2YHVA

Structure of l1196m mutant anaplastic lymphoma kinase
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
308
structure length
291
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILMELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Design of Potent and Selective Inhibitors to Overcome Clinical Anaplastic Lymphoma Kinase Mutations Resistant to Crizotinib.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 291
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yhvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yhvA01
2OLCA 3S95A 3UMWA 5HVJA 4AZFA 2HXLA 4YSMA 1SMHA 2XJ2A 5F95A 3VNTA 3ORNA 2R3JA 5FEQA 4E93A 2XF0A 4WNMA 4BBFA 3P86A 1DM2A 4M8TA 3FLNC 4BGHA 5A4TA 3SGCA 4MNEB 2WPAA 4K1BA 3F82A 2C47A 4JG6A 3T3UA 1PXJA 3BEAA 3CD3A 4PPCA 2A4LA 4AN9A 3OOGA 2QKWB 3FKNA 5AJQA 3L8XA 2YCRA 3RPSA 2YM5A 1W7HA 2H6DA 4HGSA 2R3LA 2LAVA 3SXSA 4DTKA 3GP0A 5LWMA 1WBWA 3UC4A 4EH5A 3BLQA 2C6MA 3GCVA 3NUNA 3EQHA 4R7HA 1YOJA 3TIYA 4XRLA 3BE9A 4C61A 5IA4A 4DH8A 2PVYA 4UMRA 3GFEA 3HLLA 3VUTA 3BLHA 4KD1A 4X2JA 5ETIA 3TZ8A 4FK3A 4XV9A 3R7YA 3NIZA 1A48A 1Q5KA 4RQVA 4FUXA 2OZOA 1P5EA 3A7FA 5AP5A 3ZYAA 2WOTA 4AACA 4ANSA 3R9HA 5IEYA 3CLYA 2VO0A 4IDTA 4DEAA 4QYHA 4ASEA 2JFMA 3HX4A 4IQ6A 3V8TA 2IZUA 3PWDA 4Y5QA 2QNJA 4QQCA 2NRUA 5B2KA 3K5UA 3RALA 3UIMA 3VUDA 4E1ZA 1WBSA 5HO8A 4EZ5A 5AEPA 4JDIA 2W05A 4LOOA 2XB7A 3MI9A 4D2SA 4A07A 3QF9A 4DGMA 4O22A 3ZLYA 2BZHB 5BNJA 4QMLA 4I3ZA 4DTBA 3UVRA 2CN5A 3KXZA 3I4BA 2WTJA 2ERZE 3E93A 4QYGA 2E9OA 2W06A 3COIA 3N9XA 2WTDA 3NNVA 3O8TA 4IVBA 4OTWA 5FRIA 3QUEA 3PA4A 3DJ5A 3QL8A 1KSWA 5EW9A 3LMIA 4RC2A 2ITOA 3C4ZA 2R3MA 3C50A 3BBTB 1WVXA 4YZBA 2OIDA 2DUVA 3EKKA 5E8VA 2VO3A 4N6YA 4EH9A 5E8YA 1JWHA 4PL4A 4MXAA 3IS5A 4LGGA 4BBMA 4MKCA 3R0TA 2R3QA 2J5EA 3L1SA 2B9HA 3W2OA 4RJ3A 3R6XA 2WD1A 4MYGA 4JBOA 4CKRA 4YTFA 5HIEA 2VTLA 4FKUA 4I5PA 4ZY5A 1Z9XA 5I9WA 2GNFA 3CTQA 3OWLA 1K9AA 4TZRA 4FKTA 3O0GA 3QXPA 4FZAB 1S9JA 3DCVA 3F5XA 3TDVA 4C2VA 5GZ9A 1FOTA 3LFBA 4ZLYA 5JFWA 4K8AA 1AD5A 4IHPA 4BDKA 4CMOA 2XYUA 4IM3A 4QP1A 3V5JA 4TN6A 1ZMVA 3ZDUA 2R3PA 4RJ7A 5JH6A 4MBLA 4IX5A 5FXSA 5IEVA 1PW2A 2R3HA 2VTIA 2O63A 3ZDIA 2VWZA 3PYYA 5T6KA 3RNYA 4RT7A 4TWCA 4IJPA 3RINA 3MPMA 5ETCA 4GH2A 3QTIA 3FMDA 4BYIA 2CMWA 4FL2A 1YQJA 2VTSA 4QYFA 4YZNA 2RG5A 5L8JA 4J8MA 4TL0A 1PYEA 3TNWA 2YA9A 4KIPA 4MHAA 2W1EA 3RPVA 3R04A 4C4JA 3ZUTA 3MDYA 4K6ZA 3RHKA 4CXAA 5HLPA 2XK6A 3QD2B 5HE0A 3BQRA 4RJ4A 4WOVA 3RTPA 5C8KA 2OSCA 3PJ2A 4FIJA 4KABA 2O8YA 3LCTA 2ACXA 1IEPA 2C1BA 4YJTA 3QKKA 4JRVA 3OVVA 4B7TA 4I1ZA 5H8BA 3OTUA 4UY9A 3DZOA 5J9LA 3UIXA 3O96A 2UZDA 3DAKA 2W5AA 4BDDA 2OO8X 5CZHA 4AW5A 4DT9A 3LE6A 1KOAA 3QHWA 2BZKB 3FY0A 3E64A 5HCXA 5IF1A 3PY3A 2QOQA 2F2CB 2YERA 4TYIA 3N4TA 4I6BA 3P4KA 5JQ8A 3I1AA 4GEOA 4OTIA 2VWVA 4CFVA 4NFNA 3PG1A 4C34A 4AXAA 1ZXEA 2PVFA 4LM5A 4U45A 2IW6A 2HENA 5KMKA 4J95A 4DCAA 3W2PA 3LJ0A 5LMKC 4UYAA 3CE3A 5E8ZA 4X2NA 4LYNA 3UVQA 4FIGA 4BCQA 2ZAZA 4E7WA 3OUKA 1W84A 2YN8A 3KU2A 3LFNA 3ZFXA 4LUDA 4ZP5A 4EI4A 1YI3A 4PV0A 1TQPA 5HD4A 5BVNA 3DB8A 2BKZA 2PVJA 2C5XA 3R71A 3PTGA 4B6LA 2Z02A 2GHMA 3QTRA 3R1SA 4I0RA 2WMAA 2WHBA 2UVZA 3U6JA 2A1AB 4R3RA 4EWHA 2C5OA 2PK9A 4PL3A 3FZSA 1PKDA 1PXNA 3H4JA 3H9RA 4KA3A 2KULA 4EYJA 3HAMA 4MNFA 3GGFA 1UVRA 5EOBA 4YHFA 5LARA 5C4KA 4NZWB 3F61A 4F9WA 2RGPA 1GOLA 3BHHA 3ORTA 3RPYA 4JT3A 4Y83A 2ONLA 3AD4A 4FKGA 3DTCA 3O23A 4FTOA 2R64A 4FNWA 4FTQA 3CEKA 4PP9A 5CTPA 4FA2A 4FV4A 4JR7A 4X7QA 1J91A 2DS1A 4D1XA 4DFXE 4O7LA 2HELA 4P7EA 4AFEA 4CFNA 3PRIA 5JEBA 4GS6A 4M3QA 5AP4A 2W5BA 3AC1A 5CI7A 4YGAA 4BDHA 3UO4A 3PJCA 5A6OA 4DBNA 2V7OA 5E8XA 4PMSA 4FT5A 3C4XA 4F09A 1FINA 2AUHA 4DEEA 3DBEA 2B7AA 4F08A 3FEGA 3RK7A 1U5RA 4MX9A 1M2QA 1WAKA 5EM5A 5BVOA 3MH1A 4BDAA 2P55A 4DN5A 4F6WA 2REIA 4O38A 4CRSA 4DGOA 4FTNA 4EOMA 2F7ZE 4UALA 1XO2B 1V0BA 4GT5A 5JQ5A 4YUQA 4J96A 5AR5A 3CPBA 4QP2A 4TPTA 5CX9A 3UTOA 1OMWA 4GV1A 3R8ZA 3PSCA 5A4CA 3DFAA 4FSNA 3FV8A 4EK8A 4ZTHA 5KMIA 5AUVA 2PZIA 3QCYA 2C4GA 3MGYA 2VWUA 4L52A 5CEMA 3LLTA 2VRXA 3ID6C 4Z16A 3FAAA 5HE2A 5FDPA 3OZ6A 4IWDA 3P7BA 3ATTA 2WQBA 4E6QA 4JL9A 2HOGA 3DOGA 5K5XA 2XIRA 4FV0A 2H96A 2X0GA 4HNFA 2P2HA 1LEZA 3LXPA 3E92A 1KOBA 4K0YA 4OTRA 5GJFA 2W1CA 4BIEA 3RVGA 3RWQA 1OKVA 2YITA 3DAEA 3W2RA 2YIXA 4C4IA 2HXQA 3ZM4A 5H9BA 4XCUA 5IMEA 2BPMA 3SVVA 2OJGA 2QI8A 5F4NA 3JY0A 2J5FA 3U8WA 2QO7A 3SXFA 2X4ZA 1OIQA 3LJ1A 1KE9A 2Y4PA 4PTCA 4W8DA 4KRCA 3CS9A 4USDA 4MXCA 3F5GA 3GC7A 4UXQA 2Y7JA 2PVNA 5EI6A 5CF5A 1OPLA 1HCLA 4Z55A 2WFYA 3UO5A 1OKYA 3I81A 4C4FA 4FG7A 2XNPA 5CLPA 4DBXA 2X6EA 1QL6A 3L9MA 1BKXA 4FTRA 1UU3A 2BDWA 4H3PA 5AMNA 4ZIMA 4M13A 4RWKA 4U43A 4XP3A 4I0SA 4DEBA 4C3RA 1ZYJA 2YHVA 3BYVA 2UZWE 4GCJA 4FL3A 4Q5HA 3ZSIA 3LXKA 4RWJA 5J95A 1KV2A 4ASXA 4C8BA 3E7OA 4PL5A 2W1GA 3E3PA 4BRXA 2WEIA 3UQCA 3HP5A 2W96B 4WNPA 4CZYB 4IAAA 5IISA 3IG7A 2WQMA 4XP0A 3R9DA 5ETAA 5FEDA 2PULA 2YM7A 2YM4A 4EH7A 4JS8A 3VUMA 3W2CA 1J7LA 4HCVA 4I5HA 5DBXA 1M2RA 4FEVA 2CGVA 1JSUA 5ANEA 1OBGA 3SX9A 3E62A 3U4UA 3DQXA 5M56A 4OAVB 5CSVA 1Y57A 2WMSA 4R3CA 4D9UA 1R39A 2FB8A 2ONLC 1OKWA 2B9JA 3NW6A 3C4CA 3HL7A 