E9PA 1F3MC 4EC8A 1JBPE 1U5RA 4RIYA 3ERKA 1ZOGA 4FICA 3DT1A 4CYJA 4FEUA 4GUBA 3TV7A 4CT1A 3MPMA 3NDMA 5DA3A 4ZMFA 3GCVA 3SQQA 3W33A 2W1IA 3DKOA 2BAJA 4CFXA 3GCPA 4ZY4A 2WMUA 2ETKA 4YLKA 2HK5A 4U43A 3S4QA 1XBCA 2OZOA 3G0FA 3ZU7A 4XNEA 3IG7A 3QZFA 4U7ZA 5HD7A 4RWJA 2C0TA 2UZOA 4DEAA 2Y6OA 4GVAA 4HGEA 1G5SA 2RSVA 1VEBA 4H05A 3EL8A 4FT5A 2H96A 4RIWA 2XK6A 4EHZA 3U54A 2PUIA 1GIJA 2I0YA 3KA0A 3ZXZA 3R9NA 3GGFA 4PPCA 4EOLA 3WZEA 4KSQA 4IWPA 1RDQE 4RQKA 4AW2A 2PZRA 1PXMA 4GT4A 1Y6BA 2CNUA 3ULIA 3PE2A 3QZIA 5H8BA 5CEOA 2ZV2A 4AF3A 5A46A 2QURA 4NM5A 2GTNA 4WNOA 3UP2A 3DPKA 5KMNA 3OROA 5JFVA 2C6OA 1PMNA 4QMPA 5AUUA 3Q9WA 2IG7A 3EQHA 4M67A 3FBVA 3DXPA 2C6MA 2VO7A 3FZOA 3JR1A 4MXAA 4ANBA 1DAYA 5LVPA 4DF3A 1NVSA 3QCSA 1QL6A 2IO6A 3PPZA 3EJ1A 3F3ZA 4HYHA 4AWIA 4ZMEA 4EOOA 3OY1A 1M7QA 3UGCA 5CEPA 5FG8A 4AXAA 3QTIA 3AXWA 1Q3DA 3RPYA 2J2IB 3JS2A 4HGTA 4K33A 4Z55A 5M44A 3T3VA 3KCFA 3QXPA 4O0VA 5K4JA 5ANGA 3LKMA 3QRUA 4D2PA 3F6XA 5E90A 3C4XA 5L2IA 3M1SA 5A4EA 4OLIA 2IVTA 4ALUA 2RKUA 3AC5A 5AV3A 2V7OA 3ZO2A 3MFRA 4J53A 2F4JA 3QUPA 3DFAA 3ROYA 1OKWA 2HZ0A 3LFFA 5L8KA 3DK6A 4A06A 3MB7A 2WFYA 3V51A 4KS7A 3N4UA 1PJKA 3HGKA 5C1QB 3R1SA 5BMMA 2IZRA 3LJ0A 4BRXA 5ANDA 3A99A 4U0IA 3ETAA 3DB6A 3I0QA 4RVLA 5BVNA 4FZ7A 1R0PA 2BAKA 2PPQA 5HIBA 4DCAA 3HRFA 3BZ3A 4WSYA 2GU8A 1BYGA 2VTAA 3GBZA 2WMBA 3R8PA 5HX6A 4QTDA 4MNFA 4DFBA 4AZEA 3RAKA 4G9RA 4V0GA 3REPA 4RVKA 4RX5A 2WMQA 2JDTA 2BZJA 3BHUA 4AAAA 2R9SA 3R63A 4U81A 4C58A 5IDNA 2F7XE 1H28A 4BCGA 2NRYA 3QALE 4O0XA 4FUYA 2OIDA 3RNIA 2GHLA 3H0ZA 5IQCA 4O0TA 3QD3A 5A6NA 2GS7A 2WELA 3DDPA 2VO0A 3QAME 4EZ3A 3PLAE 2ZV7A 3AQVA 3PJCA 4MX9A 3FZTA 3LCKA 3Q6WA 4QOXA 4GUEA 4V01A 2CSNA 5FXQA 3D2IA 4CFMA 2EWAA 3GQLA 1P14A 4PNIA 4JS8A 4EUUA 3RHKA 4YNOA 5AA9A 1OIYA 4WUNA 2EXEA 4RX7A 4LL5A 1JKTA 2PE2A 5IQDA 4CMUA 1RW8A 5K9IA 2XJ0A 5FDXA 5BVWA 3E8NA 2UUEA 4D1XA 4CFVA 5AAGA 2B7AA 2EVAA 3O50A 4EORA 1M52A 3KK9A 1H8FA 4CFFA 5AADA 3NUNA 4KKGA 4OTRA 3CR0A 2ITXA 3M42A 4S33A 3UODA 2J9MA 1ZYLA 2XZSA 1IG1A 4JR3A 5DIAA 4QQJA 5A9UA 2W1DA 2XIRA 4L3JA 3QD2B 3HUBA 3QWJA 1QCFA 1WVXA 4AW1A 1PKGA 2WHBA 4IZ7A 4WBBB 4O38A 3TIYA 3VUIA 5JFXA 1HOWA 3IGOA 3ODZX 3ZRMA 5FM2A 5FP5A 4AN3A 2PSQA 2P2HA 4H39A 5BYZA 4PMSA 3SC1A 5M4IA 1Y8GA 1ZYCA 3ORKA 4MNEB 2FYSA 2XH5A 3NYNA 4D0XA 4S32A 3B8QA 1TVOA 3EQRA 5EYMA 5M53A 2X8IA 2OICA 4A9YA 1U5QA 2BIYA 4O0SA 3CY2A 3KB7A 5HI2A 2P55A 3COKA 3OUKA 4RVTA 5E8SA 2X2MA 5FEQA 5D1JA 4OR5A 2SRCA 1M17A 1VZOA 3D5WA 3OT8A 3UQCA 4LRJA 3R01A 2HAKA 4XUFA 3LFEA 5BYLA 4JOAA 4N57A 4FTKA 3R00A 3UDBA 3EH9A 3K3IA 2UW3A 2YCRA 3FQEA 3U87A 2GNIA 4BCMA 4XV3A 4GJ3A 3SRVA 3LVPA 3FDNA 4DFZE 3PDTA 4E5WA 4UEUA 2IJMA 2OW3A 2CGXA 2WQMA 3DTCA 3MVLA 4BF2A 1YOLA 3JXWA 5C01A 1H01A 1Q3WA 2JIVA 4I20A 4O21A 5HICA 4ZLOA 2QOFA 3R02A 4GK2A 4I21A 4M0ZA 3TL8A 4IACA 2PMIA 4ACDA 3EKNA 1WBOA 4YP8A 4G2FA 5HO8A 3PXQA 3PRIA 2EB3A 4DA5A 5L6WL 1Q8YA 4FSYA 5KMKA 2XRWA 3ZFYA 3QX4A 5FM3A 4U45A 3QTXA 3OFMA 5AMNA 1Q99A 5E7RA 4ALWA 3RWPA 4E4XA 3TJCA 3SD0A 3CTJA 2J0JA 4CKIA 4NEUA 4LG4A 4RSSA 2OK1A 3GC0A 2J0KA 3R22A 3R2YA 1PYEA 3SDJA 2YZAA 3CY3A 3DZQA 4XG4A 2KULA 5JFWA 3G0EA 2RF9A 3HECA 5CASA 1H4LA 4APCA 4F9CA 5K0KA 5IU2A 4XOYA 4NYEA 2GQGA 5CSXA 4I94A 3ZSIA 2PUUA 3UVQA 3DK7A 4CVAA 2C69A 2ITNA 3FZSA 4L8MA 2YN8A 3UC4A 4KKHA 4M13A 3POOA 4F7NA 2HCKA 2QR7A 4RLKA 4OTGA 4CRLA 5F9EA 4TYIA 5M06A 2OO8X 3PXKA 2WU6A 5GIOE 4PY1A 2HWOA 4FV3A 5IA4A 2XNEA 4G3FA 1V0BA 3MTLA 5IQAA 1UVRA 3MYGA 5E1SA 4U3YA 2CPKE 2BZKB 5AIRA 2O63A 3MVJA 4TNDA 3LMHA 3WBLA 5HEZA 3ZZEA 2OJ9A 5JH6A 5TOZA 2V5QA 1QPEA 4C62A 4UX9A 1URWA 1ZYSA 2Y0AA 4W8EA 1Y91A 1CKIA 4LOPA 1Z5MA 2CKPA 4UXLA 1UNLA 1IA9A 3P78A 4UWCA 5AAFA 3OMVA 3RZFA 1E1XA 4XHKB 2GQRA 4E6DA 3Q4TA 3C4CA 4WNPA 5K3YA 5HNGA 4A4XA 3WF7A 4QRCA 1BMKA 5EM8A 4K18A 2PUPA 1PHKA 4IWDA 3S0OA 2BILB 3RZBA 1IAJA 3A4PA 4AT5A 4C33A 2I7QA 2I6LA 2QO9A 4OTQA 4DFNA 4E73A 4BWXA 3PVBA 1J91A 1I09A 2OU7A 4FKQA 4HVIA 3PG3A 4DFXE 3UBDA 3I4BA 3QZGA 4GIHA 2XB7A 1DI8A 5ANJA 3BLHA 2F2CB 5AP5A 4O0YA 2G01A 3G2FA 1MUOA 2G2HA 2OH0E 3E7OA 1PMEA 4FF8A 4RJ7A 4U40A 3ZC6A 3RNYA 4S2ZA 4O81A 4UMUA 2DS1A 4IB1A 4Z7HA 3LQ3A 2VWBA 4BFMA 4EONA 1IRKA 3NUSA 5CSHA 2CN8A 2WTIA 4BKYA 2FSTX 2EXCX 4QO9A 2NO3A 3VUMA 1RJBA 4YZBA 4CCUA 5IZFA 4IX3A 3K2LA 3LLAA 4LL0A 4EC9A 4OBQA 2W5BA 2FSOX 4AQCA 2YIQA 5ETAA 5C4LA 5DEWA 5DEYA 3W8LA 1Y8YA 2W1FA 5BPYA 2C6TA 5HCZA 3V6SA 2CNVA 3OG7A 5HE2A 3R9DA 4F6UA 4ZLYA 4W8DA 3QF9A 5IH6A 3OXTA 4YO4A 3PA4A 3QFVA 