5HZNA

Structure of nvp-aew541 in complex with igf-1r kinase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
296
Chain Sequence
AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Insulin-like growth factor 1 receptor
publication title Identification of a 5-[3-phenyl-(2-cyclic-ether)-methylether]-4-aminopyrrolo[2,3-d]pyrimidine series of IGF-1R inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 296
sequence length 304
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hznA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hznA01
3DOGA 3LKMA 4WRSA 4DTAA 4GIIA 4JL9A 4L44A 2VAGA 3BU5A 3D14A 4P5ZA 2JAVA 4XNEA 3SW4A 4KAOA 4F7JA 4F4PA 2FSLX 3R00A 3C4XA 2EU9A 4J53A 5AV4A 3V3VA 3LFNA 3G2FA 2QOQA 4Z55A 4OTPA 2PE0A 2IZRA 3EQFA 5DT0A 2QO9A 3WF7A 3FEGA 4U40A 4AW0A 3ORNA 2W17A 4XS2A 1XHAA 4X2FA 3KXNA 3ZUVA 2BPMA 3CXWA 3RALA 5TOZA 2BTRA 4AX8A 1V0OA 3BE9A 3VC4A 2XKEA 3V5LA 4HNFA 4AE9A 3DK7A 4ACDA 3DFAA 5BMSA 2CKPA 4FSQA 5BVEA 2WGJA 2XIKA 4GG5A 4KSPA 2JAMA 5K4IA 1Y91A 4KBAA 1KWPA 1PY5A 5A3XA 3G0EA 4ANNA 2VZ6A 3CD3A 3ORXA 4EUTA 5L6OA 3MFTA 2X0GA 4FOCA 5HNBA 3NZ0A 2W06A 3MJ1A 4M15A 4BRXA 2JDTA 4ZK5A 1CKJA 2G2HA 3LCOA 2Y4PA 3DBDA 3NS9A 4ZZMA 4ZMFA 3EFKA 3I6WA 4YO6A 3EN7A 4MNEA 2AYPA 1RW8A 2VTTA 4FF8A 4ZTSA 4BBFA 1J3HA 1P4FA 4EYMA 3GFEA 1RJBA 2I1MA 2BZHB 4QMSA 3EQGA 3ZC6A 3MFRA 3V8TA 5EQYA 3K3JA 1QPJA 4Q5HA 5C01A 1Q4LA 4D28A 2X8DA 4J97A 5BVKA 4U97A 3RJCA 1KE7A 2WMBA 3VW6A 2WTDA 3BELA 4FYNA 4AT3A 4X6RA 3TIYA 4DH5A 1PKDA 5A9UA 3NMUF 5CYIA 3TJCA 4E5BA 2HY81 3AMYA 4IZ5A 4ANBA 2P4IA 4DAWA 3AT2A 2V62A 4U6RA 3SOCA 3ZRLA 4AW1A 3S0OA 2YZLA 4DEAA 3DDQA 3HGKA 3QD3A 3VS7A 4FL1A 4WG3A 3AMAA 4XV9A 3AC4A 4TYIA 4BTFA 5CAPA 2YCFA 3ORTA 3JUHA 5GNKA 1H01A 5E91A 5IH5A 4QP8A 2W9FB 3COMA 2YHVA 4MXOA 5AR7A 1FGIA 1PMUA 3PG3A 4EORA 4E8AA 2X81A 4EOOA 2HW6A 2GNJA 4IB1A 3G15A 4YJSA 3W2QA 3R9RA 2WQOA 1Y8GA 3ZLWA 3I0QA 5DR2A 4QTEA 3OG7A 2PE1A 3AD5A 5FD2A 3U4UA 3NUAA 1JOWB 5EI2A 4JQEA 1GIIA 2Z7RA 3R7GA 2CKQA 4TYEA 1H0VA 2BAQA 4I1ZA 4USDA 5CF8A 4X2JA 4LI5A 2PWLA 3ZC5A 3D5XA 4ZJJA 3K3IA 4RGJA 2FB8A 4RJ3A 3BHYA 4Q9SA 1STCE 1MRYA 1VR2A 4QQJA 1A48A 1AQ1A 3AD4A 4RIYA 4O96A 4YP8A 4D4YA 3FLSA 3W2CA 2ZV8A 2BRNA 1GZOA 5FDXA 3QQKA 1XR1A 2XNMA 5IZFA 4DEBA 4O84A 2H34A 3NNWA 4PL5A 5JT2A 4UYNA 3AT4A 4Y73A 4QMNA 3F3UA 3U9NA 2EWAA 4USFA 5J7HA 3PJ2A 4GKIA 2PTKA 5AAEA 3QA0A 4CVAA 3PSBA 2W7XA 5TT7A 3D7TB 3PY3A 2RIOA 4QQCA 1ND4A 3KN6A 4M66A 3NIEA 1BLXA 5EDRA 2JIIA 3EL8A 3IO7A 3HV4A 5IKWA 3EYGA 4I5MA 3MYGA 4QYEA 3BQCA 3RWPA 4GK3A 4RMZA 3LFBA 4CT1A 3UZTA 4FG8A 3LFQA 5L8KA 2VWZA 3MB7A 3TN8A 4AAAA 4D9UA 3OBJA 1DS5A 2C6DA 3C50A 4YC3A 5DI1A 4ALUA 5FBOA 3NVKI 2ITVA 3OY1A 5E4HA 2NRYA 2BDWA 2PVLA 2WMWA 2CKOA 3HMIA 3QGYA 1KOAA 4B9DA 2XK9A 1XQZA 4MBJA 4HVGA 4PDSA 5M4UA 5D1JA 3HAMA 5FP6A 2XJ0A 4EWHA 3PWYA 4FKPA 3KXHA 5BX0A 3ALOA 4MXYA 4O7TA 4FNYA 4FEWA 3K5VA 4X0MA 1BX6A 4YJQA 3DB8A 3T9TA 2ITOA 5HNGA 4QMYA 1BMKA 1OBGA 3KMUA 5M53A 2J7TA 3VUMA 4QQTA 3BBTB 4FL3A 3E8EA 4KINA 3HV5A 2YM8A 4MEDA 4BDBA 2BALA 3VNTA 3W16A 4B4LA 1Q24A 4F6UA 3S2PA 3PE2A 4E6CA 3KF4A 2ZMDA 5BUIA 2QG7A 3FHRA 5LWMA 4FIIA 5CU3A 4FTAA 3BPRA 4O38A 5FG8A 2Y8OA 4QP4A 5H8EA 4DGMA 3KMMA 4R7BA 3AXWA 2XCKA 4UMQA 3N9XA 4E4XA 1H24A 2BFYA 2WMAA 4FTUA 3RGFA 4F08A 4OTQA 3KCKA 5J5TA 5HCXA 1NA7A 1H25A 4U3ZA 4FKIA 5JEBA 4EHVA 3QTZA 4GVJA 4I20A 3D15A 2I7QA 4UV0A 3EN4A 2R7IA 1KUTA 4D4VA 3LXKA 1TQMA 3UG2A 3AG9A 3EB0A 4O27B 3RVGA 2FH9A 1Q5KA 3R21A 4HGEA 4O91A 4UB7A 1O9UA 3RM7A 3C1XA 1U54B 2B0QA 3EL7A 3MIYA 3F66A 5BVNA 5C1QB 4L53A 3CD8A 4LM5A 3QQHA 5EQPA 3PVWA 5ANJA 3MY1A 3PA4A 4MXCA 4TYGA 1NVRA 5AR5A 4AA5A 3HX4A 5LMKA 2QOOA 1H00A 4RX8A 4FKQA 4H3PA 3SD0A 2NRUA 1YXXA 2W5HA 3LFDA 2JITA 3RNIA 5CX9A 5BVDA 5I9WA 5DIAA 4NL0A 2G01A 3NYOA 3MW1A 4XG8A 2X6DA 1Q61A 1TVOA 3LIJA 3Q96A 4FSRA 5D41A 3CTQA 4P90A 4QO9A 4ZLYA 2KTYA 2B9IA 3O23A 4IWQA 5KKRB 1NW1A 4X3JA 2PUPA 1B38A 1U5RA 4J95A 4CZYB 3G51A 1W8CA 4J52A 3QCQA 4ZSGA 3ZSIA 1F0QA 4FVQA 4N4SA 3LLTA 2X9FA 4YZNA 4MXZA 1EH4A 2WQBA 3UJGA 5IA2A 5JFXA 4BBEA 4CLIA 4PP9A 3POOA 3R9NA 2YISA 3HNGA 3KRWA 4R3RA 4V05A 4MD8E 5G6VA 4BL1A 1DM2A 1WVXA 4AS0A 5HO7A 2C5VA 2EXCX 3FQHA 4FTNA 3CSVA 3UQGA 4I6HA 4JAIA 4FBXA 4RIXA 4KSQA 3OCTA 3GCSA 1Y57A 5DNRA 3I5ZA 2X4FA 2JKMA 4MXAA 5IU2A 2C6EA 5H8GA 3VUKA 2WO6A 3TNHA 4NKAA 3GQLA 3FWQA 3WYXA 4F7NA 3NUXA 4X7QA 2YDIA 2OJFE 5CY3A 3T3UA 2HENA 2EXMA 2ITPA 3LJ2A 4WNPA 2XVDA 5KKRC 3DZOA 3Q04A 5ETIA 3GOPA 4HVHA 3PJ3A 3U87A 4XP0A 2F9GA 3C5IA 3VULA 3D5WA 3U8WA 1OZ1A 2VWBA 4QPAA 3VQHA 3QUDA 2VWWA 4IE9A 4Y46A 3WZJA 4V01A 1PYXA 4PMSA 1AD5A 3ROCA 2YAAA 3V5JA 5AX9A 3L9NA 2ERKA 5DBXA 4DHFA 2OH4A 2QVSE 5CAUA 3NDMA 5IDPA 4PMMA 5A4CA 3F61A 5CSWA 4EQUA 2YCQA 2YWVA 3QKLA 4OBQA 4AFJA 4DGGA 4MNFA 4QT1A 3W2SA 4KKHA 2HW7A 3GC7A 4G5JA 3QRJA 1UU9A 1H0WA 1YHSA 2C3LA 2O65A 3DQXA 2VTPA 4MCVA 4UWCA 4U81A 4MWHA 1W7HA 3H9RA 4TY1A 4U7ZA 2QCSA 3LJ1A 3UO4A 4BY9E 4OBPA 4BF2A 4KS8A 2A4LA 3E8NA 4R7HA 1YW2A 1OPJA 5K0XA 5ETAA 4A4XA 4WG4A 3C4ZA 1KV1A 2XIYA 2YZAA 4D2PA 2C68A 5LMBA 4FG7A 5AM7A 3IW8A 4G31A 1J91A 4M12A 3QQLA 2B7AA 1ZY4A 