5E8WA 3R9NA 2CHLA 4FK6A 1ZZ2A 5EYKA 3ZOSA 3KL8A 3TUBA 4FTLA 2QLUA 4CFXA 3FXXA 3IGOA 2X4FA 3A2CA 1PXLA 2B1PA 3E8EA 3QRKA 5JGAA 4CTCA 4FC0A 3ULIA 5EDQA 1OUKA 2W1ZA 3CPCA 3PP1A 4S33A 2JKOA 2CNUA 4UWYA 3DNDA 3WOWA 3TV6A 3FI8A 3P5KA 2WMBA 4W8EA 5A46A 3M11A 4RX8A 2OIQA 3N4UA 1NY3A 5CANA 5KHWA 2JLDA 2V62A 4F7JA 1QPJA 2X2MA 2CDZA 2GDOA 5CQWA 3EQPA 3Q9YA 3QQFA 4RFYA 5E92A 1H07A 3BKBA 5J1VA 4DFBA 2C0TA 3H9FA 4BI1A 1UKIA 4IM0A 2WQOA 2YAKA 3NWWA 4AOJA 4U3ZA 4FR4A 5HD7A 5IA2A 2IO6A 2Z60A 3JY9A 5DR9A 5AUXA 5L6OA 3BGPA 5GINE 2RKUA 1OIRA 1UV5A 2B52A 1ZMUA 3PE1A 4RWLA 2PPQA 4D4RA 4E4NA 3ZFMA 4YO6A 3BEGA 3CR0A 3BLRA 3TV4A 3RM6A 1XH7A 5LWNA 4OGRA 5AX9A 3IONA 5LMBA 5AFVA 3MBLA 1JKTA 5CT7A 4A4LA 2JDSA 5AIRA 2I0VA 2YCFA 1PXIA 4JAIA 4FV2A 1REJA 5KMNA 4AT5A 4FSUA 3FI3A 3Q4CA 1B38A 3HV4A 4I4FA 5BVWA 5G1XA 5KBQA 4FGBA 1PMVA 4U7ZA 4V04A 4ZS4A 5CASA 1M2PA 3QZGA 2XMYA 3FPMA 1ZRZA 4YP8A 1U4DA 3IDBA 2BR1A 3U9NA 3W33A 3FHIA 2JGZA 5CEKA 3PZEA 1Q62A 4DLJA 4KSQA 4EC8A 1H1QA 4J71A 3LAUA 1JKLA 3LOKA 4EYMA 3DK6A 2JBPA 2G9XA 3R2BA 3OMVA 4IAIA 3WZKA 3GU6A 1ERKA 5FBOA 4YLKA 4JOAA 4ZSEA 3ZEWA 3FLSA 4NM5A 4S31A 4BIDA 1SVEA 3H0YA 4M66A 3VRYA 4G6LA 4OW8A 3HMOA 4DFNA 3LKMA 4JXFA 3FQSA 4P5ZA 4S32A 1E9HA 3QQKA 1IRKA 3QYZA 4RX7A 4QTBA 2WGJA 3MW1A 3FMLA 4JX3A 5A3XA 3R7OA 5LOHA 2WMUA 4OBQA 4TXCA 3G0FA 3BWFA 2UW9A 3F3WA 4NEUA 2NNWB 4AZTA 4BI0A 3OHTA 2W4KA 5KZ0A 1W8CA 4AGCA 3F2NA 3PP0A 5M4IA 2PYWA 3JYAA 4HYHA 4E6CA 5HHWA 5M53A 3VF9A 4GVJA 3BHTA 4O1PA 3MH2A 3KULA 3S4QA 2J0KA 3I7BA 3KCKA 3QLFA 4JIAA 3QUDA 5HI2A 4NKSA 1O9UA 1OL6A 1HOWA 2WMQA 3L8VA 4G3EA 4GT4A 4A06A 5KBRA 4DTAA 4O0YA 1J7UA 4HVSA 2E9NA 2PU8A 5IU2A 5DH3A 1FMKA 3QHRA 2VWIA 3H9OA 4QO9A 4ZS0A 4IDVA 2WMRA 4RIYA 4TYEA 1UKHA 2QURA 1WMKA 3UO6A 5EYDA 2QG5A 4HCTA 3KULB 1UU8A 5H8GA 3QX2A 1GIHA 2VNYA 4YTCA 3HEGA 5ETFA 5KMOA 1YOLA 4IC7A 3VF8A 3QU0A 4FVQA 2RIOA 3C0GA 4I6FA 3KK8A 4OT6A 3SW4A 4RMZA 4TTHB 4NTSA 1P4OA 3GNIB 4QYYA 3ZBFA 2UZTA 4NSTA 2JITA 4L43A 1FVVA 3P23A 5K3YA 3IO7A 5C8MA 4ZTSA 5AR2A 2C6LA 3ODZX 4RIYB 3GXLA 3QZHA 2CNQA 3Q4TA 5IH4A 4P2KA 4E26A 3CGOA 3LQ8A 2JKMA 1ZLTA 2GNGA 3G6GA 3BPRA 2XKCA 3K54A 3VUHA 4BI2A 5BUEA 4BYJA 3BHVA 1M14A 3LFCA 4FSQA 3E5AA 3MV5A 2W17A 4FKIA 4WIHA 4AOTA 1SZMA 4EBWA 5IH5A 3GQIA 2IPXA 1YHVA 1Y6AA 3RCJA 3T9IA 1PHKA 3V5QA 3BYOA 3BU5A 2XEYA 3KRXA 4YBKA 5DRDA 4CKJA 1SVGA 4G9CA 3OW4A 3I5ZA 3RPOA 2CGXA 1VR2A 3A7JA 3QTWA 5J5TA 3OCGA 3C4EA 3NNXA 3R8UA 2WTKB 4D2WA 4RFZA 3LCOA 2ETKA 1BLXA 3BE2A 4GIIA 1GZKA 2GTNA 4BB4A 3MESA 1PXMA 2VO7A 1SYKA 2ETRA 1UU7A 1ZWSA 1Q61A 1JLUE 3I60A 3GBZA 4NK9A 4O96A 3R9OA 1XR1A 5DE2A 2Z2WA 4XOZA 4UB7A 1JAMA 2W9FB 3F5UA 4PNKA 3FMHA 2BHHA 5IUHA 3KC3A 3FBVA 2PE1A 3NSZA 4ANMA 4GFGA 4L45A 2WTCA 1H28A 4FV7A 2XRWA 4AN2A 3A7IA 4ZXTA 3TKIA 2WO6A 3O8PA 2UZNA 3Q9WA 4YJOA 3LQ3A 4ZJJA 1FBNA 5HO7A 3MH0A 2GSFA 5L2IA 3NAXA 2BAJA 3MJ1A 5ANDA 2W5HA 2QOOA 2UW5A 3D0EA 5CEPA 4RSSA 1KE6A 2VTNA 5IEXA 3GOPA 3ZRLA 2YIRA 3R7IA 4O7NA 3HV6A 3NYNA 4MWHA 4OBPA 2GCDA 4CTBA 3W55A 3IW5A 5A14A 4X2GA 3V01A 1JOWB 1E1XA 2ZM3A 4L9IA 4C4EA 4L7FA 3CBLA 4RX9A 1WBPA 2OJ9A 3QTQA 5AUZA 2BZIB 3D15A 3OEFX 5E90A 3VULA 3KFAA 3LCSA 4R6VA 4EH2A 3JXWA 1GIIA 4XG8A 3DU8A 4PRJA 4F1TA 1VZOA 4ITIA 4J8NA 4U9AA 3QLGA 3ZO1A 3BRBA 4BCKA 3MVMA 4DC2A 1IA8A 1CTPE 2QOFA 3ANRA 3PJ1A 4U8ZA 5L3AA 1H1RA 2PTKA 5TE0A 4RPVA 3RAHA 3TZ9A 4ZSAA 2B9FA 1M7QA 1CMKE 4XMOA 4KBKA 3AGLA 3DLSA 4YHJA 2ITVA 3KK9A 4FV9A 4GFMA 4JNWA 3HKOA 4EOKA 2YAAA 4M84A 4YZ9A 4CZTA 3PPZA 4RLKA 2A2AA 4WG4A 3DJ6A 2QCSA 3MYGA 4IWOA 3D7TA 4Q5EA 5IG1A 3OXTA 3NGAA 3D5VA 4USFA 3LJ2A 2HZNA 1JSVA 3OBJA 1PMUA 3OW3A 3LM0A 3KRWA 2XK8A 4L53A 5BYYA 2VX3A 2IN6A 1IA9A 5KO1A 2FVDA 3QGWA 3WE8A 1T45A 4IC8A 2X2LA 1ZARA 2VTPA 1XH9A 2XA4A 4FTUA 2HIWA 4QTDA 5CQUA 3OCBA 4QYEA 3TUDA 4I23A 3OY3A 4FG8A 4KKGA 4TWPA 4AN3A 2XH5A 2C6OA 4FV6A 2WEVA 2CJMA 2QR8A 3D7TB 3NUSA 3V6RA 5EQPA 4YC3A 4JQEA 4CV8A 5IQAA 3ZM9A 3AG9A 3G5DA 4MXZA 4A4OA 3DXPA 3SC1A 3D2KA 2XS0A 4FYOA 4UEUA 2O65A 3A4OX 2WTKC 5EM6A 5F1ZA 4RIOA 5GHVA 4FEUA 3KMUA 4ALUA 2B54A 1BMKA 4YSJA 4TYGA 2AC5A 2GNJA 5EG3A 3DTWA 1F3MC 3HV7A 4FV5A 3AT4A 4AZSA 2BAQA 4AT4A 3DXQA 1CKPA 3SQQA 3LZBA 5EYMA 3AQVA 3BHYA 5CY3A 4HGEA 4CT2A 3RAWA 1KE5A 3E88A 4FT0A 4NH1A 4F9YA 3SD0A 2JIUA 3ZRKA 2Y9QA 2CKOA 4E4MA 4NKAA 1SNUA 5KZIA 3GCSA 3EFLA 1XBCA 2RFDA 2VGOA 5CVGA 3D7ZA 5FUTA 2XNNA 2ZMDA 1NVRA 2XZSA 4U3YA 3PXFA 4DFLA 3IW6A 1GZ8A 4LRKA 1GZOA 2DWBA 4KNBA 4EUTA 3E8CA 4LFIA 4F70A 3CXWA 4WSQA 2PVHA 4ZLOA 5M4UA 1PJKA 3FC2A 4J7BA 4KKHA 4Q9SA 2A0CX 5EHLA 3Q2JA 2VV9A 3OWPA 1MRUA 5ANIA 5I9XA 4IAKA 3MSSA 5EI8A 4BGGA 3NCGA 4OTGA 1ZYLA 3GB2A 5CSXA 3RPRA 4FEXA 4XEYA 4IZYA 2XIKA 1UA2A 5CT0A 4XG3A 5BVKA 4EH4A 3C13A 4D5HA 4YJVA 4O0UA 4MD8E 1XHAA 2BRMA 3ZZEA 5I9VA 2YABA 1STCE 4CCBA 5CU4A 4FSYA 3OCSA 4F9BA 5LMKA 2EXMA 5CEIA 4QTEA 4RLLA 2PWLA 3GT8A 2Y8OA 3O71A 4QMWA 4CVAA 1GIJA 4F7LA 1H00A 5GIPE 2NPQA 3RJCA 1OB3A 3DXNA 4FSTA 4G9RA 4R5SA 5F94A 4EWQA 2Q83A 4XLIA 1SM2A 2IVUA 4QMNA 5DG5A 4N4SA 5DT3A 4ACCA 4FIHA 3DBQA 4N70A 1YWVA 3W18A 5C1QB 1Z5MA 4M12A 1FMOE 4AA0A 2OFUA 2WTIA 2OK1A 4A9TA 5M08A 3KRLA 