5CU2A 3KVXA 5HU9A 3KU2A 4EWQA 1BUHA 5EKNA 5FD2A 5FWKK 4ACMA 3RCDA 4EHEA 4O7SA 2UZWE 1YOMA 2QKRA 3D5XA 3FHIA 4G34A 1OB3A 5JGDA 2QG7A 5JFSA 5ANKA 3AT4A 3HA8A 3R2BA 1O6KA 4FMQA 5H8EA 3OVVA 3ZEWA 4D2VA 5JMSA 5HO7A 3RALA 5C8KA 3OZ6A 5KMOA 5LXMA 3AC3A 2HWPA 3HMMA 5D11A 3UIUA 2CKOA 5BVDA 1FGKA 5EM6A 2EU9A 3ENMA 1YKRA 4IWOA 4WT6A 5HCYA 1PY5A 3I7BA 3MSSA 1M14A 3QA8A 3VS0A 3A7IA 3AD6A 4DINA 4RWKA 4JX7A 4F63A 3UQGA 5EM5A 1GOLA 2C3KA 4TN6A 2BPMA 3ZXTA 2R3JA 3O96A 1Q62A 4FV9A 4FX3A 5IQIA 3CGOA 4AZSA 3NUUA 3R8VA 5DFPA 4IVBA 3W2RA 3EQFA 5J9YA 3TUBA 2UZVA 3PP1A 3OHTA 1SVGA 4H3QA 4A9RA 1AQ1A 2B9IA 3G15A 3UVPA 1DI9A 3DLSA 2XVDA 3I5NA 1PXJA 3GUBA 3V04A 3KRXA 2QODA 2UZNA 3UJGA 4QNAA 2H6DA 3OTUA 4ZSGA 4XOZA 5E91A 2DQ7X 4W4XA 4EQMA 4G6LA 2O0UA 4DAWA 3CJGA 3KRWA 3ZSGA 3KN5A 1QMZA 2X4FA 4A07A 4E8AA 3R73A 3ALNA 2UW7A 2FO0A 3LHJA 5IA5A 4BDCA 4WRSA 2Z8CA 4FYOA 5ACKA 2C6KA 2O64A 5CLPA 4QMYA 3KMUA 3QQUA 3VC4A 4IZYA 4L67A 4F1TA 2KTYA 3HZTA 1YWRA 3G33A 3DY7A 2QOCA 3QA0A 4R7HA 3DNDA 4BDEA 4ERWA 4Y5HA 1PF8A 2C30A 5GINE 3EL7A 3SW4A 4U41A 2JDVA 4BIEA 4KBAA 4FTUA 1KWPA 4QPSA 5J7HA 1FOTA 3L1SA 3FE3A 4Y8DA 2Z7RA 3O0GA 3L8XA 4GS6A 4B99A 3LMGA 5EW8A 2QONA 4XMOA 4F1MA 5ITAA 4M8TA 4MF1A 3E5AA 4XRJA 4E4LA 4E20A 4QP2A 3VWAA 2YM5A 3ANRA 2OIQA 5D12A 2QO2A 4JQ8A 4YTHA 3VBVA 1ZOHA 4HYUA 3L9LA 4TL0A 2I0HA 1K9AA 4L7FA 2X81A 4ZOGA 3QTSA 4GYIA 5DPVA 3IDCA 4RPVA 1OI9A 2E2BA 3QCYA 1O6YA 1NT2A 3FL5A 3UIXA 4IB3A 4TWCA 4FSZA 3HDNA 1REJA 1CMKE 3OF0A 3R0TA 2EB2A 1HCKA 4C0TA 2RGPA 3HV7A 2VTNA 4D4YA 5JEBA 1T46A 4UZDA 3W10A 4WG3A 2V62A 3BYUA 5E9EA 1V0PA 3IO7A 5M4UA 2XYNA 2X2KA 4Y95A 2BRMA 2FGIA 4U6RA 2RG6A 4AE9A 4HPTE 2QOOA 3ULZA 3PXFA 2VO3A 4FTRA 3VF8A 2VX3A 4WHZA 1YHSA 2J90A 3M2WA 3DGKA 4E6AA 3F3TA 5EW9A 3QXOA 4JG7A 2ITOA 3NEWA 4KSPA 4PF4A 3RP9A 4R1YA 4IEBA 4RIXB 3R7OA 1SNXA 3SG8A 3FY2A 5J79A 5AP0A 4USFA 5TE0A 2W96B 4C3RA 4I22A 4IDVA 1ZY4A 5DR2A 4LUEA 4BZDA 4DGLC 1KUTA 4O7LA 2W5AA 5AP4A 2HXLA 4IANA 3QL8A 1K3AA 4JDHA 2OJGA 2XJ1A 4IM2A 2YAAA 4XP3A 2XIKA 3N4TA 3ROCA 5F95A 5M08A 1PW2A 2XKCA 2VO6A 2Z7QA 3IECA 3LCOA 3L8SA 4QYEA 4YC3A 4NW5A 2PVMA 5DMZA 5AP6A 4EQCA 2PZ5A 4FTIA 4BDHA 5LJJA 3QGWA 1XBBA 2ZB1A 2AYPA 4EH8A 2YCSA 4L7SA 1K2PA 3PJ8A 2HYYA 2Y8OA 4MBIA 4M84A 2OXXA 4E93A 4NM0A 2ONLC 5KBQA 4L43A 2NRUA 2OJJA 2OXYA 1MRUA 4IQ6A 5BVKA 4RJ4A 4RJ3A 5EKOA 3P9JA 3CBLA 2H34A 3DTWA 4CSVA 4DH3A 4BCJA 1OIUA 3UOLA 3OP5A 4UWBA 3E7VA 4AFJA 2WU7A 2DYLA 5JQ5A 5CQUA 3CQUA 2WNTA 4L53A 1UKHA 5BVEA 5GZAA 3WIGA 1GZ8A 3N51A 5CS6A 2PVKA 2B55A 4DEBA 1WBPA 1EH4A 2B54A 3QD4A 2ESMA 1W7HA 2WQBA 4RLLA 3I0OA 4WBOA 4CV9A 2Y4IC 5CAUA 3HRBA 1A9UA 4EYJA 4F99A 5CVHA 2ZDUA 3KXNA 4JDKA 3ZMMA 4CLJA 2W7XA 3E92A 4Q9SA 2PMOX 2BMCA 3BGPA 4J8NA 3U9NA 4CZTA 4YJUA 1KOBA 3FUPA 5EI2A 4MD9E 5I3RA 4JI9A 2ERZE 5HESA 3VRZA 4BI0A 4FOBA 3OXIA 1CTPE 2BUJA 3CXWA 4I1ZA 5FTGA 2VV9A 4C2VA 3KY2A 3KC3A 3EQBA 2OJFE 4YSMA 1YXUA 1U46A 1OL7A 2JKQA 2YACA 4F7SA 4J71A 4CKRA 2JITA 5LVOA 3KXXA 1JSTA 2C6LA 3D0EA 3F5PA 4QP9A 4F9WA 2JIIA 4IBMA 4TRLA 3NAYA 2PZPA 4II5A 3RK7A 4QPMA 4I5CA 3EQDA 4JJRA 4ZEGA 1G3NA 3A7GA 3BYVA 4JT3A 3UC3A 4ZZNA 4O84A 3PP0A 4GFGA 1CDKA 3SVVA 5FRIA 3C1XA 2GHMA 4FTJA 1YI4A 2VTIA 4MHAA 2OZAA 4RIOA 4EOSA 4MNEA 5HG9A 2IZSA 3RINA 4GKHA 3PY0A 3KEXA 4AE6A 5HNIX 5HBJA 3BEAA 1BLXA 2GFCA 3TTJA 2QQ7A 3SOAA 2BALA 3R8UA 3VULA 4EKKA 1ZYJA 2YERA 3GCUA 4GMYA 4S30A 3LE6A 2PY3A 4NM3A 1H27A 2IVSA 4FC0A 5KX8A 4NKSA 4PL3A 4YTIA 4D2SA 5HU3A 5CX9A 3KRRA 5KBRA 3ANQA 3GC9A 1STCE 5EW3A 5AR3A 3R8ZA 5AR7A 4USEA 4L44A 3EN7A 4FIJA 2JKMA 1MQBA 5DRBA 3R9OA 4E26A 4ZTMA 3S3IA 3WF8A 2A2AA 5LVMA 2Z60A 4XLIA 4C4HA 4R3PA 4DH7A 2HENA 1J1CA 2XM9A 3AT3A 3VIDA 2G2FA 1OKVA 1OUYA 3SKCA 2PWLA 3KREA 3CKWA 2X2LA 2B53A 3RPRA 4EK3A 2VTMA 4FTOA 3TG1A 3EQIA 3DK3A 4O0WA 2E9NA 5G6VA 3C4EA 5AX9A 4A7CA 2OG8A 2R0UA 3DJ7A 4DH8A 4F0GA 2YHVA 2W4OA 3BE9A 4JBOA 2JDOA 3RM7A 4HJOA 4IJPA 3FC1X 4K6ZA 2PULA 2F49A 3II5A 1RE8A 4FIGA 2YDIA 4FKLA 3RJCA 3LCDA 5B2LA 3DKFA 4UY9A 1NW1A 3R7UA 3RAWA 3PVGA 4P90A 1OL5A 1OL2A 4BTKA 4NIFB 3BPRA 4JX3A 3UZPA 2JBPA 4XP2A 2G9XA 4FI1A 5I3OA 5I9UA 2VTSA 4BCOA 2R3MA 3BIZA 5BUEA 1NXKA 5IA3A 1JQHA 4TYEA 1Q8TA 5FP6A 3PSCA 3R28A 4YZDA 5JZNA 4BIDA 3K3JA 4X7QA 1W84A 2BTRA 3FLNC 1PMUA 1CM8A 4QP1A 4O7NA 1V1KA 3BYOA 3GT8A 3UZTA 2EUFB 2WXVA 4WIHA 5I9WA 4EHGA 5HLNA 1PYXA 3MPAA 3QUDA 4X3FB 4PTCA 2CHLA 4C37A 2UZBA 2XNMA 3UMWA 3P79A 4D1ZA 3P7AA 1LP4A 1ZOEA 1P4OA 3PXYA 3TNQB 4R5SA 3P23A 2HOGA 1XH9A 4FGBA 1YW2A 2Q0BA 