2IVVA 2JIVA 2QC6A 3CPCA 3H10A 5FTOA 4BDKA 5AUYA 3Q53A 2HOGA 2XIXA 4F6SA 5AAGA 4FEXA 4FTCA 1O6KA 4JDIA 3ZO3A 4D2TA 3GI3A 4XJ0A 2V5QA 2QO2A 3PRIA 1SMHA 3GU5A 2OK1A 1OIQA 4YUQA 3CIKA 5IA5A 4RVKA 4QMQA 3A7FA 4S30A 2VO0A 2F49A 3ETAA 5T3QA 1LEZA 3BHVA 5CALA 1ZLTA 4LRMA 4MTAA 4I5PA 4IAYA 3P7AA 1RDQE 4IAZA 3TDVA 3RAIA 4FTMA 2ZM4A 1JKLA 1REJA 5DH3A 1H1QA 4YNEA 4A9RA 4DG3E 2RL5A 5AR8A 1FVVA 3MVMA 4GIHA 4W4VA 1OPLA 2IZUA 5AAFA 2WTJA 2W1HA 5HD7A 3D4QA 1SZMA 5T6KA 1S9IA 2Y4IB 3DKCA 5CU4A 4GCJA 3QZGA 1NXKA 3UDBA 4G9RA 3QLFA 3BU6A 3CLYA 5EYKA 4IEBA 4U0IA 3MVLA 4FIFA 5DGZA 4O22A 3W2OA 2CLQA 4RJ5A 3SRVA 2DWBA 4CEGA 5CEKA 4V04A 1PXMA 2B9HA 5KMNA 2P2HA 1BL7A 2QOCA 5J79A 2UW6A 5J7BA 3R1YA 5LMAA 4AZVA 2OW3A 2VNWA 2VWIA 3VRZA 5JQ5A 4OLIA 3MY5A 3TKUA 2IVSA 3UZPA 3KULA 3PJ8A 3QXPA 1R3CA 3BLQA 4A4LA 5GIPE 2VV9A 4IX6A 5HTIA 1JSTA 4F0GA 4BWXA 4BCMA 1YDRE 3HA8A 3V5PA 4BCKA 3LFCA 3MV5A 3MBLA 1YI4A 5DPVA 2GS7A 2ACXA 2UV2A 3TDWA 3BBWA 3FQSA 1OITA 4RVLA 5K3YA 1XBCA 2GFSA 3F6XA 4WNMA 2VGOA 4CV8A 4K9YA 3BV2A 5AR3A 4JIKA 2IW6A 3U51A 5E8ZA 3VIDA 4FZ6A 1ZRZA 3FMHA 4G6LA 3LCKA 4M84A 5KZIA 3P79A 5FEQA 3WE4A 4WNKA 3QU0A 4S33A 4EC8A 1OKVA 3IOKA 4J7BA 2Y0AA 3TUBA 1WFCA 4RIXB 2JKKA 4ZP5A 4Y5QA 5C4LA 4MAOA 3LVPA 4FK3A 3WE8A 4GKHA 4YJRA 2BZKB 4IX3A 4XG7A 2W4OA 4XH6A 5CVHA 5BQ0A 3IG7A 1FBNA 5F95A 2BZJA 1JSVA 3MVJA 4H58A 1PXJA 3VUDA 2C3JA 2CDZA 5AP2A 3SA0A 2GQRA 4PY1A 3CKXA 4C35A 3TEIA 4ASDA 4EOJA 3DAEA 3AOXA 4O81A 5B2KA 2UW9A 4D4SA 1JKKA 4AOTA 2Z7QA 4PPCA 3OROA 3FDNA 5ANEA 2WTCA 4FZAB 2B52A 1UNHA 3DKFA 3EN5A 2BZIB 4G3CA 4EH8A 4TT7A 2X8IA 2IWIA 4X3FC 3I6UA 3OC1A 2I0EA 1JWHA 5L2IA 3I7BA 1ZOGA 3NWWA 4XX9A 3EN9A 4NM7A 3Q2JA 4WO5A 5GJDA 1LR4A 3CCNA 4I6QA 5E1EA 2FGIA 3C4EA 3QZIA 2C30A 1OBDA 2IVTA 3BWJA 2LAVA 3R7IA 1OIRA 4IFGA 1SVHA 2B9FA 1WVYA 4JT3A 4DTBA 5CANA 4HGSA 1OL2A 3R9DA 4GFMA 2C6IA 1J1BA 3HDMA 3F69A 4YBJA 2IW9A 4BZDA 4D0WA 1P14A 3KEXA 2EB2A 3OXZA 5HHWA 4M14A 4I41A 3SLSA 3VAPA 3EOCA 4BN1A 1Z9XA 5GIOE 5LVLA 4XOYA 4ZTLA 4M7IA 5HLWA 3VBXA 2CNVA 1WCCA 3PLSA 5E8TA 1KSWA 3BHUA 3IOPA 4EH5A 3EYHA 4JBPA 4IBMA 1SM2A 3DXQA 4CT2A 3ZU7A 2HAKA 3FLZA 2Q0NA 1YDSE 4PV0A 2WQNA 3ZDUA 4FKUA 4TKSA 4YTFA 2HWOA 4CFXA 4PPAA 1Z57A 4L43A 4IAKA 3TXOA 3WI6A 3LW0A 3UIMA 4CV9A 3QBNA 1FVTA 5FRIA 3OBGA 4NCTC 3MESA 4H05A 2IVUA 3KB7A 5FXRA 2O2UA 4W8DA 1V0BA 1DAYA 3LM5A 2RFNA 5GJGA 2OF2A 4IQ6A 3DPKA 4RC2A 5CEMA 4KIOA 2WTKB 2R3FA 4QNYA 4EQCA 3A7IA 3OT3A 3M1SA 2WHBA 3GP0A 3ENMA 1QPCA 2BHEA 2EXEA 3E64A 3CR0A 3QCYA 4JNWA 4U80A 3AC2A 3HA6A 3FI8A 3CP9A 4NIFA 2UW4A 3QXOA 3FYKX 3WZDA 3V01A 3RPRA 4QTDA 4D2WA 3EQIA 3F3VA 2XYNA 2YCSA 4C36A 3PZHA 2G9XA 5IF1A 4NM5A 3FE3A 4QMLA 4WRGA 4R1VA 3ACJA 3HV6A 4X21A 2JEDA 3FZRA 3H4JA 3BLHA 4B99A 4N70A 4CNHA 3BYOA 2A27A 4QP7A 3D94A 2OIQA 4DGLC 3QGWA 4PQNA 1H1PA 4RA4A 4BDCA 3UTOA 3D0EA 3WZUA 4MBLA 4RJ4A 3KXXA 4CKJA 4XEYA 3C4FA 1Q3WA 2VGPA 4FV6A 3OWLA 1ZMUA 3H0YA 3NUPA 3VBYA 2WTKC 5M51A 4IB5A 4W4WA 4CMTA 2R9SA 2XNNA 3O96A 5KHWA 4O0UA 2GHLA 4FTOA 4RIWA 1YRPA 4KUJA 4ORKA 4DBXA 4RJ8A 4BKYA 3ZUTA 4PDPA 4ACHA 1JLUE 4U79A 3QD0A 4P4CA 3MA3A 5AP1A 3SQQA 1JKSA 3C0IA 5K9IA 3F2RA 4LL5A 4TYJA 4F9CA 5JFSA 4ANMA 3EIDA 4Q9ZA 5M4FA 3SXSA 4RBLA 4ERWA 4ANLA 3DFCB 3TCPA 4IM0A 5HVYA 5IQBA 5DT3A 4AP7A 1KE6A 4DCAA 4MQ1A 1IR3A 3DKGA 2WELA 3A7GA 2C1BA 3EQHA 3FLWA 3NNVA 4BCOA 2UW5A 2WMRA 3PXRA 2RGPA 4UMRA 4IZYA 2XM8A 5AEPA 5CXZA 1OUKA 4ZXTA 1MP8A 1SNXA 4MWIA 4BIBA 4KBCA 5HESA 4DFXE 4LFIA 4MQ2A 5HBJA 5L8LA 4F6WA 3IKAA 5FXSA 3W55A 4AW2A 2XNOA 5CSHA 3F7WA 4IJPA 3FYJX 4F99A 2XJ2A 3ID6C 3U55A 4AGWA 4QD6A 3EQPA 2BRBA 3A60A 3QWJA 4FSZA 1BL6A 2GHGA 5ANKA 2G1TA 5IPJA 4C61A 1F3MC 4QMZA 3PRFA 5ANIA 2PVHA 3Q52A 4YLJA 2JIUA 3W32A 2B9JA 2QURA 3K2LA 2R3GA 4I6BA 3SC1A 3QTUA 2G2IA 2ITNA 3VW8A 5KBRA 3ELJA 1G8AA 2VTLA 1KV2A 3N4UA 3MH3A 1JAMA 1G8SA 3F2AA 2AC5A 2BDJA 4XV1A 1GY3A 2C6OA 5BMMA 1NT2A 2XP2A 2R3QA 1MRVA 4E5AX 3BZ3A 4BDIA 4BCNA 4ZLZA 3DCVA 4FIJA 4JBQA 1R39A 3ZZEA 2WFYA 4KIPA 1PYEA 3GQIA 5LCJA 4K11A 3SG8A 5ACBC 4KIKA 4NSTA 4EK5A 5EQEA 4D55A 1UA2A 3UO5A 3DXPA 3HLLA 4AN9A 2GS2A 3PYYA 4C4HA 1XJDA 1ZARA 4H1MA 4JG7A 4N6YA 2VTAA 5CQWA 4HOKA 2CGUA 4XG2A 5L6WL 3W10A 4I94A 5BUJA 3VS6A 2HWPA 5E8WA 4KD1A 4TWPA 2OICA 2R3MA 2YAKA 4PL3A 2CCHA 5EI8A 4ENYA 3UC4A 2ITQA 2XKFA 2J2IB 4FIEA 3O51A 3CGOA 3L9LA 4EHEA 3R8LA 2B1PA 3JVSA 4EQMA 2C5YA 2PVMA 3KGAA 2BMCA 3QALE 2RG5A 1YOLA 1Q3DA 2B53A 2W05A 5C26A 5EM5A 2C3IB 5HU3A 3QX4A 3FI2A 2ZV7A 3KK8A 3PXQA 3Q4UA 3OTUA 4LOQA 3W2PA 3DV3A 4RZVA 2OJJA 3A62A 4DFYA 3JR1A 5HG7A 3ULZA 4J71A 4AZSA 4FTRA 4AU8A 3TNPC 4RG0A 3JY0A 5E92A 3FKNA 4CKRA 3QKMA 4S34A 1ZMVA 1PHKA 3IW4A 5FGKA 2E2BA 4F7LA 4F63A 3KA0A 3VF9A 4HZRA 5I3RA 3ATTA 5KHXA 4ZSLA 1L3RE 4C59A 4E6AA 4XHKB 4NT4A 3KMWA 5JZNA 3UP2A 1UVRA 3QC9A 4L45A 4Y8DA 5DEYA 4CTCA 2R3KA 3FXZA 4NIFB 1XH4A 3GCQA 4MHAA 3CC6A 4J8MA 5EW9A 4A4OA 3FSKA 4YR8A 2PZ5A 2XK7A 3FHIA 3IPHA 5EM6A 5CAQA 1HCKA 3DB6A 4L3PA 1SVEA 4G16A 4JQ7A 4TN6A 3NW6A 5IG1A 5CAVA 1ZWSA 3G9NA 1V1KA 4RZWA 4BCQA 3EQRA 3LCSA 3BYUA 3G33A 4W4XA 2YIXA 3C7QA 3P7CA 5KZ0A 5FEDA 4FA2A 3O0GA 3I79A 2JKOA 3NRMA 2WU6A 