4O6EA 4HGTA 2F7XE 2CCIA 1YXTA 3A4PA 4E73A 5LQFA 1F0QA 1VYZA 4XBRA 4YLLA 4L7SA 2J6MA 4NJDA 3HVCA 3OTVA 3QTSA 4ASZA 2PMLX 4L67A 1OVEA 4DEIA 3UJGA 1VJYA 2V5QA 3ZRMA 4FI1A 4N57A 4QPSA 3QZFA 3RZBA 3ERKA 3MY0A 3H10A 5D41A 2UW7A 1DAWA 2OJJA 2IW8A 4OR5A 5DN3A 3EN7A 5HQ0A 2NP8A 4QRCA 5AUYA 4BBEA 2X2KA 3FZPA 4LGHA 5HG8A 1R0EA 4GIHA 5HESA 5AUWA 4LI5A 3ZLSA 3W2QA 4XS2A 3PLSA 4GUBA 2GHLA 2FA2A 1VEBA 4FKWA 4YTIA 3SXRA 4HZRA 2W99B 2ITXA 1H25A 1O6LA 4DYMA 3ETAA 3U4WA 4UN0C 3KB7A 4OTHA 5J7HA 3Q3BA 4EK5A 1QPDA 5JFSA 1XBBA 2XKDA 3OXZA 1Y8GA 4YU2A 3KCFA 2XBJA 1PXKA 1ZOEA 1GZNA 3EKNA 4BC6A 3CIKA 3OCTA 3U55A 4AW1A 3O17A 3A8WA 1FQ1B 5HU9A 2UW4A 3R8PA 1TVOA 2OZAA 4KIQA 4YZDA 3KY2A 4B8MA 5IA0A 3RWPA 4C37A 4KAOA 5JT2A 4G5JA 4MCVA 3VS4A 1KE7A 2C6EA 3GCUA 5FDXA 5DI1A 4ZLZA 2O5KA 4BDBA 3LCDA 5AUUA 4KIOA 3TACA 4HPUE 4WRSA 4DFYA 1XJDA 3EJ1A 1JQHA 4USEA 3ET7A 5A9UA 4HW7A 1M7NA 4R1VA 4DFUA 2R3FA 1P2AA 3Q96A 4ZY6A 2EB3A 2FGIA 3AD6A 5GZAA 3COMA 2OZAB 3NLBA 5IA3A 3C0HA 1GY3A 1H1WA 2XK7A 5E8TA 2YZAA 2HWPA 2HZ4A 5L4QA 3EL8A 4MBJA 4UWBA 3GC0A 1E1VA 3DNEA 4PWNA 4RA5A 4WSYA 5I9ZA 4N0SA 3SG9A 4ZMEA 2VUWA 4F64A 4GVAA 4EQUA 3D5UA 3EMGA 4D4YA 5EW8A 4F99A 4XV1A 4U42A 3Q6WA 4ZOGA 3KRJA 4PQNA 2B9IA 2IVVA 3EQBA 4W4WA 4XYFA 1YKRA 1JKSA 3PWYA 1Q4LA 5HGIA 3ZMMA 5EFQA 5ANGA 4D58A 1H27A 2OH0E 1OI9A 2G2FA 4R5YA 4CSVA 3ZO3A 3ZBXA 4RJ5A 4ITHA 2E2BA 1Q8UA 3QKMA 4JBQA 1GJOA 3QQJA 1Q8WA 5FXQA 2YDJA 4UMQA 4WA9A 1OL2A 4HYIA 4QP6A 5E9EA 3TZ7A 4C7TA 5FWKK 4TT7A 5E91A 3EQIA 4ZSJA 3L9LA 5TOZA 2ZB1A 4NT4A 3TM0A 3VS3A 4ORKA 2QKRA 2R7BA 1OUYA 4J52A 3QFVA 4U5JA 3DJ7A 3S2PA 5K0XA 3UDBA 4LRMA 3AC4A 2YFXA 3II5A 2E9VA 3TT0A 4R7BA 1A9UA 4OAUC 3A7HA 4O0SA 4IB0A 4CG8A 4UBAA 4FODA 3AD5A 5DR2A 5FP6A 2EUFB 3RMFA 1J1CA 2P0CA 4FT3A 5AP6A 3H3CA 5HVKA 3ORKA 3RM7A 3CQWA 3E63A 4NW6A 3TKHA 3WZJA 4YJSA 3FL5A 1U5QA 2AYPA 3KVXA 4FOBA 5IKWA 5BQ0A 3AMBA 4AGDA 3F69A 2J4ZA 4FICA 1X8BA 3OBGA 2CGWA 4AAAA 3F88A 2BILB 5BVDA 1ATPE 4CD0A 3UOLA 3MFSA 4O7WA 4H05A 4FEWA 2DYLA 4ANLA 4ACHA 3F66A 4TYHA 5F20A 1NW1A 5IQHA 2FO0A 2UW3A 3C5IA 3LXNA 1AGWA 4L01A 3BCEA 4BCMA 2FSTX 3GU7A 4BCNA 1DAYA 4QMQA 2WMWA 4FYNA 3WYXA 4HZSA 4QPAA 3WILA 5HNBA 4O82A 4XBUA 3VJOA 3PA5A 3DGKA 4RA4A 1B6CB 2IWIA 4E8AA 2CSNA 2GQGA 3NX8A 2BKKA 4XV3A 4O83A 1IG1A 4GK3A 3MFTA 4JBVA 4DG0E 5M4FA 2OU7A 2R3OA 3CCNA 4X2KA 4GYIA 4X6QC 1OIUA 4C3FA 2XIXA 1OL7A 4O2PA 5BYLA 4TYHB 1P4FA 5L2TA 4UMTA 1TQMA 3CTJA 3DBCA 1MQBA 4V01A 4C57A 3AT3A 1YXUA 2OWBA 3DKCA 1H24A 3I0OA 5M57A 5K4IA 2H9VA 3A60A 4FKVA 3LPBA 3GU5A 4DCEA 4ZTNA 4QP4A 1UWHA 4GL9A 3KF4A 2GS6A 2IVTA 1WCCA 3R8LA 2BRHA 2AC3A 5TKDA 4D2PA 4U40A 2ZVAA 2RFEA 1GNGA 5CI6A 5B2MA 2X1NA 4JQ8A 2KTYA 4QMZA 1PKGA 2B0QA 1ZY5A 4QT1A 4EEVA 2HCKA 2YM3A 3CQEA 4BTMA 2X8IA 5I9YA 2W1HA 3QRTA 3W16A 3FLZA 3ZSHA 5I5ZA 4IB5A 4U44A 2UZUE 4U80A 3RI1A 2WU7A 2XVDA 3NYVA 4H3QA 3G9NA 5TO8A 4DINA 4I0TA 4F9CA 2OKRA 2UZOA 4GW8A 5ANOA 4JQ7A 4FGRA 3GCPA 1L3RE 5C8NA 5HNGA 3CKWA 3B8RA 4GYGA 5K9IA 3WF6A 2C0OA 4BR3A 2X7OA 4NM7A 2C6IA 4TW9A 4IE9A 1PXOA 4O0TA 2PZPA 3G0EA 3MS9A 4U79A 4EOOA 3FMMA 4CMUA 3KEXA 5AP2A 4LGDA 3PSDA 5FTOA 4EQCA 2OGVA 3BGZA 2Z7LA 4AZEA 4DA5A 3Q9XA 1YXXA 3IGGA 3IW7A 5IMXA 3CP9A 1KV1A 2XIZA 3CGFA 1V0OA 5CSWA 4PPAA 4C0TA 4V05A 4J1RA 3A7GA 2X8EA 4WKQA 3UOKA 3V51A 2PZRA 4YTHA 3R7VA 3EQGA 1Q8ZA 3R7UA 4BCJA 4Q9ZA 3TUCA 3QQHA 3R28A 2XK4A 3DBFA 4FBXA 4FT7A 4Y5HA 4AA5A 3DLZA 4HVGA 1KWPA 3Q32A 3T3VA 4PMPA 3FKOA 4FTTA 4BTKA 3QWKA 3TXOA 1JKKA 4C58A 4JDKA 4QMXA 2Y4IB 3ZHPC 3KXHA 4M15A 1LEWA 5CF8A 3FMJA 4QQ5A 1Q3WA 5FM2A 1BL7A 3NUXA 3TV7A 4L00A 3MVLA 1YDTE 4RIXA 3BBWA 4NFMA 2C30A 3NYXA 4ZTLA 3Q2MA 3HECA 2XNBA 1U46A 3L9NA 4R8QA 2JDRA 1J7IA 3FLQA 2HW6A 4J98A 1H0VA 2VTOA 2WMTA 1LP4A 4WO5A 4WBBB 2PSQA 1Q97A 4JAJA 3FKLA 4B9DA 5L8KA 4A9RA 2QODA 1H8FA 1OPKA 2FH9A 3MJ2A 3OF0A 2CN8A 5EOLA 4BTFA 4X2FA 1Q24A 3MY1A 4RIXB 4DF3A 4TNBA 3F3ZA 3PUPA 1MRVA 4LG4A 5IZFA 5EDRA 3EQCA 3FJQE 2Q0NA 4MQ2A 4Z9LA 4AQCA 3V5TA 3IQ7A 3FXZA 3JR1A 1W83A 5L2QA 5D9HA 2WMXA 4L68A 5IH6A 4LV8A 4ALWA 2ZV7A 4IWQA 5CU3A 1URWA 5AV0A 4HVHA 1KE8A 4KINA 4RBLA 4YZMA 3R73A 2J51A 2VAGA 3QYWA 4FKJA 1ZZLA 4IAZA 4Y72A 2A27A 4RGJA 3Q5IA 4G3GA 3DS6A 3GC9A 4GU9A 3FL4A 3OFMA 4EHGA 3MIYA 4S34A 4D1SA 3FI4A 3GQLA 3KRRA 4EK3A 5AR3A 3PXYA 4CGAA 4IZ7A 3Q4UA 2ETMA 4M67A 3KREA 4BCHA 4BZNA 3FZRA 3R30A 3ZLXA 3ZH8A 4AP7A 2P2IA 4HNIA 2ITQA 4ONAA 3COKA 4EOJA 1REKA 4MXYA 4IADA 5KMLA 4BWPA 3O8UA 5HVYA 1UNHA 3QALE 1MP8A 4MEDA 4AUAA 3TN8A 4JRNA 5A54A 4CCUA 5LVOA 3KMMA 4G31A 4XG7A 2OF4A 3V5PA 1RQQA 3I5NA 5JZNA 3QQGA 2GNIA 4KUJA 4AS0A 2BDJA 2ITWA 2JD5A 2JAVA 2QO9A 5AP0A 3ALNA 1U54A 1Z57A 5ICPA 2BIYA 3FDNA 4BCGA 3MH3A 4Y85A 4BHZA 2PMOX 3EQRA 4XHKB 1I09A 4FVPA 4X3FC 3WF9A 5E1EA 4O2ZA 1MUOA 5HLWA 3NNUA 3K2LA 3LQ5A 1JBPE 3MB6A 3UE4A 3OROA 3VW6A 4E6DA 3S0OA 2Y4IC 5CS6A 5BPYA 2J90A 3MA3A 1PF8A 1QMZA 2ZB0A 3DV3A 3GVUA 3O51A 5IUGA 3VAPA 3Q9ZA 2F9GA 2W7XA 5H3QA 4R3PA 2VTMA 2VTQA 3ULZA 4BL1A 4RIWA 4M0ZA 5DA3A 1U54B 2F2UA 3RAIA 4AE9A 5DHJA 3TNQB 3Q60A 5ACKA 5H8EA 2I7QA 3QD0A 4EH3A 3KA0A 3UIBA 5DEYA 3LMGA 5IQCA 2OICA 3UBDA 4YBJA 1YWNA 3F7WA 