2YISA 1BX6A 5DN3A 4ASDA 1U59A 3FPMA 2GS6A 4FUXA 4ZXTA 4AUAA 4BICA 4EK8A 2PVJA 4YUQA 3A7JA 3BELA 2P33A 3E3BX 3O51A 3TNHA 4CMOA 4F64A 5I9ZA 5CENA 4BGGA 4I6BA 3BLRA 3D83A 3BHYA 3VF9A 4HVSA 5GIPE 1WBVA 3DQWA 3DXQA 1GIHA 4RMZA 1PRYA 4BYJA 1UKIA 5TO8A 3PZHA 5I9YA 2RL5A 2XKDA 2GFSA 3FY0A 3NIZA 2ZMDA 4QMSA 3ZFXA 1G8AA 4IE9A 4RFYA 1FINA 4RIWB 2BDJA 2XNOA 4C2WA 4FL1A 3ATSA 4I0RA 3CSVA 2XNGA 1GZOA 3FXZA 5JK3A 3SGCA 1OIRA 5I9VA 1Q8ZA 2JAMA 2ZJWA 2XEYA 3V6RA 1J7IA 4X3JA 3QHRA 3ZRLA 3TKIA 1OL1A 4R6VA 2LAVA 4CGAA 5L4QA 3PE1A 3VBQA 4XG2A 1XH7A 4ZJVA 2CKEA 3FMKA 1XH8A 3LQ5A 2GS2A 4ITJA 5CVFA 4IH8A 2WKMA 5HG8A 5L6OA 1OPJA 2IPXA 4F6SA 2VTQA 4FKUA 5CXZA 3ZUUA 5FDPA 3K54A 4PP7A 2O3PA 2JC6A 2PVYA 5AUVA 3QQKA 4BTMA 4YR8A 3DBCA 4UV0A 5IDPA 5KO1A 2WZJA 3FHRA 3ZUTA 1O9UA 2QOKA 4AP7A 3DNEA 4IC7A 4MF0A 2PMLX 3HMNA 3O71A 1OPLA 2WOTA 4NFMA 1H0WA 2GNJA 3DV3A 3BEGA 4FT9A 3S95A 2A4LA 3IPHA 4R7IA 4FT0A 3F9NA 4U3ZA 3RGFA 3SA0A 3NCZA 3THBA 4UB7A 3ZFMA 3ZONA 3UPZA 1BKXA 1GZKA 2VUWA 3G9NA 4G3CA 4G6OA 4OTDA 4WG5A 3RBWA 3Q53A 4Q5EA 3LM0A 3G90X 5LMKC 2OFUA 4XRLA 3BHHA 3OW3A 4EJ7A 3VO3A 4BTJA 3CC6A 3R1YA 1Y57A 4Q9ZA 2XP2A 4FBXA 3QD0A 2FUMA 4TYHA 5BVFA 4EOJA 5KKRB 4DTAA 3CS9A 3RM6A 4TKSA 3EZVA 4CKJA 2X7GA 1KOAA 3WZKA 1U54A 3QCXA 1JKLA 5DHJA 4MBLA 5GZ8A 2YM8A 3MA6A 4L68A 3T3UA 2H9VA 2YM3A 2VWUA 1GAGA 4FNXA 3TI1A 5JSMA 3R71A 3MFTA 4M68A 4I41A 5CANA 4R77A 4C4JA 4RWLA 3P7BA 4FIIA 3RKBA 3K5UA 4M15A 4M69A 5M07A 4JQEA 3V5JA 3SX9A 1B38A 2BVAA 2R64A 2VD5A 3QUEA 3VS7A 5AEPA 2GPHA 3NUAA 3AC2A 4YJTA 3DCVA 4ZTNA 4H3BA 4EJNA 3E93A 2V0DA 2WTKC 4MAOA 2RFEA 2XF0A 4E6QA 4IDTA 4CXAA 1R0EA 3D7TB 2QOQA 5CQWA 4ORKA 3VW6A 4J98A 4G3GA 3MH1A 4CZUA 2XRUA 4D2TA 3DDQA 4YU2A 4TWNA 5BMSA 2F7EE 2REIA 3OS3A 3I60A 5FEEA 5CVGA 5M51A 2CNQA 3Q2JA 4QMVA 2JEDA 3MY5A 4YJSA 5D10A 4JQ7A 4YO6A 2J0MB 2C6DA 5CEQA 4FIEA 3C0HA 3D4QA 2Y4IB 3MFUA 5HNBA 4F7LA 4YMJA 2BRNA 3BHTA 4YZMA 4FSMA 4ZTRA 3R9HA 1V0OA 1XWSA 4DT8A 5KE0A 1FMKA 3L8VA 4FKGA 2Y4PA 2WGJA 1YDTE 4EH7A 3KCKA 3GU4A 4X2KA 3TZ7A 3ZLWA 2V7AA 5E8YA 2WAJA 3MJ2A 2V55A 3FMDA 4FKTA 3W16A 4O82A 3JY0A 4MQ1A 2UZEA 4KWPA 3ZH8A 4QMXA 5H3QA 3D94A 3RMFA 3ORPA 4ZTQA 1J1BA 5CT0A 5D7VA 3VBXA 3FMJA 4ONAA 4ASEA 3QQJA 1FVVA 4FVRA 3H30A 4HNFA 4FODA 4XG7A 5CAPA 1OPKA 3OWJA 2IN6A 5AIKA 1CKJA 4K1BA 3DJ6A 2XIXA 5L3AA 3IOKA 2OLCA 3NYOA 5AA8A 2XMYA 2YA9A 4NK9A 3NNUA 3Q04A 4O7RA 4D4RA 2QOLA 3SRVB 3UE4A 4YJPA 1XBAA 4FZAB 4Z9LA 4J52A 2QHMA 3F61A 4XH6A 2GNGA 5HLWA 3WOWA 4LOQA 3RTPA 2WMSA 5KMMA 3UZRA 4OTHA 4EH3A 5HD4A 4KA3A 3SOCA 2ZMCA 2GMXA 3FLZA 2IVUA 4F08A 4NT4A 5JN2A 5K0XA 4RC2A 5HIDA 1KSWA 2WTWA 3ORZA 4RJ8A 5TT7A 4EI4A 2C5YA 3WYYA 4CG8A 3KFAA 2PK9A 3QRJA 2W4JA 1H0VA 2XK3A 3S1HA 3AMYA 1LUFA 2X4ZA 4U79A 4YTFA 2ITWA 5IEVA 3QZHA 4DTBA 3GU6A 4AX8A 4BKJA 4CFWA 5KMJA 3MY1A 3RHXA 4CFUA 4RZVA 2XK9A 4FV2A 3P5KA 4QPAA 3HVCA 2IZUA 2ZAZA 3TN8A 1OMWA 1URCA 4QMOA 2OI4X 3OCSA 3JVSA 4XG6A 2RFDA 4FG9A 5HBHA 1E1VA 4D9TA 4H36A 3O8PA 4QMQA 4LV5A 2I0VA 4UWYA 5EH0A 2UW6A 4P4CA 2JDRA 1WBSA 2ETRA 3H10A 5I4NA 2W1ZA 3PXRA 3FJQE 1KE5A 4MWIA 3OY3A 3OT3A 2P2IA 3HV6A 4ZP5A 2UVYA 2O5KA 4ZK5A 3QGYA 5EFQA 4H3PA 5HG5A 1LR4A 3M11A 2I40A 2WQNA 3PVWA 3Q4CA 4GK4A 5E8WA 3WF6A 4PRJA 3OC1A 4EOKA 3ORMA 2ZV9A 4G3DA 5AR5A 3EOCA 4JR7A 4PPAA 1ZMVA 3ZZWA 4DYMA 1APME 4MKCA 1YOJA 1JNKA 3AG9A 3I6WA 2QLUA 3DU8A 1R78A 1VYWA 3C4WA 4C38A 4KIKB 4D4SA 1P4FA 5BUIA 3F2AA 3O7LB 2R3IA 3GU7A 3IK3A 3EFLA 5EI8A 3I81A 3QRTA 5F94A 4ZZMA 3BE2A 3WZUA 4D0WA 3EYHA 3MW1A 4M7IA 4D58A 3NW7A 4HZSA 4IHPA 1GY3A 1WZYA 4KRDA 2WQEA 5CZHA 4ASXA 4DGGA 5KCVA 2FSMX 2E9VA 3TXOA 1QPJA 3ORXA 4GG5A 3DA6A 2ZV8A 3H0YA 3QRKA 4FVQA 3VW8A 3PIZA 3EHAA 5AP3A 5CSWA 4CD0A 5T3QA 3ATTA 2BIKB 4FNZA 5KHXA 4A9TA 3O8TA 5AJQA 4ANMA 4DCEA 5HO6A 4RG0A 4YLJA 5J8IA 4O6LA 2CGVA 3TZ8A 3H9FA 3F3UA 3F69A 2JFLA 4AA5A 3C7QA 4IFGA 3W32A 3AC1A 3FWQA 3AC4A 4AA0A 2X9EA 2C68A 2PZYA 3A8XA 4I5PA 3MIAA 4LQMA 3G5DA 4ENYA 4YZ9A 5DR9A 1WAKA 4BYIA 4BCPA 4AZWA 2VWXA 3AOXA 1GZNA 2UZDA 4JIAA 4EBVA 3HLLA 4PNKA 1GJOA 4CEGA 2B9JA 1PMVA 3W2OA 4QMTA 4JL9A 4DHFA 4QTBA 3GENA 2W05A 4Y73A 4AZFA 4UN0C 4ANSA 4CTCA 3GNIB 2PHKA 3WF9A 4FKWA 5DR6A 5IMEA 3C9WA 3PXZA 2R7BA 1Q8UA 3HDMA 2WPAA 3F7ZA 4PQNA 4OW8A 2PVNA 3IKAA 3FAAA 4LOOA 4QT1A 5CU3A 5E8XA 2XYUA 4JBVA 4AU8A 3A7HA 3G51A 4H1JA 3A60A 4I92A 2P4IA 3PTGA 4O7TA 3F3WA 4O91A 4OTIA 3KULB 4HGSA 2B1PA 2X7OA 2YIXA 3DXNA 4NCTA 4NJDA 3TNIA 1ZXEA 4MXOA 2XNNA 2PL0A 4NU1A 2ZVAA 3D2KA 1W83A 4TYJA 1YWNA 3A2CA 