5ETIA

Structure of dead kinase mapk14
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVRKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structure of dead kinase MAPK14
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 355
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etiA01
4IACA 1URWA 2XJ1A 3UO4A 2BTRA 4H05A 4J8MA 2BZJA 3R00A 3QHWA 3PA5A 5CU2A 1YXTA 4U7ZA 1U5RA 2I7QA 2VNWA 3ZEPA 2WMAA 1UU3A 4WBBB 4OTHA 5TF9A 2WTVA 4TRLA 3POOA 5BVFA 5LMAA 4NTSA 2ZV2A 3HP5A 4ZZNA 3O8PA 3O2MA 4OGRA 4MYGA 4FEUA 3PZEA 2PUUA 4MXAA 5KCVA 4D2RA 3QFVA 4FIIA 4RX8A 5KMJA 1G8SA 2UW5A 2C0IA 5AV0A 3T8OA 5LMKC 4M8TA 5J5TA 2CN5A 3RWQA 3PDTA 4OTGA 1IR3A 2WTCA 1ATPE 3MJ1A 1ZYDA 4FKGA 4O0YA 4B6LA 3GQLA 3KRWA 4YZDA 4MXOA 3HMIA 3FY0A 1KE8A 2QOFA 2WMWA 1TKIA 1H07A 3F2AA 3GNIB 4RFMA 3A8XA 5HO8A 5J79A 5EOLA 4YJOA 4A9UA 2DS1A 2WIPA 2GNLA 1JNKA 3DBDA 5CF6A 4FSZA 1VZOA 5L8LA 5L2TA 3QQKA 3VF8A 1ZYLA 5FGKA 1PXKA 3BYVA 5HX8A 3L9MA 2AC5A 4X3FC 4CFUA 5E8TA 3BE2A 2BALA 1H8FA 5LMKA 1OL7A 3GOPA 2FUMA 2ETRA 2HWPA 1O6YA 2JGZA 2WKMA 3QZFA 5EM6A 3G15A 1ZZLA 3DAEA 5FUTA 4ENXA 3CKXA 2WMTA 3PE2A 2WMUA 4G34A 3ZSHA 2F2UA 2I40A 5AP6A 2WTWA 3R7GA 2EU9A 1FGIA 4MNFA 2B9IA 4EOPA 3QL8A 4RVTA 2R3GA 3CQWA 3IK3A 4ZTRA 4PNKA 4O82A 4J52A 3E8DA 2ZOQA 5TR6A 2XIRA 2DWBA 1UKIA 2WOTA 3D7TB 3GQIA 2W0JA 3TZMA 4APPA 5IA4A 4E4LA 2P3GX 2QC6A 3JVRA 3KN6A 1RE8A 3Q53A 4GK3A 4AN9A 5GZ8A 4XG2A 3UC4A 1IRKA 3LLAA 3DJ5A 5AUUA 1HCLA 1L3RE 2J7TA 2BRNA 3PXZA 4GIHA 3ZSIA 1OPLA 5CLPA 4JXFA 4U5JA 4BTFA 3C4WA 5HE0A 2CGWA 2ESMA 5DVRA 5KHWA 4IWOA 5HLWA 3DAKA 2PZYA 5EKOA 4YTCA 4J1RA 1P4OA 1W8CA 5EW9A 5IH5A 3ET7A 2WQOA 4E4NA 3OUKA 4DH3A 4AU8A 3PG3A 5CAPA 3WIKA 1BMKA 1UA2A 4ENYA 5EFQA 2WZJA 1H00A 4YBJA 5EM5A 4EH3A 3AD6A 2R5TA 4CV9A 3BGQA 2BRMA 3A7HA 1LEZA 1PXOA 2VNYA 4WG5A 3C0HA 3W55A 2UZNA 4UV0A 4C2VA 4QNYA 4GYIA 3CCNA 4XNEA 4V04A 3AT2A 3P79A 2X9EA 3ZO1A 3TTIA 4DINA 2EXCX 4DYMA 3ZSGA 2B7AA 2GNFA 3CTJA 3MFUA 2OF2A 4HZSA 3R6XA 5EI2A 3VS5A 4P90A 4BDHA 4EKKA 3LW0A 4IVAA 5AR4A 2WQEA 4UWYA 3TUBA 2B4SB 3JR1A 4L3JA 4DEDA 1J7LA 4EWHA 3COMA 5CU3A 2IZRA 3SV0A 2UUEA 1PHKA 1DI9A 1FQ1B 4FT0A 4BYJA 3PIZA 2Y9QA 3QC4A 3LJ1A 3R7IA 4WOVA 5CVGA 1WBWA 1Q61A 2R3NA 3PPKA 3QQHA 4ACGA 5D11A 5BUIA 4DT9A 4C4FA 2WTIA 3A4PA 5DNRA 1UV5A 4DG2E 4ZLZA 2BAJA 4IC8A 4QP7A 4IH8A 4AP7A 4I21A 3UVQA 5IA1A 2OZAA 2XRWA 2JKMA 2JKKA 2E9NA 3QYZA 4B7TA 3E3BX 1YXSA 3PLAE 4M7IA 4ANLA 1UNGA 3I5ZA 4MBIA 4KKEA 3T3UA 3V6SA 2REIA 5LVMA 2QU5A 2R7IA 2YM3A 4ZZMA 1OIYA 1H01A 3EYGA 3SA0A 3SXSA 4W8EA 2I0EA 3I81A 4H1JA 4PP7A 2XK6A 2YM7A 5CT7A 3IW4A 3V51A 5JGAA 4IE9A 2GDOA 3W8QA 4FSNA 4FTQA 3RAHA 3HRCA 1P14A 5HVKA 5CQWA 1OKYA 2PPQA 3HP2A 4AW1A 4K0YA 2C3KA 4TYEA 2C5NA 3QLGA 2WAJA 4L9IA 2QR8A 4IZAA 4AN3A 4DLJA 2EXEA 3D15A 3MPMA 1H4LA 2HOGA 4QMWA 4QMPA 2IZSA 4O7SA 4GT5A 4NW6A 5BQ0A 5IUGA 4RIXB 3W8LA 2VX3A 3ZO4A 3ZXTA 3QCXA 4BBEA 3VQUA 1Q99A 3DZOA 2QOKA 3DLZA 3PPJA 4FT5A 3CP9A 3NNUA 1Q24A 3ETAA 4AT3A 2PUNA 4IC7A 2XK9A 4MF0A 2R2PA 2X4ZA 3EH9A 4U0IA 3VF9A 4UMRA 3I4BA 1B38A 4R3PA 3OW3A 2G01A 3U6HA 4FTTA 4EJNA 3E87A 4D4YA 2O65A 4IB1A 3S2PA 1OMWA 4MQ2A 1Y6AA 4R5YA 5CVHA 5IQAA 5CEQA 4O7ZA 1ZXEA 4PV0A 4RG0A 3HGKA 3MH2A 3MFSA 4DEBA 3ERKA 1MQ4A 4L01A 3MVJA 4BDIA 4M66A 2OH0E 1GIIA 2PL0A 2XNPA 3BHUA 3MH3A 5AMNA 4ZSAA 2C69A 4AGCA 3FQSA 3BGZA 4BB4A 4FIGA 4RSSA 3ZC6A 2R64A 4XLVA 4CTBA 4NYEA 4DEAA 3PWYA 4P2KA 5E8ZA 4XS2A 3VUHA 4QP4A 2GSFA 3AOXA 3MFTA 5HG9A 5BVEA 5DLSA 4MVFA 3QX4A 3I60A 4Q5EA 4AX8A 3V5LA 3SGCA 1ZYCA 4CCUA 3P4KA 4KAOA 2JBPA 3QTIA 2ZM1A 3AC8A 3FI4A 4J71A 4AOJA 5TE0A 4E8AA 1IAHA 4Q5HA 3QQJA 3OCBA 1WMKA 4RIYB 4WHZA 4Q9SA 2OZOA 2UZLA 4FX3A 4RJ4A 4ZS0A 5AV4A 3B8RA 5FTGA 3DPKA 3R0TA 3V04A 5CU4A 4EH9A 4ZMFA 2XBJA 3P0MA 3CD8A 5IH6A 4JAIA 3F7WA 3GCPA 3L1SA 3R7OA 2C30A 4DFNA 4HCUA 4E4MA 4R7BA 4JG7A 3V8TA 4QQTA 4XV9A 1U54B 2WTDA 3H30A 4FSMA 4YJVA 5M4FA 2YWPA 4C3FA 3SRVB 3F2NA 3OCTA 2V7OA 4FA2A 2ZM3A 3GCQA 2W1FA 3IW8A 4I0SA 1LEWA 5A4TA 5GIPE 4AZFA 1FINA 5JFWA 2BKKA 4UWCA 1FOTA 3RPSA 1JKLA 3S1HA 2BUJA 2C6KA 3DT1A 3F5XA 4LOQA 4P5ZA 4NH1A 3IW5A 1UU8A 4R77A 2HZIA 1T45A 4AG8A 5IUHA 4MD7E 2BIKB 4ONAA 2XK3A 3RI1A 2RFNA 5DWRA 3OWPA 3QD0A 4U97A 3ENHA 2QQ7A 4G17A 5AR2A 2X8EA 4YJQA 5AR7A 4ANQA 4UY9A 3M2WA 1DM2A 4XG9A 3U6IA 2R3IA 3P86A 2C6EA 2GHLA 4C59A 4QTEA 3FMEA 4AUAA 4E20A 1SVEA 3RAIA 4GG7A 3KXHA 3W32A 4JRNA 3DQXA 3A61A 2ITNA 4FZAB 1Q8TA 2XEZA 5D12A 5AUTA 3ATSA 3GT8A 4RWJA 3ZLWA 2RKUA 3U54A 2PVFA 4WT6A 3DLSA 5BVOA 2ZB0A 4BDKA 3H4JA 5D7AA 3DK6A 4II5A 4LFIA 4F1OA 1IAJA 2WIHA 2C1BA 4BWKA 1IEPA 2ITYA 2Y7JA 3L8XA 1YHWA 2G2FA 2X6DA 4KSPA 4CT1A 4CG9A 4BIBA 2WTKC 3FY2A 3LOKA 4R78A 4C4JA 1K3AA 1H28A 4DGMA 2HW6A 5J1WA 3VS3A 3RM6A 3ZDUA 4JJRA 4DBXA 3WYYA 4Y95A 3OXTA 4GFGA 1H1WA 2ZM4A 1APME 4YR8A 3Q9WA 4LI5A 4BBFA 3NRMA 3ZLXA 5HTBA 4C36A 5IMEA 5AUVA 3E7OA 3D14A 3LM0A 4BTJA 3BIZA 4AW0A 5F95A 3UE4A 5LWMA 3VUGA 4QTAA 3WARA 3LXLA 5IQBA 3R1QA 4YC8A 5A54A 4KABA 4OBPA 4DFBA 3GGFA 3OVVA 1Y91A 4HVDA 4IX4A 5HIEA 