4JDJA 2YEXA 5DWRA 4CLIA 3FHRA 4GSBA 4I41A 4UV0A 4I5CA 4S30A 4FUYA 3EN9A 2ITZA 3EWHA 5HKMA 4C38A 2VU3A 3NCZA 4M97A 4C4GA 1XKKA 3HA8A 3PIZA 3QTZA 4RIWB 3JVRA 4YNOA 3UPZA 2WU6A 4GT3A 4QPMA 3LFQA 3EFWA 4FSZA 4P90A 4CFUA 3ITZA 3L8PA 4QP8A 4O81A 1ZY4A 1OIYA 1IAJA 4DGGA 2RFSA 2QONA 5J9ZA 5KMJA 3UOHA 2I1MA 3P0MA 2HWOA 4M69A 1LR4A 1WBOA 2H34A 2UW6A 4M0YA 4DHFA 4E4XA 2VD5A 4K77A 2UZBA 2P3GX 5D12A 4I5MA 3VS6A 1NXKA 5CALA 5HBEA 3RK9A 3D4QA 3ZFYA 4B0GA 3W10A 4HVDA 4ZJIA 4IACA 1NT2A 1OITA 4ZEGA 1BI7A 2Z8CA 3UVPA 1RW8A 2C0IA 3H0ZA 4IFGA 4W4VA 1K3AA 5GJDA 5AA9A 4B8LA 4RJ6A 1H08A 2O0UA 4RVTA 1NVQA 4RG0A 2I0YA 4G6NA 3NUAA 1JNKA 2UZEA 3QX4A 4TY1A 3C4FA 4M69B 3MPTA 4I92A 1ZMWA 3UIUA 4EL9A 4KSPA 4JLCA 5B2LA 3GCQA 4DEHA 1VYWA 1OM1A 2YM8A 5J7BA 5LMAA 3A8XA 5L2WA 1JVPP 4PX6A 3FYKX 4L46A 4G2FA 3QBNA 3TNIA 2CGUA 3CY3A 1QPEA 3GI3A 3H30A 1YVJA 3DAJA 5B7VA 3ZXTA 2WQEA 4HYSA 4R7IA 2GS2A 4HJOA 5DIAA 3UC3A 2YJSA 4C33A 4BKJA 3QD4A 3EH9A 3GUBA 3QA8A 4F1MA 4D2VA 2YM6A 5HTCA 5JKGA 4DAWA 1R3CA 3KQ7A 4LOPA 4CFMA 2ZJWA 1YRPA 4HYUA 1WVYA 5JK3A 2B4SB 3ORIA 5HEZA 4EONA 4QMUA 3ZC5A 5AV3A 5HTBA 3W8LA 3NUYA 2PMNX 3FZTA 3KVWA 1XQZA 3O7LB 3QCQA 3WZDA 3UG1A 4Y8DA 3IW4A 3HMPA 4FIIA 2C68A 2QOKA 3ZU7A 4F4PA 4GRBA 3VHEA 3BZ3A 4LMUA 3F2RA 2W4JA 4BDJA 1OGUA 4FV8A 2IVSA 2X7GA 3B2WA 4LQMA 1FVRA 4W4YA 5EDPA 1Q41A 4RZWA 4G1WA 3W1FA 5L6PA 5HOAA 5FEEA 2OXDA 4D2TA 2BROA 2R7IA 3PVBA 5CU6A 2XJ0A 1P14A 3QCSA 5IQDA 3PA3A 5HORA 4F6SA 5DVRA 4IX4A 2ITUA 2UUEA 4ZY4A 5IQIA 4D2RA 2W4OA 4JJRA 3UG2A 3U54A 4YPSA 3PLAE 3E8DA 3ORLA 4W4XA 3V6SA 5BVEA 2PHKA 3OOMA 2OJIA 2P4IA 3QA0A 5DEWA 5IA5A 3EYGA 5LVLA 4X0MA 3UNJA 3V5WA 5M07A 2GQSA 4EH8A 1Q8YA 2Z7SA 2X7FA 2GNHA 5LXMA 4YJQA 3VN9A 1OL1A 1HCKA 2C6DA 3PXRA 2UZLA 4UMPA 4ZJVA 3POOA 2W1DA 4WD5A 5AR8A 2UW0A 5L6WL 4U97A 4IEBA 4TWNA 1WBTA 3VBTA 4DEDA 4HPTE 3WF5A 3BU3A 5C01A 1WBVA 4XUFA 2O64A 2PVLA 2VO6A 2YIWA 4IX3A 3HP2A 5DPVA 1TKIA 4AGUA 5IQGA 2OF2A 3Q53A 3PFQA 3E7VA 2E9UA 3FSKA 5FQDC 5I9UA 3ZO4A 1ZYSA 3T8OA 4F0IA 2ESMA 4FNYA 1WVWA 2QD9A 2E9PA 4PF4A 3MWUA 1ZOHA 1JSTA 2QLQA 3IK3A 4L3JA 5CWZA 3VUKA 2GPHA 2JDVA 3PPJA 5EKOA 4GG7A 4BCPA 4LRJA 4C4HA 1PYXA 1IR3A 4NWMA 3DA6A 5AWMA 2X6DA 5FD2A 4CV9A 2ZDTA 3D94A 4O0RA 3SDJA 5HLNA 2CLXA 3P79A 4FZ7A 4L42A 5AV2A 3A62A 2OXYA 4EH6A 4UX9A 2QHNA 3ENHA 4HVIA 2IW9A 5IPJA 1Y8YA 3FE3A 1FGIA 2ZOQA 3GU8A 4JR3A 3TJCA 2B53A 4M14A 3HMMA 3TL8A 3EB0A 4AGWA 4F1OA 3HAVA 1KUTA 3E87A 3BU6A 3PY0A 1OECA 2G2HA 2JFLA 3NZ0A 4YJUA 5KUPA 3FZ1A 3R01A 2PUIA 2V22A 2ITYA 3CTHA 1CKJA 2GNLA 4ZK5A 3NDMA 4O27B 4CMTA 4K9YA 4HGLA 4ANOA 3EQDA 3HMIA 5E7RA 2YIYA 2QG7A 3TKUA 3QQUA 4ZTMA 5HX8A 3ELJA 3LVPA 4FNXA 2XK9A 4IX6A 2I40A 1ZOGA 4IWPA 4FV3A 2YCSA 3RHXA 4DEGA 4F7SA 4O0WA 5FTGA 1NVSA 3MVHA 3DK3A 4QP7A 4OUCA 2XNEA 3HNGA 4EK6A 1R78A 3SA0A 2QOCA 3RP9A 3TZMA 2WTVA 3NPCA 3UZRA 4EHVA 5KMMA 4PMMA 4BCFA 4ZSGA 5BUJA 2C3LA 3DZQA 3EHAA 4QTAA 3PIXA 2V55A 2X39A 5CAVA 3UQGA 5LVMA 3DQWA 2O2UA 2XP2A 4P5QA 4D28A 3G2FA 5AA8A 5AIKA 4YZCA 3V8WA 3SHEA 4G3CA 4WRGA 5CNNA 3TG1A 2NRYA 1NA7A 3EIDA 3T9TA 4ZTRA 1B39A 2XIYA 3FUPA 2VX1A 5C27A 3I79A 5DR6A 4IB3A 1LPUA 3VWAA 2VWXA 1AQ1A 2V7AA 2XJ1A 2YCQA 5HIBA 3OUNB 5DFPA 5CSPA 1V1KA 2PE0A 2WAJA 2WXVA 3MVJA 5LCJA 5KE0A 4A4XA 3VVHA 1JPAA 2PVMA 4Y73A 3WZEA 3ORPA 4XG4A 4V0GA 3QGYA 5CEOA 2YZLA 2ITPA 4XP2A 4BN1A 1H1PA 3HRBA 4OLIA 4XNEA 3VBVA 3B8QA 4APPA 2C69A 2P33A 4A9YA 2GHGA 3R1YA 2XUUA 2QU6A 5C4LA 4IW0A 3ROCA 1H4LA 4I6QA 1RDQE 3DFCB 3CD8A 3KXXA 1W82A 5T68A 4ZZNA 2VGPA 4GKIA 1APME 5EM8A 2F57A 3HRCA 2VX0A 4J53A 5AR4A 4WNKA 2UVXA 4E6AA 4N6ZA 4BCIA 3TEIA 4FT9A 3VIDA 4C62A 4V0GB 1DI8A 3C5UA 5HE3A 1Y6BA 5AM6A 1G8AA 2R5TA 1L8TA 2WELA 4Q2AA 4AW2A 3E3BX 3C4WA 3EN4A 3MFUA 4L6QA 4RZVA 3P7AA 1FVTA 1XWSA 5BYZA 2JC6A 2VTAA 1XH8A 4I93A 4O84A 3IOPA 5H2UA 4DE4A 5DOSA 3WIKA 3R00A 4MAOA 4TYJA 3MN3A 5M4CA 3DBDA 4BHNA 3QZIA 3IPHA 1A06A 4II5A 2G2IA 4MF0A 4XG6A 5E8SA 4U41A 4XLVA 3P7CA 3D83A 3R7GA 2C3JA 3EFKA 3A61A 3QRJA 3RBWA 4NW5A 3BI6A 4IANA 4PMTA 4ACGA 4FEQA 4RVLA 4ZZOA 4CYJA 4WNOA 3CY2A 3PIYA 3HUCA 3B2TA 3D2IA 4BF2A 4LV5A 4BDCA 2YACA 3IDPA 5CAOA 4BDFA 3R83A 4X3JA 5JFVA 5K4JA 3VO3A 2FSLX 4FZFB 5JMSA 3KN6A 3D5WA 4O21A 4QTCA 5GNKA 3HGKA 3TNPC 3RZFA 2EU9A 3VS1A 2OXXA 5DT4A 4ZAUA 1H26A 3HMNA 1UU9A 5KCVA 3ZUVA 5EW3A 4CFWA 4ENXA 4Z3VA 5EHOA 5AADA 3R8VA 4FKSA 3FYJX 4BZOA 1DI9A 5TF9A 3Q6UA 4FG9A 4XRJA 2RL5A 3BQCA 3GFWA 5DGZA 3ZO2A 3AC2A 3BV2A 2GS7A 4NUSA 4RX5A 3LMHA 1G5SA 3VBXA 3EL7A 2CCHA 4D4VA 2X9FA 4E3CA 5B0XA 1CM8A 2J7TA 5CU0A 3Q04A 4GMYA 3Q52A 4JDHA 3MA6A 2NO3A 5CAPA 4GFOA 4GKHA 2IG7A 3UP7A 2Y6MA 4ITJA 3G51A 3ZXZA 4ARKA 5I3RA 3MPAA 3RCDA 3POZA 4OBOA 3OY1A 4OTQA 5BMSA 5GIOE 1M17A 3OXIA 4FKPA 3ZLWA 4B99A 1CKIA 3UP2A 3FQHA 2PUPA 2ZM4A 4MXOA 5KHXA 2VTJA 2QU5A 3LW0A 3DB6A 5T3QA 4RJ8A 5AR7A 5HX6A 4YPDA 2QOLA 2PUUA 2BHEA 4FIFA 4FKLA 2UW8A 2RFNA 2PE2A 5DRBA 5FM3A 4UMUA 4R78A 4XV2A 4O7TA 1G3NA 3I7CA 3TWJA 3G15A 5HO6A 4O7VA 1J1BA 3UOJA 4M68A 5J9YA 3V8SA 3WI6A 5IUIA 1OKZA 2V0DA 4AT3A 4FOCA 2I0HA 3NEWA 3R1NA 3OG7A 3AT2A 2IZRA 4Y95A 2WIHA 4B4LA 5CSHA 5L2SA 1BX6A 2EXCX 5M06A 3FI2A 3UMXA 4FTCA 