4AZTA 3S00A 4UX9A 3KVWA 2W1ZA 4YBKA 4FV7A 4GUBA 2PVYA 3NX8A 1Q8YA 4G1WA 5AUXA 4F0IA 4EH9A 1OKYA 3RBWA 3FC1X 3H30A 1PW2A 4LL0A 5CI6A 4I0TA 4GJ2A 4NW6A 4Y72A 3IECA 4M3QA 4R5YA 4BDAA 5L3AA 2UW0A 2W0JA 3A7JA 5A54A 2JFLA 3IDCA 3N51A 4IW0A 4K6ZA 2WZJA 5AUUA 5DWRA 5GZAA 2RSVA 1P4OA 2W1IA 2X8EA 3F5XA 3GNIB 4Q5EA 4BTJA 3UPXA 4Z7HA 3FL4A 1CMKE 5CU0A 5HIDA 5HORA 4BCFA 3L8SA 5JQ8A 3FMNA 3PY1A 1ZZ2A 2OFVA 5L2TA 2XJ1A 3MTFA 4D9TA 4IACA 4AACA 2E9NA 4BGGA 4Z3VA 1IA9A 2JBPA 3KY2A 5AUTA 3E87A 4R3CA 2ZB0A 1M52A 1T46A 5FP5A 4EOMA 4YPSA 4O7SA 3NSZA 1XKKA 3FSFA 4HW7A 5KMIA 4AQCA 4JI9A 5JKGA 4L7FA 3QZHA 1H08A 5GINE 4NM3A 4E7WA 2CNQA 4G34A 4JX3A 4F1TA 4YJTA 4FKRA 4OBOA 1B39A 4FTLA 3UG1A 3OHTA 4AW5A 4RFYA 4JRNA 3QTXA 2ITWA 4O1OA 4RFZA 2UVXA 4AFEA 1WAKA 2BIKB 4PDOA 4QYGA 4TZRA 3WF5A 2NPQA 4JG6A 4EK3A 2I0HA 2VTJA 2QQ7A 3VHEA 1NVSA 2ONLC 2YM7A 3HL7A 1GJOA 4AZEA 2UZTA 4TWNA 4RRVA 4I5CA 1VYWA 5A46A 3CY2A 3RCJA 4FC0A 2EVAA 3LMGA 3I7CA 4E4LA 1W84A 1YWNA 4DE4A 2C69A 4C7TA 5IISA 3FBVA 2W1CA 3I1AA 4YJUA 1Z5MA 4KIKB 2XRWA 3EWHA 3Q6WA 4XLIA 4EJNA 4KRCA 4LUDA 5HICA 5JFVA 4BTMA 1I09A 1QL6A 4TL0A 4CLJA 3QRKA 4J99A 4YLLA 4ZLOA 4IX5A 5AP4A 3QAME 4C4GA 4C33A 2W1FA 3GVUA 5CVFA 4KWPA 4XBRA 5DVRA 5HE2A 4EYJA 4FTQA 3ZCLA 4ZOGA 2GQSA 1W0XC 4O21A 4XRLA 4FGBA 4J8NA 4EOSA 4IVDA 3ULIA 4G3FA 2R3HA 4H1JA 5LCKA 4IANA 4PMPA 4KNBA 3ODYX 2O3PA 2VWYA 4GH2A 3TT0A 1E9HA 4GU9A 5L6PA 5BYZA 2Y9QA 4GFOA 4C37A 2ZDTA 2I40A 4EOKA 2QKWB 3UYSA 1WBPA 4YJPA 5TO8A 1APME 1FMKA 2YJSA 3VS0A 2J6MA 3ZMMA 5BVOA 3Q32A 1OI9A 3BX5A 1OECA 3VS5A 2OZOA 5A4QA 4KRDA 3ZO1A 4ZJVA 3F3ZA 2OO8X 4CFMA 4PTCA 3NVMB 1H4LA 5C27A 3WBLA 1LPUA 4M13A 4FKSA 4G3EA 3VRYA 2VTIA 4M67A 4ACCA 1YWRA 4F70A 5H9BA 4RWIA 4FV3A 3QYZA 4U9AA 1ZXEA 4RVTA 3E93A 4BI0A 3TG1A 4DA5A 3JYAA 4JIAA 4OUCA 4QOXA 2XNBA 4MNEB 4YNOA 3BGZA 4OT6A 3UGCA 5M44A 5A6NA 2YJRA 4R6VA 3MN3A 4L9IA 4K18A 3MIAA 1W98A 3L8XA 3PG1A 5EFQA 4ZY6A 3DA6A 1E1XA 3KN5A 1GIJA 3R9OA 3U9CA 2W1DA 3UODA 4DH8A 3DU8A 2RKUA 2QU5A 3H9FA 4O86A 5B2MA 1MQ4A 4GK2A 1UWJA 2XF0A 3PFQA 4BYIA 3P4KA 3R8PA 2O0UA 3D2IA 2C5OA 1UU3A 5EKOA 4KIQA 4L00A 3BGPA 3E92A 5I9YA 2JDOA 1LEWA 3I0OA 1UNGA 2ZV2A 4QP2A 2YM6A 3W18A 3FKLA 3R8UA 3ZXTA 4H36A 3UQCA 5FM3A 4F9BA 5AP3A 3GB2A 4L3JA 4RX9A 4TXCA 1P2AA 2YWPA 4MD7E 2YDKA 3ZLSA 3GU4A 2F7XE 3FZOA 2UZWE 4B8MA 4NTSA 1OUYA 2Z60A 4H39A 3ZONA 5AV1A 2YEXA 3KRLA 5AWMA 5JGBA 3LFEA 4U44A 5L4QA 3NCZA 4W9XA 4WIHA 3H9OA 5M09A 2O8YA 3BU3A 4CD0A 2PMLX 5AMNA 2UW8A 3W1FA 1YDTE 3DZQA 5CSPA 2I0VA 2GNFA 3S3IA 4FI1A 4WOVA 4BWKA 4QPMA 3MPMA 4QP6A 4UY9A 1H26A 1PXLA 3PWDA 3FMDA 1M2RA 1CSNA 2X4ZA 3NEWA 4IXPA 5HEZA 3MTLA 3RP9A 4DGNA 4WBBB 3EN6A 3SX9A 1XH9A 3L1SA 4EOLA 2VX1A 4C4JA 1PKGA 1BUHA 3MI9A 2ITTA 3DBEA 3CBLA 3O8PA 4DEHA 4EH2A 1OB3A 3UIXA 1IG1A 2C4GA 4RIYB 4LG4A 3WF6A 2A19B 1W83A 4GU6A 5K0KA 3VO3A 2OZAA 2QKRA 3PA3A 3RPOA 4WSQA 4EONA 5JGAA 4HYUA 5DRBA 5ETFA 2QG5A 3ZTXA 1OKZA 5I9VA 4WG5A 2C3KA 2XZSA 4MF1A 3DBFA 3R71A 2B4SB 3TWJA 3ZLYA 1XH7A 4R8QA 4ZTNA 2W1EA 4FIGA 2A1AB 2WU7A 2WPAA 3PSDA 3EFJA 4DFNA 4QTBA 5K5XA 4PDYA 1QPEA 3QC4A 3ZFYA 5E7RA 5LARA 3BYSA 3TZ7A 4IM3A 5CENA 3HRBA 2V7AA 3GCUA 3MJ2A 4QTCA 3AGMA 2C0OA 3ROYA 4O2ZA 4K8AA 2W5BA 5ANDA 4GT5A 5BUEA 2XEYA 3A8WA 4ZJIA 3T8OA 4IDTA 3OWJA 1WBWA 5CQUA 4CKIA 4FSNA 4RIOA 5LVPA 4NFMA 4RWJA 3GXLA 2H8HA 3ZDIA 3OT8A 2ZM1A 4QMTA 3GCVA 5J9LA 2YIYA 2QOIA 3R02A 4O2PA 3GBZA 1REKA 4R3PA 3VUHA 4C62A 3OMVA 5HLNA 3QQJA 1KE8A 3PPZA 1PF8A 2EB3A 3QA8A 4G6OA 2C6MA 2XKCA 3I5NA 3NAYA 5D12A 3FY2A 2UZBA 5CF5A 4BC6A 4WUAA 5TF9A 3BHHA 1T45A 1A06A 1U4DA 4RLLA 4TW9A 5CS6A 3RZBA 4NCTA 4BDFA 3NPCA 4CFFA 2R0IA 3IW5A 1Q62A 4Y5HA 4AF3A 4Y83A 3E8CA 1TQIA 1L8TA 4O0WA 4XP3A 3F3WA 3HV3A 1YOMA 3TNIA 4A07A 4OTFA 4F65A 4E73A 2PYWA 5IQHA 2JFMA 2XM9A 2VX3A 4LUEA 3QTRA 3HP2A 4UWBA 4QMVA 5AJQA 5AUVA 4HGTA 3LMHA 3LXPA 1VEBA 3QF9A 3LCTA 3COIA 3NAXA 4BCJA 2P2IA 2HZNA 1Q97A 2J0IA 3G0FA 2YM5A 3RPSA 5CEPA 2BRGA 4PP7A 5I3OA 1ZZLA 4EH4A 3RMFA 5IUHA 1J1CA 4GT4A 4I0RA 3Q4ZA 2F7EE 3E63A 4FTIA 4YJNA 4RJ6A 4QTAA 5KBQA 2Z8CA 4YTIA 4YHTA 5I4NA 4TWOA 3CQWA 4JR3A 4L8MA 1OPKA 4G17A 4HNIA 3PVGA 4V0GA 4HPUE 1FOTA 5CLPA 3ZEPA 5HX8A 2O5KA 4BCHA 4DFBA 1A9UA 3NYVA 4EOQA 3U6HA 2Q0BA 2I6LA 3BGQA 2FVDA 3R7OA 3TKHA 2DS1A 2A0CX 2J50A 4CXAA 2X7OA 4K1BA 1Q99A 4USEA 4DT8A 2BTSA 2VNYA 1YHVA 2Z2WA 5DT4A 3UIBA 3FUPA 4DBNA 4MYGA 2RFEA 3PXYA 1FPUA 4O6EA 4CSVA 3R01A 3UNKA 4LGDA 4AZWA 4E20A 4BI1A 4XG4A 4QMPA 3FXWA 4QYFA 2UZEA 2G2FA 3DLSA 4IADA 2UUEA 3G6GA 3DLZA 4L68A 4BFMA 2OG8A 4WUNA 5DMZA 3ALNA 5CWZA 1HCLA 3OTVA 5EW3A 3GOKA 4QP9A 3UOLA 3IGGA 4CFNA 2UW7A 2CNUA 1JVPP 5K4JA 2Y4IC 3AGLA 3ODZX 4JBOA 4TNDA 1GOLA 1ZYCA 3PSCA 3SGCA 5KUPA 2GNGA 3GT8A 5I9ZA 4CQGA 2VTNA 5E1SA 2RG6A 3GC9A 4YZCA 4GG7A 2J0LA 4NW5A 3ZBXA 2CN5A 3NNXA 2WOTA 4KB8A 4KKEA 3EJ1A 4LRJA 5C4KA 3AC8A 5LMKC 3BRBA 4XCUA 5C03A 3UO6A 3O7LB 4D2SA 4C2VA 3TZMA 2IW8A 4DEEA 5DE2A 5IEYA 1U5QA 3U6JA 1IAJA 2BRMA 2WMUA 4FGRA 2R4BA 4FSUA 1OIUA 1URWA 4OTIA 3HUCA 5AP7A 3TJDA 5FLFA 1PJKA 2X2KA 3MA6A 3Q9WA 4FV1A 2WB8A 3ZFXA 4FSWA 2BAKA 4BYJA 2AC3A 2FYSA 3QL8A 1YVJA 4EK6A 3DAJA 2C0IA 