5CNNA 3AD4A 4FL3A 4BBEA 3BYMA 4FV5A 2C47A 5E1EA 4LFIA 2G1TA 4MK0A 5IG1A 4YPDA 3NW6A 2G15A 5ANEA 3SHEA 1KE6A 4FEWA 3KN6A 4FKSA 3UTOA 4B4LA 4YHFA 2VRXA 4TWPA 2JBOA 1FQ1B 5FTOA 3RPOA 4EOPA 4EL9A 5CYIA 4QMLA 5I5ZA 4X2JA 1CSNA 3NNVA 5HORA 4R5YA 4OTWA 3NYVA 4FE2A 5JRSA 3V5QA 2VNWA 2R3HA 4HNIA 3ZM9A 4I4EA 3GC7A 3JVRA 4NJ3A 4XLVA 3C5UA 1JKKA 4K9YA 5EK7A 3AGLA 3LFDA 3BQRA 4O83A 2OKRA 3CQEA 5ANIA 2JIUA 2YJSA 3ZO3A 2ZB0A 4O0UA 4DFYA 5HTCA 2QR8A 5HX8A 3CQWA 2XS0A 2CLXA 2OFVA 4IAAA 3W2QA 4YHTA 5CI7A 1B39A 3OOGA 5LCKA 5CSPA 2J6MA 3HNGA 3CLYA 1OUKA 2PVRA 4DFUA 3FSFA 4D1SA 5HE3A 5GZ9A 3IONA 2YITA 5IKWA 3QC4A 4BCFA 2C4GA 5C4KA 3DZOA 5AUTA 1JSVA 4L42A 3HRCA 2YZLA 4ZSLA 4U9AA 3ELJA 4NIFA 4B0GA 1P2AA 4F70A 2BTSA 3GB2A 4OUCA 4Y72A 3U6IA 3O17A 3TEIA 3UIBA 3WILA 4IXPA 1UWJA 4J95A 2J51A 4JBPA 4EH6A 4ACHA 3KXHA 4TY1A 4FG7A 2IW9A 3A61A 5DE2A 2VN9A 3IW4A 3IS5A 1Q8WA 2WMTA 3PY1A 3Q32A 3POZA 1J7UA 5HCXA 3O2MA 3GOKA 3U6JA 5ICPA 4HW7A 4GVJA 1Q24A 3HMPA 1YDSE 4GFOA 5LMAA 3DOGA 3QX2A 4AW5A 1H1QA 3GFEA 4ANQA 3QYZA 3KF7A 2ITVA 3QBNA 3V3VA 4IFCA 5B7VA 2YAKA 5LVLA 1MP8A 1H1RA 2RIOA 4FTMA 4I6FA 4FZDB 4MBJA 4BIBA 4U42A 3U6HA 4DT9A 3IW7A 2BAQA 3NYXA 5CU4A 3NNXA 5HE0A 3E8CA 4BCHA 3ZC5A 1OBDA 4E6CA 2CKQA 1QPCA 1WFCA 5AM6A 3FQHA 4W9XA 1IASA 2IW6A 4QTEA 3D15A 5DLSA 3OBJA 1TKIA 3TNPC 4ZSEA 1G8SA 2C5OA 4P5QA 5IH4A 4K8AA 2CGUA 3KF4A 4Z16A 3HV5A 4O7WA 2UW4A 2X39A 4BTFA 5IA2A 2CN5A 1W98A 4X0MA 1ZY5A 3VS5A 5KHWA 5FEDA 3ZLXA 4IAFA 2ITPA 5FGKA 5IA1A 4NH1A 4E4MA 4H58A 1O6LA 4HVHA 4FEXA 4GEOA 4J8MA 3LAUA 5CY3A 2HW6A 4GG7A 1FGIA 3ORNA 3Q6UA 4HCUA 2ETMA 3IW5A 3B2TA 2C3IB 5GNKA 4BI1A 3E8EA 4NM7A 4QYFA 3TM0A 3FI8A 4GV1A 2YM6A 1REKA 4PDSA 2B9HA 3U4UA 5DYJA 4IMYA 4LV8A 3P86A 4YPSA 4FG8A 3DKGA 2R3LA 3P08A 2Y7JA 3IDPA 4FSQA 4IVDA 4N0SA 3ZO4A 4FEVA 3CPBA 5AV2A 3UOJA 4MCVA 2WMXA 4OAUC 1YWVA 3BWJA 4LUDA 4O27B 3ITZA 4XS2A 3WIKA 3FXXA 4TZRA 4D28A 1FBNA 1OIQA 5IH5A 3TUCA 3JUHA 3OTVA 4M3QA 5JRQA 3BU6A 3VUDA 1YI3A 4IB0A 5IQBA 3UNKA 2VWIA 3B8RA 5D41A 4N6YA 5GJDA 2RFNA 3FL4A 4ANLA 4C4FA 4BN1A 4M66A 1ZMUA 2B9FA 4UMQA 1NY3A 2A1AB 3P4KA 3MPTA 4DLJA 5EDRA 2R7IA 3CPCA 3MGYA 3CTQA 4BGQA 1WMKA 4U44A 1UNGA 2QO7A 4M69B 3CE3A 1ZYDA 1SYKA 1YXTA 4GL9A 5FQDC 3QHWA 4FTAA 3WZJA 4C4IA 5B2MA 4CZYB 4RZWA 3EMGA 4X3FC 4CV8A 4XJ0A 2QOBA 2C3JA 5M4CA 1U54B 4XX9A 5AFVA 4ACGA 4JRVA 1YHVA 1A06A 5HTBA 1VR2A 4G3EA 5L2TA 4GW8A 1W8CA 3HEGA 4G9CA 4R3RA 4S31A 4EYMA 2F7ZE 1OECA 3NMUF 2PUNA 1UV5A 3OXZA 4TW9A 4WUAA 5CEMA 1UWHA 3CKXA 3FC2A 3QC9A 4ZJIA 5LMKA 1H08A 3NRMA 3MY0A 2X8DA 3ENHA 1TQPA 5K5NA 4O6EA 1LEZA 2BDFA 2CDZA 4GIIA 4NWMA 3RK5A 2FH9A 2PZIA 3BBWA 3V01A 5CWZA 5J87A 1XH6A 3Q5ZA 4PMTA 4RIXA 2RG5A 4UZHA 3HX4A 4OT6A 3FSKA 2BKZA 3VS3A 4ZTHA 4L9IA 2R3NA 1PXPA 3E8DA 1PXNA 3IW6A 4G16A 4A4LA 2X6EA 3QQGA 3E62A 2ZOQA 3FI4A 3IQ7A 4FKOA 4LGHA 5EI6A 5TKDA 3W2SA 1IA8A 5DG5A 4L45A 4F9YA 2ZM3A 3HKOA 3OCTA 2JKKA 4L3LA 4PL4A 3FPQA 3W18A 4TYHB 4IB5A 4E5AX 2JKOA 4KIKA 3I5ZA 3NUXA 4IAYA 3VVHA 3VBYA 4JAIA 5HTIA 4QP4A 3OBGA 4DGMA 2GSFA 4QMUA 5FTQA 4J7BA 4OTFA 1M2QA 3QU0A 4HCVA 4WRGA 4L3PA 4IZAA 1UU9A 5B0XA 3CEKA 5A6OA 5HHWA 5IEXA 3ZDIA 2R3GA 4BB4A 5CAOA 4MXZA 2Z7LA 2BRBA 3JPVA 4USDA 1L8TA 1OVEA 4HGLA 4FA2A 5DGZA 2GNLA 2YIYA 4CFNA 1KE8A 4HVGA 5IQHA 4RX9A 5AX3A 1ZZLA 2F57A 3R7EA 3SXSA 4C57A 3COIA 3GU5A 3NAXA 4JAJA 5EG3A 1ZWSA 3Q4UA 3ZS5A 4DG3E 3BV3A 2YJRA 1XJDA 2XM8A 1ERKA 2X1NA 1JAMA 3ODYX 3DBFA 4E5BA 2NNWB 3BI6A 5LMBA 5IUIA 3W55A 1OZ1A 3DFCB 4LRMA 4GK3A 4GT5A 4DGNA 1KE7A 3FQSA 3QTQA 3MIYA 2OZAB 1ZLTA 4HYSA 4JBQA 4PMMA 4ANOA 2I0EA 3C50A 4BDFA 2HY81 4NTTA 2X7FA 3DAEA 4EK6A 4F1OA 4UMPA 3TDWA 2AC5A 2YDKA 2VWZA 2OBJA 3NWWA 4TXCA 4ZSJA 4B7TA 3QQLA 5EQEA 4UALA 4FKPA 4QQ5A 4M0YA 5AV0A 4ASZA 3VS6A 1WCCA 5J1VA 4EH2A 3SG9A 5A4CA 3T9TA 3PG1A 4KAOA 4BKZA 4C4GA 3LFNA 3C5IA 3S00A 3PPJA 4ZS0A 4FYNA 2J0IA 4AG8A 4BGHA 1DS5A 2VX0A 4EZ5A 4EK5A 4I0TA 3UNJA 1SNUA 2C5NA 4FV1A 4FTQA 2JD5A 4IX5A 4EH5A 2UW5A 1OITA 1S9IA 2VZ6A 4I6QA 3E63A 3HP2A 3ID6C 2QNJA 5L8JA 4XG9A 3G9LX 2PVFA 4AGUA 1JKSA 3BLQA 3LZBA 3QKKA 3UYTA 4ZAUA 2W99B 4ZTSA 4U97A 3NR9A 5IF1A 2BDWA 3RPVA 3KULA 4IAZA 2GQSA 3KKVA 2ITZA 5DNRA 1RQQA 2LGCA 4FV7A 4FT7A 2BKKA 4HZRA 4QYGA 2R4BA 4KIQA 5CZIA 5L6PA 2BFYA 4XV2A 1H1SA 3AMAA 5AM7A 5L2QA 3TKHA 3D14A 2YEXA 4DEHA 4O86A 4XG8A 1JPAA 3ZEPA 3MH3A 4FL2A 4FKRA 2W0JA 3QKLA 3EKKA 4FSWA 5F20A 1Q97A 2Z2WA 3EYGA 3F7WA 3U51A 3P7CA 2QG5A 5AR8A 4D5KA 5IQEA 3QRIA 5TR6A 3QLGA 2WTJA 3EFJA 3QTRA 2Z7SA 2OF4A 