3GOKA 5JFXA 4EHEA 3WF7A 3QRUA 1H0WA 2GTMA 3FWQA 4CNHA 4DH5A 3K3JA 4MXXA 4RQKA 3FZOA 5HG5A 5FP5A 2XNGA 3DKOA 3K3IA 5TT7A 2BUJA 2J0MB 2ITTA 3QKLA 5HBJA 2QHMA 4G3DA 4AZWA 4BICA 3NS9A 5C26A 4IAFA 4ASDA 2R3IA 4L8MA 3KGAA 2ZYBA 4KS8A 5FGKA 4JI9A 4UXLA 3ANQA 4E20A 4I20A 2QC6A 4JX7A 1BUHA 4YJPA 3I6WA 4P4CA 4G16A 3KKVA 4CZUA 5AP3A 3IKAA 5CNOA 2HY0A 5CAUA 4YHTA 3LIJA 3VRZA 4JBPA 5AAGA 4UZDA 3EZRA 5C9CA 4GU6A 5AP7A 2JKKA 4BKZA 4NYEA 3BHUA 4C59A 2ZV9A 2QVSE 2R4BA 5HG9A 2CKEA 4QMPA 4CG9A 4C35A 2PL0A 1RJBA 1Q3DA 2GU8A 4KS7A 1XBAA 4DGNA 4BDGA 2JIVA 4BFMA 5KKRB 4YMJA 3JS2A 3DKGA 3PRFA 5IDPA 4XJ0A 3TNHA 1R0PA 4PPBA 4A7CA 2X8DA 3KMWA 3OC1A 3QXOA 3ATSA 3AC3A 3BIZA 4KIKA 3LXLA 3I0QA 3R22A 3VQUA 4FX3A 3MTFA 4O91A 3AXWA 3NW5A 4NCTA 4EOQA 1SVHA 3U51A 1XH4A 2CKPA 3PJ8A 2W0JA 2CLQA 3P08A 2HYYA 3S3IA 2R3GA 3R8MA 3D14A 3KXNA 3NW7A 2YDKA 4IVDA 5BVFA 4MD7E 3BGQA 3R2YA 3HYHA 3QTUA 3GENA 4H3BA 5CU2A 1EH4A 3W2SA 4YR8A 5BMMA 1BI8A 2W1IA 3F9NA 3VHKA 4ALVA 3KN5A 4I22A 5ANJA 3W32A 4KIKB 5AP1A 3ORZA 4F65A 2EXEA 3WZUA 3ORXA 3WF8A 1YI6A 3FMEA 3EZVA 3NR9A 4U6RA 5E1SA 4BWXA 3U6HA 3OS3A 2Z7RA 3ZEPA 4L3LA 3NMUF 3WYYA 4PNIA 2G15A 2Y6OA 4TNDA 2EWAA 3KXGA 2YDIA 4IAYA 5EHYA 4E5AX 5CAQA 4E5BA 3RNIA 5ITAA 1MRYA 2YIQA 3C0IA 2I6LA 4GK4A 5J87A 2J0IA 3PY1A 1GAGA 4G34A 5DT0A 3S1HA 3F6XA 4ERKA 4FV1A 5ACBC 4ACDA 4QMYA 4X6RA 2JEDA 4IMYA 3R1QA 3DPKA 3UODA 4TKSA 4YC8A 4BZDA 5EQYA 4NJ3A 2BFXA 3TIZA 4X3FA 4AF3A 5TR6A 4EK4A 2XK3A 5D11A 3GEQA 5C03A 3ZSGA 3UQFA 3ACJA 3C51A 2WTWA 3DT1A 4IIRA 4PTEA 3RGFA 3AOXA 5KNJA 3U6IA 5D7AA 4IFCA 3UGCA 4JVGA 4BDEA 2YLEA 3V04A 3CC6A 4D5KA 4EQMA 4IZ5A 2HK5A 3ZONA 4ANNA 2Q0BA 1DS5A 3NRMA 3NVKI 1OBDA 5CF6A 4ZTQA 4KWPA 4DH1A 3ACKA 5EI2A 4K11A 4NM3A 4RRVA 5FLFA 5CF4A 5IQBA 2C1AA 2VN9A 4EZ7A 3HZTA 2R9SA 4X3FB 2VWYA 3PVUA 5AUTA 2WMVA 3VC4A 4H39A 2BDFA 5M51A 4FF8A 4GUEA 5BX0A 3I6UA 4O0VA 2VWWA 1YXVA 4FVRA 5LJJA 2HZ0A 3F3VA 3UZPA 4KB8A 4I21A 4QNYA 1IAHA 4MWIA 2WQNA 3N4VA 3PVGA 4I4EA 4QQJA 4QD6A 2EVAA 4ANQA 2YWVA 3G9LX 3KXMA 3P78A 2UZVA 4CT1A 3PZHA 4D1ZA 1W0XC 5KKRC 4L3PA 5M44A 4I6HA 4ANBA 4EOSA 3ENMA 3MB7A 3QC9A 3SW7A 2Z7QA 3NYOA 3DK7A 4EC9A 3D9VA 3F2AA 3TTJA 4O7ZA 2BTRA 2UV2A 2CNVA 1Q99A 3MFRA 3RAKA 4EJ7A 3ORMA 5CYIA 4C36A 5J8IA 1PMNA 3HDNA 3UPXA 4G17A 3OWJA 5KX8A 3N51A 4I24A 5DYJA 2FSOX 4CQEA 1T46A 2CPKE 2ITNA 1ZYDA 4XX9A 3PSBA 5JRQA 3Q5ZA 3GU4A 2GQRA 3F5PA 3W8QA 2JIIA 1OZ1A 3U9CA 4LOQA 3MY5A 2C5VA 3HV3A 4CFFA 2F7EE 3F3TA 4PP7A 2X81A 3G90X 3BX5A 1ZAOA 5J79A 4IM2A 1YOMA 3SLSA 1WFCA 2VTRA 3OEZA 4A9UA 4APCA 4GJ2A 5IDNA 2XCHA 3ZUUA 1YW2A 5GZ8A 1UNLA 2GMXA 4NCTC 3VUIA 4D4SA 2VNWA 5DLSA 4DH3A 4EJNA 3MTLA 4NIFA 2HW7A 2C6TA 3VS5A 2W9ZB 3PXKA 3HDMA 2JDTA 3Q4ZA 3C7QA 3F3UA 3M1SA 3OWKA 4MH7A 1YWRA 3LFDA 5GJGA 4BKYA 2W1FA 4RVMA 3SAYA 4A9SA 4YNEA 3NVMB 2VWBA 2WNTA 1YHSA 3QAME 3QWJA 3BYMA 3LHJA 4FMQA 4BY9E 4FKOA 4AU8A 4FZDB 4YO4A 5HICA 4IH8A 1Q8TA 3FLYA 4QMSA 4WG3A 2HZIA 4FTAA 2FUMA 3OT3A 3PXQA 3QRIA 4RC3A 2RG6A 2PVKA 3C9WA 4MBIA 4QQTA 5D10A 4NIFB 5EKNA 3ROYA 4OT5A 2PVRA 3M42A 1PY5A 5AAEA 1UWJA 3IDCA 1M52A 4OTFA 4YLJA 4MVFA 4RVKA 3C1XA 1W98A 2R3KA 4NTTA 4J97A 4K2RA 5JGDA 1IASA 4WT6A 4E4LA 3UYTA 2G01A 4MTAA 4WUNA 3PJ3A 4BTJA 5BUIA 2VTTA 5EQEA 2X9EA 4LL5A 2H8HA 3VW8A 5IQEA 4Y46A 2J9MA 5EM7A 5CVFA 3R7EA 5K5NA 2G1TA 4R1YA 3WARA 1PRYA 1H1SA 3HRFA 5HZNA 3QQLA 4PDPA 3RK5A 5M55A 1FPUA 2J0LA 2OIBA 5D7VA 3UNZA 4DITA 4BIBA 2XRUA 3D5XA 3SKCA 2QR7A 4DGLC 2PUNA 4AOIA 3ZC6A 4IZAA 1V0PA 2C3KA 4FSWA 3THBA 4CEGA 2BFYA 1RE8A 4UZHA 3A99A 4FE2A 4MQ1A 3R9RA 3VBYA 3DDPA 2A19B 2Y0AA 2OI4X 4YJNA 5AV1A 3VS0A 4O7SA 1YDRE 4NU1A 2PY3A 2WIPA 5FG8A 4S2ZA 3VS2A 4LL0A 3R21A 4EHZA 3CSVA 1OPJA 5LCKA 1QPCA 5CZIA 4G6OA 3AMYA 2F49A 1ND4A 2OBJA 1K2PA 2QO2A 3AC5A 3JVSA 3F7ZA 5F9EA 2JDOA 2QOIA 3BV3A 3SOCA 3SRVA 2OJFE 1I44A 3EN6A 4F63A 5HTIA 5L8LA 2YWPA 4ZMFA 5CEQA 5EH0A 4AG8A 3BYUA 3OD6X 4KBCA 4WG5A 4U81A 3QD3A 4QP3A 1WZYA 4UWCA 4EUUA 4PDSA 5AM7A 3SG8A 2VZ6A 4ENYA 5A4LA 5G6VA 3BWJA 4MD9E 4TWOA 3P9JA 3R02A 4KBAA 3LFSA 4I94A 2R0IA 2YLFA 1QCFA 3BYSA 3NUUA 2OW3A 1BYGA 4G3FA 4G5PA 3SRVB 1OL5A 4K33A 1URCA 2ZMCA 4U0IA 4O7YA 5E8UA 4IB1A 3WE4A 3OT8A 4EKLA 1XH6A 2XCKA 4HOKA 4AWIA 3CJFA 3FC1X 3ZCLA 5CXZA 4LUEA 5DMZA 2R0UA 3PG3A 5LVPA 4O6LA 3NAYA 3WBLA 4QNAA 5HCYA 4EOPA 4PDOA 3QC4A 1FGKA 4FKRA 4FNZA 5HIDA 1PXPA 3K5VA 4F7NA 2FYSA 2JAMA 5JN2A 4DLIA 3FMKA 5EYCA 2IJMA 3FXWA 3HUBA 1F5QA 2QOBA 2PMIA 4PY1A 4IBMA 5FBNC 4EZ3A 4CLJA 3NIEA 5EK7A 3DY7A 4JG8A 3CQUA 1CSNA 4RFMA 4TRLA 5CENA 4QMTA 1U59A 4AE6A 5A4EA 2I0EA 3LFFA 4YURA 5HNIX 1MQ4A 2IZTA 2R2PA 1H01A 4KKEA 4KRDA 4D0WA 4QOXA 1BL6A 4WHZA 3SV0A 3P1AA 2XNMA 4ID7A 4XH6A 2CKQA 4HCUA 3REPA 3FPQA 3TDWA 4DG3E 5I4NA 1R1WA 2XM9A 3LLAA 2XNOA 4F0GA 4O0XA 4D0XA 5JZJA 4UYNA 2GFCA 1PMEA 2J0JA 2XEZA 4FSMA 2ZDUA 4BVUA 5FXRA 4ZSLA 4FSRA 4L44A 5HG7A 5JRSA 2F4JA 3GC8A 3L9PA 4CRLA 3PPKA 5D1JA 3EYHA 3VUGA 4EORA 1XH5A 2BMCA 2ERKA 5ANKA 4XG2A 4YC6A 5CVHA 2HY81 3DKFA 4E5WA 4O7RA 5K0KA 4DG2E 2C5YA 4ERWA 5J1WA 1SNXA 4J99A 2FSMX 4EKKA 3FSFA 4AW0A 4DT8A 3LCKA 5HE1A 4DH7A 5M09A 3WIGA 2XYNA 4AFJA 4AX8A 2OH4A 4Z7GA 3G6HA 