3AC4A 4GRBA 3DFAA 3C4FA 4FR4A 3ZTXA 3C4XA 3VUIA 4LG4A 2UZVA 5E92A 3BEAA 2IJMA 4MK0A 4R1YA 4LM5A 3ORXA 2V0DA 1GJOA 3HA6A 5CANA 2BTSA 2W5HA 5J87A 3V5QA 5CAVA 3KGAA 3G0FA 4EK4A 2IO6A 3T3VA 4D4RA 1Q8YA 3Q4ZA 4R3CA 3P5KA 5FQDC 3BWFA 2BFYA 3R7EA 3FAAA 2UZUE 3LHJA 5LVPA 4IVDA 3KVXA 2I0VA 4W4XA 4NKAA 1NVQA 2F7EE 4EHVA 3Q5ZA 5IMXA 1R3CA 4BGGA 4BWXA 2RG5A 3OOMA 4RT7A 5C4LA 1KE7A 2W5AA 4ZOGA 3PXRA 3I0QA 4O1PA 4D55A 4RMZA 4I5PA 3QHRA 4JVGA 4QMSA 4XJ0A 5HI2A 4D2PA 2YJRA 3OT8A 2XM8A 1Q97A 1FGKA 3KN5A 3GCSA 4CZYB 3QD4A 2OI4X 2JKQA 3C4CA 4FC0A 3UTOA 4I4EA 2PVNA 4EQMA 3RAKA 4WRSA 4D28A 3LFNA 1YKRA 1ZOEA 4X2KA 4GT3A 4CZTA 2UZWE 3AMYA 3ATTA 4O7LA 1OBGA 3A99A 4FMQA 4XH6A 3RK9A 1FMOE 3QUDA 3VVHA 4D5HA 4JG8A 3TDWA 1RQQA 3FKNA 1YXVA 1MP8A 4GCJA 4KIKB 4QYHA 4FL3A 4GFMA 3CQUA 4OBOA 2PVLA 3R8VA 3TNWA 3NMUF 5HTCA 5HE3A 4BDBA 5JGBA 4FV5A 2QOIA 3RVGA 1GOLA 1SVHA 4FICA 4O0RA 5IZFA 2XJ2A 3IOPA 4W9XA 4YO6A 3EN5A 3E92A 4HPUE 2CGUA 4JI9A 4YZMA 3NUXA 4U41A 3WZJA 4UXQA 4KIPA 2OK1A 3KF4A 5CXZA 1JKSA 4BCJA 5KNJA 5BPYA 1JOWB 5FLFA 3NW7A 3C0IA 4TWNA 3G6HA 3HAMA 4M3QA 5CI7A 4YP8A 3VS0A 3DBCA 4TWOA 5JK3A 3HKOA 4ALWA 4XBRA 2VV9A 3ORTA 4RJ6A 3Q2JA 3IDCA 2W9ZB 3LIJA 2KTYA 3FHRA 4XG8A 1H08A 3C5IA 4H36A 4IX6A 4JNWA 3R8MA 3PVGA 4EYMA 2XYNA 4LL5A 4YC3A 4X7QA 3HL7A 4FV2A 4ALVA 1KE5A 1UWHA 1QPCA 4PL5A 3E88A 3TT0A 4KSQA 3W2QA 3NVKI 2AYPA 2QVSE 2UZBA 3FC1X 3FXXA 3ZRKA 4E4XA 5EQPA 2Z02A 2I6LA 4WIHA 2UVXA 3TV7A 4CFXA 1XH7A 3U4WA 2WU6A 4PMMA 2B52A 4XG3A 4PWNA 5FXQA 3OBJA 3FDNA 3L9LA 2VU3A 3VUDA 1JSUA 3BYUA 2FH9A 1R0EA 3MVLA 3EFJA 2GNGA 2WHBA 1H0WA 4RLLA 1YOMA 4YJSA 3OOGA 3E62A 3VBVA 4D2VA 4RX5A 3IO7A 4O21A 1YOJA 2ERZE 2PVKA 3BPRA 3LE6A 3OP5A 1J7IA 4LRJA 2OIQA 3U87A 1OPJA 4FKSA 5K4IA 3K5VA 4KWPA 4X2NA 5HE2A 1UVRA 2WEVA 4RWIA 3KK8A 3FL5A 2VWWA 3MSSA 4C61A 2RFSA 4ASXA 5LVNA 3R2BA 4ZXTA 2O5KA 4PTCA 4MD8E 1OBDA 4A7CA 2ITXA 2CCHA 1J91A 5I9YA 4QQ5A 2GU8A 4ASEA 3FI8A 2Y8OA 4FZ6A 4HGSA 3GEQA 4BC6A 3SD0A 5KHXA 3NZ0A 3PSCA 4JRVA 4NM7A 3UZPA 3ZUTA 3BLRA 3BI6A 3Q04A 3WZDA 4C2WA 4EKLA 5JMSA 5GJDA 4FZDB 4OW8A 4NJDA 3VS2A 1DS5A 3DKCA 3U6JA 5EHOA 2F7XE 2ZAZA 3C9WA 4AZEA 5AWMA 4XEYA 4ACHA 2YM6A 1B39A 5IUIA 3A7JA 3F3UA 5I9XA 2BHEA 2WMQA 4XRJA 3ODZX 1O9UA 3RK5A 4GUEA 1UWJA 4OAUC 4MNEA 3ORPA 3F7ZA 3FWQA 3KXZA 4A4LA 1K2PA 3P7CA 4F9WA 2BHHA 3F3ZA 4JDKA 3M42A 3FMLA 2ITVA 3E63A 1Q8ZA 3EL7A 3UG1A 5A3XA 3MH0A 4XV2A 5E8SA 3QGYA 3FLYA 3UODA 3VBTA 1PMEA 4P4CA 2J4ZA 4RIWB 3CIKA 1JBPE 2NRYA 4EH6A 3EOCA 5DOSA 1JWHA 2VTSA 1SVGA 3RM7A 3WILA 3KVWA 4O0WA 2V5QA 4YHTA 2FO0A 1YW2A 4BCIA 4Y73A 3LCDA 4YLJA 3W18A 2OG8A 3F61A 3BEGA 3DOGA 2BVAA 3MA6A 3NNWA 4C58A 2QKWB 5KMOA 3R9NA 1WAKA 5TKDA 5CSVA 3OWLA 5BUEA 4O0XA 3W2OA 4F6WA 4LUDA 4BIEA 5HCXA 4R7IA 4Z9LA 4DG3E 4QP2A 4UBAA 5K0XA 3QQLA 4TNDA 4BCPA 3V8WA 3QZHA 2B9HA 5BYYA 3D7TA 4TNBA 5IQCA 4G31A 5BNJA 4A06A 3ZONA 3E3PA 3I0OA 2C3LA 1UNLA 2Z60A 3HRFA 3KXNA 5BVWA 3OEZA 2HXQA 1RJBA 4L42A 4ZEGA 4BBMA 4DEHA 5J9LA 1Z5MA 2UW3A 3DNEA 5C4KA 4RA4A 5CNNA 3Q9XA 5BMMA 1JPAA 5IF1A 4CSVA 5JSMA 3FMDA 3MS9A 4QQCA 3G9NA 2W1HA 3PXFA 4HGLA 4NK9A 2Z2WA 2XB7A 4HPTE 4OT5A 5FRIA 3POZA 2HXLA 3C4ZA 4DFXE 5M4UA 1ZY4A 1JKKA 5JH6A 1W7HA 5AP4A 3TZ7A 3QQUA 2VTLA 3FMJA 1PY5A 4KNBA 1HCKA 1KOBA 2C6MA 1Q8UA 3KCKA 4FKUA 4EC9A 5EQEA 4FIEA 1PF8A 3BBWA 3R04A 5M56A 1PMNA 5KMMA 4ZJJA 3BHYA 3V5WA 4EUTA 3EZVA 4AW2A 3WE4A 4WNPA 4HYIA 5CWZA 5J5SA 5JRQA 4GSBA 2W1IA 4FVRA 4C57A 3LLTA 3R2YA 4I94A 1PXMA 4QYFA 4GJ2A 3FPQA 2GS2A 1NVRA 4DH1A 3TTJA 5DR2A 4U40A 3VO3A 4FKVA 4MBJA 2ITOA 2G15A 3EKNA 3DKOA 2WTJA 3SW7A 2F2CB 5EI6A 3DXPA 1YHSA 1VEBA 3COHA 3OROA 5GZ9A 4XHKB 4YZ9A 5ANOA 5F1ZA 3MH1A 3EQGA 5EYMA 3GU6A 3ORLA 4JIAA 4WO5A 3ULZA 3KCFA 5LARA 3U55A 2H9VA 3IGOA 4GH2A 3QZGA 4E5WA 3SX9A 2C5VA 1P4FA 4O96A 5HKMA 1PMUA 4ERWA 3FXZA 4IW0A 4RC3A 1M17A 3MPAA 5HG5A 4RJ5A 4PUZA 5HG8A 1YHVA 5ACKA 5A4EA 3ID6C 2JDTA 4QP6A 2QO9A 2YCFA 3QLFA 2E2BA 4G5PA 3IQ7A 2OJIA 2B9JA 3ENMA 4QMMA 4S31A 3FZOA 4BDFA 2R3KA 2VWVA 3IECA 3NUSA 2C5YA 2H34A 4PPAA 3R63A 4IAAA 4DTAA 2QONA 5LMBA 3NCGA 1DAWA 3CGFA 2OKRA 3P1AA 1F5QA 4I5HA 4NSTA 4UZHA 3DTCA 2JDOA 5ETIA 5CYIA 2B1PA 4FYOA 3QAME 4O83A 2UVYA 1WVWA 5I9WA 4FSYA 4F0FA 4DH5A 2DYLA 3MN3A 4KINA 4QYYA 2ONLC 3OD6X 2PVRA 4G5JA 1A9UA 1GIJA 5HNIX 3G51A 4L6QA 1VR2A 3FQEA 5HCZA 4QMTA 5AUYA 5C01A 3COIA 4C4HA 2WO6A 3KMWA 1VYWA 3EKKA 4DF3A 4JOAA 3EQFA 3I79A 4ALUA 5L6PA 4PRJA 2C68A 4CYJA 5T6KA 3EQHA 3PPZA 4E26A 4FTJA 2C5XA 4D4SA 4YMJA 3DGKA 4GW8A 4QRCA 3ZC5A 4WSQA 4U3ZA 3OT3A 3KRLA 4KD1A 5K4JA 1YI4A 4GU6A 4O2PA 1FVTA 1Q3DA 2ONLA 5GNKA 4YBKA 4PMSA 1NA7A 2FGIA 3E7VA 3FLSA 4O2ZA 4WSYA 3TXOA 4LQMA 4OUCA 4UMPA 4XYFA 1ND4A 4BZOA 1KWPA 2ITTA 2WD1A 4XOZA 3V5PA 3HAVA 3NUAA 2GQGA 4S33A 2J6MA 2Y4PA 3SQQA 3LFQA 2EWAA 3BX5A 3I5NA 2XCKA 2YJSA 3AGMA 3D2IA 4D9UA 4F70A 1M14A 4MXZA 3VRZA 2X2KA 5AA8A 5LVOA 5HQ0A 5L2IA 1U5QA 4X3FA 3UO6A 3IKAA 5B2MA 3PSDA 2XNBA 1Q41A 1H25A 3OBGA 4D2WA 3GU4A 3TKHA 3PLSA 3SAYA 3KC3A 4MH7A 2CGXA 5DRDA 4EL9A 3G2FA 3NUYA 