4D55A 2QKWB 4IJ9A 5ETFA 1M2RA 2X8EA 2JFMA 5AWMA 4PWNA 4AOTA 1BL7A 4KS8A 3PSBA 4L46A 4LM5A 4NW6A 2CLQA 4DEDA 2YM4A 5EDPA 1R1WA 4O2ZA 1NVRA 2C5VA 3ORIA 3LFSA 2IWIA 4G1WA 4QQTA 4I0SA 4C35A 4UXQA 3BCEA 4XV9A 4IVCA 4O2PA 3PJ1A 1OL6A 3F66A 4WNKA 4FSRA 3MESA 5HE1A 5JGAA 4YLLA 3H9RA 4W4YA 4BL1A 4IW0A 1TQMA 2XNBA 4JDIA 4YSJA 2YWPA 5IPJA 2PVHA 1AD5A 4S34A 1PKDA 2UZTA 4ERKA 4DH1A 4HPUE 1MRYA 3R7YA 4RIYB 4YNEA 3R30A 2VAGA 3R1QA 2J7TA 5H8GA 3RAHA 3TDVA 5DOSA 3UO4A 4GU6A 4X6QC 3LFBA 3HAMA 3O23A 5DVRA 3U55A 3EB0A 4HCTA 3EZRA 1L3RE 1W0XC 4AW0A 1DM2A 4QP6A 4DH5A 3BQCA 5IUHA 4OAVB 3SXRA 3O8UA 4N6ZA 4X2GA 2HW7A 3ORTA 4X21A 5J9ZA 3C0GA 1FVTA 2QLQA 3PWYA 3VHEA 4U8ZA 2YM7A 4MTAA 4QD6A 2UW0A 3OEFX 3WE8A 3VJNA 1H1PA 2QU6A 3VQUA 2WMWA 3F3VA 3NCGA 5CAQA 5CSVA 4BR3A 4BHZA 2Z02A 3MN3A 3O7LD 4QTAA 4Q2AA 1SVHA 3UQFA 3FMEA 3TUDA 4TNBA 4FGRA 3V5WA 3ZLSA 3G6GA 2FA2A 3R8LA 3CCNA 4AS0A 3I7CA 1ZZ2A 4NUSA 4OBPA 5J5SA 2A27A 4RA5A 2R3PA 3NNWA 5BQ0A 1R39A 4EH4A 4O7YA 2W5HA 3D5UA 5ACBC 4BI2A 2J5FA 3FMHA 4L52A 4U80A 4LGGA 1NVQA 2OIBA 4KIOA 3N4VA 4W4WA 3V5TA 4L6QA 3VN9A 4DLIA 2JAVA 2QU5A 4BDBA 3ET7A 3MWUA 4O1PA 4UYAA 5D9HA 3V8WA 2CGWA 1VYZA 4IM0A 5DRDA 4YURA 4NCTC 1OKYA 2ITQA 3JYAA 3C13A 4G5PA 5C8MA 3QLFA 1Z9XA 3LXPA 3RAIA 2HZNA 1GIIA 2J5EA 3ACKA 3HV3A 3F2RA 3CD8A 3GEQA 1WBTA 5A4TA 1OBGA 1XQZA 3N9XA 5LOHA 1YI6A 2XIZA 4FSNA 4C8BA 4PX6A 5B2KA 1WBWA 4BWKA 3QTZA 4NKAA 4ZTLA 4C3FA 3D9VA 4BY9E 2FB8A 3EN6A 3LXNA 5AP1A 3WI6A 5KUPA 1FVRA 1HCLA 1SZMA 3LJ2A 4A9SA 3S2PA 4DG0E 3GCSA 3PJ2A 2J4ZA 4I5MA 5L8LA 3R6XA 2ERKA 3LXLA 3Q3BA 3KXMA 4K77A 2JLDA 1JLUE 4OTPA 5ETIA 4KKEA 2OSCA 5EOLA 2UVXA 3Q2MA 5T6KA 1WBNA 2WB8A 2BCJA 3DKCA 2XJ2A 3OWKA 2QD9A 3VS2A 2OWBA 5CU0A 4N4SA 2GDOA 5A14A 1YRPA 4MD7E 4QP8A 5DWRA 2YCFA 2R3OA 4GU9A 4EH9A 4YJQA 4FTTA 4P2KA 3DQXA 4PTEA 5M57A 4F6WA 3QTWA 1AGWA 4EHVA 2VWWA 4BDIA 4RBLA 4I23A 2W1CA 5CTPA 4DGOA 3CIKA 1XKKA 4YBKA 5CU6A 4C59A 2R3FA 4MVFA 2R2PA 3BU5A 4BZNA 4C3PA 4E7WA 1Q5KA 5TF9A 4KNBA 3L9PA 1R3CA 4KIPA 4EK4A 1YXVA 4QYHA 1JVPP 4QQCA 5EOBA 3QCQA 4CYIA 3FI2A 4N70A 2V22A 5KKRC 3NW5A 2YWVA 5EYDA 3H9OA 2FVDA 3SLSA 2CMWA 5GHVA 2WIHA 3DAKA 3GQIA 3SXFA 4JVGA 4I4FA 2R3KA 3G6HA 4L01A 4TTHB 3ZM4A 5J9LA 4RJ5A 3TNWA 3LLTA 4RWIA 3DJ5A 3KL8A 4UYNA 4V0GB 5EHOA 3WF5A 4ACCA 4BBMA 1H00A 1XH5A 2QOIA 4FZ6A 3DAJA 3F2NA 2W1EA 1SVEA 4AOIA 3QYWA 4QP3A 3ZTXA 2C6EA 1YHWA 3BYSA 3R7IA 3GVUA 3NUYA 4R3CA 5FLFA 4O96A 2CJMA 2XK7A 5AP7A 4NL0A 3PSDA 3UOHA 2UV2A 4ITIA 3T9IA 5C26A 5JQ8A 2NPQA 3R8MA 3LFCA 2YABA 2XK4A 1PXKA 3GP0A 3U4WA 2XEZA 3LCTA 2WMVA 4FTCA 2ITTA 2WIPA 4YJNA 5E92A 3MA3A 3RWQA 4FTNA 4CTBA 4KRCA 4Z7GA 3AC8A 3CGFA 3MJ1A 4BCKA 3HYHA 2XKFA 1M7NA 4GYGA 4W9WA 4KD1A 1XR1A 4UBAA 3BGZA 4K0YA 4WSQA 2W9ZB 2WD1A 4F4PA 2GNHA 4U5JA 4WG4A 2PTKA 3C4FA 3FV8A 4FNWA 3HAVA 2CCHA 4XBUA 4BDDA 4PUZA 2WTCA 5EYCA 4QMNA 5CALA 5F1ZA 3BRBA 1Z57A 4FNYA 2C1BA 2ZM1A 2IVVA 3PZEA 2OXDA 1ZRZA 2QHNA 2R3RA 2YCQA 5DT4A 4CMTA 4BC6A 5CF5A 3BU3A 4ZSAA 3KMWA 3R21A 3RK9A 2UVZA 2ZYBA 1BI7A 2HZIA 4MXCA 3VS4A 1YXXA 4LMUA 4FKVA 5I0BA 5L2WA 5E8VA 3KQ7A 5C03A 3EQPA 4YJRA 3PA3A 3LMIA 5HOAA 4PDPA 2B52A 2X9FA 2OF2A 4JXFA 4K11A 5CEIA 1JOWB 3OOMA 2PMNX 3FLSA 3R9RA 4WOVA 4EEVA 3W2PA 3NLBA 2NP8A 4FK6A 3MS9A 3QKMA 3DS6A 3PYYA 4JIKA 1ZMWA 4WD5A 3SAYA 2W1GA 3Q96A 3HUCA 2O2UA 4LMNA 3LCSA 3PVUA 5GJGA 3WE4A 3D5VA 4TPTA 1H07A 3PPKA 3T8OA 3UPXA 3FMLA 4KBKA 3Q60A 4XYFA 3HL7A 4GRBA 5HKMA 4DBXA 3KMMA 4QMMA 5AUZA 2QOHA 4AACA 4UMRA 4AGCA 4BCNA 4CT2A 4D2RA 3A62A 4PV0A 4Z3VA 4IX4A 2ONLA 2OGVA 5JGBA 4W4VA 4RGJA 3V5PA 3NX8A 2UZUE 4F9BA 4KB8A 5AR4A 3R7GA 5HG7A 4X3FA 5EQPA 3A4OX 4ZJJA 4FEQA 5C8NA 4XG3A 2O8YA 5EM7A 2J0LA 5A4QA 4FR4A 5IISA 3LM5A 5K4IA 2VTTA 1GNGA 3W8QA 4BDGA 2WOUA 4A4OA 5LWMA 3K5VA 1ZARA 4YJOA 5EHLA 4BDJA 4F0IA 3D7TA 1OM1A 1YQJA 1J7LA 2W06A 3UG2A 4ENXA 4FIHA 1B6CB 4PDYA 4EUTA 2YIWA 3I6UA 4X6RA 5IMXA 5DT3A 5J1WA 4I93A 2VNYA 3DBDA 4YGAA 2XCHA 3ALOA 2R5TA 4OBOA 4PP9A 4MXXA 2HXQA 3E87A 1OGUA 2E9UA 3KVWA 3LQ8A 4IADA 4EOMA 4OGRA 5KMLA 2BROA 2VGPA 4Y5QA 3HP5A 2PE0A 1IR3A 2XCKA 2ZDTA 4J99A 2R0IA
chains in the Genus database with same CATH superfamily