3TI1A 1TQIA 4IXPA 2BVAA 2WZJA 3O7LD 2J2IB 3UYSA 4C2WA 1YI4A 4FTJA 4GJ3A 3V3VA 3HA6A 3R63A 2O3PA 5LVNA 2QOHA 3EOCA 2R3RA 4EOIA 3EQFA 3MIAA 3EFJA 2XKFA 2DQ7X 2IZSA 3L8SA 3VJNA 2ZV8A 2J50A 3NNWA 5IQFA 4OTPA 4BDIA 3IECA 3LM5A 2BRNA 3AGMA 1WBNA 3KF7A 4NL0A 4W9WA 3IW8A 5IA1A 4IVCA 3TTIA 2C5NA 3FY2A 4CQGA 1O6YA 3UNKA 1UNGA 4FTMA 4NM0A 4PTGA 3OP5A 4FKQA 4ACMA 4O86A 4R77A 4H1MA 3S00A 1ZYCA 3ALOA 3EN5A 3ODYX 4X21A 3UZTA 3ZTXA 4FTKA 4YJRA 3FMNA 3O2MA 3PE2A 2YJRA 4GG5A 2BZJA 5E4HA 4DFZE 3QTXA 5HCZA 3G33A 5JSMA 1O6KA 4QMVA 3LFEA 3VS7A 1CDKA 3COHA 4BCOA 3ZS5A 2C6KA 2PZ5A 4CYIA 4MF1A 5AAFA 4IJ9A 3JPVA 4H36A 2XBAA 3CJGA 4XG9A 4QMMA 2C3IB 4AZVA 3M2WA 2VTHA 2RF9A 3IOKA 3VBQA 3VQHA 3PVWA 4AA4A 4Z7HA 2BCJA 3VBWA 4RWIA 3FLWA 2UVYA 3E8NA 2WOUA 4IVAA 1YXSA 4QMOA 3V5LA 4C02A 3QUPA 2GFSA 4OTDA 2JKQA 4H1JA 4PDYA 1YHWA 1J3HA 4F6UA 2OG8A 2B55A 3AMAA 3O50A 2BRBA 3ZZWA 3U87A 2HAKA 3BELA 2ZV2A 4QP9A 5AX3A 2OFVA 3CKXA 2EB2A 4H58A 2PZYA 4EOLA 4FZ6A 2R3NA 4RC4A 5DNRA 2WKMA 3AC8A 4WBOA 2WB8A 2BAKA 4O1OA 2JBOA 1YDSE 3PXZA 5JGBA 2LGCA 3NUPA 1LUFA 4GK2A 3RKBA 4BGQA 4EBVA 4FIEA 5A4QA 5HU3A 3QCXA 3JUHA 2QQ7A 4K18A 5J5SA 3TCPA 4MK0A 2XKEA 4FL1A 2YISA 3HV5A 4W9XA 4M7IA 4WUAA 5CXHA 5I0BA 4C3PA 5I3OA 1S9IA 5AV4A 3FQEA 2BTSA 4XOYA 4MNEA 4PUZA 5FTQA 4CKIA 4JIKA 2XM8A 3LFAA 4JG7A 4LMNA 4D9TA 4F9AA 2BRGA 3SOAA 2RSVA 4D55A 4F0FA 1Y91A 3PDTA 2ZM1A 5HBHA 2BIKB 2BALA 3DDQA 4BWKA 5A6NA 4ZZMA 1G8SA 2SRCA 4FTIA 3TJDA
chains in the Genus database with same CATH superfamily
2OLCA 3S95A 3UMWA 5HVJA 4AZFA 2HXLA 4YSMA 1SMHA 2XJ2A 5F95A 3VNTA 3ORNA 2R3JA 5FEQA 4E93A 2XF0A 4WNMA 4BBFA 3P86A 1DM2A 4BJJB 4M8TA 3FLNC 4BGHA 5A4TA 3SGCA 4MNEB 2WPAA 4K1BA 3F82A 2C47A 4JG6A 3T3UA 1PXJA 3BEAA 3CD3A 4PPCA 2A4LA 4AN9A 3OOGA 2QKWB 3FKNA 5AJQA 3L8XA 2YCRA 3RPSA 2YM5A 1W7HA 2H6DA 4HGSA 2R3LA 2LAVA 3SXSA 4DTKA 3GP0A 5LWMA 1WBWA 3UC4A 4EH5A 3BLQA 2C6MA 3GCVA 3NUNA 3EQHA 4R7HA 1YOJA 3TIYA 4XRLA 3BE9A 4C61A 5IA4A 4DH8A 2PVYA 4UMRA 3GFEA 3HLLA 3VUTA 3BLHA 4KD1A 4X2JA 5ETIA 3TZ8A 4FK3A 4XV9A 3R7YA 3NIZA 1A48A 1Q5KA 4RQVA 4FUXA 2OZOA 1P5EA 3A7FA 5AP5A 3ZYAA 2WOTA 4AACA 4ANSA 3R9HA 5IEYA 3CLYA 2VO0A 4IDTA 4DEAA 4QYHA 4ASEA 2JFMA 3HX4A 4IQ6A 3V8TA 2IZUA 3PWDA 4Y5QA 2QNJA 4QQCA 2NRUA 5B2KA 3K5UA 3RALA 3UIMA 3VUDA 4E1ZA 1WBSA 5HO8A 4EZ5A 5AEPA 2ZFYA 4JDIA 2W05A 4LOOA 2XB7A 3MI9A 4D2SA 4A07A 3QF9A 4DGMA 4O22A 3ZLYA 2BZHB 5BNJA 4QMLA 4I3ZA 4JMQA 4DTBA 3UVRA 2CN5A 3KXZA 3BL7A 3I4BA 2WTJA 2ERZE 3E93A 4QYGA 2E9OA 2W06A 3COIA 3N9XA 2WTDA 3NNVA 3O8TA 4IVBA 4OTWA 5FRIA 3QUEA 3PA4A 3DJ5A 3QL8A 1KSWA 5EW9A 3LMIA 4RC2A 2ITOA 3C4ZA 2R3MA 3C50A 3BBTB 1WVXA 4YZBA 2OIDA 2DUVA 3EKKA 5E8VA 2VO3A 4N6YA 4EH9A 5E8YA 1JWHA 4PL4A 4MXAA 3IS5A 4LGGA 4BBMA 4MKCA 3R0TA 2XARA 2R3QA 2J5EA 3L1SA 2B9HA 3W2OA 4RJ3A 3R6XA 2WD1A 4MYGA 4JBOA 4CKRA 4YTFA 5HIEA 2VTLA 4FKUA 4I5PA 4ZY5A 1Z9XA 5I9WA 2GNFA 3CTQA 3OWLA 1K9AA 4TZRA 4FKTA 3O0GA 3QXPA 4FZAB 1S9JA 3DCVA 3F5XA 3TDVA 4C2VA 5GZ9A 1FOTA 3LFBA 4ZLYA 5JFWA 4K8AA 4AAYA 1AD5A 4IHPA 4BDKA 4CMOA 2XYUA 4IM3A 4QP1A 3V5JA 3P5JC 4TN6A 1ZMVA 3ZDUA 2R3PA 4RJ7A 5JH6A 4MBLA 4IX5A 4O4FA 5FXSA 1PW2A 2R3HA 2VTIA 5IEVA 2O63A 3ZDIA 2VWZA 3PYYA 5T6KA 3RNYA 4RT7A 4TWCA 4IJPA 3RINA 3MPMA 5ETCA 4GH2A 3QTIA 3FMDA 4BYIA 2CMWA 4FL2A 1YQJA 2VTSA 4QYFA 4YZNA 2RG5A 5L8JA 4J8MA 4TL0A 1PYEA 3TNWA 2YA9A 4KIPA 4MHAA 2W1EA 3RPVA 3R04A 4C4JA 3ZUTA 3MDYA 4K6ZA 3RHKA 4CXAA 5HLPA 2XK6A 3QD2B 5HE0A 3BQRA 4RJ4A 4WOVA 3RTPA 5C8KA 2OSCA 3PJ2A 4FIJA 4KABA 2O8YA 3LCTA 2ACXA 1IEPA 2C1BA 4YJTA 3QKKA 4JRVA 3OVVA 4B7TA 4I1ZA 5H8BA 3OTUA 4UY9A 3DZOA 5J9LA 3UIXA 3O96A 2UZDA 3DAKA 2W5AA 4BDDA 2OO8X 5CZHA 4AW5A 4DT9A 3LE6A 1KOAA 3QHWA 2BZKB 3FY0A 3E64A 5HCXA 5IF1A 3PY3A 2QOQA 2F2CB 2YERA 4TYIA 3N4TA 4I6BA 3P4KA 5JQ8A 3I1AA 4GEOA 4OTIA 2VWVA 4CFVA 4NFNA 3PG1A 4C34A 4AXAA 1ZXEA 2PVFA 4LM5A 4U45A 2IW6A 2HENA 5KMKA 4J95A 4DCAA 3W2PA 3LJ0A 5LMKC 4UYAA 3CE3A 5E8ZA 4X2NA 4LYNA 3UVQA 4FIGA 4BCQA 2ZAZA 4E7WA 3OUKA 1W84A 2YN8A 3KU2A 3LFNA 3ZFXA 4LUDA 4ZP5A 4EI4A 1YI3A 4PV0A 1TQPA 5HD4A 5BVNA 3DB8A 2BKZA 2PVJA 2C5XA 3R71A 3PTGA 4B6LA 2Z02A 2GHMA 3QTRA 3R1SA 4I0RA 2WMAA 3AKKA 2WHBA 4I6LA 2UVZA 3U6JA 2A1AB 4R3RA 4EWHA 2C5OA 2PK9A 4PL3A 3FZSA 1PKDA 1PXNA 3H4JA 3H9RA 4KA3A 2KULA 4EYJA 3HAMA 4MNFA 3GGFA 1UVRA 5EOBA 4YHFA 5LARA 5C4KA 4NZWB 3F61A 4F9WA 2RGPA 1GOLA 3BHHA 3ORTA 3RPYA 4JT3A 4Y83A 2ONLA 3AD4A 4FKGA 3DTCA 3O23A 4FTOA 2R64A 4FNWA 4FTQA 3CEKA 4PP9A 5CTPA 4FA2A 4FV4A 4JR7A 4X7QA 1J91A 2DS1A 4D1XA 4DFXE 4O7LA 2HELA 4P7EA 4AFEA 4CFNA 3BLAA 3PRIA 5JEBA 4GS6A 4M3QA 5AP4A 2W5BA 3AC1A 5CI7A 4YGAA 4BDHA 3UO4A 3PJCA 5A6OA 4DBNA 2V7OA 5E8XA 4PMSA 4FT5A 3C4XA 4F09A 1FINA 2AUHA 4DEEA 3DBEA 2B7AA 4F08A 3FEGA 3RK7A 1U5RA 4MX9A 1M2QA 1WAKA 5EM5A 5BVOA 3MH1A 4BDAA 2P55A 4DN5A 4F6WA 2REIA 1TFFA 4O38A 4CRSA 4DGOA 4FTNA 4EOMA 2F7ZE 4UALA 1XO2B 1V0BA 4GT5A 5JQ5A 4YUQA 4J96A 5AR5A 3CPBA 4QP2A 4TPTA 5CX9A 3UTOA 1OMWA 4GV1A 3R8ZA 3PSCA 5A4CA 3DFAA 4FSNA 3FV8A 4EK8A 4ZTHA 5KMIA 5AUVA 2PZIA 3QCYA 2C4GA 3MGYA 2VWUA 4L52A 5CEMA 3LLTA 2VRXA 3ID6C 4Z16A 3FAAA 5HE2A 5FDPA 3OZ6A 4IWDA 3P7BA 