5D10A 3MJ2A 4JQ8A 3VUMA 2BRBA 2VWXA 4EOQA 4N57A 5E9EA 2XH5A 5EG3A 4FSTA 4RIYA 1U59A 3C7QA 2BROA 5CEPA 3PFQA 2IPXA 3G9LX 5F4NA 4G6NA 5J1VA 4CFMA 2Q0NA 2WMBA 3B2TA 5ETCA 4DGGA 2C5OA 5HBEA 2QI8A 3D5UA 2ACXA 4N4SA 3WF5A 4Z16A 4XP0A 4IWPA 2UW4A 2WQBA 3DDPA 2YZAA 4YTIA 3RPYA 5AP5A 4C35A 4CQGA 5KMKA 5CNOA 5AUXA 2R3MA 4L68A 3FKLA 4XCUA 5J7HA 3AC5A 2QKRA 3HV7A 4O27B 4PMTA 4HOKA 5EKNA 3LQ3A 3H9OA 3FZSA 2R3LA 3ZO2A 4DHFA 2OFVA 1XR1A 4XP2A 3JS2A 3TL8A 1BL7A 4CZUA 3LZBA 3V5JA 1ZOGA 2A1AB 1YDSE 2WFYA 3NUPA 1IASA 2YCQA 2Z7RA 4QPAA 1PW2A 3DU8A 4CXAA 2IW8A 2OWBA 2RSVA 4DCEA 3HEGA 4DGLC 4F7NA 4AFEA 3MY0A 4GK2A 5B2KA 2O64A 4V0GA 4NIFB 3TACA 3UIMA 5IDNA 5M08A 2J2IB 1GIHA 4IAZA 5CQUA 3B8QA 2W9FB 4AT4A 3F3TA 3RPRA 5IQFA 2IVTA 3FZPA 1YVJA 3P7AA 1NXKA 2CHLA 4NL0A 4NEUA 4O38A 1KOAA 1FVVA 3ZBFA 4RWKA 1OI9A 3ZS5A 5CALA 2ZJWA 2YDJA 3GCUA 5HVJA 3OHTA 4TWPA 1JQHA 4BFMA 5E8YA 4QMOA 1IA8A 4HNFA 4IJ9A 1QCFA 5EM8A 3RWPA 3AGLA 4FSRA 4GT4A 2J0MB 4FZ7A 2R0UA 1XH4A 3JUHA 4IANA 3ACKA 3KRXA 5HNBA 4YLKA 5AP2A 1ZY5A 2ZMCA 5H8GA 4EH5A 3PYYA 2EUFB 5C9CA 4LL0A 4U6RA 1QPEA 2WMRA 1Q3WA 2P2IA 3PE1A 1BI7A 1WBSA 3RINA 5CENA 3O7LB 2JKOA 1OPKA 1NT2A 3S4QA 2HELA 3VWAA 5JEBA 4F1MA 3DK7A 4JX3A 1IA9A 1YWRA 4MXCA 2IWIA 2WPAA 3FXWA 5A14A 5AIKA 5AP7A 4NUSA 4CV8A 4EK3A 3R30A 3ITZA 3MY5A 2X9FA 3P7BA 2VX0A 5ANIA 4HJOA 2YABA 4FIHA 3ZCLA 3F88A 3EFKA 3OG7A 4R1VA 2J0IA 4FV0A 4OTQA 4ACMA 3OXZA 2JEDA 3PJ1A 4FVQA 2XMYA 3FYKX 3PA3A 2XNGA 2PYWA 1Y57A 5EDQA 4G9CA 5CZIA 3C51A 4RZVA 3DCVA 4DT8A 5DRBA 3EQDA 5HIDA 5GZAA 4NM3A 3QD3A 2J51A 4FYNA 4I0TA 4IB5A 3VHKA 3VRYA 5JFVA 3RMFA 2OIDA 3CSVA 4YTFA 3E5AA 2JDVA 4FUXA 3ZZWA 5CU6A 5EK7A 3W10A 1KSWA 4DEGA 4F63A 4UYAA 5H8EA 1OUKA 4JIKA 4FV7A 1PKGA 1LR4A 2J50A 2X2LA 1BYGA 4FOCA 1PMVA 5AX3A 3NGAA 4ZLOA 3F2RA 3FEGA 3EMGA 4AN2A 4K11A 3LKMA 4CFWA 4CTCA 3KXXA 4IAIA 4AZWA 4BDEA 2ZYBA 4N6ZA 1ZYJA 2W99B 2E9UA 2JIIA 3QTWA 1SNUA 4FK3A 4P5QA 4TZRA 4KBKA 5E91A 4NZWB 2VUWA 4D0WA 2YCRA 2O2UA 3BYOA 4YZCA 4AFJA 5JFXA 1BI8A 5FTQA 2IZTA 3UC3A 1G3NA 5HO7A 5I4NA 5JFSA 1WZYA 2P4IA 4X6RA 4TKSA 3DS6A 3F69A 4AS0A 2ZV8A 4UYNA 4R5SA 2X4FA 4FKJA 4J97A 4L8MA 3C50A 4O7NA 3RBWA 4OBQA 4TYHB 4X2JA 2W5BA 1SNXA 3H10A 4TW9A 4D1XA 4DE4A 4UEUA 2W4JA 4ZZOA 4QQJA 3HNGA 4FSUA 5FEQA 1MRVA 3QC9A 4YNEA 5IISA 4BCHA 3U9NA 3P08A 1MRUA 2H6DA 1ZWSA 3ZMMA 3FLZA 3DZQA 3MIYA 4GU9A 4L46A 3W2PA 3EQBA 4AE9A 3N4VA 5I9ZA 3BBTB 3MB6A 4M13A 2GHGA 5FEEA 1Q5KA 4EJ7A 4M12A 5HORA 5KUPA 3E93A 3ANRA 1WVXA 2UZEA 2X81A 4YO4A 2VTIA 2J5EA 5CT0A 4CGAA 3V8SA 5E4HA 4FIJA 4X3JA 4I41A 3WF7A 3QCSA 4FV9A 3ZUUA 3E64A 4L7SA 4XV3A 2XNEA 4CNHA 3DQWA 4OAVB 3FYJX 4OTIA 3UIBA 1H26A 1AQ1A 3WF8A 4FVPA 4WNMA 5TT7A 3Q4TA 2IZUA 4J98A 3C4EA 4IXPA 4CVAA 3ORZA 2ZVAA 2VTOA 4J7BA 4OR5A 4EHGA 5J9YA 3TJDA 4E3CA 3LQ8A 4PMPA 2CDZA 4NCTC 2WGJA 4I20A 1CKIA 5D7VA 3FMHA 3AQVA 2GNJA 3Q9ZA 3F5UA 3FSFA 2R3JA 4PP9A 5BMSA 4ZTHA 4WRGA 4JG6A 5C26A 2J5FA 3K3IA 5IH4A 2YAKA 3KEXA 4NFMA 4ANNA 1W82A 5CEOA 4IEBA 3PRIA 4D9TA 2XZSA 2VTTA 3GENA 5CAOA 2A4LA 3GC8A 4PPBA 2RL5A 2VTHA 3WF9A 4FT9A 4H3BA 1OM1A 4XX9A 4Y83A 4ACDA 5AAGA 2VGOA 4EK6A 5AAEA 4M84A 4NCTA 2QOHA 3MB7A 3EN9A 4L45A 1XBCA 2XA4A 3FPMA 5FP6A 3COKA 3PVWA 1YWNA 2EXMA 4ZSGA 1B6CB 5HICA 4NTTA 4UMUA 5EYDA 4BCFA 4QPMA 5DT3A 2QD9A 1XWSA 4DGNA 2IVVA 4RVMA 4FTCA 3GU5A 4YJRA 3HMOA 4BTMA 1XBBA 2OZAB 1W0XC 2XK8A 2VWIA 2FSTX 4PL3A 1YXXA 2XIKA 3G0EA 4UMQA 2PMNX 4WNKA 5D9HA 3QXOA 5K9IA 4DFZE 3LMGA 3KKVA 4AZTA 2OXDA 2GNIA 3L9PA 4V01A 2F49A 4QTCA 4RGJA 5HGIA 4ZTQA 2H8HA 2XRUA 4CD0A 2BPMA 4IWDA 2XEYA 4FGBA 2C0TA 4MKCA 5FEDA 1CTPE 1JVPP 4FZFB 4ERKA 3BHVA 3RCDA 2QOLA 3FZTA 4G9RA 4FT7A 2VO7A 4GL9A 5GHVA 2JLDA 4A4OA 4RQVA 3QA8A 3D4QA 2B0QA 3TCPA 4IJPA 4X2GA 2J0LA 4WBOA 3HYHA 4IVBA 3R1YA 2FVDA 4F08A 2UVZA 4JAJA 1VYZA 3MYGA 3QYWA 4D58A 3BRBA 3FSKA 3O8TA 1ZRZA 3N51A 3PY0A 4U42A 2PTKA 5AP1A 4O1OA 2UZTA 1H1QA 2FYSA 4XUFA 4B4LA 4PDPA 2VGPA 5DE2A 5BYZA 5LCKA 5IPJA 2G2IA 1Z57A 2VWZA 2JDSA 1AD5A 1Q8WA 4A07A 2JAMA 3S0OA 3CGOA 3VBWA 3RP9A 3R1NA 4FNZA 4G16A 4W4WA 2X39A 2HK5A 3D94A 2OXYA 1M2RA 5HIBA 2UZOA 1YRPA 3W33A 4C37A 3DXQA 3Q60A 4ZMEA 2C47A 4FEVA 2JC6A 2GQSA 4QMLA 3HV3A 1KUTA 5ETFA 5FXSA 5CAUA 2XIXA 5CEMA 5EW3A 4AA0A 3MFRA 3T9IA 3DV3A 4KIQA 5CAQA 3IDPA 3NW6A 5DEWA 4YSJA 5JRSA 1E1XA 2VWUA 4ZJIA 5TOZA 2XK7A 5A46A 1ZLTA 5B7VA 2W96B 3LCKA 3DA6A 2IW6A 4AOIA 1OIQA 1L8TA 3QUPA 3N9XA 3S3IA 4C7TA 3BCEA 3MIAA 2HW7A 3AXWA 1RW8A 3QA0A 3ZZEA 4J99A 2NPQA 4NM5A 4FODA 2V7AA 2NP8A 3R22A 4Y46A 5H9BA 4CG8A 4I6HA 3NYNA 3HLLA 5T68A 2H96A 3D7ZA 2O63A 5FBOA 4D5KA 2PZIA 4I5MA 1YI3A 4I6BA 5JQ8A 1Y8GA 3SOAA 3OEFX 4E5AX 3D0EA 5JZJA 3GU7A 2C6DA 2X7GA 3EB0A 4BHZA 5J9ZA 5C8KA 3A7GA 4U43A 4FBXA 3V5TA 4ANMA 4FE2A 4S32A 5A4CA 4YPSA 2WMVA 3ZO3A 3OY3A 4FNXA 4DH8A 5KE0A 4NKSA 3OCSA 4JL9A 2SRCA 3PIYA 1GNGA 2PMIA 3KULB 5ANJA 4M69A 1X8BA 1ZMUA 3PY3A 5F20A 1ZOHA 2P0CA 5AR3A 5AAFA 2R3QA 5KMNA 1Q62A 2P2HA 2FA2A 3AD4A 3H0ZA 3PY1A 1CM8A 4HCTA 4IAKA 3EL8A 5AIRA 3QF9A 3SG8A 2PVHA 2YN8A 