2VGOA 2WO6A 2ZM4A 3R1NA 3Q9ZA 5E8UA 4FRFA 1FMOE 5F4NA 3UIMA 5IEYA 3H3CA 4GCJA 3LW0A 4QP7A 3TT0A 4AXCA 5IUGA 2WTKB 3QTUA 3FKNA 3NVMB 1F5QA 4MYGA 2YFXA 4FZFB 3UNZA 3UVRA 4O7VA 2WMRA 2EXMA 2BZIB 2UW9A 3COHA 2IZTA 4RFMA 2BZHB 3GOPA 5CXHA 3EIDA 3W1FA 4Y83A 3EN5A 3FYJX 3VUGA 2YLFA 5AV1A 3R83A 2AC3A 4F9AA 2Y6MA 5KZ0A 5EHYA 5ETCA 2GNFA 4I5HA 4J96A 2QI8A 4QMWA 3UG1A 4B9DA 4X2FA 2DWBA 1Q41A 4G31A 5AAEA 3KRLA 2F2UA 4BDAA 4MD8E 3TKUA 1J3HA 1OGYA 2UW8A 2AUHA 2XARA 3OD6X 3H4JA 5KNJA 4LDTA 5GJFA 4AT3A 2IW8A 3GCQA 2B0QA 4ZY5A 3HMOA 4QYYA 5C27A 5C9CA 3MFSA 4TYGA 3ZDUA 4TT7A 3TV4A 4XV1A 4ALVA 2A19B 1F0QA 5AP2A 3OWLA 3P0MA 3U8WA 4C61A 3AT2A 5HGIA 4G5JA 4R8QA 2QCSA 3F88A 4DITA 5LARA 3TACA 3F5UA 4M12A 4RRVA 4D2WA 3UP7A 4BDKA 4C7TA 3BL9A 3EN9A 2XBJA 1YXSA 3MB6A 4UMTA 2DUVA 3FKOA 5JKGA 3TZMA 2VTRA 4I24A 1ND4A 5EQYA 1UU7A 4AN2A 3FLWA 3HA6A 2WTDA 2UZLA 3OEZA 4CRSA 3VBTA 4EKLA 3KXZA 3VHKA 4P5ZA 3WYXA 4AOJA 4EOQA 1U4DA 4BHNA 2IF8A 3EN4A 1BI8A 4J97A 4RVMA 4DN5A 2O65A 2W17A 3KRJA 4IAIA 5BNJA 2PYWA 4B8LA 5HQ0A 3FEGA 2ACXA 4B6LA 2W1HA 3AD5A 1DAWA 3Q4ZA 4MH7A 1E9HA 4AGDA 3OCGA 3NPCA 3QQFA 3NZ0A 3VS1A 4EZ7A 2OH4A 3NVKI 4GFMA 4QNYA 3AKJA 3IGGA 2XBAA 2I1MA 5DI1A 3E88A 4XCUA 4F7JA 3U9CA 5ANOA 2ITYA 3BX5A 1TQIA 2XUUA 1UU3A 4JNWA 3FMMA 4IM3A 3D7ZA 3DBQA 3F5GA 3GC8A 5T68A 3SW7A 3OW4A 3L9NA 3MV5A 1PXIA 4FV8A 3A7FA 3LFQA 5K5XA 3BHVA 3EWHA 1NA7A 4XEYA 5A3XA 4E3CA 1ATPE 3FI3A 4I6HA 3MH2A 2VTOA 4JG8A 4KBCA 3NGAA 4AT4A 3LFAA 3ZCLA 4HVDA 3LIJA 3F5XA 4EQUA 2XNPA 2WQOA 4KUJA 4IZ5A 4I3ZA 2ITUA 4GJ2A 3EFWA 3VAPA 1LPUA 3EQCA 4YHJA 4EOIA 4PDOA 3MVMA 2F9GA 4FK3A 4LYNA 5BV3A 4B8MA 4OT5A 4PTGA 4YJVA 4AZTA 5LWNA 4O22A 5HBEA 1CKPA 3IDBA 4M14A 3ZRKA 4F09A 4CG9A 3GU8A 4Q5HA 5HZNA 4GSBA 2BR1A 3OUNB 2XKEA 3PWDA 2BRHA 4IAKA 3ZUVA 4WO5A 3MDYA 5BVOA 4NZWB 3PRFA 4A9UA 3UMXA 3NS9A 3TJDA 5E4HA 1I44A 2J50A 2VTPA 3BV2A 3RI1A 3IOPA 4DEEA 3VRYA 1JSUA 1MRVA 3VUHA 4ZZOA 2X6DA 4QTCA 3FZPA 1FPUA 4C02A 2W4KA 4O0RA 2YDJA 1OKZA 1WVWA 2HELA 3C0IA 3RPSA 4HOKA 1W82A 3RCJA 4AA4A 2RFSA 5CF8A 1JWHA 1KE9A 3A8WA 2C0IA 3Q9YA 3TYKA 4ZS4A 5BX0A 5KMIA 3OWPA 3Q9XA 4AN9A 4V04A 4AXFA 1KV2A 5IQFA 2C5XA 4O4EA 3E64A 5DH3A 4CQGA 3PIXA 2X0GA 5AUWA 3MVHA 3VUKA 3KXGA 4AFEA 4F65A 3VJOA 3UOKA 3AMBA 5EYKA 4AGWA 2C1AA 4FTLA 4MXYA 3PY3A 4WA9A 5HVYA 4RC3A 3ZHPC 2WMAA 4XBRA 3JY9A 4Y85A 4RQVA 2C0OA 5LVNA 1S9JA 5FXSA 4IWQA 3NUPA 4E1ZA 4DEIA 4FT3A 2P3GX 4D9UA 3R7VA 3NSZA 2WEVA 2XA4A 3ZYAA 4P7EA 1H26A 3FXWA 3ZSHA 2VWYA 4YC8A 5H9BA 4FJVA 3PA5A 1H24A 1UU8A 3KK8A 4LI5A 3ZLYA 4H1MA 4ZY6A 4DE4A 4XP0A 5CF4A 5FUTA 4ANNA 1SM2A 5I9XA 4BCQA 4PMPA 5DBXA 4NSTA 3PUPA 3GI3A 3R04A 4TWOA 5EDQA 4C34A 1KV1A 1YVJA 4EWHA 2VTLA 4FKJA 3V8TA 2Y9QA 4LGDA 2JDSA 4DEGA 5IA0A 4G6NA 3UYSA 1PXOA 4X2NA 5IQGA 4APPA 2VTJA 2P0CA 3SV0A 3W2CA 3CTHA 3O5AA 3ZBXA 5E8ZA 5J5TA 3IW8A 5HVJA 4D5HA 3GFWA 3OCBA 3MI9A 3CD3A 5AR2A 3FZRA 2JGZA 1T45A 3ZOSA 1M2PA 5CEKA 4ID7A 3PLSA 3TTIA 2VWVA 3ZBFA 2OJIA 3HMIA 5HIEA 5JT2A 4RJ6A 3C4ZA 4NTSA 2VU3A 4DTKA 5J95A 1PXLA 4IX6A 4K2RA 4MQ2A 2W9FB 3V5LA 2H8HA 1ZAOA 5AUYA 4F0FA 5FXRA 3L9MA 2A0CX 4LRKA 1Q61A 3NIEA 5FBOA 4YC6A 5M55A 1Y6AA 2XK8A 2Q83A 2VTHA 2VX1A 3TZ9A 2QVSE 3EFKA 3EQGA 3PJ3A 4YZCA 3I79A 2HIWA 4L00A 3WARA 4FSUA 3E3PA 2C6IA 2YIRA 4JDJA 1XO2B 3VQHA 1P5EA 3L8PA 4RC4A 4FV4A 5CT7A 5D7AA 5J7BA 5M56A 4YBJA 4HYIA 5CAVA 3Q52A 4M97A 3P1AA 5CNOA 4DBNA 4FVPA 2E9OA 3MH0A 4IVAA 4BBFA 4BCIA 1A48A 1G8KA 2FSLX 4PL5A 2C3LA 4O4DA 3VBWA 3QQHA 5HLPA 5DT0A 4QMZA 5AUXA 3KGAA 3GXLA 2PU8A 4GKIA 3DB8A 4FV6A 4FV0A 4ARKA 2GCDA 4R1VA 4AZVA 5JZJA 2WEIA 3TWJA 3UO6A 3BGQA 2Q0NA 5LQFA 3CP9A 3QWKA 3HV4A 2YLEA 4R7BA 1XH4A 2G2IA 3I1AA 4MEDA 3FLQA 3BWFA 4RX8A 5A4LA 5CI6A 3FZ1A 1WVYA 2BHEA 3LOKA 1MQ4A 4JRNA 5H2UA 4MWHA 3TCPA 3ZO1A 4DFLA 5HVKA 3VUTA 2HZ4A 4RT7A 3Q5IA 4BZOA 3CJFA 5M4FA 4CCBA 4CQEA 5LCJA 1YDRE 2A98A 3MBLA 1X8BA 3LJ1A 3V8SA 4WKQA 4C36A 4C4EA 4IC8A 2R3QA 2XIYA 2GTMA 4CNHA 3TV6A 4DG2E 1IEPA 1H1WA 5FBNC 3VNTA 3F82A 3DBEA 4PPBA 5KZIA 3LPBA 4O7ZA 3RVGA 4DC2A 4FOCA 4NFNA 4R78A 1VJYA 4FSTA 4E4NA 4YTCA 5L2SA 2QC6A 3C51A 4ITHA 4BWPA 2BHHA 4G17A 3BKBA 3UO5A 3FLYA 2GHGA 4IIRA 5G1XA 4JG6A 4FIFA 4CLIA 4J1RA 4KINA 2BFXA 4RFZA 4ZLZA 3MTFA 1UNHA 3DLZA 4BVUA 1LEWA 3FMNA 3ACJA 4FKIA 5E8TA 4ZIMA 3UDTA 2WTVA 3FKLA 3BBTB 4RA4A 3FYKX 4GH2A 2B4SB 4Y46A 3B2WA 3COMA 1Q4LA 1H25A 4D4VA 1QPDA 4V05A 2PE1A 3WZDA 2HY0A 4GT3A 1XHAA 5AV4A 1SMHA 4YZNA 5A54A 1IAHA 4JMQA 3AGMA 4KABA 3PIYA 5BYYA 1UA2A 3TIZA 4WNMA 2PVLA 2CCIA 4JLCA 3ORLA 4O1OA 5M09A 5CF6A 4EBWA 2BRGA 1BL6A 3LXKA 3PFQA 5BUJA 2E9PA 1F3MC 4EC8A 1JBPE 1U5RA 4RIYA 3ERKA 1ZOGA 4FICA 3DT1A 4CYJA 4FEUA 4GUBA 3TV7A 4CT1A 3MPMA 3NDMA 5DA3A 4ZMFA 3GCVA 3SQQA 3W33A 2W1IA 3DKOA 2BAJA 4CFXA 3GCPA 4ZY4A 2WMUA 2ETKA 4YLKA 4MUQA 2HK5A 4U43A 3S4QA 1XBCA 2OZOA 3G0FA 3ZU7A 4XNEA 3IG7A 3QZFA 