4IHPA 2WAJA 2HY0A 3V8WA 4BDHA 3B2TA 2OZAB 4YSJA 3UMWA 4QMXA 3CQUA 3ZOSA 5EI6A 3QWKA 4YHFA 4LOPA 3SVVA 1OL7A 5I5ZA 4PWNA 3OCBA 5CF6A 3V5QA 5HNIX 3ZBFA 2O63A 4ZEGA 4NJ3A 2CJMA 4A9SA 5LOHA 4BI2A 2OWBA 3QFVA 3P9JA 5CSXA 4QP3A 4H3QA 1CM8A 1Y6AA 1UU7A 5G1XA 3LPBA 4FKGA 3UVPA 4FEVA 1IRKA 5BYLA 3R6XA 5JRSA 3OEFX 3NR9A 3PP1A 3DJ6A 5AX3A 1YKRA 3ZXZA 3BE2A 3FZPA 4EZ3A 3AD6A 4ITJA 3ORKA 3C5UA 3CEKA 4WHZA 4XG9A 5JGDA 2WEIA 2J0JA 2R3IA 3EMGA 5H2UA 5TE0A 3SW7A 2V55A 4IWOA 3PXFA 3DK3A 4BGHA 3ZS5A 3LM0A 3RNYA 1VZOA 4LYNA 5JN2A 4BR3A 2GNHA 5B7VA 5A4LA 5LWNA 4D2RA 1CKPA 3TZ9A 3E7OA 3VBVA 4I22A 3ACKA 3QRIA 3P7BA 3V5WA 2DUVA 4HVSA 4LQMA 4DYMA 2E9VA 3OVVA 5J9ZA 3F5GA 3MWUA 1LP4A 3Q6UA 2GMXA 4BIEA 4M69A 5HX6A 4M0YA 3PA5A 3PE1A 2R3RA 1B6CB 4S32A 2RF9A 4MF0A 4TYHA 4L7SA 2OXYA 4U43A 3K54A 5DG5A 4DN5A 3DTCA 2X9EA 3R7EA 3HZTA 2VN9A 4YO4A 4CYIA 3TNWA 4BKJA 2XK4A 3GCPA 4ZZOA 4EKLA 1H07A 3I60A 4UXQA 4P7EA 1UKIA 4HPTE 1H1WA 2E9PA 3HMNA 3OS3A 3V8SA 5AV0A 5IUGA 5H3QA 2XYUA 2PY3A 2WXVA 4QYHA 3WIGA 4GSBA 4EI4A 3UZRA 2GNLA 2P55A 3AT3A 3R2BA 4FT3A 4I4EA 4IVBA 2YDJA 2B55A 2GHMA 2W4KA 2JKQA 4N57A 3QTIA 4GS6A 5CNNA 4ZSEA 2QI8A 3VF8A 2HZIA 3OWPA 4NWMA 2VWXA 3PLAE 2P33A 4DT9A 4FEQA 3ATSA 2OFUA 3R22A 2PUNA 2HYYA 3M42A 3R8VA 4AN2A 3C9WA 5HVKA 4MH7A 2W4JA 4ANQA 3Q60A 3R30A 3Q4CA 4UALA 3UVRA 4ANOA 5CASA 3AC5A 4FL2A 5J1WA 3PDTA 4CG9A 5IQEA 2Y6OA 4NH1A 3H3CA 5HOAA 3RK7A 4DG2E 1BI8A 2IZTA 4DH3A 2PZRA 2ETKA 4FSMA 5CTPA 5D11A 4IH8A 5TKDA 3F7ZA 4FIHA 3FPMA 3QYWA 3SRVB 3ZYAA 3E62A 3MVHA 3OZ6A 3QTSA 2XBAA 2ZOQA 1PXOA 2AUHA 3GU7A 3ZLXA 3ZSHA 3RAHA 2JD5A 2BDFA 3UVQA 3O8UA 4U42A 2PSQA 3I81A 2J5EA 1OL1A 3C13A 2W99B 1JKTA 3KULB 5F94A 2REIA 2XK8A 5IMXA 4EJ7A 4PNKA 5AIKA 2HXLA 3BIZA 2OLCA 4FV4A 3BKBA 4AT5A 4D5HA 1QPDA 3PXKA 4MD9E 5DEWA 2FSTX 4YZ9A 5F1ZA 3DTWA 2CLXA 5D10A 3FJQE 2NP8A 3Q4TA 5J95A 5TR6A 4IVAA 5CZHA 3RM6A 3O8TA 2GTNA 4EUUA 5B2LA 4B8LA 3BYMA 4GRBA 2PHKA 1XO2B 3QD2B 4RT7A 3HMMA 4FV5A 3W8QA 4EWQA 5C8NA 3RHKA 3EFWA 3SG9A 5EDPA 3QQUA 4UXLA 2WD1A 3EH9A 3Q2MA 5K5NA 4OTWA 3UOJA 3VS1A 5DYJA 4PL4A 1ZYJA 3QX2A 2C5XA 3DBCA 3R1QA 3CY3A 4U41A 1WMKA 1URCA 4XV2A 3V6RA 4ARKA 2YACA 4IZAA 4HYHA 1RE8A 3LHJA 1E1VA 3V6SA 3TL8A 4AGDA 2OSCA 2P0CA 3WOWA 5KMKA 2R5TA 2YFXA 2XNPA 2QOKA 3EFLA 5A6OA 4IJ9A 4I3ZA 2JC6A 3GC8A 4L46A 3ZH8A 2WOUA 2HELA 4NZWB 1GZKA 2VU3A 2WQEA 4GMYA 4S31A 3RAWA 4DINA 3KCFA 4AA4A 1F5QA 4CFVA 4Y95A 4NFNA 1JQHA 5CNOA 5FEEA 2CGVA 3UQFA 2KULA 4IAIA 5LXMA 3P5KA 5M08A 1FINA 2QODA 4CZTA 5I0BA 5IQAA 3IDBA 4L67A 2ZVAA 3MPAA 5HZNA 3PIZA 4A9YA 3D83A 2BIYA 2JDRA 3CKWA 4O7ZA 1Q41A 3S4QA 3ZUUA 2VO3A 4A7CA 5GJFA 3KRXA 4QP1A 4WSYA 4AOIA 4FT9A 4JR7A 3FY0A 2J0MB 2CCIA 4FKWA 4HVDA 2PVJA 1WBNA 1H1SA 4W8EA 4FTTA 3AQVA 4UEUA 5FDPA 4BDEA 5KNJA 1YXUA 1I44A 4DEGA 4S2ZA 4QMWA 2OI4X 4A9UA 1M2QA 4Z7GA 3LJ0A 4MVFA 3EQCA 3IDPA 2XUUA 3O50A 5FWKK 4EEVA 4BBMA 3F82A 1OVEA 3TZ8A 2GCDA 4L52A 4IFCA 1IAHA 3WYYA 3LFSA 5EHLA 4R1YA 5E8UA 3D7ZA 4M69B 3ZFMA 5C8MA 2Y7JA 4JDJA 4AG8A 4AGUA 3P86A 1Q8WA 3V04A 3PIXA 2GQGA 4XUFA 3ORPA 5D7AA 3RK9A 3D9VA 5CU6A 4FK6A 4ZSJA 3TV4A 2XKDA 3BQRA 4II5A 4LV8A 4ASZA 3A2CA 3CJGA 3N4VA 4J1RA 4WBOA 3SAYA 2HZ0A 3WZEA 3ZM4A 3F88A 2C47A 5IQIA 1FVRA 3R2YA 4I93A 4ZS4A 3LLAA 4O0RA 3AC1A 2WIHA 2X39A 3A4PA 1YI6A 2C5NA 4ONAA 3ZO2A 4BCGA 4EBVA 5E90A 4JOAA 5AA8A 3OF0A 5EYCA 4APPA 4EZ5A 4LMNA 3RPVA 4GEOA 4LGGA 1H8FA 2VTHA 4C4EA 5IEVA 3UNZA 4IDVA 2CHLA 1OKWA 2QR7A 4FZFB 4F1OA 2E9OA 3CTJA 1V0PA 3KQ7A 4RVMA 3B2WA 2GSFA 4A9TA 2F57A 3SXFA 3ZSGA 5AV3A 4EK4A 3CS9A 1W82A 2UZVA 4U8ZA 4JDHA 4YTHA 5HIBA 2WQMA 2VUWA 3NUNA 3T3VA 4E5WA 3G90X 2HXQA 3UNJA 2J9MA 1Y6BA 4P2KA 2CMWA 3BV3A 3CJFA 5EG3A 5I9XA 4YJOA 4EKKA 3ANQA 2Z02A 2OU7A 5AIRA 3HAVA 3QTQA 3C51A 4M68A 5T68A 3R7YA 4FVRA 3FZTA 3BWFA 2ZYBA 3KU2A 3TNQB 3C4WA 4G6NA 4C2WA 3DQWA 2HIWA 3R8MA 2CPKE 5HD4A 4CG8A 3K5UA 4QRCA 5M07A 4AT4A 2HCKA 5E8YA 4ZY5A 4XV3A 1WBSA 4DLIA 2VX0A 3O2MA 1U59A 4RIWB 3R7VA 3U6IA 4ANSA 3PVUA 2QOFA 5HBEA 4TRLA 2PZIA 4FT5A 5CEIA 1TKIA 4YHJA 2ZJWA 2J90A 4IAAA 3IK3A 1DI9A 3DS6A 4DGOA 3L9MA 1U54A 3KC3A 3QLGA 4L6QA 1M7QA 4ZTRA 2PMIA 5EHOA 4FZDB 4CRLA 1YWVA 2G15A 2RFDA 2WMTA 3JVRA 4EOPA 5A14A 5J9YA 4I4FA 2UZOA 3KVXA 2R7BA 5ICPA 5HG8A 1ZOEA 3VVHA 4DLJA 1PMEA 1FQ1B 2W96B 1K9AA 3NCGA 4K77A 3MPTA 4F9YA 4DF3A 2PUIA 2OKRA 1SYKA 2VTMA 1HOWA 3MY0A 3ORIA 4TNBA 3VS2A 5CT0A 4CMOA 4ACGA 1R0EA 4FOBA 2QOHA 2UZNA 3Q5ZA 5KMOA 2YERA 4FX3A 4RWLA 5DA3A 4OTDA 3MS9A 4M0ZA 4CFUA 5KO1A 4G2FA 3A8XA 3FAAA 3NW7A 3C0GA 5BVFA 5J1VA 3UBDA 4J96A 5FTGA 2IZSA 3EKNA 3BEAA 3JY9A 4OAUC 3D2KA 4JJRA 3KXMA 3HYHA 1X8BA 5CT7A 4F64A 2VWUA 1OIYA 3UMXA 3E88A 2XCHA 2PUUA 5HU9A 4OAVB 2C0TA 4BICA 1ZAOA 2R3NA 5DRDA 3UC3A 1KE5A 3GFWA 2XA4A 3BLRA 5AR2A 1P5EA 2QHMA 2XIZA 4BKZA 4E93A 1SNUA 3KFAA 3TV6A 5DOSA 4YC8A 4FE2A 3ITZA 3KXGA 1GNGA 2VO7A 5M56A 1GZ8A 3RK5A 3OW4A 4D4RA 2CSNA 2WMXA 2YCRA 4C3PA 4ZTMA 5KMJA 3ORMA 5CU2A 4BHNA 2YA9A 4NM0A 4CMUA 3HRFA 4YZBA 2QOBA 3TUCA 4FEUA 5J8IA 4NTTA 1OL5A 4BWPA 4ALVA 1GAGA 3CE3A 1Q8UA 3UYTA 4OTRA 5CZIA 3DBQA 3NUUA 3LOKA 2PVFA 5FQDC 3SXRA 1G3NA 1CDKA 1J7UA 3UE4A 3TM0A 1FGKA 