3KXGA 4RWLA 1H1PA 3VS7A 4DBNA 1V0BA 4KKGA 5M57A 4L3LA 4MWIA 4EOMA 4Z7HA 4HVHA 1Q4LA 3ALOA 5EM7A 5I9VA 2IVUA 3LVPA 4O0TA 2YIRA 3R02A 1OIRA 4M67A 3NSZA 4MAOA 2BMCA 5CSHA 5FM2A 5FTOA 4BCNA 4ZJVA 4GVJA 4U79A 4GK4A 3A7FA 3QKKA 4S34A 4YPDA 3HV6A 1QMZA 2XP2A 4CKRA 3DDQA 4FG7A 3UP2A 5IQHA 4BKJA 3LFSA 1BX6A 4ZAUA 3NNXA 3IS5A 1YDTE 4QPSA 4IZYA 3VBQA 5JQ5A 5CX9A 3NDMA 3VBYA 2BRHA 5EH0A 4UZDA 2QLUA 1WFCA 4RJ7A 2HZNA 2VO0A 4CRSA 5G6VA 2FSLX 2JIVA 5KZ0A 3D5WA 2Z7SA 4ITIA 2IN6A 3NYVA 1Z9XA 3UPZA 4YZNA 4BGQA 2YIQA 2RF9A 3GP0A 3QU0A 4OLIA 5IDPA 3BLQA 3F66A 4ZSJA 2OFUA 3BV3A 2W05A 5IEVA 2Y0AA 1UU9A 5I0BA 4Y5HA 3VS4A 4EZ3A 5JKGA 4FEQA 4QTBA 4F1TA 3LFCA 3SG9A 4FEXA 5FDPA 4F09A 4PTEA 5AV3A 4OTPA 3VW8A 4PTGA 4AT5A 4C38A 3QTQA 3TUCA 4TL0A 4GYGA 2WXVA 4DFYA 5IG1A 3IPHA 4FIFA 3KF7A 2I1MA 4ZK5A 4EC8A 4USFA 3CXWA 4YZBA 4TXCA 1J1BA 4AGUA 4E6QA 1XQZA 2GHMA 4KA3A 5I9UA 1ZYSA 1MQBA 3ZEWA 4EOJA 4ZTNA 4EZ7A 5K5XA 3CKWA 3NAXA 2W06A 3EWHA 1ZZ2A 4PQNA 2X2MA 3ZOSA 3DBEA 3RKBA 3C1XA 3DAJA 4I5CA 5ETAA 3VUTA 5AR5A 4M15A 2YM8A 4BTKA 4AA4A 1XH6A 3EIDA 4C4EA 5LWNA 2WNTA 1PYEA 5HO6A 4UALA 3NEWA 3DJ7A 3L8VA 5E90A 4CLIA 4NW5A 4U3YA 4Y5QA 2PSQA 4YSMA 5M09A 1TVOA 4FKTA 3RK7A 5HOAA 1YI6A 3SOCA 2GTMA 3LFFA 1XHAA 3N4UA 1LP4A 3KFAA 4QP3A 2JIUA 3EN4A 3TV4A 5CZHA 3A8WA 2CNUA 4KKHA 5AJQA 4A9TA 5DPVA 2PU8A 3QTRA 4EOIA 3WZKA 1I44A 4ZY4A 4QOXA 2O8YA 5AADA 4IZ5A 4O7YA 4CKJA 3I6UA 3LPBA 4FGRA 3CBLA 4ITJA 3A7IA 4HYSA 5DIAA 4OTDA 4YJUA 1KV1A 2XKFA 2YLEA 3L9NA 4KBAA 4L3PA 5DFPA 3TIYA 4IMYA 5AEPA 1NVSA 4JR7A 3Q3BA 2E9VA 1GZOA 4U45A 2YZLA 3RHKA 3TUDA 1YQJA 3V01A 4BCGA 1V1KA 5BX0A 4O91A 2CKEA 2CSNA 5GJGA 5E1SA 5DT0A 1S9JA 3TN8A 4QMXA 3BLHA 4G3EA 1GZKA 4LGDA 3BELA 2YA9A 4F99A 2VTPA 2YERA 4O7RA 3QBNA 4EQCA 3UQGA 4GFOA 3A4OX 3LXKA 1XO2B 3R21A 3ZH8A 3NS9A 4MQ1A 4EWQA 3KA0A 5IQDA 3QKMA 4F7SA 3EYHA 2QODA 4ASZA 4F7LA 4N0SA 3GC7A 5ANKA 1DI8A 4XRLA 3R71A 4L00A 5M51A 4X0MA 5A6NA 3IG7A 3PA4A 2BDJA 4RZWA 2W1ZA 3EN7A 5CSPA 5EOBA 4DFUA 5J95A 1PXJA 5AUWA 2JDRA 3B2WA 3DXNA 3DFCB 3GC0A 3KB7A 4LV5A 2JBOA 4IVCA 4FL1A 5FDXA 2BRGA 4JDIA 5HE1A 4A9YA 4MEDA 4WUNA 5I5ZA 4CLJA 3UOJA 4NIFA 3RTPA 4IADA 4NM0A 4QT1A 4FV6A 3I6WA 3REPA 5HESA 4C4IA 5HD4A 1BLXA 5HHWA 3VJNA 2HENA 3UOKA 2WOUA 4FTRA 3ZXZA 4ARKA 5L2SA 4EK8A 4CFVA 5KBQA 4XV1A 4D4VA 2EB2A 3CY3A 5E7RA 3LMIA 2OSCA 3D83A 2BKZA 2BIYA 3FLNC 5AP3A 2RGPA 3E8NA 4AZVA 3UQFA 3UYTA 3NW5A 2X8IA 3PZHA 3BU5A 4IWQA 3TZ8A 3UGCA 2WB8A 3RZFA 3VIDA 1OUYA 4FKPA 4BDCA 3W2CA 3QRTA 3LJ0A 3LFBA 5HD7A 3D2KA 4MX9A 1Y6BA 2J0KA 3EZRA 3DBQA 3Q4UA 3R28A 4F0IA 2WU7A 2OO8X 3VN9A 5CEKA 4HVIA 2R3RA 3DBFA 3Q4CA 1REKA 3TNPC 5B2LA 4MTAA 5CF8A 4DA5A 3KK9A 3NNVA 5HNGA 4JQ7A 4C33A 3A2CA 3C13A 2Q0BA 3HDNA 3AG9A 4FK6A 3UQCA 2PE1A 5DEYA 4E1ZA 4JBVA 1OL5A 3WZEA 1V0PA 3TM0A 3RNYA 1EH4A 4RX7A 4FTKA 2W1EA 4EOSA 5KKRB 4U81A 4KIOA 1WBNA 3SKCA 1PXNA 2CJMA 2VZ6A 3O23A 4FV3A 2PWLA 4RPVA 4F65A 5M55A 4ITHA 1U46A 4KUJA 4GIIA 4PDOA 1WCCA 3ROCA 2XK4A 4XMOA 2RG6A 3F9NA 4RIXA 3Q5IA 2B54A 2CNVA 5A4LA 1R78A 3DY7A 1FBNA 4F64A 1TQPA 5IU2A 4N6YA 2XUUA 3PJ8A 3R01A 3W16A 3VNTA 3PVUA 4H1MA 3HMPA 5IEXA 1OZ1A 3ODYX 5HCYA 1GY3A 3HDMA 4K2RA 4RFYA 2Z7LA 4IFCA 2F4JA 1J3HA 4XG7A 4AE6A 4HVGA 2OIBA 2OU7A 1PXPA 2PUPA 4KS8A 4QMNA 4FEWA 3CJGA 1OITA 5DR9A 2W4OA 1HOWA 3PXQA 3HVCA 3JXWA 4O0SA 5KZIA 3L8SA 4AWIA 3ORMA 4AA5A 4R6VA 3OTUA 5IQIA 4MNEB 2V62A 3CS9A 3OTVA 1FMKA 2B9FA 3WF6A 2UW0A 4PL4A 4BDJA 5KMLA 3BKBA 2QOOA 2NRUA 3WYXA 1S9IA 4FSQA 3LXPA 2JFLA 3O50A 2HCKA 4U44A 5HEZA 5E8VA 3JY9A 3CPBA 1YXUA 2BILB 2GFCA 5CY3A 5AV1A 4PDYA 4TYJA 4EBWA 4QNAA 3LCSA 3D5XA 3FE3A 3QRKA 5HG7A 3WZUA 5IQEA 4IB0A 2HIWA 3EJ1A 2XBAA 4DGOA 2CCIA 3UNJA 3OZ6A 4DFLA 4LOPA 4TYHA 1OKWA 5L2WA 2WMXA 1PRYA 2XKCA 1XH5A 3MPTA 1SM2A 2BZKB 2VWYA 4LV8A 5CTPA 4I0RA 3AMAA 3T9TA 5IA5A 5HVYA 3OXIA 1OVEA 2I0YA 5LOHA 3FLQA 4QP1A 3PJ3A 1OL1A 5C8MA 5EW8A 5M44A 4I22A 4Q2AA 2XCHA 4JBPA 4DEIA 3OY1A 3FI3A 2VTRA 3KMUA 4AGWA 3QRIA 4N70A 4DN5A 1U54A 3R9HA 5EYKA 3QD2B 3SRVA 4O7WA 3FHIA 2XYUA 3SXRA 5L8KA 1AGWA 4HVSA 5LQFA 3QX2A 4O22A 4HGEA 1ERKA 1QL6A 3W1FA 5JT2A 3ALNA 4YU2A 1JKTA 4EYJA 4QMUA 4FTAA 4W8DA 4FKOA 4DC2A 5JZNA 2YAAA 4FOBA 3ZM4A 4AF3A 3GU8A 1GZ8A 4YJTA 5BYLA 4Z55A 3NX8A 4BWPA 2Y6MA 3K5UA 4ZTSA 5J8IA 2PK9A 4U8ZA 3R9OA 4F0GA 5M07A 3FUPA 2PE0A 3PTGA 4DH7A 5BVDA 2DQ7X 3HV5A 4USEA 5EHLA 2VN9A 5F9EA 5DR6A 5L6WL 3V6RA 1STCE 3BU3A 4FKLA 3R8PA 4LRMA 4FTNA 4BCKA 2RFDA 4QD6A 5EDRA 3DKGA 3SLSA 4BI0A 3AC3A 3GC9A 2F9GA 4A4XA 2HZ4A 2OGVA 5DBXA 3ZHPC 2G1TA 2QURA 4ID7A 4WKQA 5I3OA 2JD5A 4EK5A 4EOOA 3GFWA 2Y4IB 4EH2A 4YUQA 5FWKK 2PZRA 4O0UA 5EI8A 3D5VA 1PJKA 3GUBA 4O84A 2LAVA 4IX3A 1QPJA 4MXYA 1O6LA 4BICA 4DLIA 2GFSA 2WQMA 4B8LA 3LQ5A 3GVUA 4TT7A 1CKJA 3EQIA 4GKIA 2VX1A 5H2UA 2XM9A 4BGHA 5CXHA 3UOLA 2VTAA 1U4DA 2OLCA 2P33A 3WI6A 2GS6A 2O3PA 4GKHA 2CN8A 3FKOA 2EVAA 3PRFA 3QXPA 2VTQA 2AUHA 3UP7A 2EB3A 3ZLSA 1Y8YA 4EH7A 3WOWA 4L44A 2F57A 3LCOA 3VW6A 2CKOA 2OJFE 4C02A 4E6AA 2XIYA 3JY0A 4I3ZA 3Q6WA 5HTIA 4IIRA 