4U7ZA 5HD7A 4RWJA 2C0TA 2UZOA 4DEAA 2Y6OA 4GVAA 4HGEA 1G5SA 2RSVA 1VEBA 4H05A 3EL8A 4FT5A 2H96A 4RIWA 2XK6A 4EHZA 3U54A 2PUIA 1GIJA 2I0YA 3KA0A 3ZXZA 3R9NA 3GGFA 4PPCA 4EOLA 3WZEA 4KSQA 4IWPA 1RDQE 4RQKA 4AW2A 2PZRA 1PXMA 4GT4A 1Y6BA 2CNUA 3ULIA 3PE2A 3QZIA 5H8BA 5CEOA 2ZV2A 4AF3A 5A46A 2QURA 4NM5A 2GTNA 4WNOA 3UP2A 3DPKA 5KMNA 3OROA 5JFVA 2C6OA 1PMNA 4QMPA 5AUUA 3Q9WA 2IG7A 3EQHA 4M67A 3FBVA 3AKLA 3DXPA 2C6MA 2VO7A 3FZOA 3JR1A 4MXAA 4ANBA 1DAYA 5LVPA 4DF3A 1NVSA 3QCSA 1QL6A 2IO6A 3PPZA 3EJ1A 3F3ZA 4HYHA 4AWIA 4ZMEA 4EOOA 3OY1A 1M7QA 3UGCA 5CEPA 5FG8A 4AXAA 3QTIA 3AXWA 1Q3DA 3RPYA 2J2IB 3JS2A 4HGTA 4K33A 4Z55A 5M44A 3T3VA 3KCFA 3QXPA 4O0VA 5K4JA 5ANGA 3LKMA 3QRUA 4D2PA 3F6XA 5E90A 3C4XA 5L2IA 3M1SA 5A4EA 4OLIA 2IVTA 4ALUA 2RKUA 3AC5A 5AV3A 2V7OA 3ZO2A 3MFRA 4J53A 2F4JA 3QUPA 3DFAA 3ROYA 1OKWA 2HZ0A 3LFFA 5L8KA 3DK6A 4A06A 3MB7A 2WFYA 3V51A 4KS7A 3N4UA 1PJKA 3HGKA 5C1QB 3R1SA 5BMMA 2IZRA 3LJ0A 4BRXA 5ANDA 3A99A 4U0IA 3ETAA 3DB6A 3I0QA 4RVLA 5BVNA 4FZ7A 1R0PA 2BAKA 2PPQA 5HIBA 4DCAA 3HRFA 3BZ3A 4WSYA 2GU8A 1BYGA 2VTAA 3GBZA 2WMBA 3R8PA 5HX6A 4QTDA 4MNFA 4DFBA 4AZEA 3RAKA 4G9RA 4V0GA 3REPA 4RVKA 4RX5A 1G8JA 2WMQA 2JDTA 2BZJA 3BHUA 4AAAA 2R9SA 3R63A 4U81A 4C58A 5IDNA 2F7XE 1H28A 4BCGA 2NRYA 3QALE 4O0XA 4FUYA 2OIDA 3RNIA 2GHLA 3H0ZA 5IQCA 4O0TA 3QD3A 5A6NA 2GS7A 2WELA 3DDPA 2VO0A 3QAME 4EZ3A 3PLAE 2ZV7A 3AQVA 3PJCA 4MX9A 3FZTA 3LCKA 3Q6WA 4QOXA 4GUEA 4V01A 2CSNA 5FXQA 3D2IA 2ZFYA 4LV7A 4CFMA 2EWAA 3GQLA 1P14A 4PNIA 4JS8A 4EUUA 3RHKA 4YNOA 5AA9A 1OIYA 4WUNA 2EXEA 4RX7A 4LL5A 1JKTA 2PE2A 5IQDA 4CMUA 4AQKA 1RW8A 5K9IA 2XJ0A 5FDXA 5BVWA 3E8NA 2UUEA 4D1XA 4CFVA 5AAGA 2B7AA 2EVAA 3O50A 4EORA 1M52A 3KK9A 1H8FA 4CFFA 5AADA 3NUNA 4KKGA 4OTRA 3CR0A 2ITXA 3M42A 4S33A 3UODA 3NFFB 2J9MA 1ZYLA 2XZSA 1IG1A 4JR3A 5DIAA 4QQJA 5A9UA 2W1DA 2XIRA 4L3JA 3QD2B 3HUBA 3QWJA 1QCFA 1WVXA 4AW1A 1PKGA 2WHBA 4IZ7A 4WBBB 4O38A 3TIYA 3VUIA 5JFXA 1HOWA 3IGOA 3ODZX 3ZRMA 5FM2A 5FP5A 4AN3A 2PSQA 2P2HA 4H39A 5BYZA 4PMSA 3SC1A 5M4IA 1Y8GA 1ZYCA 3ORKA 4MNEB 2FYSA 2XH5A 3NYNA 2X0PA 4D0XA 4S32A 3B8QA 1TVOA 3EQRA 5EYMA 5M53A 2X8IA 2OICA 4A9YA 1U5QA 2BIYA 4O0SA 3CY2A 3KB7A 5HI2A 2P55A 3COKA 3OUKA 4RVTA 5E8SA 2X2MA 5FEQA 5D1JA 4OR5A 2SRCA 1M17A 1VZOA 3D5WA 3OT8A 3UQCA 4LRJA 3R01A 2HAKA 4XUFA 3LFEA 4I6LA 4JOAA 5BYLA 4N57A 4FTKA 3R00A 3UDBA 3EH9A 3K3IA 2UW3A 2YCRA 3FQEA 3U87A 2GNIA 4BCMA 4XV3A 4GJ3A 3SRVA 3LVPA 3FDNA 4DFZE 3PDTA 4E5WA 4UEUA 2IJMA 2OW3A 2CGXA 2WQMA 3DTCA 3MVLA 4BF2A 1YOLA 3JXWA 5C01A 1H01A 1Q3WA 2JIVA 4I20A 4O21A 5HICA 4ZLOA 2QOFA 3R02A 4GK2A 4I21A 4M0ZA 3TL8A 4IACA 2PMIA 4ACDA 3EKNA 1WBOA 4YP8A 4G2FA 5HO8A 3PXQA 3PRIA 2EB3A 4DA5A 5L6WL 1Q8YA 4FSYA 5KMKA 2XRWA 3ZFYA 3QX4A 5FM3A 4U45A 3QTXA 3OFMA 5AMNA 1Q99A 5E7RA 4ALWA 3RWPA 4E4XA 3TJCA 3SD0A 3CTJA 2J0JA 4CKIA 4NEUA 4LG4A 4RSSA 2OK1A 3GC0A 2J0KA 3R22A 3R2YA 1PYEA 3SDJA 2YZAA 3CY3A 3DZQA 4XG4A 2KULA 5JFWA 3G0EA 2RF9A 3HECA 4O4CA 5CASA 1H4LA 4APCA 4F9CA 5K0KA 5IU2A 4XOYA 4NYEA 2GQGA 5CSXA 4I94A 3ZSIA 2PUUA 3UVQA 3DK7A 4CVAA 2C69A 2ITNA 3FZSA 4L8MA 2YN8A 3UC4A 4KKHA 4M13A 3POOA 4F7NA 2HCKA 2QR7A 4RLKA 4OTGA 4CRLA 5F9EA 4TYIA 5M06A 2OO8X 3PXKA 2WU6A 5GIOE 4PY1A 2HWOA 4FV3A 5IA4A 2XNEA 4G3FA 1V0BA 3MTLA 5IQAA 1UVRA 3MYGA 5E1SA 4U3YA 2CPKE 2BZKB 5AIRA 2O63A 3MVJA 4TNDA 3LMHA 3WBLA 5HEZA 3ZZEA 2OJ9A 5JH6A 5TOZA 2V5QA 1QPEA 4C62A 4UX9A 1URWA 1ZYSA 2Y0AA 4W8EA 1Y91A 1CKIA 4LOPA 1Z5MA 2CKPA 4UXLA 1UNLA 1IA9A 3P78A 4UWCA 5AAFA 3OMVA 3RZFA 1E1XA 4XHKB 2GQRA 4E6DA 3Q4TA 3C4CA 4WNPA 5K3YA 5HNGA 4A4XA 3WF7A 4QRCA 1BMKA 5EM8A 4K18A 2PUPA 1PHKA 4IWDA 3S0OA 2BILB 3RZBA 1IAJA 3A4PA 4AT5A 4C33A 2I7QA 2I6LA 2QO9A 4OTQA 4DFNA 4E73A 4BWXA 3PVBA 1J91A 1I09A 2OU7A 4FKQA 4HVIA 3PG3A 4DFXE 3UBDA 3I4BA 3QZGA 4GIHA 2XB7A 1DI8A 3P5JC 5ANJA 3BLHA 2F2CB 5AP5A 4O0YA 2G01A 3G2FA 1MUOA 2G2HA 2OH0E 3E7OA 1PMEA 4FF8A 4RJ7A 4U40A 3ZC6A 3RNYA 4S2ZA 4O81A 4UMUA 2DS1A 4IB1A 4Z7HA 3LQ3A 2VWBA 4BFMA 4EONA 1IRKA 3NUSA 5CSHA 2CN8A 2WTIA 4BKYA 2FSTX 2EXCX 4QO9A 2NO3A 3VUMA 1RJBA 4YZBA 4CCUA 5IZFA 4IX3A 3K2LA 3LLAA 4LL0A 4EC9A 4OBQA 2W5BA 2FSOX 4AQCA 2YIQA 5ETAA 5C4LA 5DEWA 5DEYA 3W8LA 1Y8YA 2W1FA 5BPYA 2C6TA 5HCZA 3V6SA 2CNVA 4QDVA 3OG7A 5HE2A 3R9DA 4F6UA 4ZLYA 4W8DA 3QF9A 5IH6A 3OXTA 4YO4A 3PA4A 3QFVA 5CU2A 3KVXA 5HU9A 3KU2A 4EWQA 1BUHA 5EKNA 5FD2A 5FWKK 1W2CA 3RCDA 4ACMA 4EHEA 4O7SA 2UZWE 1YOMA 2QKRA 3D5XA 3FHIA 4G34A 1OB3A 5JGDA 2QG7A 5JFSA 5ANKA 3AT4A 3HA8A 3R2BA 1O6KA 4FMQA 5H8EA 