1YOJA 2BVAA 4C34A 2ITZA 3L9PA 3RAKA 3VJNA 4N0SA 1MRUA 4ZTHA 4CTBA 5AA9A 2X1NA 3EZVA 4LMUA 3U4WA 5JMSA 5DFPA 1H28A 4BCPA 4O82A 3VHKA 3DT1A 4R78A 5DLSA 5HCZA 3P0MA 3QKKA 4TWCA 3TIZA 4UMPA 3RHXA 1H1RA 2YIQA 5E9EA 5HTCA 2R64A 4DEDA 3IQ7A 3GUBA 1KOBA 3OP5A 3ZM9A 2IO6A 2R3PA 2W1GA 3GU6A 4RX7A 2YIWA 4CYJA 3D5UA 4M97A 5HVJA 5I9UA 4ZMEA 3B8QA 5EW8A 5M57A 3G9LX 3FZSA 4YPDA 4ERKA 4DH7A 2BHHA 2F2CB 4UMTA 4FNZA 2QONA 3RKBA 1SVGA 2PZYA 4BDGA 4IC7A 4O7RA 2F2UA 3ZZWA 2VTRA 2YLFA 2GTMA 3CGFA 3OD6X 5AUWA 4CCUA 5LQFA 4O83A 3FI3A 4UYAA 3UP7A 4BTKA 2C6TA 3Q9YA 4NEUA 4GT3A 5EKNA 3E7VA 4HYIA 4KKGA 3FXXA 2UZUE 3TI1A 4BHZA 5IEXA 4I23A 5EHYA 5IMEA 3RPYA 2BFXA 4PMTA 4B0GA 1ZYLA 4AN3A 3VUTA 5IQCA 2BKZA 2PMOX 4F9AA 3FMKA 4RPVA 3W2RA 2WIPA 4ZZNA 2ZB1A 4Y85A 3MDYA 5J87A 2ZMCA 2YABA 2OJIA 3FLNC 4QMMA 2PPQA 4O7LA 3BHTA 1IEPA 3DJ7A 3G5DA 3OOMA 5CAOA 4R77A 2CGXA 3UOHA 3MH2A 4HVIA 5L2WA 5JFWA 2R3LA 2JDSA 4FNXA 1NY3A 2YM4A 3QCXA 1PXPA 5C9CA 4GYGA 3RCDA 2WNTA 3P1AA 4UZDA 1FMOE 1R1WA 5HE0A 2VTOA 4F0FA 4NYEA 3HUBA 1Q8TA 4HCVA 4KS7A 3VUGA 4D2VA 4YU2A 5LVMA 2OGVA 2XNEA 4FV0A 5D9HA 5AP5A 2QNJA 5L8JA 3QUPA 1KE9A 1OMWA 3IW7A 3RZFA 5ITAA 4C58A 5M55A 1YQJA 4JVGA 4W4YA 5CEQA 3VN9A 4MKCA 1U46A 5IQGA 4UWYA 1CKIA 3RINA 4IB0A 2GU8A 2ESMA 2Q83A 1G5SA 2O64A 3FQEA 4RFMA 4IC8A 1R0PA 3NUYA 4I6FA 3FMEA 4I21A 4BDDA 3VUIA 3OUNB 5FTQA 3IS5A 3PUPA 3A61A 2ZAZA 3FMJA 4G9CA 2PULA 2X7GA 4J98A 3DKOA 3QQGA 4K2RA 4ACMA 4E4MA 5HTBA 2ITXA 3L8PA 1PXNA 4ZTQA 2WEVA 3R1SA 2OH0E 1ZMWA 4M8TA 1VYZA 3BYVA 1O6LA 5IA3A 4RX5A 1BI7A 3COKA 4GFGA 4HYSA 5DR9A 4EH3A 2XEZA 2F7ZE 3Q5IA 4BVUA 4C02A 5FM2A 2QD9A 2GNIA 3KKVA 4DC2A 3OW3A 4X6QC 1M2PA 2I0YA 4X3FA 3SKCA 3LQ8A 3OCSA 5F20A 4FT0A 3SDJA 3MFSA 4FSYA 2QLQA 1UV5A 4WA9A 1DAWA 2FSMX 3VBWA 2Z7LA 1ZOHA 3NLBA 1YI3A 1H27A 4APCA 2HK5A 4ZY4A 3PPJA 2UVYA 4ID7A 2XK6A 4FMQA 2PE2A 4F1MA 3E5AA 4GJ3A 4IIRA 3HRCA 5EYMA 4KBKA 4LOOA 4MBIA 4QMUA 3WF9A 3E3BX 2BILB 1YXSA 3CTHA 4FZ7A 4O7NA 2GFCA 1CTPE 3QHWA 1QCFA 1YXVA 5FUTA 3QRUA 4H3BA 2GS6A 2JDVA 3S95A 2C1AA 3QHRA 2R3OA 4JBVA 4HCUA 5KMMA 3LXNA 5AUZA 3O71A 3DDPA 2QO7A 1QMZA 3ENHA 4C57A 3VS3A 1RQQA 1XH6A 3ORZA 4FKJA 1YXTA 4G3GA 3TTJA 4D1XA 5HIEA 2CN8A 2H96A 2VO6A 5D7VA 3WIKA 4ASXA 4EH7A 3FL5A 3KXZA 4I92A 3IONA 5LVOA 3ZRKA 4FKTA 4FV9A 3GEQA 2XNGA 4FICA 5F4NA 4YTCA 2UZDA 4FV2A 4L01A 3R7UA 1WBTA 1BKXA 3VBQA 2QLUA 3R0TA 4YC6A 4E1ZA 2PZPA 1AGWA 4Q2AA 2YLEA 3UIUA 3WZKA 4FSTA 3HECA 4QQ5A 4DTKA 1DI8A 1OM1A 3A99A 5AFVA 3MH1A 5JK3A 3FC2A 4FODA 3GU8A 5M06A 3N4TA 3R9HA 2OJ9A 4R5SA 4E26A 1XH5A 5CXHA 4OTHA 4EBWA 5EOBA 4JDKA 3TKIA 4A06A 1ZYSA 4X2KA 3T9IA 4C4FA 4IM2A 4AXAA 3LQ5A 5HG5A 4JS8A 1S9JA 3D5VA 4BZNA 4TTHB 1IA8A 5HO6A 4B7TA 3P78A 5A4TA 3ET7A 4DFZE 1OL6A 3R1NA 5JZJA 4X2NA 4RLKA 4R7IA 4FTJA 4PTGA 3LCDA 2A2AA 3LMIA 3R73A 4Z16A 2DQ7X 4GK4A 3MB6A 4PPBA 4XBUA 3R63A 2X7FA 4UN0C 1WBOA 3VS4A 4Z9LA 4FR4A 2XMYA 3OFMA 3LZBA 5LJJA 4AOJA 3HMPA 3HVCA 2B54A 4BZOA 4WD5A 3PVBA 1IASA 2OF4A 2J5FA 3NYXA 4CGAA 3FI4A 3TTIA 2J4ZA 5A4EA 3TUDA 5F9EA 5HI2A 4EK8A 4BB4A 5JH6A 4AA0A 2GDOA 3O17A 5HE1A 2R2PA 5ANGA 3BCEA 5KMLA 2OJGA 4DCEA 2R3JA 4LRKA 5CVGA 4O0YA 1NVQA 3DGKA 3RI1A 3LFAA 4AUAA 5EH0A 5IA1A 5KE0A 3IW6A 5AM6A 2BKKA 3BEGA 4RQVA 4FYOA 3F2NA 3QUEA 4E4NA 3PJCA 3MGYA 5HE3A 4FT7A 1MQBA 5IQDA 3WARA 2XH5A 4WNOA 1WBVA 5L2SA 2OIDA 2NNWB 3KF7A 2C6KA 1Y8YA 4K0YA 3DAKA 4JX7A 5FXQA 5BNJA 4I24A 3COHA 3KREA 2IJMA 4NKSA 4GW8A 4NK9A 3F9NA 2ITUA 4GVAA 4NU1A 1OGUA 3DK6A 4D1SA 4E3CA 4ZAUA 2XB7A 5DHJA 3ZRMA 4DITA 5E8XA 3F5UA 4E6QA 3F3TA 4U3YA 4UBAA 5EDQA 3ZEWA 4XG6A 5CEOA 4IB3A 2BRHA 2P3GX 2J0KA 3QQFA 4IVCA 2H6DA 4NJDA 3CQEA 2ERZE 5IH6A 5KCVA 1WVWA 4YURA 3PTGA 3C0HA 4HCTA 4X3FB 5H8BA 4XLVA 2V0DA 4ENXA 1PXKA 3MH0A 5E8SA 3C4CA 2IG7A 4UZHA 2YITA 4D5KA 2WMVA 1PXIA 2V7OA 3KRRA 3VQUA 1UKHA 3II5A 1XH8A 4O6LA 3GGFA 5IQFA 4I5HA 1YHWA 4PRJA 3NGAA 2XRUA 3PZEA 3OWKA 3QRTA 3M2WA 4AWIA 2CKEA 2WTVA 4YLKA 1J7LA 4WT6A 5GHVA 4P5QA 4ZSAA 3OXIA 4O0TA 2GPHA 2JLDA 4XRJA 4XMOA 4RQKA 4ZS0A 2E9UA 2SRCA 2XIRA 3JS2A 4RC3A 4E6DA 5EYDA 3F5PA 3DNDA 4F9WA 1PRYA 2LGCA 4JRVA 4G5PA 2VTSA 4U5JA 3LAUA 4XOZA 3JXWA 3R28A 4EH6A 1K2PA 4CQEA 5AP6A 4BDJA 3LXLA 3FV8A 1Q8ZA 3HP5A 1UU8A 3W33A 4HJOA 4CCBA 2XS0A 1PMNA 2X6EA 3KRJA 2EUFB 3DXNA 4QNAA 5IA4A 2PL0A 4ALWA 5HQ0A 4O7VA 5L2QA 4O7YA 3PXZA 4O0XA 2YM3A 4OR5A 4RJ7A 5HCYA 3DNEA 3WILA 4CZUA 3DY7A 3LQ3A 4C38A 3REPA 2FUMA 5FBNC 3VBTA 2RFSA 3FKOA 3HV7A 4RA5A 5ETCA 1VJYA 2DYLA 5B0XA 5GZ8A 4FKLA 4LGHA 1M17A 4AZFA 4EC9A 2WTIA 3LFFA 3OUKA 2BROA 3EQBA 2XK3A 4BCIA 2VD5A 3HDNA 3O7LD 4BGQA 4FG9A 2BAJA 5BPYA 4G3DA 3FMMA 3LE6A 2OXDA 4C4IA 2PVRA 2QOLA 3QCSA 3FZ1A 3PP0A 3Q3BA 4OT5A 4V0GB 3HEGA 2ZV9A 3THBA 4DFLA 5AR4A 2FSOX 3RTPA 4GUEA 1XWSA 4EHZA 2F4JA 2CGWA 4KABA 3SV0A 5IH4A 5AV2A 4YJVA 4DEIA 4F09A 4EL9A 3A4OX 5IDNA 4DFUA 5HO8A 4L3LA 3VWAA 4O0SA 1ATPE 3UPZA 5E8VA 5J5SA 3FMLA 1XBBA 3POZA 4F7SA 2PU8A 4IWPA 2UVZA 3OCGA 4JXFA 3M11A 5HG9A 4ASEA 5AADA 1UWHA 5M4IA 3S1HA 3MFUA 5HBHA 2UZLA 4MXXA 3E3PA 4CRSA 1TQPA 4FTKA 2PVKA 2QHNA 4FV8A 4IX4A 3B8RA 4NUSA 2W5AA 5HGIA 2ETMA 2ETRA 2HZ4A 3H0ZA 4QPSA 2JBOA 3W8LA 