3GB2A 3Q52A 4ZP5A 3R9DA 2BAKA 4S30A 4PY1A 1CSNA 4WA9A 4BCQA 2G9XA 4F6SA 5K0KA 5AV2A 4F9AA 3FV8A 5AFVA 3QTSA 4I24A 3VAPA 4QMZA 3ZFYA 2UW8A 3K54A 4XP3A 2P55A 3PWDA 2YEXA 5DT4A 4UN0C 2IW9A 1PYXA 4RIOA 3SHEA 3TZ9A 3TJCA 3U8WA 3QWJA 5KX8A 2F7ZE 3BE9A 1W83A 3EN6A 4LOOA 3RAWA 1YWVA 3SVVA 3BQCA 4G3GA 3H9RA 4LGHA 4R7HA 2GQRA 4GMYA 2OJJA 3H0YA 4WUAA 4RJ3A 3V3VA 2W4KA 3NUNA 2CKPA 5CU0A 4PPCA 4E6DA 5K5NA 1OKVA 3I7CA 3UNZA 4FG9A 2CPKE 4D1SA 2WELA 4IBMA 4XBUA 4Y8DA 3VHEA 4YHFA 4O86A 3VQHA 4GS6A 3QTZA 4WNOA 4JLCA 3MTFA 4K1BA 1SMHA 3W2RA 1XH9A 3QALE 4BRXA 4D0XA 4RC2A 5EHYA 4EONA 2LGCA 3NR9A 2W1DA 4USDA 3C0GA 3KY2A 2A19B 4QMVA 5AX9A 2NO3A 4AW5A 2YM5A 4AXAA 5LJJA 4MXXA 4CT2A 4H3PA 2QLQA 3D9VA 3WIGA 4ANOA 4CEGA 4HW7A 3TKIA 2HY81 3MY1A 4IM3A 3JVSA 5HU3A 1LUFA 4MD9E 5TO8A 1A48A 4PNIA 2PZ5A 4ZTMA 4K77A 4IZ7A 3O7LD 3ORIA 4DTBA 4H3QA 2ERKA 4NU1A 4K8AA 4H39A 3SW4A 2UW6A 4C62A 5H3QA 5DI1A 3LCTA 3CE3A 4CMTA 3MVMA 5IEYA 5AM7A 1V0OA 2PUIA 4BN1A 3BYMA 3NPCA 5FG8A 3TI1A 3O51A 3NVMB 4IDVA 2ITQA 4KB8A 5HZNA 1OGUA 3UOHA 4B9DA 1E9HA 3A60A 4L67A 3IW7A 4I6FA 3QRUA 3QZIA 4E7WA 4YLLA 3NAYA 4ZIMA 3VS6A 4ZSEA 3P78A 4YJPA 4B8MA 4X3FB 4KIKA 4AZSA 2J9MA 4YJNA 2JAVA 2QO7A 1JSTA 3BQRA 2OF4A 4FUYA 4FTIA 2YIWA 5HU9A 4HZRA 2DUVA 4BDDA 1NY3A 2GMXA 3G33A 1E1VA 3JPVA 4G3DA 4CYIA 3ZU7A 3LAUA 2OJ9A 3UJGA 2BCJA 2VWBA 2HAKA 5D41A 3S95A 3ACJA 4BVUA 3DB8A 3MTLA 4RVKA 2BZIB 5ICPA 1XH8A 2FSOX 3MA3A 1G8AA 3UDBA 4RRVA 5HLPA 3ZLYA 2OJGA 4UB7A 1O6KA 3IOKA 3IW6A 4C4GA 4GG5A 4E93A 2C6TA 1UU7A 3KULA 3TNIA 2R3FA 3HA8A 4A9RA 3UZRA 4LGGA 2C4GA 2A0CX 3FMKA 4O81A 5EQYA 4TTHB 5LCJA 3N4TA 4RFZA 3CD3A 4NJ3A 5C8NA 4M14A 5CS6A 3O8UA 4KRDA 4YC6A 4UXLA 1FPUA 4FTOA 5BUJA 4IAFA 4DITA 2YIXA 2VO6A 3QQFA 4B0GA 1YOLA 2PVJA 2X0GA 4K33A 4BI2A 2B55A 3QQGA 2CKQA 5GJFA 4V0GB 3R7VA 3VBXA 2C3IB 4YNOA 2O0UA 2YITA 3RJCA 2YLFA 3AC1A 3NWWA 4W4VA 4C34A 5FXRA 4IM2A 3QRJA 4TWCA 3MI9A 4DAWA 4WG4A 2XVDA 4BCMA 2GTNA 3NYOA 4QMYA 2W7XA 4L7FA 1WVYA 2WQNA 3TWJA 1H24A 4KRCA 5L8JA 1UNHA 5EDPA 3H3CA 4O7TA 4EH4A 4G3CA 1M52A 2YDIA 1W84A 3P23A 4JT3A 2QG7A 3IONA 4FNYA 2UZDA 3R8LA 3JYAA 2YWVA 3UO5A 4IQ6A 3PJ2A 1R39A 3F6XA 4F6UA 2BAQA 2VO3A 3CJFA 3KL8A 3I1AA 4RBLA 4X2FA 4XOYA 3IGGA 4FI1A 5EYCA 1PXLA 3MESA 3M11A 2YIYA 3BWJA 2GPHA 2XNOA 4FG8A 4XLIA 5CSWA 4F4PA 3VULA 4UMTA 4ZY5A 3LJ2A 4EZ5A 2WEIA 3Q6UA 5IKWA 5IQGA 3UIUA 4LUEA 5DYJA 4I92A 5HBHA 4O7VA 4BDAA 5M06A 4ANBA 2GNHA 2XS0A 4EOLA 3CR0A 4AOTA 1J1CA 5IA2A 4IB3A 4S2ZA 4J96A 4C3RA 4BCOA 3LXNA 1JSVA 2YCSA 3HMNA 1M2QA 3ZDIA 4IFGA 4MCVA 1LPUA 2X7OA 4EORA 2J0JA 1REJA 2J90A 1WBPA 1KE9A 2ZB1A 4FKQA 2XJ0A 3Q2MA 3OWJA 1K9AA 2OH4A 3KRRA 2OBJA 2PE2A 4QYEA 4GJ3A 4I93A 3OF0A 4RIWA 3SXFA 1P5EA 4LYNA 4BF2A 3UVRA 2VAGA 4UWBA 4D2SA 5F94A 5C1QB 3FBVA 3Q96A 4BZNA 2X7FA 3FLWA 2XKEA 2Z8CA 3QWKA 3ZRLA 2ITUA 1G5SA 3PJCA 3THBA 3BHTA 2VTNA 1ZAOA 2C1AA 3TV6A 3NYXA 3O17A 3AT4A 1BKXA 3ZUVA 3HZTA 4JDHA 5BVNA 4RQKA 2QR7A 4H58A 4Q9ZA 2IVSA 4C8BA 1KV2A 3GOKA 3ELJA 3KMMA 3O0GA 5KBRA 3R8ZA 2QOBA 2PMLX 2VTMA 4NWMA 1M7NA 3AMBA 3CLYA 4G3FA 4DTKA 1WBVA 3CPCA 3DTWA 5KO1A 3UMXA 3CEKA 3BYSA 3DJ6A 3RCJA 1JAMA 2QU6A 4YTHA 3RGFA 3VC4A 3EQCA 3QCYA 4APCA 4FF8A 3UG2A 4EOKA 1SZMA 3E8CA 1OIUA 2HWOA 3FZ1A 2RFEA 3AC2A 3K3JA 4C0TA 4G6LA 3I7BA 4I1ZA 4M0ZA 4RVLA 5AM6A 4EUUA 4K18A 4JDJA 5CVFA 5A6OA 5J7BA 3F5PA 4BZDA 5DA3A 2CNQA 3FMNA 2YISA 2ZDTA 4FT3A 1BUHA 2YHVA 5AUZA 2C6OA 2C3JA 3NUUA 2OXXA 1CDKA 3S00A 3U9CA 2BDFA 4FV8A 3M1SA 3BHHA 3EQPA 3ZFXA 3HECA 1A06A 3UBDA 5B0XA 4RJ8A 1F0QA 3F82A 4G1WA 2XIZA 4JS8A 5AP0A 2BZHB 2XKDA 3SDJA 4JX7A 4Z3VA 4L52A 3RNIA 3RALA 4FKIA 4HGTA 3Q32A 4ORKA 5DH3A 1M2PA 3HUCA 3HMMA 3PVBA 3QCQA 3R8UA 1ZMVA 2OICA 5E8XA 4B99A 5A4QA 4Y72A 1J7UA 4MF1A 3P9JA 5L3AA 2IG7A 2QHNA 2X8DA 3MWUA 3KU2A 5FBNC 5LXMA 4QP9A 4IX5A 2I0HA 4O0VA 4J95A 4R8QA 5DHJA 5E1EA 3HX4A 3IDBA 3VS1A 4LRKA 4J53A 4ASDA 2R3PA 1SYKA 4Y85A 2QOQA 3H9FA 3UIXA 4BY9E 4O6LA 4RA5A 2YDKA 4G2FA 3C5UA 4BR3A 3U4UA 3ZFMA 2HY0A 4CFFA 4BIDA 4U9AA 3ZRMA 4L53A 3G5DA 4ANSA 2UV2A 1GZNA 1RDQE 4FV1A 2PMOX 3R7UA 4FTMA 4L43A 3DNDA 4OT6A 3PIXA 5CASA 2B53A 3RHXA 5KKRC 4P7EA 4EI4A 1CMKE 3PUPA 2UW7A 3BU6A 4QO9A 1WBOA 3L8PA 5DGZA 3OUNB 3TDVA 3ZM9A 3UVPA 2QG5A 5CF4A 2QHMA 3GCVA 5L2QA 5JGDA 2X6EA 2XF0A 1NW1A 4JBQA 3GI3A 2YM4A 3OFMA 1P2AA 4QP8A 3F3VA 4BHNA 4CKIA 3WE8A 4EQUA 4M0YA 3HUBA 4JQEA 5T3QA 4W4YA 3TEIA 3CQEA 4D2TA 5IA0A 2Y6OA 3PG1A 4DG0E 3OS3A 5DMZA 1OL2A 3GBZA 4JR3A 4TPTA 1XKKA 3PP1A 2YACA 2C0OA 3PXYA 4IDTA 3ULIA 4I23A 1ZMWA 1R0PA 4QTDA 5HLNA 2CMWA 4FTUA 4KBCA 4NFNA 4RC4A 2FB8A 4ZLYA 2CGVA 2Z7QA 4HYHA 5K3YA 4FL2A 3FZRA 2C6IA 3EQRA 5AA9A 4TY1A 1JLUE 4E6CA 4GVAA 2X1NA 4AGDA 4WD5A 1H1RA 3NLBA 3MVHA 1W98A 4A9SA 2KULA 3ORNA 1T46A 2NNWB 3TG1A 5E8UA 2WTKB 5FD2A 4I6QA 4G6OA 3GFEA 3DB6A 3MGYA 5AR8A 4R3RA 1F3MC 3R83A 2C6LA 5C03A 3KREA 3DK3A 5JN2A 3HRBA 3LMHA 5DG5A 4ZSLA 1GAGA 3R9RA 2ETKA 4EHEA 1PXIA 2W1GA 3FC2A 1I09A 4ZS4A 4GEOA 3NCZA 1VJYA 3W2SA 2WMSA 2GCDA 4FNWA 4EEVA 3EFWA 4FTLA 3G90X 4YGAA 