3OVVA 3ZEWA 4D2VA 5JMSA 5HO7A 3RALA 5C8KA 3OZ6A 5KMOA 5LXMA 3AC3A 2HWPA 3HMMA 5D11A 3UIUA 2CKOA 5BVDA 1FGKA 5EM6A 2EU9A 3ENMA 1YKRA 4IWOA 4WT6A 5HCYA 1PY5A 3I7BA 3MSSA 1M14A 3QA8A 3VS0A 3A7IA 3AD6A 4DINA 4RWKA 4JX7A 4F63A 3UQGA 5EM5A 1GOLA 2C3KA 4TN6A 2BPMA 3ZXTA 2R3JA 3O96A 1Q62A 4FV9A 4FX3A 5IQIA 3CGOA 4AZSA 3NUUA 3R8VA 5DFPA 4IVBA 3W2RA 3EQFA 5J9YA 3TUBA 2UZVA 3PP1A 3OHTA 1SVGA 4H3QA 4A9RA 1AQ1A 2B9IA 3G15A 3UVPA 1DI9A 3DLSA 2XVDA 3UDSA 3I5NA 1PXJA 3GUBA 3V04A 3KRXA 2QODA 2UZNA 3UJGA 4QNAA 2H6DA 3OTUA 4ZSGA 4XOZA 5E91A 2DQ7X 4W4XA 4EQMA 4G6LA 2O0UA 4DAWA 3CJGA 3KRWA 3ZSGA 3KN5A 1QMZA 2X4FA 4A07A 4E8AA 3R73A 3ALNA 2UW7A 2FO0A 3LHJA 5IA5A 4BDCA 4WRSA 2Z8CA 4FYOA 5ACKA 2C6KA 2O64A 5CLPA 4QMYA 3KMUA 3QQUA 3VC4A 4IZYA 4L67A 4F1TA 2KTYA 3HZTA 1YWRA 3G33A 3DY7A 2QOCA 3QA0A 4R7HA 3DNDA 4BDEA 4ERWA 4Y5HA 1PF8A 2C30A 5GINE 3EL7A 3SW4A 4U41A 2JDVA 4BIEA 4KBAA 4FTUA 1KWPA 4QPSA 5J7HA 1FOTA 3L1SA 3FE3A 4Y8DA 2Z7RA 3O0GA 3L8XA 4GS6A 4B99A 3LMGA 5EW8A 2QONA 4XMOA 4F1MA 5ITAA 4M8TA 4MF1A 3E5AA 4XRJA 4E4LA 4E20A 4QP2A 3VWAA 2YM5A 3ANRA 2OIQA 5D12A 2QO2A 4JQ8A 4YTHA 3VBVA 1ZOHA 4HYUA 3L9LA 4TL0A 2I0HA 1K9AA 4L7FA 2X81A 4ZOGA 3QTSA 4GYIA 5DPVA 3IDCA 4RPVA 1OI9A 2E2BA 3QCYA 1O6YA 1NT2A 3FL5A 3UIXA 4IB3A 4TWCA 4FSZA 3HDNA 1REJA 1CMKE 3OF0A 3R0TA 2EB2A 1HCKA 4C0TA 2RGPA 3HV7A 2VTNA 4D4YA 5JEBA 1T46A 4DHIB 4UZDA 3W10A 4WG3A 2V62A 3BYUA 5E9EA 1V0PA 3IO7A 5M4UA 4BJJB 2XYNA 2X2KA 4Y95A 2BRMA 2FGIA 4U6RA 2RG6A 4AE9A 4HPTE 2QOOA 3ULZA 3PXFA 2VO3A 4FTRA 3VF8A 2VX3A 4WHZA 1YHSA 2J90A 3M2WA 3DGKA 4E6AA 3F3TA 5EW9A 3QXOA 4JG7A 2ITOA 3NEWA 4KSPA 4PF4A 3RP9A 4R1YA 4IEBA 4RIXB 3R7OA 1SNXA 3SG8A 3FY2A 5J79A 5AP0A 4USFA 5TE0A 2W96B 4C3RA 4I22A 4IDVA 1ZY4A 5DR2A 4LUEA 4BZDA 4DGLC 1KUTA 4O7LA 2W5AA 5AP4A 2HXLA 4IANA 3QL8A 1K3AA 4JDHA 2OJGA 2XJ1A 4IM2A 2YAAA 4O4FA 4XP3A 2XIKA 3N4TA 3ROCA 5F95A 5M08A 1PW2A 2XKCA 2VO6A 2Z7QA 3IECA 3LCOA 3L8SA 4QYEA 4YC3A 4NW5A 2PVMA 5DMZA 5AP6A 4EQCA 2PZ5A 4FTIA 4BDHA 5LJJA 3QGWA 1XBBA 2ZB1A 2AYPA 4EH8A 2YCSA 4L7SA 1K2PA 3PJ8A 2HYYA 2Y8OA 4MBIA 4M84A 2OXXA 4E93A 4NM0A 2ONLC 5KBQA 4L43A 2NRUA 2OJJA 2OXYA 1MRUA 4IQ6A 5BVKA 4RJ4A 4RJ3A 5EKOA 3P9JA 3CBLA 2H34A 3DTWA 4CSVA 4DH3A 4BCJA 1OIUA 3UOLA 3OP5A 4UWBA 3E7VA 4AFJA 2WU7A 2DYLA 5JQ5A 5CQUA 3CQUA 2WNTA 4L53A 1UKHA 5BVEA 5GZAA 3WIGA 1GZ8A 3N51A 5CS6A 2PVKA 2B55A 4DEBA 1WBPA 1EH4A 2B54A 3QD4A 2ESMA 1W7HA 2WQBA 4RLLA 3I0OA 4WBOA 4CV9A 2Y4IC 5CAUA 3HRBA 1A9UA 4EYJA 4F99A 5CVHA 2ZDUA 3KXNA 4JDKA 3ZMMA 4CLJA 2W7XA 2XAMA 3E92A 4Q9SA 2PMOX 2BMCA 3BGPA 4J8NA 3U9NA 4CZTA 4YJUA 1KOBA 3FUPA 5EI2A 4MD9E 5I3RA 4JI9A 2ERZE 5HESA 3VRZA 4BI0A 4FOBA 3OXIA 1CTPE 2BUJA 3CXWA 4I1ZA 5FTGA 2VV9A 4C2VA 3KY2A 3KC3A 3EQBA 2OJFE 4YSMA 1YXUA 1U46A 1OL7A 2JKQA 2YACA 4F7SA 4J71A 4CKRA 2JITA 5LVOA 2AQXA 1JSTA 3KXXA 2C6LA 3D0EA 3F5PA 4QP9A 4F9WA 2JIIA 4IBMA 4TRLA 3NAYA 2PZPA 4II5A 3RK7A 4QPMA 4I5CA 3EQDA 4JJRA 4ZEGA 1G3NA 3A7GA 3BYVA 4JT3A 3UC3A 4ZZNA 4O84A 3PP0A 4GFGA 1CDKA 3SVVA 5FRIA 3C1XA 2GHMA 4FTJA 1YI4A 2VTIA 4MHAA 2OZAA 4RIOA 4EOSA 4MNEA 5HG9A 2IZSA 3RINA 4GKHA 3PY0A 3KEXA 4AE6A 5HNIX 5HBJA 3BEAA 1BLXA 2GFCA 3TTJA 2QQ7A 3SOAA 2BALA 3R8UA 3VULA 4EKKA 1ZYJA 2YERA 3GCUA 4GMYA 4S30A 3LE6A 2PY3A 4NM3A 1H27A 2IVSA 4FC0A 5KX8A 4NKSA 4PL3A 4YTIA 4D2SA 5HU3A 5CX9A 3KRRA 5KBRA 3ANQA 3GC9A 1STCE 5EW3A 5AR3A 3R8ZA 5AR7A 4USEA 4L44A 3EN7A 4FIJA 2JKMA 1MQBA 5DRBA 3R9OA 4E26A 2X0OA 4ZTMA 3S3IA 3WF8A 2A2AA 5LVMA 3W0NA 2Z60A 4XLIA 4C4HA 4R3PA 4DH7A 2HENA 1J1CA 2XM9A 3AT3A 3VIDA 2G2FA 4DHJA 1OKVA 1OUYA 3SKCA 2PWLA 3KREA 3CKWA 2X2LA 2B53A 3RPRA 4EK3A 2VTMA 4FTOA 3TG1A 3EQIA 3DK3A 4O0WA 2E9NA 5G6VA 3C4EA 5AX9A 4A7CA 2OG8A 2R0UA 3DJ7A 4DH8A 4F0GA 2YHVA 2W4OA 3BE9A 4JBOA 2JDOA 3RM7A 4HJOA 4IJPA 3FC1X 4K6ZA 2PULA 2F49A 3II5A 1RE8A 4FIGA 2YDIA 4FKLA 3RJCA 3LCDA 5B2LA 3DKFA 4UY9A 1NW1A 3R7UA 3RAWA 3PVGA 4P90A 1OL5A 1OL2A 4BTKA 4NIFB 3BPRA 4JX3A 3UZPA 2JBPA 4XP2A 2G9XA 4FI1A 5I3OA 5I9UA 2VTSA 4BCOA 2R3MA 3BIZA 5BUEA 1NXKA 5IA3A 1JQHA 4TYEA 1Q8TA 5FP6A 3PSCA 3R28A 4YZDA 5JZNA 4BIDA 3K3JA 4X7QA 1W84A 2BTRA 3FLNC 1PMUA 1CM8A 4QP1A 4O7NA 1V1KA 3BYOA 3GT8A 3UZTA 2EUFB 2WXVA 4WIHA 5I9WA 4EHGA 5HLNA 1PYXA 3MPAA 3QUDA 4X3FB 3W0OA 4PTCA 2CHLA 4C37A 2UZBA 2XNMA 3UMWA 3P79A 4D1ZA 3P7AA 1LP4A 1ZOEA 1P4OA 3PXYA 3TNQB 4R5SA 3P23A 2HOGA 1XH9A 4FGBA 1YW2A 2Q0BA 2YISA 1BX6A 5DN3A 4DDIA 4ASDA 1U59A 3FPMA 2GS6A 4FUXA 4ZXTA 4AUAA 4BICA 4EK8A 2PVJA 4YUQA 3A7JA 3BELA 2P33A 3E3BX