4QYYA 1K3AA 4O7WA 2OBJA 4YZDA 4AGCA 4ZIMA 4EHGA 1LUFA 2V22A 3QD4A 4PX6A 3TV7A 2YIRA 1WZYA 2WMSA 2WMQA 4X2GA 3RWQA 3AC3A 2R0UA 5IUIA 5BYYA 4ITHA 3P08A 3U54A 3WF8A 4MX9A 4FKOA 2Z7SA 3EHAA 5DR6A 3PPKA 1GZNA 2J51A 3EQDA 5DN3A 1R78A 4W9WA 4C0TA 4O0VA 4D0XA 4D1ZA 2YN8A 3E8DA 4MK0A 4DH1A 4YZMA 4IMYA 3OY3A 4LV5A 3HMOA 4AE6A 4FVPA 4PF4A 3EKKA 1PMVA 2BR1A 2UW3A 2VRXA 4GL9A 3Q9XA 5JRQA 2PK9A 4TPTA 2FA2A 3NUSA 4FNWA 2FO0A 2H9VA 3UOKA 4UMUA 4YGAA 2X2MA 3I4BA 4XP2A 2ITYA 5EK7A 3SHEA 3ANRA 2C6LA 2X2LA 4OW8A 2ONLA 4YMJA 5C8KA 5HKMA 4YSMA 2XBJA 1UNLA 5IA0A 4B6LA 3EZRA 3P23A 3GC0A 3NYNA 4JAJA 3V5TA 4PUZA 3ZO4A 1J7IA 4CFWA 1MUOA 4RC4A 3ORLA 4ITIA 5BVWA 4U45A 2QR8A 4I0SA 4XG3A 3PY0A 4HZSA 3ERKA 5M4CA 3V51A 3HKOA 4FKVA 4D58A 2W9ZB 3DJ5A 5AP0A 2PMNX 1JSUA 3R8ZA 4C3RA 2OXXA 5EOLA 3QZFA 3PJ1A 1ERKA 3OXTA 4DG0E 3JPVA 2BUJA 3IGOA 4PNIA 1M7NA 1JBPE 2VTQA 5HLPA 3PIYA 4N6ZA 5CI7A 5CSVA 5LVNA 4RSSA 3VJOA 2WKMA 2PVNA 4EZ7A 3A7HA 2IN6A 1M14A 4JQ8A 3KK9A 2IPXA 3G6HA 4QMOA 4RWKA 3SOAA 3R04A 2JGZA 3FLYA 3OOGA 4IZ7A 1O6YA 2VWVA 5EM8A 2ZM3A 4L42A 4EOIA 1JNKA 5GZ9A 3R83A 4WKQA 4OGRA 3KL8A 3NW5A 3D7TA 4HGLA 4OTGA 4PTEA 4KA3A 2NO3A 4XYFA 5ANOA 5EM7A 4K33A 4TYHB 4GV1A 2BCJA 4IAFA 3FLQA 1ZYDA 3ZHPC 4C8BA 4FUXA 1GIHA 3L8VA 4JLCA 4BIDA 4GYIA 4C3FA 2Y6MA 5ACKA 3AMBA 1BYGA 1XBAA 1ZY5A 2OIBA 2ZDUA 3OEZA 5CF4A 3CPBA 3MSSA 3GENA 3TACA 4IWDA 4O1PA 3QTWA 1JPAA 2QU6A 4JG8A 3FPQA 2WTWA 4FUYA 3Q9ZA 5JSMA 3NNUA 5KX8A 3NIZA 3BI6A
chains in the Genus database with same CATH superfamily
3DOGA 3LKMA 4WRSA 4DTAA 4GIIA 4JL9A 4L44A 2VAGA 3BU5A 3D14A 4P5ZA 2JAVA 4XNEA 3SW4A 4KAOA 4F7JA 4F4PA 2FSLX 3R00A 3C4XA 2EU9A 4J53A 4O4FA 3V3VA 5AV4A 3LFNA 3G2FA 2QOQA 4Z55A 4OTPA 2PE0A 2IZRA 3EQFA 5DT0A 2QO9A 3WF7A 3FEGA 4U40A 4AW0A 3ORNA 2W17A 4XS2A 1XHAA 4X2FA 3KXNA 3ZUVA 2BPMA 3CXWA 3RALA 5TOZA 2BTRA 4AX8A 1V0OA 3BE9A 3VC4A 2XKEA 3V5LA 4HNFA 4AE9A 3DK7A 4ACDA 3DFAA 5BMSA 2CKPA 4FSQA 5BVEA 2WGJA 2XIKA 4GG5A 4KSPA 2JAMA 5K4IA 1Y91A 4KBAA 1KWPA 1PY5A 5A3XA 3G0EA 4ANNA 2VZ6A 3CD3A 3ORXA 4EUTA 5L6OA 3MFTA 2X0GA 4FOCA 5HNBA 3NZ0A 2W06A 3MJ1A 4M15A 4BRXA 2JDTA 4ZK5A 1CKJA 2G2HA 3LCOA 2Y4PA 3DBDA 3NS9A 4ZZMA 4ZMFA 3EFKA 3I6WA 4YO6A 3EN7A 4MNEA 2AYPA 1RW8A 2VTTA 4FF8A 4ZTSA 4BBFA 1J3HA 1P4FA 4EYMA 3GFEA 1RJBA 2I1MA 2BZHB 4QMSA 3EQGA 3ZC6A 3MFRA 3V8TA 5EQYA 3K3JA 1QPJA 4Q5HA 5C01A 1Q4LA 4D28A 2X8DA 4J97A 5BVKA 4U97A 3RJCA 1KE7A 4O4EA 2WMBA 3VW6A 2WTDA 3BELA 4FYNA 4AT3A 4X6RA 3TIYA 4DH5A 1PKDA 5A9UA 3NMUF 5CYIA 3TJCA 4E5BA 3UDSA 2HY81 3AMYA 4IZ5A 4ANBA 2P4IA 4DAWA 3AT2A 2V62A 4U6RA 3SOCA 3ZRLA 4AW1A 3S0OA 2YZLA 4DEAA 3DDQA 3HGKA 3QD3A 3VS7A 4FL1A 4WG3A 3AMAA 4XV9A 3AC4A 4TYIA 4BTFA 5CAPA 2YCFA 3ORTA 3JUHA 5GNKA 1H01A 5E91A 5IH5A 4QP8A 2W9FB 3COMA 2YHVA 4MXOA 5AR7A 1FGIA 1PMUA 3PG3A 4EORA 4E8AA 2X81A 4EOOA 2HW6A 2GNJA 4IB1A 3G15A 4YJSA 3W2QA 3R9RA 2WQOA 1Y8GA 3ZLWA 3I0QA 5DR2A 4QTEA 3OG7A 2PE1A 3AD5A 5FD2A 3U4UA 3NUAA 1JOWB 5EI2A 4JQEA 1GIIA 2Z7RA 3R7GA 2CKQA 4TYEA 1H0VA 2BAQA 4I1ZA 4USDA 5CF8A 4X2JA 4LI5A 2PWLA 3PUFC 3ZC5A 3D5XA 4ZJJA 3K3IA 4RGJA 2FB8A 4RJ3A 3BHYA 4O4CA 4Q9SA 1STCE 1MRYA 1VR2A 4QQJA 1A48A 1AQ1A 3AD4A 4RIYA 4O96A 4YP8A 4D4YA 3FLSA 3W2CA 2ZV8A 2BRNA 1GZOA 5FDXA 3QQKA 1XR1A 2XNMA 5IZFA 4DEBA 4O84A 2H34A 3NNWA 4PL5A 5JT2A 4UYNA 3AT4A 4Y73A 4QMNA 3F3UA 3U9NA 2EWAA 4USFA 5J7HA 3PJ2A 4GKIA 2PTKA 5AAEA 3QA0A 4CVAA 3PSBA 2W7XA 5TT7A 4DHIB 3D7TB 3PY3A 2RIOA 4QQCA 1ND4A 3KN6A 4M66A 3NIEA 1BLXA 5EDRA 2JIIA 3EL8A 3IO7A 3HV4A 5IKWA 3EYGA 4I5MA 3MYGA 4QYEA 3BQCA 3RWPA 4GK3A 4RMZA 3LFBA 4CT1A 3UZTA 4FG8A 3LFQA 5L8KA 2VWZA 3MB7A 3TN8A 4AAAA 4D9UA 3OBJA 1DS5A 2C6DA 3C50A 4YC3A 5DI1A 4ALUA 5FBOA 3NVKI 2ITVA 3OY1A 5E4HA 2NRYA 2BDWA 2PVLA 2WMWA 2CKOA 3HMIA 3QGYA 1KOAA 4B9DA 2XK9A 1XQZA 4MBJA 4HVGA 4PDSA 5M4UA 5D1JA 3HAMA 5FP6A 2XJ0A 4EWHA 3PWYA 4FKPA 3KXHA 5BX0A 3ALOA 4MXYA 4O7TA 4FNYA 4FEWA 3K5VA 4X0MA 1BX6A 4YJQA 3DB8A 3T9TA 2ITOA 5HNGA 3PFYA 4QMYA 1BMKA 1OBGA 3KMUA 5M53A 2J7TA 3VUMA 4QQTA 3BBTB 4FL3A 3E8EA 4KINA 3HV5A 2YM8A 4MEDA 4BDBA 2BALA 3VNTA 3W16A 4B4LA 1Q24A 4F6UA 3S2PA 3PE2A 4E6CA 3KF4A 2ZMDA 5BUIA 2QG7A 3FHRA 5LWMA 4FIIA 5CU3A 4FTAA 3BPRA 4O38A 5FG8A 2Y8OA 4QP4A 5H8EA 4DGMA 3KMMA 4R7BA 3AXWA 2XCKA 4UMQA 3N9XA 4E4XA 1H24A 2BFYA 2WMAA 4FTUA 3RGFA 4F08A 4OTQA 3KCKA 5J5TA 5HCXA 1NA7A 1H25A 4U3ZA 4FKIA 5JEBA 4EHVA 3QTZA 4GVJA 4I20A 3D15A 2I7QA 4UV0A 3EN4A 2R7IA 1KUTA 4AXFA 4D4VA 3LXKA 4DFBA 1TQMA 3UG2A 3AG9A 3EB0A 4O27B 3RVGA 2FH9A 1Q5KA 3R21A 4HGEA 4O91A 3TMOA 4UB7A 1O9UA 4O4BB 3C1XA 3RM7A 1U54B 2B0QA 3EL7A 3MIYA 3F66A 5BVNA 5C1QB 4L53A 3CD8A 4LM5A 3QQHA 5EQPA 3PVWA 5ANJA 3MY1A 3PA4A 4MXCA 4TYGA 1NVRA 5AR5A 4AA5A 3HX4A 5LMKA 2QOOA 1H00A 4RX8A 4FKQA 4H3PA 3SD0A 2NRUA 1YXXA 2W5HA 3LFDA 2JITA 3RNIA 5CX9A 5BVDA 5I9WA 5DIAA 4NL0A 2G01A 3NYOA 3MW1A 4XG8A 2X6DA 1Q61A 1TVOA 3LIJA 3Q96A 4FSRA 5D41A 3CTQA 4P90A 4QO9A 4ZLYA 2KTYA 2B9IA 3O23A 4IWQA 5KKRB 1NW1A 4X3JA 2PUPA 1B38A 1U5RA 4J95A 4CZYB 3G51A 1W8CA 4J52A 3QCQA 4ZSGA 3ZSIA 1F0QA 4FVQA 4N4SA 3LLTA 2X9FA 4YZNA 4MXZA 1EH4A 2WQBA 3UJGA 5IA2A 5JFXA 4BBEA 4CLIA 4PP9A 3POOA 