5L4QA 3UYSA 4FKWA 3OCGA 3MDYA 4QMQA 2PVYA 2QCSA 2YFXA 4BL1A 3KXMA 3FQHA 2PZPA 3UMWA 4IHPA 3QGWA 4GUBA 5DN3A 3QKLA 3QUEA 1CKPA 3KRJA 5CSXA 3LM5A 3O96A 4GV1A 4BKZA 3O71A 3HV4A 3OC1A 1R1WA 4BKYA 5ITAA 1OL6A 1XBAA 3ORKA 4TYIA 4YHJA 3EHAA 5BVKA 1OB3A 1YDRE 3R1SA 4AACA 3UZTA 3FL4A 1H27A 3RPOA 3NIEA 4C3PA 3BGPA 4JBOA 2PVMA 3CY2A 5HX6A 3F5GA 3ZYAA 1M7QA 3TKUA 2A2AA 5E8WA 4MWHA 4FKRA 3BZ3A 3TNQB 5ANEA 5D1JA 2V22A 5I3RA 5GIOE 1DAYA 4KS7A 2PULA 3DKFA 3FMMA 4AQCA 4LMUA 2GS7A 3TIZA 2XNNA 3LFAA 3LFEA 4IAYA 1URCA 1TQIA 4PF4A 5H8BA 2W17A 2R9SA 2E9OA 3OW4A 3VUKA 4BDGA 3GXLA 5FP5A 3F3WA 2ETMA 1BL6A 2VD5A 4PX6A 2ZMDA 2ITWA 2QNJA 2BFXA 3E8EA 4CQEA 2CLQA 3FJQE 3UNKA 4DEEA 4EBVA 4K9YA 2AC3A 3OMVA 4PDSA 3QTXA 4ACCA 2ITZA 1OKZA 3G6GA 4FSWA 3RPVA 4X21A 4NT4A 5ANGA 3QTUA 4HNIA 5CEIA 3R73A 4RX9A 1FVRA 5ANDA 4ZY6A 4EHZA 1WBTA 3PP0A 4F7JA 2ITPA 4CCBA 2A27A 2QO2A 5CF5A 4MBLA 5KMIA 1MUOA 1OECA 2BDWA 3A62A 4BI1A 5M53A 5M4IA 4J8NA 4WG3A 2XNMA 2Y4IC 3Q9YA 3UPXA 3PSBA 4MHAA 5C27A 2W1CA 4X6QC 3RZBA 4E5BA 5L6OA 2E9PA 3ZBXA 1QPDA 1MRYA 2PHKA 2OW3A 2V55A 4V05A 1ZARA 4XG6A 1IG1A 4O6EA 4I4FA 5A9UA 4M68A 3VJOA 3ANQA 4M69B 4EH8A 2HYYA 2ZDUA 4TYGA 2HZ0A 1UKHA 2VTJA 5G1XA 4CFNA 5CI6A 2G2HA 2Q83A 2R3HA 3MV5A 2ZV7A 4LMNA 3NIZA 3CC6A 4FV4A 3FI2A 3K2LA 4BYIA 4XG4A 4D1ZA 4U80A 5M4CA 4HCVA 4CMUA 5FM3A 2BR1A 4DCAA 3II5A 5LVLA 2QOCA 2UW9A 4QYGA 3ROYA 4UX9A 1H0VA 1H1SA 3PXKA 4M97A 4OTFA 4W9WA 2R7BA 5GINE 3EFLA 1KE6A 3MBLA 2PY3A 2ZV9A 3TNHA 3OWKA 2RIOA 2CLXA 4AAAA 2R3OA 3KQ7A 2FSMX 1TQMA 2R0IA 3MW1A 4RLKA 3AD5A 3SC1A 3U51A 4CMOA 4E73A 3AT3A 5HBJA 5ACBC 4CRLA 2R4BA 4IM0A 2JITA 1PKDA 3CTHA 3CTQA 4K6ZA 4F9BA 4F9CA 4YURA 4Z7GA 4OTRA 4F9YA 4HYUA 5IA3A 2VRXA 2JFMA 3WBLA 4TN6A 3R7YA 3LFDA 4ZTLA 1XJDA 3BV2A 4OTWA
chains in the Genus database with same CATH superfamily
4IACA 1URWA 2XJ1A 3UO4A 2BTRA 4H05A 4J8MA 2BZJA 3R00A 3QHWA 3PA5A 5CU2A 1YXTA 4U7ZA 1U5RA 2I7QA 2VNWA 3ZEPA 2WMAA 1UU3A 4WBBB 4OTHA 5TF9A 2WTVA 4TRLA 3POOA 5BVFA 4AXEA 5LMAA 4NTSA 2ZV2A 3HP5A 4ZZNA 3O8PA 3O2MA 4OGRA 4MYGA 4FEUA 3PZEA 2PUUA 4MXAA 5KCVA 4D2RA 3QFVA 4FIIA 4RX8A 5KMJA 1G8SA 2UW5A 2C0IA 5AV0A 3T8OA 5LMKC 4M8TA 4JMQA 5J5TA 2CN5A 3RWQA 3PDTA 4OTGA 1IR3A 2WTCA 1ATPE 3MJ1A 1ZYDA 4FKGA 4O0YA 4B6LA 3GQLA 3KRWA 4YZDA 4MXOA 3HMIA 3FY0A 1KE8A 2QOFA 2WMWA 1TKIA 1H07A 3F2AA 3GNIB 4RFMA 3A8XA 5HO8A 5J79A 5EOLA 4YJOA 4A9UA 2DS1A 2WIPA 2GNLA 1JNKA 3DBDA 5CF6A 4FSZA 1VZOA 5L8LA 5L2TA 3QQKA 3VF8A 1ZYLA 5FGKA 1PXKA 3BYVA 5HX8A 3L9MA 2AC5A 4X3FC 4CFUA 5E8TA 3BE2A 2BALA 1H8FA 5LMKA 1OL7A 3GOPA 2FUMA 2ETRA 2HWPA 1O6YA 2JGZA 2WKMA 3QZFA 5EM6A 3G15A 1ZZLA 3DAEA 5FUTA 4ENXA 3CKXA 2WMTA 3PE2A 2WMUA 4G34A 3ZSHA 2F2UA 2I40A 5AP6A 2WTWA 3R7GA 2EU9A 1FGIA 4MNFA 2B9IA 4EOPA 3QL8A 4RVTA 2R3GA 3CQWA 3IK3A 4ZTRA 4PNKA 4O82A 4J52A 3E8DA 2ZOQA 5TR6A 2XIRA 2DWBA 1UKIA 2WOTA 3D7TB 3GQIA 2W0JA 3TZMA 4APPA 5IA4A 4E4LA 2P3GX 2QC6A 3JVRA 3KN6A 1RE8A 3Q53A 4GK3A 4AN9A 5GZ8A 4XG2A 3UC4A 1IRKA 3LLAA 3DJ5A 5AUUA 1HCLA 1L3RE 2J7TA 2BRNA 3PXZA 4GIHA 3ZSIA 1OPLA 5CLPA 4JXFA 4U5JA 4BTFA 3C4WA 5HE0A 2CGWA 2ESMA 5DVRA 5KHWA 4IWOA 5HLWA 3DAKA 2PZYA 5EKOA 4YTCA 4J1RA 1P4OA 1W8CA 5EW9A 5IH5A 3ET7A 2WQOA 4E4NA 3OUKA 4DH3A 4AU8A 3PG3A 5CAPA 3WIKA 1BMKA 1UA2A 4ENYA 5EFQA 2WZJA 1H00A 4YBJA 5EM5A 4EH3A 3AD6A 2R5TA 4CV9A 3BGQA 2BRMA 3A7HA 1LEZA 1PXOA 2VNYA 4WG5A 3C0HA 3W55A 2UZNA 4UV0A 4C2VA 4QNYA 4GYIA 3CCNA 4XNEA 4V04A 3AT2A 3P79A 2X9EA 3ZO1A 3TTIA 4DINA 2EXCX 4DYMA 3ZSGA 2B7AA 2GNFA 3CTJA 3MFUA 2OF2A 4HZSA 3R6XA 5EI2A 3VS5A 4P90A 4BDHA 4EKKA 3LW0A 4IVAA 5AR4A 2WQEA 4UWYA 3TUBA 2B4SB 3JR1A 4L3JA 4DEDA 1J7LA 4EWHA 3COMA 5CU3A 2IZRA 3SV0A 2UUEA 1PHKA 1DI9A 1FQ1B 4FT0A 4BYJA 3PIZA 2Y9QA 3QC4A 3LJ1A 3R7IA 4WOVA 5CVGA 1WBWA 1Q61A 2R3NA 3PPKA 3QQHA 4ACGA 5D11A 5BUIA 4DT9A 4C4FA 2WTIA 3A4PA 5DNRA 1UV5A 4DG2E 4ZLZA 2BAJA 4IC8A 4QP7A 2XAMA 4IH8A 4AP7A 4I21A 3UVQA 5IA1A 2OZAA 2XRWA 2JKMA 2JKKA 2E9NA 3QYZA 4B7TA 3E3BX 1YXSA 3PLAE 4M7IA 4O4DA 4ANLA 1UNGA 3I5ZA 4MBIA 4KKEA 3T3UA 3V6SA 2REIA 5LVMA 2QU5A 2R7IA 2YM3A 4ZZMA 1OIYA 1H01A 3EYGA 3SA0A 3SXSA 4W8EA 2I0EA 3I81A 4H1JA 4PP7A 2XK6A 2YM7A 5CT7A 3IW4A 3V51A 5JGAA 4IE9A 2GDOA 3W8QA 4FSNA 4FTQA 3RAHA 3HRCA 1P14A 5HVKA 5CQWA 1OKYA 2PPQA 3HP2A 4AW1A 4K0YA 2C3KA 4TYEA 2C5NA 3QLGA 2WAJA 4L9IA 2QR8A 4IZAA 4AN3A 4DLJA 2EXEA 3D15A 3MPMA 1H4LA 2HOGA 4QMWA 4QMPA 2IZSA 4O7SA 4GT5A 4NW6A 5BQ0A 5IUGA 4RIXB 3W8LA 2VX3A 3ZO4A 3ZXTA 3QCXA 4BBEA 3VQUA 1Q99A 3DZOA 2QOKA 3DLZA 3PPJA 4FT5A 3CP9A 3NNUA 1Q24A 3ETAA 4AT3A 2PUNA 4IC7A 2XK9A 4MF0A 2R2PA 2X4ZA 3EH9A 4U0IA 3VF9A 4UMRA 3I4BA 1B38A 4R3PA 3OW3A 2G01A 3U6HA 4FTTA 4EJNA 3E87A 4D4YA 2O65A 4IB1A 3S2PA 1OMWA 4MQ2A 1Y6AA 4R5YA 5CVHA 5IQAA 5CEQA 4O7ZA 1ZXEA 4PV0A 4RG0A 3HGKA 3MH2A 3MFSA 4DEBA 3ERKA 1MQ4A 4L01A 3MVJA 4BDIA 4M66A 2OH0E 1GIIA 2PL0A 2XNPA 3BHUA 3MH3A 5AMNA 4ZSAA 2C69A 4AGCA 3FQSA 3BGZA 4BB4A 4FIGA 4RSSA 3ZC6A 2R64A 4XLVA 4CTBA 4NYEA 4DEAA 3PWYA 4P2KA 5E8ZA 4XS2A 3VUHA 4QP4A 2GSFA 3AOXA 3MFTA 