3ATTA 2WQBA 4E6QA 4JL9A 2HOGA 3DOGA 5K5XA 1TZDA 2XIRA 4FV0A 2H96A 2X0GA 4HNFA 2P2HA 1LEZA 3LXPA 3E92A 1KOBA 4K0YA 4OTRA 5GJFA 2W1CA 4BIEA 3RVGA 3RWQA 1OKVA 2YITA 3DAEA 3W2RA 2YIXA 4C4IA 2HXQA 3ZM4A 5H9BA 4XCUA 5IMEA 2BPMA 3SVVA 2OJGA 2QI8A 5F4NA 3JY0A 2J5FA 3U8WA 2QO7A 3SXFA 2X4ZA 1OIQA 3LJ1A 1KE9A 2Y4PA 4PTCA 4W8DA 4KRCA 3CS9A 4USDA 4MXCA 3F5GA 3GC7A 4UXQA 2Y7JA 2PVNA 5EI6A 5CF5A 1OPLA 1HCLA 4Z55A 2WFYA 3UO5A 1OKYA 3I81A 4C4FA 4FG7A 2XNPA 5CLPA 4DBXA 2X6EA 1QL6A 3L9MA 1BKXA 4FTRA 1UU3A 2BDWA 4H3PA 5AMNA 4ZIMA 4M13A 4RWKA 4U43A 4XP3A 4I0SA 4DEBA 4C3RA 1ZYJA 2YHVA 3BYVA 2UZWE 4GCJA 4FL3A 4Q5HA 3ZSIA 3LXKA 4RWJA 5J95A 1KV2A 4ASXA 4C8BA 3E7OA 4PL5A 2W1GA 3E3PA 4BRXA 2WEIA 3W0PA 3UQCA 3HP5A 2W96B 4WNPA 4CZYB 4IAAA 5IISA 3IG7A 2WQMA 4XP0A 3R9DA 5ETAA 5FEDA 2PULA 2YM7A 2YM4A 4EH7A 4JS8A 3VUMA 3W2CA 1J7LA 4HCVA 4I5HA 5DBXA 3W0QA 1M2RA 4FEVA 2CGVA 1JSUA 5ANEA 1OBGA 3SX9A 3E62A 3U4UA 3DQXA 5M56A 4OAVB 5CSVA 1Y57A 2WMSA 4R3CA 4D9UA 1R39A 2FB8A 2ONLC 1OKWA 2B9JA 3NW6A 3C4CA 3HL7A 5E8WA 3R9NA 2CHLA 4FK6A 1ZZ2A 5EYKA 3ZOSA 3KL8A 3TUBA 4FTLA 2QLUA 4CFXA 3FXXA 3IGOA 2X4FA 3A2CA 1PXLA 2B1PA 3E8EA 3QRKA 5JGAA 4CTCA 4FC0A 3ULIA 5EDQA 1OUKA 2W1ZA 3CPCA 3PP1A 4S33A 2JKOA 2CNUA 4UWYA 3DNDA 3WOWA 3TV6A 3FI8A 3P5KA 2WMBA 4W8EA 5A46A 3M11A 4RX8A 2OIQA 3N4UA 1NY3A 5CANA 5KHWA 2JLDA 2V62A 4F7JA 1QPJA 2X2MA 2CDZA 2GDOA 5CQWA 3EQPA 3Q9YA 3QQFA 4RFYA 5E92A 1H07A 3BKBA 5J1VA 4DFBA 2C0TA 3H9FA 4BI1A 1UKIA 4DDGA 4IM0A 2WQOA 2YAKA 3NWWA 4AOJA 4U3ZA 4FR4A 5HD7A 5IA2A 4F78A 2IO6A 2Z60A 3JY9A 5DR9A 5AUXA 5L6OA 3BGPA 2XANA 5GINE 2RKUA 1OIRA 1UV5A 2B52A 1ZMUA 3PE1A 4RWLA 2PPQA 4D4RA 4E4NA 3ZFMA 4YO6A 3BEGA 3CR0A 3BLRA 3TV4A 3RM6A 1XH7A 5LWNA 4OGRA 5AX9A 1G8KA 3IONA 5LMBA 5AFVA 3MBLA 1JKTA 4LDTA 5CT7A 4A4LA 2JDSA 5AIRA 2I0VA 2YCFA 1PXIA 4JAIA 4FV2A 1REJA 5KMNA 4AT5A 4FSUA 3FI3A 3Q4CA 1B38A 3HV4A 4I4FA 5BVWA 5G1XA 5KBQA 4FGBA 1PMVA 4U7ZA 4V04A 4ZS4A 5CASA 1M2PA 3QZGA 2XMYA 3FPMA 1ZRZA 4YP8A 1U4DA 3IDBA 2BR1A 3U9NA 3W33A 3FHIA 2JGZA 5CEKA 3PZEA 1Q62A 4DLJA 4KSQA 4EC8A 1H1QA 4AQKA 4J71A 3LAUA 1JKLA 3LOKA 4EYMA 3DK6A 2JBPA 2G9XA 3R2BA 3OMVA 4IAIA 3WZKA 3GU6A 1ERKA 5FBOA 4YLKA 4JOAA 4ZSEA 3ZEWA 3FLSA 4NM5A 4S31A 4BIDA 1SVEA 3H0YA 4M66A 3VRYA 4G6LA 4OW8A 3HMOA 4DFNA 3LKMA 4JXFA 3FQSA 4P5ZA 4S32A 1E9HA 3QQKA 1IRKA 3QYZA 4RX7A 4QTBA 2WGJA 3MW1A 5BV3A 3FMLA 4JX3A 5A3XA 3R7OA 5LOHA 2WMUA 4OBQA 4TXCA 3G0FA 3BWFA 2UW9A 3F3WA 4NEUA 2NNWB 4AZTA 4BI0A 3OHTA 2W4KA 5KZ0A 1W8CA 4AGCA 3F2NA 3PP0A 5M4IA 2PYWA 3JYAA 4HYHA 4E6CA 5HHWA 5M53A 3VF9A 4GVJA 3BHTA 4O1PA 2X0PA 3MH2A 3KULA 3S4QA 2J0KA 3I7BA 3KCKA 3QLFA 4JIAA 3QUDA 5HI2A 3BL9A 4NKSA 1O9UA 1OL6A 1HOWA 2WMQA 3L8VA 4G3EA 4GT4A 4A06A 5KBRA 4DTAA 4O0YA 1J7UA 4HVSA 2E9NA 2PU8A 4O4EA 5IU2A 5DH3A 1FMKA 3QHRA 2VWIA 3H9OA 4QO9A 4ZS0A 4IDVA 2WMRA 4RIYA 4TYEA 1UKHA 2QURA 1WMKA 3UO6A 5EYDA 2QG5A 4HCTA 3KULB 1UU8A 5H8GA 3QX2A 1GIHA 2VNYA 4YTCA 3HEGA 5ETFA 5KMOA 1YOLA 4IC7A 3VF8A 3QU0A 4FVQA 2RIOA 3C0GA 4I6FA 3KK8A 4OT6A 3SW4A 4RMZA 4TTHB 4NTSA 1P4OA 3GNIB 4QYYA 3ZBFA 2UZTA 4NSTA 2JITA 4L43A 1FVVA 3P23A 5K3YA 3IO7A 5C8MA 4ZTSA 5AR2A 2C6LA 3ODZX 4RIYB 3GXLA 3QZHA 2CNQA 3Q4TA 5IH4A 4P2KA 3W0MA 4E26A 3CGOA 3LQ8A 2JKMA 1ZLTA 2GNGA 3G6GA 3BPRA 2XKCA 3K54A 3VUHA 4BI2A 5BUEA 4BYJA 3BHVA 1M14A 3LFCA 4FSQA 3E5AA 3MV5A 2W17A 4FKIA 4WIHA 4AOTA 1SZMA 4EBWA 5IH5A 3GQIA 2IPXA 1YHVA 1Y6AA 3RCJA 3T9IA 1PHKA 3V5QA 3BYOA 3BU5A 2XEYA 3KRXA 4YBKA 5DRDA 4CKJA 1SVGA 4G9CA 3OW4A 3I5ZA 3RPOA 2CGXA 1VR2A 3A7JA 3QTWA 5J5TA 3OCGA 3C4EA 3NNXA 3R8UA 2WTKB 4D2WA 4RFZA 3LCOA 2ETKA 1BLXA 3BE2A 4GIIA 1GZKA 2GTNA 4BB4A 3MESA 1PXMA 2VO7A 1SYKA 2ETRA 1UU7A 1ZWSA 1Q61A 1JLUE 3I60A 3GBZA 4NK9A 4O96A 3R9OA 1XR1A 5DE2A 2Z2WA 4XOZA 4UB7A 1JAMA 2W9FB 3F5UA 4PNKA 3FMHA 2BHHA 5IUHA 3KC3A 3FBVA 2PE1A 3NSZA 4ANMA 4GFGA 4L45A 2WTCA 1H28A 4FV7A 2XRWA 2X0OA 4AN2A 3A7IA 4ZXTA 3TKIA 2WO6A 3O8PA 2UZNA 3Q9WA 4YJOA 3LQ3A 4ZJJA 1FBNA 5HO7A 3MH0A 2GSFA 5L2IA 3NAXA 2BAJA 3MJ1A 5ANDA 2W5HA 2QOOA 2UW5A 3D0EA 3NFGB 5CEPA 4RSSA 1KE6A 2VTNA 5IEXA 3GOPA 3ZRLA 2YIRA 3R7IA 4O7NA 3HV6A 3NYNA 4MWHA 4OBPA 2GCDA 4CTBA 3W55A 3IW5A 5A14A 4X2GA 3V01A 1JOWB 1E1XA 2ZM3A 4L9IA 4C4EA 4L7FA 3CBLA 4RX9A 1WBPA 2OJ9A 3QTQA 5AUZA 2BZIB 3D15A 3OEFX 5E90A 3VULA 3KFAA 3LCSA 4R6VA 4EH2A 3JXWA 1GIIA 4XG8A 3DU8A 4PRJA 4F1TA 1VZOA 4ITIA 4J8NA 4U9AA 3QLGA 3ZO1A 3BRBA 4BCKA 3MVMA 4DC2A 1IA8A 1CTPE 2QOFA 3ANRA 3PJ1A 4U8ZA 5L3AA 1H1RA 2PTKA 5TE0A 4RPVA 3RAHA 3TZ9A 4ZSAA 2B9FA 1M7QA 1CMKE 4XMOA 4KBKA 4DHIB 3AGLA 3DLSA 4YHJA 2ITVA 3KK9A 4FV9A 4GFMA 4JNWA 3HKOA 4EOKA 2YAAA 4M84A 4YZ9A 4CZTA 3PPZA 4RLKA 2A2AA 4WG4A 3DJ6A 2QCSA 3MYGA 4IWOA 3D7TA 4Q5EA 5IG1A 3OXTA 3NGAA 3D5VA 4USFA 3LJ2A 2HZNA 4QEBA 1JSVA 3OBJA 1PMUA 3OW3A 3LM0A 3KRWA 2XK8A 4L53A 5BYYA 2VX3A 2IN6A 1IA9A 5KO1A 2FVDA 3QGWA 3WE8A 1T45A 4IC8A 2X2LA 1ZARA 2VTPA 1XH9A 2XA4A 4FTUA 2HIWA 4QTDA 5CQUA 3OCBA 4QYEA 3TUDA 4I23A 3OY3A 4FG8A 4KKGA 4TWPA 4AN3A 2XH5A 3TMOA 2C6OA 4FV6A 2WEVA 2CJMA 2QR8A 3D7TB 3NUSA 3V6RA 3PFYA 4YC3A 4JQEA 4CV8A 5EQPA 5IQAA 3ZM9A 3AG9A 3G5DA 4MXZA 4A4OA 3DXPA 3SC1A 