3R9NA 2YISA 3HNGA 3KRWA 4R3RA 4V05A 4MD8E 5G6VA 4BL1A 1DM2A 1WVXA 4AS0A 5HO7A 2C5VA 2EXCX 3FQHA 4FTNA 3CSVA 3UQGA 4I6HA 4JAIA 4FBXA 4RIXA 4KSQA 3OCTA 3GCSA 1Y57A 5DNRA 3I5ZA 2X4FA 2JKMA 4MXAA 5IU2A 2C6EA 5H8GA 3VUKA 2WO6A 3TNHA 4NKAA 3GQLA 3FWQA 3WYXA 4F7NA 3NUXA 4X7QA 2YDIA 2OJFE 5CY3A 3T3UA 2HENA 2EXMA 2ITPA 3LJ2A 4WNPA 2XVDA 5KKRC 3DZOA 3Q04A 5ETIA 3GOPA 4HVHA 3BL9A 3PJ3A 3U87A 4XP0A 2F9GA 3C5IA 3VULA 3D5WA 3U8WA 1OZ1A 2VWBA 4QPAA 3VQHA 3QUDA 2VWWA 4IE9A 4Y46A 3WZJA 4V01A 4AXCA 1PYXA 4PMSA 1AD5A 3ROCA 2YAAA 3V5JA 5AX9A 3L9NA 2ERKA 5DBXA 4DHFA 2OH4A 2QVSE 5CAUA 3NDMA 5IDPA 4PMMA 5A4CA 3F61A 5CSWA 4EQUA 2YCQA 2YWVA 3QKLA 4OBQA 4AFJA 4DGGA 4MNFA 4QT1A 3W2SA 4KKHA 2HW7A 3GC7A 4G5JA 3QRJA 1UU9A 1H0WA 1YHSA 2C3LA 2O65A 3DQXA 2VTPA 4MCVA 4UWCA 4U81A 4MWHA 1W7HA 3H9RA 4TY1A 4U7ZA 2QCSA 3LJ1A 3UO4A 4BY9E 4OBPA 4BF2A 4KS8A 2A4LA 3E8NA 4R7HA 1YW2A 1OPJA 5K0XA 5ETAA 4A4XA 4WG4A 3C4ZA 1KV1A 2XIYA 2YZAA 4D2PA 2C68A 5LMBA 4FG7A 5AM7A 3IW8A 4G31A 1J91A 4M12A 3QQLA 2B7AA 1ZY4A 2IVVA 2JIVA 2QC6A 3CPCA 3H10A 5FTOA 4BDKA 5AUYA 3Q53A 2HOGA 2XIXA 4F6SA 5AAGA 4FEXA 4FTCA 1O6KA 4JDIA 3ZO3A 4D2TA 3GI3A 4XJ0A 2V5QA 2QO2A 3PRIA 1SMHA 3GU5A 2OK1A 1OIQA 4YUQA 3CIKA 5IA5A 4RVKA 4QMQA 3A7FA 4S30A 2VO0A 2F49A 3ETAA 5T3QA 1LEZA 3BHVA 5CALA 1ZLTA 4LRMA 4MTAA 4I5PA 4IAYA 3P7AA 1RDQE 4IAZA 3TDVA 3RAIA 4FTMA 2ZM4A 1JKLA 1REJA 5DH3A 1H1QA 4YNEA 4A9RA 4DG3E 2RL5A 5AR8A 1FVVA 3MVMA 4GIHA 4W4VA 4AQKA 1OPLA 2IZUA 5AAFA 2WTJA 4I6LA 2W1HA 5HD7A 3D4QA 1SZMA 5T6KA 1S9IA 2Y4IB 3W0PA 3DKCA 5CU4A 4GCJA 3QZGA 1NXKA 3UDBA 4G9RA 3QLFA 3BU6A 3CLYA 5EYKA 4IEBA 4U0IA 3MVLA 4FIFA 5DGZA 4O22A 3W2OA 2CLQA 4RJ5A 3SRVA 2DWBA 4CEGA 5CEKA 4V04A 1PXMA 2B9HA 5KMNA 2P2HA 1BL7A 2QOCA 5J79A 2UW6A 5J7BA 3R1YA 5LMAA 4AZVA 2OW3A 2VNWA 2VWIA 3VRZA 5JQ5A 4OLIA 3MY5A 3TKUA 2IVSA 3UZPA 3KULA 3PJ8A 3QXPA 1R3CA 3BLQA 4A4LA 5GIPE 2VV9A 4IX6A 5HTIA 1JSTA 4F0GA 4BWXA 4BCMA 1YDRE 3HA8A 3V5PA 4BCKA 3LFCA 3MV5A 3ML1A 3MBLA 1YI4A 5DPVA 2GS7A 2ACXA 2UV2A 3TDWA 4MUQA 3BBWA 3FQSA 1OITA 4RVLA 5K3YA 1XBCA 2GFSA 3F6XA 1TFFA 4WNMA 2VGOA 4CV8A 4K9YA 3BV2A 5AR3A 4JIKA 2IW6A 3U51A 5E8ZA 3VIDA 4FZ6A 1ZRZA 3FMHA 4G6LA 3LCKA 4M84A 2XANA 5KZIA 3P79A 5FEQA 3WE4A 4WNKA 4LDTA 3QU0A 4S33A 4EC8A 1XMLA 1OKVA 3IOKA 4J7BA 2Y0AA 3TUBA 1WFCA 4RIXB 2JKKA 4ZP5A 4Y5QA 5C4LA 4MAOA 3LVPA 4FK3A 3WE8A 4GKHA 4YJRA 3TYKA 2BZKB 4IX3A 4XG7A 2W4OA 4XH6A 5CVHA 5BQ0A 3IG7A 1FBNA 5F95A 2BZJA 1JSVA 3MVJA 4H58A 1PXJA 1W2DA 2C3JA 2CDZA 5AP2A 3VUDA 3SA0A 2GQRA 4PY1A 3CKXA 4C35A 3TEIA 4ASDA 4EOJA 3DAEA 3AOXA 4O81A 5B2KA 2UW9A 4D4SA 1JKKA 4AOTA 2Z7QA 4PPCA 3OROA 3FDNA 5ANEA 2WTCA 4FZAB 2B52A 1UNHA 3DKFA 3EN5A 2BZIB 4G3CA 4EH8A 4TT7A 2X8IA 2IWIA 4X3FC 3I6UA 3OC1A 2I0EA 1JWHA 5L2IA 3I7BA 1ZOGA 3NWWA 4XX9A 3EN9A 4NM7A 3Q2JA 4WO5A 5GJDA 1LR4A 3CCNA 4I6QA 5E1EA 2FGIA 3C4EA 3QZIA 2C30A 1OBDA 2IVTA 3BWJA 2LAVA 3R7IA 1OIRA 4IFGA 1SVHA 2B9FA 1WVYA 4JT3A 4DTBA 5CANA 4HGSA 1OL2A 3R9DA 4GFMA 2C6IA 1J1BA 3HDMA 3F69A 4YBJA 2IW9A 4BZDA 4D0WA 1P14A 3KEXA 2EB2A 3OXZA 5HHWA 4M14A 4I41A 3SLSA 3VAPA 3EOCA 4BN1A 1Z9XA 5GIOE 5LVLA 4XOYA 4ZTLA 4M7IA 5HLWA 3VBXA 2CNVA 1WCCA 3PLSA 5E8TA 1KSWA 3BHUA 3IOPA 4EH5A 3EYHA 4JBPA 4IBMA 1SM2A 3DXQA 4CT2A 3ZU7A 2HAKA 3FLZA 2IF8A 1YDSE 2Q0NA 2WQNA 4PV0A 4FKUA 4TKSA 3ZDUA 2HWOA 4CFXA 4PPAA 1Z57A 4L43A 4IAKA 3TXOA 3WI6A 3LW0A 3UIMA 4CV9A 3KIOC 3QBNA 1FVTA 5FRIA 3OBGA 4NCTC 3MESA 4H05A 2IVUA 3KB7A 5FXRA 2O2UA 4W8DA 1V0BA 1DAYA 3LM5A 2RFNA 5GJGA 2OF2A 4IQ6A 3DPKA 4RC2A 5CEMA 4KIOA 2WTKB 2R3FA 4QNYA 4EQCA 3A7IA 3OT3A 3M1SA 2WHBA 3GP0A 3ENMA 1QPCA 2BHEA 2EXEA 3E64A 3CR0A 3QCYA 4JNWA 4U80A 3AC2A 3HA6A 3FI8A 3CP9A 4NIFA 2UW4A 3QXOA 3FYKX 4FRFA 3V01A 3WZDA 3RPRA 4QTDA 4D2WA 3EQIA 3F3VA 2XYNA 4O4DA 3VONA 2YCSA 4C36A 3PZHA 2G9XA 5IF1A 4NM5A 3FE3A 4QMLA 4WRGA 4R1VA 3ACJA 3HV6A 4X21A 2JEDA 3FZRA 3H4JA 3BLHA 4B99A 4N70A 4CNHA 3BYOA 2A27A 4QP7A 3D94A 2OIQA 4DGLC 3QGWA 4PQNA 1H1PA 4RA4A 4BDCA 3UTOA 3D0EA 3WZUA 4MBLA 4RJ4A 3KXXA 4CKJA 4QEBA 4XEYA 3C4FA 1Q3WA 2VGPA 4FV6A 3OWLA 1ZMUA 3H0YA 3NUPA 3VBYA 2WTKC 5M51A 4IB5A 4W4WA 4CMTA 2AEGA 2R9SA 2XNNA 3O96A 5KHWA 4O0UA 2GHLA 4FTOA 4RIWA 1YRPA 4KUJA 4ORKA 4DBXA 4RJ8A 4BKYA 3ZUTA 4PDPA 4ACHA 1JLUE 4U79A 3QD0A 4P4CA 3MA3A 5AP1A 3SQQA 1JKSA 3C0IA 5K9IA 3F2RA 4LL5A 4TYJA 4F9CA 5JFSA 4ANMA 3EIDA 4Q9ZA 5M4FA 3SXSA 4RBLA 4ERWA 4ANLA 3DFCB 3TCPA 4IM0A 5HVYA 5IQBA 5DT3A 4AP7A 1KE6A 4DCAA 4MQ1A 1IR3A 3DKGA 2WELA 3A7GA 2C1BA 3EQHA 3FLWA 3NNVA 4BCOA 2UW5A 2WMRA 3PXRA 2RGPA 4UMRA 4IZYA 2XM8A 5AEPA 5CXZA 1OUKA 4ZXTA 1MP8A 1SNXA 4MWIA 4BIBA 4KBCA 5HESA 4DFXE 4LFIA 4MQ2A 5HBJA 5L8LA 4F6WA 3IKAA 5FXSA 3W55A 4AW2A 2XNOA 5CSHA 3F7WA 4IJPA 3FYJX 4F99A 2XJ2A 3ID6C 3U55A 4AGWA 4QD6A 3EQPA 2BRBA 3A60A 3QWJA 4FSZA 1BL6A 2GHGA 5ANKA 2G1TA 5IPJA 2NYAA 4C61A 1F3MC 4QMZA 3PRFA 5ANIA 2PVHA 3Q52A 4YLJA 2JIUA 3W32A 2B9JA 2QURA 3K2LA 2R3GA 4I6BA 3SC1A 3QTUA 2G2IA 2ITNA 3VW8A 5KBRA 3ELJA 1G8AA 2VTLA 1KV2A 3N4UA 3MH3A 1JAMA 1G8SA 3F2AA 2AC5A 2BDJA 4AAYA 4XV1A 1GY3A 2C6OA 5BMMA 1NT2A 2XP2A 2R3QA 1MRVA 4E5AX 3BZ3A 4BDIA 4BCNA 4ZLZA 3DCVA 4FIJA 4JBQA 