5HG9A 5BVEA 5DLSA 4MVFA 3QX4A 3I60A 4Q5EA 4AX8A 3V5LA 3SGCA 1ZYCA 4CCUA 3P4KA 4KAOA 2JBPA 3QTIA 2ZM1A 3AC8A 3FI4A 4J71A 4AOJA 5TE0A 4E8AA 1IAHA 4Q5HA 3QQJA 3OCBA 1WMKA 4RIYB 4WHZA 4Q9SA 2OZOA 2UZLA 4FX3A 4RJ4A 4ZS0A 5AV4A 3B8RA 5FTGA 3DPKA 3R0TA 3V04A 5CU4A 4EH9A 4ZMFA 2XBJA 3P0MA 3CD8A 5IH6A 4JAIA 3F7WA 3GCPA 3L1SA 3R7OA 2C30A 4DFNA 4HCUA 4E4MA 4R7BA 4JG7A 3V8TA 4QQTA 3BLAA 4XV9A 1U54B 2WTDA 3H30A 4FSMA 4YJVA 5M4FA 2YWPA 4C3FA 3SRVB 3F2NA 3OCTA 2V7OA 4FA2A 2ZM3A 3GCQA 2W1FA 3IW8A 4I0SA 1LEWA 5A4TA 5GIPE 4AZFA 1FINA 5JFWA 2BKKA 4UWCA 1FOTA 3RPSA 1JKLA 3S1HA 2BUJA 2C6KA 3DT1A 3F5XA 4LOQA 4P5ZA 4NH1A 3IW5A 1UU8A 4R77A 2HZIA 1T45A 4AG8A 5IUHA 4MD7E 2BIKB 4ONAA 2XK3A 3RI1A 2RFNA 5DWRA 3OWPA 3QD0A 4U97A 3ENHA 2QQ7A 4G17A 5AR2A 2X8EA 4YJQA 5AR7A 4ANQA 4UY9A 3M2WA 1DM2A 4XG9A 3U6IA 2R3IA 3P86A 2C6EA 2GHLA 4C59A 4QTEA 3FMEA 4AUAA 4E20A 1SVEA 3RAIA 4GG7A 3KXHA 3W32A 4JRNA 3DQXA 3A61A 2ITNA 4FZAB 1Q8TA 2XEZA 5D12A 5AUTA 3ATSA 3GT8A 4RWJA 3ZLWA 2RKUA 3U54A 2PVFA 4WT6A 3DLSA 5BVOA 2ZB0A 4BDKA 3H4JA 5D7AA 3DK6A 4II5A 4LFIA 4F1OA 1IAJA 2WIHA 2C1BA 4BWKA 1IEPA 2ITYA 2Y7JA 3L8XA 1YHWA 2G2FA 2X6DA 4KSPA 4CT1A 4CG9A 4BIBA 2WTKC 3FY2A 3LOKA 4R78A 4C4JA 1K3AA 1H28A 4DGMA 2HW6A 5J1WA 3VS3A 3RM6A 3ZDUA 4JJRA 4DBXA 3WYYA 4Y95A 3OXTA 4GFGA 1H1WA 2ZM4A 1APME 4YR8A 3Q9WA 4LI5A 4BBFA 3NRMA 3ZLXA 5HTBA 3W0OA 4C36A 5IMEA 5AUVA 3E7OA 3D14A 3LM0A 4BTJA 3BIZA 4AW0A 5F95A 3UE4A 5LWMA 3VUGA 4QTAA 3WARA 3LXLA 5IQBA 3R1QA 4YC8A 5A54A 4KABA 4OBPA 4DFBA 3GGFA 3OVVA 1Y91A 4HVDA 4IX4A 5HIEA 3AC4A 4GRBA 3DFAA 3C4FA 4FR4A 3ZTXA 3C4XA 3VUIA 4LG4A 2UZVA 5E92A 3BEAA 2IJMA 4MK0A 4R1YA 4LM5A 3ORXA 2V0DA 1GJOA 3HA6A 5CANA 2BTSA 2W5HA 5J87A 3V5QA 5CAVA 3KGAA 3G0FA 4EK4A 2IO6A 3T3VA 4D4RA 1Q8YA 3Q4ZA 4R3CA 3P5KA 5FQDC 3BWFA 2BFYA 3R7EA 3FAAA 2UZUE 3LHJA 5LVPA 4IVDA 3KVXA 2I0VA 4W4XA 4NKAA 1NVQA 2F7EE 4EHVA 3Q5ZA 5IMXA 1R3CA 4BGGA 4BWXA 2RG5A 3OOMA 4RT7A 5C4LA 1KE7A 2W5AA 4ZOGA 3PXRA 3I0QA 4O1PA 4D55A 4RMZA 4I5PA 3QHRA 4JVGA 4QMSA 4XJ0A 5HI2A 4D2PA 2YJRA 3OT8A 2XM8A 1Q97A 1FGKA 3KN5A 3GCSA 4CZYB 3QD4A 2OI4X 2JKQA 3C4CA 4FC0A 3UTOA 4I4EA 3TMOA 3PFYA 2PVNA 4EQMA 3RAKA 4WRSA 4D28A 3LFNA 1YKRA 1ZOEA 4X2KA 4GT3A 4CZTA 2UZWE 3AMYA 3ATTA 4O7LA 1OBGA 3A99A 4FMQA 4XH6A 3RK9A 1FMOE 3QUDA 3VVHA 4D5HA 4JG8A 3TDWA 1RQQA 3FKNA 1YXVA 1MP8A 4GCJA 4KIKB 4QYHA 4FL3A 4GFMA 3CQUA 4OBOA 2PVLA 3R8VA 3TNWA 3NMUF 5HTCA 5HE3A 4BDBA 5JGBA 4FV5A 2QOIA 3RVGA 1GOLA 1SVHA 4FICA 4O0RA 5IZFA 2XJ2A 3IOPA 4W9XA 4YO6A 3EN5A 3E92A 4HPUE 2CGUA 4JI9A 4YZMA 3NUXA 4U41A 3WZJA 4UXQA 2XANA 4KIPA 2OK1A 3KF4A 5CXZA 1JKSA 4BCJA 5KNJA 5BPYA 1JOWB 5FLFA 3NW7A 3C0IA 4TWNA 3G6HA 3HAMA 4M3QA 5CI7A 4YP8A 3VS0A 3DBCA 4TWOA 5JK3A 3HKOA 4ALWA 4XBRA 2VV9A 3ORTA 4RJ6A 3Q2JA 3IDCA 2W9ZB 3LIJA 2KTYA 3FHRA 4XG8A 1H08A 3C5IA 4H36A 4IX6A 4JNWA 3R8MA 3PVGA 4EYMA 2XYNA 4LL5A 4YC3A 4X7QA 3HL7A 4FV2A 4ALVA 1KE5A 1UWHA 1QPCA 4PL5A 3E88A 3TT0A 4KSQA 3W2QA 3NVKI 2AYPA 2QVSE 2UZBA 3FC1X 3FXXA 3ZRKA 4E4XA 5EQPA 2Z02A 2I6LA 4WIHA 2UVXA 3TV7A 4CFXA 1XH7A 3U4WA 2WU6A 4PMMA 2B52A 4XG3A 4PWNA 5FXQA 3OBJA 3FDNA 3L9LA 2AEGA 2VU3A 3VUDA 1JSUA 3BYUA 2FH9A 1R0EA 3MVLA 3EFJA 2GNGA 2WHBA 1H0WA 4RLLA 1YOMA 4YJSA 3OOGA 3E62A 3VBVA 4D2VA 4RX5A 3IO7A 4O21A 1YOJA 2ERZE 2PVKA 3BPRA 3LE6A 3OP5A 1J7IA 4LRJA 2OIQA 3U87A 1OPJA 4FKSA 5K4IA 3K5VA 4KWPA 4X2NA 5HE2A 1UVRA 2WEVA 4RWIA 3P5JC 3KK8A 3FL5A 2VWWA 3MSSA 4C61A 2RFSA 4ASXA 5LVNA 4DDIA 3R2BA 4ZXTA 2O5KA 4PTCA 4MD8E 1OBDA 4A7CA 2ITXA 2CCHA 1J91A 5I9YA 4QQ5A 2GU8A 4ASEA 3FI8A 2Y8OA 4FZ6A 4HGSA 3GEQA 4BC6A 3SD0A 5KHXA 3NZ0A 3PSCA 4JRVA 4NM7A 3UZPA 3ZUTA 3BLRA 3BI6A 3Q04A 3WZDA 4C2WA 4EKLA 5JMSA 5GJDA 4FZDB 4OW8A 4NJDA 3VS2A 1DS5A 3DKCA 3U6JA 5EHOA 2F7XE 2ZAZA 3C9WA 4AZEA 5AWMA 4XEYA 4ACHA 2YM6A 1B39A 5IUIA 3A7JA 3F3UA 5I9XA 2BHEA 2WMQA 4XRJA 3ODZX 1O9UA 3RK5A 4GUEA 1UWJA 4OAUC 4MNEA 3ORPA 3F7ZA 3FWQA 3KXZA 4A4LA 1K2PA 3P7CA 4F9WA 2BHHA 3F3ZA 4JDKA 3M42A 3FMLA 2ITVA 3E63A 1Q8ZA 3EL7A 3UG1A 5A3XA 3MH0A 4XV2A 3W0SA 5E8SA 3QGYA 3FLYA 3UODA 3VBTA 1PMEA 4P4CA 2J4ZA 4RIWB 3CIKA 1JBPE 2NRYA 4EH6A 3EOCA 5DOSA 1JWHA 2VTSA 1SVGA 3RM7A 3WILA 3KVWA 4O0WA 2V5QA 4YHTA 2FO0A 1YW2A 4BCIA 4Y73A 3LCDA 4YLJA 3W18A 2OG8A 3F61A 3BEGA 3DOGA 2BVAA 3MA6A 3NNWA 4C58A 2QKWB 5KMOA 3R9NA 1WAKA 5TKDA 5CSVA 3OWLA 5BUEA 4O0XA 3W2OA 4F6WA 4LUDA 4BIEA 5HCXA 4R7IA 4Z9LA 4DG3E 4QP2A 4UBAA 5K0XA 3QQLA 4TNDA 4BCPA 3V8WA 3QZHA 2B9HA 5BYYA 3D7TA 4TNBA 5IQCA 4G31A 5BNJA 4A06A 3ZONA 3E3PA 3I0OA 2C3LA 1UNLA 2Z60A 3HRFA 3KXNA 5BVWA 3OEZA 2HXQA 1RJBA 4L42A 4ZEGA 4BBMA 4DEHA 5J9LA 1Z5MA 2UW3A 3DNEA 5C4KA 4RA4A 5CNNA 3Q9XA 5BMMA 1JPAA 5IF1A 3W0RA 4CSVA 5JSMA 3FMDA 3MS9A 4QQCA 3G9NA 2W1HA 3PXFA 4HGLA 4NK9A 2Z2WA 2XB7A 4HPTE 4OT5A 5FRIA 3POZA 2HXLA 3C4ZA 4DFXE 5M4UA 1ZY4A 1JKKA 5JH6A 1W7HA 5AP4A 3TZ7A 3QQUA 2VTLA 3FMJA 1PY5A 4KNBA 1HCKA 1KOBA 2C6MA 1Q8UA 3KCKA 4FKUA 4EC9A 5EQEA 4FIEA 1PF8A 3BBWA 3R04A 5M56A 1PMNA 5KMMA 4ZJJA 3BHYA 3V5WA 4EUTA 3EZVA 4AW2A 3WE4A 4WNPA 