3D2KA 2XS0A 4FYOA 4UEUA 2O65A 3A4OX 2WTKC 5EM6A 5F1ZA 4RIOA 5GHVA 4FEUA 3KMUA 4ALUA 2B54A 1BMKA 4YSJA 4TYGA 2AC5A 2GNJA 5EG3A 3DTWA 1F3MC 3HV7A 4FV5A 3AT4A 4AZSA 3W0RA 2BAQA 4AT4A 3DXQA 1CKPA 3SQQA 3LZBA 5EYMA 3AQVA 3BHYA 5CY3A 4HGEA 4CT2A 3RAWA 1KE5A 4O4BB 3E88A 4FT0A 4NH1A 4F9YA 3SD0A 2JIUA 3ZRKA 2Y9QA 2CKOA 4E4MA 4NKAA 1SNUA 5KZIA 3GCSA 3EFLA 1XBCA 2RFDA 2VGOA 5CVGA 3D7ZA 5FUTA 2XNNA 2ZMDA 1NVRA 2XZSA 4U3YA 3PXFA 4DFLA 3IW6A 1GZ8A 4LRKA 1GZOA 2DWBA 4KNBA 4EUTA 3E8CA 4LFIA 4F70A 3CXWA 4WSQA 2PVHA 4ZLOA 5M4UA 1PJKA 3FC2A 4J7BA 4KKHA 4Q9SA 2A0CX 5EHLA 3Q2JA 2VV9A 3OWPA 1MRUA 5ANIA 5I9XA 4IAKA 3MSSA 5EI8A 4BGGA 3NCGA 4OTGA 1ZYLA 3GB2A 5CSXA 3RPRA 4FEXA 4XEYA 4IZYA 2XIKA 1UA2A 5CT0A 4XG3A 5BVKA 4EH4A 3C13A 4D5HA 4YJVA 4O0UA 4MD8E 1XHAA 2BRMA 3ZZEA 5I9VA 2YABA 1STCE 4CCBA 5CU4A 4FSYA 3OCSA 4F9BA 5LMKA 2EXMA 5CEIA 4QTEA 4RLLA 2PWLA 3GT8A 2Y8OA 3O71A 4QMWA 4CVAA 1GIJA 4F7LA 1H00A 5GIPE 2NPQA 3RJCA 1OB3A 3DXNA 4FSTA 4G9RA 4R5SA 5F94A 4EWQA 2Q83A 4XLIA 1SM2A 2IVUA 4QMNA 5DG5A 4N4SA 5DT3A 4ACCA 4FIHA 3DBQA 4N70A 1YWVA 3W18A 5C1QB 1Z5MA 4M12A 1FMOE 4AA0A 2OFUA 2WTIA 2OK1A 4A9TA 5M08A 3KRLA 4O6EA 4HGTA 2F7XE 2CCIA 1YXTA 3A4PA 4E73A 5LQFA 1F0QA 1VYZA 4XBRA 4YLLA 4L7SA 2J6MA 4NJDA 3HVCA 3OTVA 3QTSA 4ASZA 2PMLX 4L67A 1OVEA 4DEIA 3UJGA 1VJYA 2V5QA 3ZRMA 4FI1A 4N57A 4QPSA 3QZFA 3RZBA 1ST4A 4O4CA 3ERKA 3MY0A 3H10A 3UDZA 5D41A 3TYKA 2UW7A 1DAWA 2OJJA 2IW8A 4OR5A 5DN3A 3EN7A 5HQ0A 2NP8A 4QRCA 5AUYA 4BBEA 2X2KA 3FZPA 4LGHA 5HG8A 1R0EA 4GIHA 5HESA 5AUWA 4LI5A 3ZLSA 3W2QA 4XS2A 3PLSA 4GUBA 2GHLA 2FA2A 1VEBA 4FKWA 4YTIA 3SXRA 4HZRA 2W99B 2ITXA 1H25A 1O6LA 4DYMA 3ETAA 3U4WA 4UN0C 3KB7A 4OTHA 5J7HA 3Q3BA 4EK5A 1QPDA 5JFSA 1XBBA 2XKDA 3OXZA 1Y8GA 4YU2A 3KCFA 2XBJA 1PXKA 1ZOEA 1GZNA 3EKNA 4BC6A 3CIKA 3OCTA 3U55A 4AW1A 3O17A 3A8WA 1FQ1B 5HU9A 2UW4A 3R8PA 1TVOA 2OZAA 4KIQA 4YZDA 3KY2A 4B8MA 5IA0A 3RWPA 4C37A 3PUFC 4KAOA 5JT2A 4G5JA 4MCVA 3VS4A 1KE7A 2C6EA 3GCUA 5FDXA 5DI1A 4ZLZA 2O5KA 4BDBA 3LCDA 5AUUA 4KIOA 3TACA 4HPUE 4WRSA 1VLRA 4DFYA 1XMMA 1XJDA 3EJ1A 1JQHA 4USEA 3ET7A 5A9UA 4HW7A 1M7NA 4R1VA 4DFUA 2R3FA 1P2AA 3Q96A 4ZY6A 2EB3A 2FGIA 3AD6A 5GZAA 3COMA 2OZAB 3NLBA 5IA3A 3C0HA 1GY3A 1H1WA 2XK7A 5E8TA 2YZAA 2HWPA 2HZ4A 5L4QA 3EL8A 4MBJA 4UWBA 3GC0A 1E1VA 3DNEA 4PWNA 4RA5A 4WSYA 5I9ZA 4N0SA 3SG9A 4ZMEA 2VUWA 4F64A 4GVAA 4EQUA 3D5UA 3EMGA 4D4YA 5EW8A 4F99A 4XV1A 4U42A 3Q6WA 4ZOGA 3KRJA 4PQNA 2B9IA 2IVVA 3EQBA 4W4WA 4XYFA 1YKRA 1JKSA 3PWYA 1Q4LA 5HGIA 3ZMMA 5EFQA 5ANGA 4D58A 1H27A 2OH0E 1OI9A 2G2FA 4R5YA 4CSVA 3ZO3A 3ZBXA 4RJ5A 4ITHA 2E2BA 1Q8UA 3QKMA 4JBQA 1GJOA 3QQJA 1Q8WA 5FXQA 2YDJA 4UMQA 4WA9A 1OL2A 4HYIA 4QP6A 5E9EA 3TZ7A 4C7TA 5FWKK 4TT7A 3W0NA 5E91A 3EQIA 4ZSJA 3L9LA 5TOZA 2ZB1A 4NT4A 3TM0A 3VS3A 4ORKA 2QKRA 2R7BA 1OUYA 4J52A 3QFVA 4U5JA 3DJ7A 3S2PA 5K0XA 3UDBA 4LRMA 3AC4A 2YFXA 3II5A 2E9VA 3TT0A 4R7BA 1A9UA 3AKJA 4OAUC 3A7HA 4O0SA 4IB0A 4CG8A 4UBAA 4FODA 3AD5A 5DR2A 5FP6A 2EUFB 3RMFA 1J1CA 2P0CA 4FT3A 5AP6A 3H3CA 5HVKA 3ORKA 3RM7A 3CQWA 3E63A 4NW6A 3TKHA 3WZJA 4YJSA 3FL5A 1U5QA 2AYPA 3KVXA 4FOBA 5IKWA 5BQ0A 3AMBA 4AGDA 3F69A 2J4ZA 4FICA 1X8BA 3OBGA 2CGWA 4AAAA 3NFFB 3F88A 2BILB 5BVDA 1ATPE 4CD0A 3UOLA 3MFSA 4O7WA 4H05A 4FEWA 2DYLA 4ANLA 4ACHA 1OGYA 3F66A 4TYHA 5F20A 1NW1A 5IQHA 2FO0A 2UW3A 3C5IA 4DHZA 3LXNA 1AGWA 4L01A 3BCEA 4BCMA 2FSTX 3GU7A 4BCNA 1DAYA 4QMQA 2WMWA 4FYNA 3WYXA 4HZSA 4QPAA 3WILA 5HNBA 4O82A 4XBUA 3VJOA 3PA5A 3DGKA 4RA4A 1B6CB 2IWIA 4E8AA 2CSNA 2GQGA 3NX8A 2BKKA 4XV3A 4O83A 1IG1A 4GK3A 3MFTA 4JBVA 4DG0E 5M4FA 2OU7A 2R3OA 3CCNA 4X2KA 4GYIA 4X6QC 1OIUA 4C3FA 2XIXA 1OL7A 4O2PA 5BYLA 4TYHB 1P4FA 5L2TA 4UMTA 1TQMA 3CTJA 3DBCA 1MQBA 4V01A 2XALA 4C57A 3AT3A 1YXUA 2OWBA 3DKCA 1H24A 3I0OA 4O4DA 5K4IA 2H9VA 3A60A 4FKVA 3LPBA 5M57A 3GU5A 4DCEA 4ZTNA 4QP4A 1UWHA 4GL9A 3UDSA 3KF4A 2GS6A 2IVTA 1WCCA 3R8LA 2BRHA 2AC3A 5TKDA 4D2PA 4U40A 2ZVAA 2RFEA 1GNGA 5CI6A 5B2MA 2X1NA 4JQ8A 2KTYA 4QMZA 1PKGA 2B0QA 1ZY5A 4QT1A 4EEVA 2HCKA 2YM3A 3CQEA 4BTMA 2X8IA 5I9YA 2W1HA 3QRTA 3W16A 3FLZA 3ZSHA 5I5ZA 4IB5A 4U44A 2UZUE 4U80A 3RI1A 2WU7A 2XVDA 3NYVA 4H3QA 3G9NA 5TO8A 4DINA 4I0TA 4F9CA 2OKRA 2UZOA 4GW8A 5ANOA 4JQ7A 4FGRA 3GCPA 1L3RE 5C8NA 5HNGA 3CKWA 3B8RA 4GYGA 5K9IA 3WF6A 2C0OA 4BR3A 2X7OA 4NM7A 2C6IA 4TW9A 4IE9A 1PXOA 4O0TA 2PZPA 3G0EA 3MS9A 4U79A 4EOOA 3FMMA 4CMUA 3KEXA 5AP2A 4LGDA 3PSDA 5FTOA 4EQCA 2OGVA 3BGZA 2Z7LA 4AZEA 4DA5A 3Q9XA 1YXXA 3IGGA 3IW7A 5IMXA 3CP9A 2NYAA 1KV1A 2XIZA 3CGFA 1V0OA 5CSWA 4PPAA 4C0TA 4V05A 4J1RA 3A7GA 2X8EA 4WKQA 3UOKA 3V51A 2PZRA 4YTHA 3R7VA 3EQGA 1Q8ZA 3R7UA 4BCJA 4Q9ZA 3TUCA 3QQHA 3R28A 2XK4A 3DBFA 4FBXA 4FT7A 4Y5HA 4AA5A 3DLZA 4HVGA 1KWPA 3Q32A 3T3VA 4PMPA 3FKOA 4FTTA 4BTKA 3QWKA 3TXOA 1JKKA 4C58A 4JDKA 4QMXA 2Y4IB 3ZHPC 3KXHA 4M15A 1LEWA 5CF8A 3FMJA 4QQ5A 1Q3WA 5FM2A 1BL7A 3NUXA 3TV7A 4L00A 3MVLA 1YDTE 4RIXA 3BBWA 4NFMA 2C30A 3NYXA 4ZTLA 3Q2MA 3HECA 2XNBA 1U46A 3L9NA 4R8QA 2IF8A 2JDRA 1J7IA 3FLQA 2HW6A 4J98A 1H0VA 2VTOA 2WMTA 1LP4A 4WO5A 4WBBB 2PSQA 1Q97A 4JAJA 3FKLA 4B9DA 5L8KA 4A9RA 2QODA 1H8FA 1OPKA 2FH9A 3MJ2A 3OF0A 2CN8A 5EOLA 4BTFA