1R39A 3ZZEA 2WFYA 4KIPA 1PYEA 3GQIA 5LCJA 4K11A 3SG8A 5ACBC 4KIKA 4NSTA 4EK5A 5EQEA 4D55A 1UA2A 3UO5A 3DXPA 3HLLA 4AN9A 2GS2A 3PYYA 4C4HA 1XJDA 1ZARA 4H1MA 4JG7A 4N6YA 2VTAA 5CQWA 4HOKA 2CGUA 4XG2A 5L6WL 3W10A 4I94A 5BUJA 3VS6A 2HWPA 5E8WA 4KD1A 4TWPA 2OICA 2R3MA 2YAKA 4PL3A 2CCHA 5EI8A 4ENYA 3UC4A 2ITQA 2XKFA 2J2IB 4FIEA 3O51A 3CGOA 3L9LA 4EHEA 3R8LA 2B1PA 3JVSA 4EQMA 2C5YA 2PVMA 3KGAA 2BMCA 3QALE 2RG5A 1YOLA 1Q3DA 2B53A 2W05A 5C26A 5EM5A 2C3IB 5HU3A 3QX4A 3FI2A 2ZV7A 3KK8A 3PXQA 3Q4UA 3OTUA 4LOQA 3W2PA 3DV3A 4RZVA 2OJJA 3A62A 4DFYA 3JR1A 5HG7A 3ULZA 4J71A 4AZSA 4FTRA 4AU8A 3TNPC 4RG0A 3JY0A 5E92A 3FKNA 4CKRA 3QKMA 4S34A 1ZMVA 1PHKA 3IW4A 5FGKA 2E2BA 4F7LA 4F63A 3KA0A 3VF9A 4HZRA 5I3RA 3ATTA 5KHXA 4ZSLA 1L3RE 4C59A 4E6AA 4XHKB 4NT4A 3KMWA 5JZNA 3UP2A 1UVRA 3QC9A 4L45A 4Y8DA 5DEYA 4CTCA 2R3KA 3FXZA 4NIFB 3UDZA 1XH4A 3GCQA 4MHAA 3CC6A 4J8MA 5EW9A 4A4OA 3FSKA 4YR8A 2PZ5A 2XK7A 3FHIA 3IPHA 5EM6A 5CAQA 1HCKA 3DB6A 4L3PA 1SVEA 4G16A 4JQ7A 4TN6A 3NW6A 5IG1A 5CAVA 1ZWSA 3G9NA 1V1KA 4RZWA 4BCQA 3EQRA 3LCSA 3BYUA 3G33A 4W4XA 2YIXA 3C7QA 3P7CA 5KZ0A 5FEDA 4FA2A 3O0GA 3I79A 2JKOA 3NRMA 2WU6A 4AZTA 3S00A 4UX9A 3KVWA 2W1ZA 4YBKA 4FV7A 4GUBA 2PVYA 3NX8A 1Q8YA 4G1WA 5AUXA 4F0IA 4EH9A 1OKYA 3RBWA 3FC1X 3H30A 1PW2A 4LL0A 5CI6A 4I0TA 4GJ2A 4NW6A 4Y72A 3IECA 4M3QA 4R5YA 4BDAA 5L3AA 2UW0A 2W0JA 3A7JA 5A54A 2JFLA 3IDCA 3N51A 4IW0A 4K6ZA 2WZJA 5AUUA 5DWRA 5GZAA 2RSVA 1P4OA 2W1IA 2X8EA 3F5XA 3GNIB 4Q5EA 4BTJA 3UPXA 4Z7HA 3FL4A 1CMKE 5CU0A 5HIDA 5HORA 4BCFA 3L8SA 5JQ8A 3FMNA 3PY1A 1ZZ2A 2OFVA 5L2TA 2XJ1A 3MTFA 4D9TA 4IACA 4AACA 2E9NA 4BGGA 4Z3VA 1IA9A 2JBPA 3KY2A 5AUTA 3E87A 4R3CA 2ZB0A 1M52A 1T46A 5FP5A 4EOMA 4YPSA 4O7SA 3NSZA 1XKKA 3FSFA 4HW7A 1G8KA 5KMIA 4AQCA 4JI9A 5JKGA 4L7FA 3QZHA 1H08A 5GINE 4NM3A 4E7WA 2CNQA 4G34A 4JX3A 4F1TA 4YJTA 4FKRA 4OBOA 1B39A 4FTLA 3UG1A 3OHTA 4AW5A 4RFYA 4JRNA 3QTXA 2ITWA 4O1OA 4RFZA 2UVXA 4AFEA 1WAKA 2BIKB 4PDOA 4QYGA 4TZRA 3WF5A 2NPQA 4JG6A 4EK3A 2I0HA 2VTJA 2QQ7A 3VHEA 1NVSA 2ONLC 2YM7A 3HL7A 1GJOA 4AZEA 2UZTA 4TWNA 4RRVA 4I5CA 1VYWA 5A46A 3CY2A 3RCJA 4FC0A 2EVAA 3LMGA 3I7CA 4E4LA 1W84A 1YWNA 4DE4A 2C69A 4C7TA 5IISA 3FBVA 2W1CA 3I1AA 4YJUA 1Z5MA 4KIKB 2AQXA 2XRWA 3EWHA 3Q6WA 4XLIA 4EJNA 4KRCA 4LUDA 5HICA 5JFVA 4BTMA 1I09A 1QL6A 4TL0A 4CLJA 3QRKA 4J99A 4YLLA 4ZLOA 4IX5A 5AP4A 3QAME 4C4GA 4C33A 2W1FA 3GVUA 5CVFA 4KWPA 4XBRA 5DVRA 5HE2A 4EYJA 4FTQA 3AKLA 3ZCLA 4ZOGA 2GQSA 1W0XC 4O21A 4XRLA 4FGBA 4J8NA 4EOSA 4IVDA 3ULIA 4G3FA 2R3HA 4H1JA 5LCKA 4IANA 4PMPA 4KNBA 3ODYX 2O3PA 2VWYA 4GH2A 3TT0A 1E9HA 4GU9A 5L6PA 5BYZA 2Y9QA 4GFOA 4C37A 2ZDTA 2I40A 4EOKA 2QKWB 3UYSA 1WBPA 4YJPA 5TO8A 1APME 1FMKA 2YJSA 3VS0A 2J6MA 3ZMMA 5BVOA 1XMMA 3Q32A 1OI9A 3BX5A 1OECA 3VS5A 2OZOA 5A4QA 4KRDA 3ZO1A 4ZJVA 3F3ZA 2OO8X 4CFMA 4PTCA 3NVMB 1H4LA 5C27A 3WBLA 1LPUA 4M13A 4FKSA 4G3EA 3VRYA 2VTIA 4M67A 4ACCA 1YWRA 4F70A 3O5AA 5H9BA 4RWIA 4FV3A 3W0QA 3QYZA 4U9AA 1ZXEA 1W2FA 4RVTA 3E93A 4AXDA 4BI0A 3TG1A 4DA5A 3JYAA 4JIAA 4OUCA 4QOXA 2XNBA 4MNEB 4YNOA 3BGZA 4OT6A 3UGCA 5M44A 5A6NA 2YJRA 4R6VA 3MN3A 4L9IA 4K18A 3MIAA 1W98A 3L8XA 3PG1A 5EFQA 4ZY6A 3DA6A 1E1XA 3KN5A 1GIJA 3R9OA 3U9CA 2W1DA 3UODA 4DH8A 3DU8A 2XAOA 2RKUA 2QU5A 3H9FA 4O86A 5B2MA 1MQ4A 4GK2A 1UWJA 2XF0A 3PFQA 4BYIA 3P4KA 3R8PA 2O0UA 3D2IA 2C5OA 1UU3A 5EKOA 4KIQA 4L00A 3BGPA 3E92A 5I9YA 2JDOA 1LEWA 3I0OA 1UNGA 5BV3A 2ZV2A 4QP2A 2YM6A 3W18A 3FKLA 3R8UA 3ZXTA 4H36A 3UQCA 5FM3A 4F9BA 5AP3A 3GB2A 4L3JA 4RX9A 4TXCA 1P2AA 2YWPA 4MD7E 2YDKA 3ZLSA 3GU4A 2F7XE 3FZOA 2UZWE 4B8MA 4NTSA 1OUYA 2Z60A 4H39A 3ZONA 5AV1A 2YEXA 3KRLA 5AWMA 5JGBA 3LFEA 4U44A 5L4QA 3NCZA 4W9XA 4WIHA 3H9OA 5M09A 2O8YA 3BU3A 4CD0A 2PMLX 5AMNA 2UW8A 3W1FA 1YDTE 3DZQA 5CSPA 2I0VA 2GNFA 3S3IA 4FI1A 4WOVA 4BWKA 4QPMA 3MPMA 4QP6A 4UY9A 1H26A 1PXLA 3PWDA 3FMDA 1M2RA 1CSNA 2X4ZA 3NEWA 4IXPA 5HEZA 3MTLA 3RP9A 4DGNA 4WBBB 3EN6A 3SX9A 1XH9A 3L1SA 4EOLA 2VX1A 4C4JA 1PKGA 1BUHA 3MI9A 2ITTA 3DBEA 3CBLA 3O8PA 4DEHA 4EH2A 1OB3A 3UIXA 1IG1A 2C4GA 4RIYB 4LG4A 3WF6A 2A19B 1W83A 4GU6A 5K0KA 3VO3A 2OZAA 2QKRA 3PA3A 3RPOA 4WSQA 4EONA 5JGAA 4HYUA 5DRBA 5ETFA 2QG5A 3ZTXA 1OKZA 5I9VA 4WG5A 2C3KA 2XZSA 4MF1A 3DBFA 3R71A 2B4SB 3TWJA 3ZLYA 1XH7A 4R8QA 4ZTNA 2W1EA 4FIGA 2A1AB 2WU7A 2WPAA 3PSDA 3EFJA 4DFNA 4QTBA 5K5XA 4PDYA 1QPEA 3QC4A 3ZFYA 1W2CA 5E7RA 5LARA 3BYSA 3TZ7A 4IM3A 5CENA 3HRBA 2V7AA 3GCUA 3MJ2A 4QTCA 3AGMA 2C0OA 3ROYA 4O2ZA 4K8AA 2W5BA 5ANDA 4GT5A 5BUEA 2XEYA 3A8WA 4ZJIA 3T8OA 4IDTA 3OWJA 1WBWA 5CQUA 4CKIA 4FSNA 4RIOA 5LVPA 4NFMA 4RWJA 3GXLA 2H8HA 3ZDIA 3OT8A 2ZM1A 4QMTA 3GCVA 5J9LA 2YIYA 2QOIA 3R02A 4O2PA 3GBZA 1REKA 4R3PA 3VUHA 4C62A 3OMVA 5HLNA 3QQJA 1KE8A 3PPZA 1PF8A 2EB3A 3QA8A 4G6OA 2C6MA 2XKCA 3I5NA 3NAYA 5D12A 3FY2A 2UZBA 5CF5A 4BC6A 4WUAA 5TF9A 3BHHA 1T45A 1A06A 1U4DA 4RLLA 4TW9A 5CS6A 3RZBA 4NCTA 4BDFA 3NPCA 4CFFA 2IEWA 2R0IA 3IW5A 1Q62A 4Y5HA 4AF3A 4Y83A 3E8CA 1TQIA 1L8TA 4O0WA 4XP3A 3F3WA 3HV3A 1YOMA 3TNIA 4A07A 4OTFA 4F65A 4E73A 2PYWA 5IQHA 2JFMA 2XM9A 2VX3A 4LUEA 3QTRA 3HP2A 4UWBA 4QMVA 5AJQA 5AUVA 4HGTA 3LMHA 3LXPA 1VEBA 3QF9A 3LCTA 3COIA