4HYIA 5CWZA 5J5SA 5JRQA 4GSBA 2W1IA 4FVRA 4C57A 3LLTA 3R2YA 4I94A 1PXMA 4QYFA 4GJ2A 3FPQA 2GS2A 1NVRA 4DH1A 3TTJA 5DR2A 4U40A 3VO3A 4FKVA 4MBJA 2ITOA 2G15A 3EKNA 3DKOA 2WTJA 3SW7A 2F2CB 5EI6A 3DXPA 1YHSA 1VEBA 3COHA 3OROA 5GZ9A 4XHKB 4YZ9A 5ANOA 5F1ZA 3MH1A 3EQGA 5EYMA 3GU6A 3ORLA 4JIAA 4WO5A 3ULZA 3KCFA 5LARA 3U55A 2H9VA 3IGOA 4GH2A 3QZGA 4E5WA 2XALA 3SX9A 2C5VA 1P4FA 4O96A 5HKMA 1PMUA 4ERWA 3FXZA 4IW0A 4RC3A 1M17A 3MPAA 5HG5A 4RJ5A 4PUZA 1ST4A 5HG8A 1YHVA 5ACKA 5A4EA 3ID6C 2JDTA 4QP6A 2QO9A 2YCFA 3QLFA 2E2BA 4G5PA 3IQ7A 2OJIA 2B9JA 3ENMA 4QMMA 4S31A 3FZOA 4BDFA 2R3KA 2VWVA 3IECA 3NUSA 2C5YA 2H34A 4PPAA 3R63A 4IAAA 4DTAA 2QONA 5LMBA 3NCGA 1DAWA 3CGFA 2OKRA 3P1AA 1F5QA 4I5HA 4NSTA 4UZHA 3DTCA 2JDOA 5ETIA 5CYIA 2B1PA 4FYOA 3QAME 4O83A 2UVYA 1WVWA 5I9WA 4FSYA 4F0FA 4DH5A 2DYLA 4FRFA 4AAYA 3MN3A 4KINA 4QYYA 2ONLC 3OD6X 2PVRA 4G5JA 1A9UA 1GIJA 5HNIX 3G51A 4L6QA 1VR2A 3FQEA 5HCZA 4QMTA 5AUYA 5C01A 3COIA 4C4HA 2WO6A 3KMWA 1VYWA 3EKKA 4DF3A 4JOAA 3EQFA 3I79A 4ALUA 5L6PA 4PRJA 2C68A 4CYJA 5T6KA 3EQHA 3PPZA 4E26A 4FTJA 2C5XA 4D4SA 4YMJA 3DGKA 4GW8A 4QRCA 3ZC5A 4WSQA 4U3ZA 3OT3A 3KRLA 4KD1A 5K4JA 1YI4A 4GU6A 4O2PA 1FVTA 1Q3DA 2ONLA 5GNKA 4YBKA 4PMSA 1NA7A 2FGIA 3E7VA 3FLSA 4O2ZA 4WSYA 3TXOA 4LQMA 4OUCA 4UMPA 4XYFA 1ND4A 4BZOA 1KWPA 2ITTA 2WD1A 4XOZA 3V5PA 3HAVA 3NUAA 2GQGA 4S33A 2J6MA 2Y4PA 3SQQA 3LFQA 2EWAA 3BX5A 3I5NA 2XCKA 2YJSA 3AGMA 3D2IA 4D9UA 4F70A 1M14A 4MXZA 3VRZA 2X2KA 5AA8A 5LVOA 5HQ0A 5L2IA 1U5QA 4X3FA 3UO6A 3IKAA 5B2MA 3PSDA 2XNBA 1Q41A 1H25A 3OBGA 4D2WA 3GU4A 3TKHA 3PLSA 3SAYA 3KC3A 4MH7A 2CGXA 5DRDA 4EL9A 4F78A 3G2FA 3NUYA 5D10A 3MJ2A 4JQ8A 3VUMA 2BRBA 2VWXA 4EOQA 4N57A 5E9EA 2XH5A 5EG3A 4FSTA 4RIYA 1U59A 3C7QA 2BROA 5CEPA 3PFQA 2IPXA 3G9LX 5F4NA 4G6NA 5J1VA 4CFMA 2Q0NA 2WMBA 3B2TA 5ETCA 4O4BB 2C5OA 5HBEA 4DGGA 2QI8A 3D5UA 2ACXA 4N4SA 3WF5A 2X0PA 4XP0A 4Z16A 4IWPA 2UW4A 2WQBA 3DDPA 2YZAA 4YTIA 3RPYA 5AP5A 4C35A 4CQGA 5KMKA 5CNOA 5AUXA 2R3MA 4L68A 3FKLA 4XCUA 5J7HA 3AC5A 2QKRA 3HV7A 4O27B 4PMTA 4HOKA 5EKNA 3LQ3A 3H9OA 3FZSA 2R3LA 3ZO2A 4DHFA 2OFVA 1XR1A 4XP2A 3JS2A 3TL8A 1BL7A 4CZUA 3LZBA 3V5JA 1ZOGA 2A1AB 1YDSE 2WFYA 3NUPA 1IASA 2YCQA 2Z7RA 4QPAA 1PW2A 3DU8A 4CXAA 2IW8A 4LV7A 2OWBA 2RSVA 4DCEA 3HEGA 4DGLC 4F7NA 4AFEA 3MY0A 4GK2A 5B2KA 2O64A 4V0GA 4NIFB 3TACA 3UIMA 5IDNA 5M08A 2J2IB 1GIHA 4IAZA 5CQUA 3B8QA 2W9FB 4AT4A 3F3TA 3RPRA 5IQFA 2IVTA 3FZPA 1YVJA 3P7AA 1NXKA 2CHLA 4NL0A 4NEUA 4O38A 1KOAA 1FVVA 3ZBFA 3NFFB 4RWKA 1OI9A 3ZS5A 5CALA 2ZJWA 2YDJA 3GCUA 5HVJA 3OHTA 4TWPA 1JQHA 4BFMA 5E8YA 4QMOA 1IA8A 4HNFA 4IJ9A 1QCFA 5EM8A 3RWPA 3AGLA 4FSRA 4GT4A 2J0MB 4FZ7A 2R0UA 1XH4A 3JUHA 4IANA 3ACKA 3KRXA 5HNBA 4YLKA 5AP2A 1ZY5A 2ZMCA 5H8GA 4EH5A 3PYYA 2EUFB 5C9CA 4LL0A 4U6RA 1QPEA 1TZDA 2WMRA 1Q3WA 2P2IA 3PE1A 1BI7A 1WBSA 3RINA 5CENA 3O7LB 2JKOA 1OPKA 1NT2A 3S4QA 2HELA 3VWAA 5JEBA 4F1MA 3DK7A 4JX3A 1IA9A 2X0QA 1YWRA 4MXCA 2IWIA 2WPAA 3FXWA 5A14A 5AIKA 5AP7A 4NUSA 4CV8A 4EK3A 3R30A 3ITZA 3MY5A 2X9FA 3P7BA 2VX0A 5ANIA 4HJOA 2YABA 4FIHA 3ZCLA 3F88A 3EFKA 3OG7A 4R1VA 2J0IA 4FV0A 4OTQA 4ACMA 3OXZA 2JEDA 3PJ1A 4FVQA 2XMYA 3FYKX 3PA3A 2XNGA 2PYWA 1Y57A 5EDQA 4G9CA 5CZIA 3TYKA 3C51A 4RZVA 3DCVA 4DT8A 5DRBA 3EQDA 5HIDA 5GZAA 4NM3A 3QD3A 2J51A 4FYNA 4I0TA 4IB5A 3VHKA 3VRYA 5JFVA 3RMFA 2OIDA 3CSVA 4YTFA 3E5AA 2JDVA 4FUXA 3ZZWA 5CU6A 5EK7A 3W10A 1KSWA 4DEGA 4F63A 4UYAA 5H8EA 1OUKA 4JIKA 4FV7A 1PKGA 1LR4A 2J50A 2X2LA 1BYGA 4FOCA 1PMVA 5AX3A 3NGAA 4ZLOA 3F2RA 3FEGA 3EMGA 4AN2A 4K11A 3LKMA 4CFWA 4CTCA 3KXXA 4IAIA 4AZWA 4BDEA 2ZYBA 4N6ZA 1ZYJA 2W99B 2E9UA 2JIIA 3QTWA 1SNUA 4FK3A 4P5QA 4TZRA 2IF8A 4KBKA 4NZWB 2VUWA 5E91A 4D0WA 2YCRA 2O2UA 3BYOA 4YZCA 4AFJA 5JFXA 1BI8A 5FTQA 2IZTA 3UC3A 1G3NA 5HO7A 5I4NA 5JFSA 1WZYA 2P4IA 4X6RA 4TKSA 3DS6A 3F69A 4AS0A 2ZV8A 4UYNA 4R5SA 2X4FA 4FKJA 4J97A 4L8MA 3C50A 4O7NA 3RBWA 4OBQA 4TYHB 4X2JA 2W5BA 1SNXA 3H10A 4TW9A 4D1XA 4DE4A 4UEUA 2W4JA 4ZZOA 4QQJA 3HNGA 4FSUA 5FEQA 1MRVA 3QC9A 4YNEA 5IISA 4BCHA 3U9NA 3P08A 1MRUA 2H6DA 1ZWSA 3ZMMA 3FLZA 3DZQA 3MIYA 4GU9A 4L46A 3W2PA 3EQBA 4AE9A 3N4VA 5I9ZA 3BBTB 3MB6A 4M13A 2GHGA 5FEEA 1Q5KA 4EJ7A 4M12A 5HORA 5KUPA 3E93A 3ANRA 1WVXA 2UZEA 2X81A 4YO4A 2VTIA 2J5EA 5CT0A 4CGAA 3V8SA 5E4HA 4FIJA 4X3JA 4I41A 3WF7A 3QCSA 4FV9A 3ZUUA 3E64A 4L7SA 4XV3A 2XNEA 4CNHA 3DQWA 4OAVB 3FYJX 4OTIA 3UIBA 1H26A 1AQ1A 3WF8A 4FVPA 4WNMA 5TT7A 3Q4TA 2IZUA 4J98A 3C4EA 4IXPA 4CVAA 3ORZA 2ZVAA 2VTOA 4J7BA 4OR5A 4EHGA 5J9YA 3TJDA 4E3CA 3LQ8A 4PMPA 2CDZA 4NCTC 2WGJA 4I20A 1CKIA 5D7VA 3FMHA 3AQVA 2GNJA 3Q9ZA 3F5UA 3FSFA 2R3JA 4PP9A 5BMSA 4ZTHA 4WRGA 4JG6A 5C26A 2J5FA 3K3IA 5IH4A 2YAKA 3KEXA 4NFMA 4ANNA 1W82A 5CEOA 4IEBA 3PRIA 4D9TA 2XZSA 2VTTA 3GENA 5CAOA 2A4LA 3GC8A 4PPBA 2RL5A 2VTHA 3WF9A 4FT9A 4H3BA 1OM1A 4XX9A 4Y83A 4ACDA 5AAGA 2VGOA 4EK6A 5AAEA 4M84A 4NCTA 2QOHA 3MB7A 3EN9A 3UDTA 4L45A 1XBCA 2XA4A 3FPMA 5FP6A 3COKA 3PVWA 1YWNA 2EXMA 4ZSGA 1B6CB 5HICA 4NTTA 4UMUA 5EYDA 4BCFA 4QPMA 5DT3A 2QD9A 1XWSA 4DGNA 2IVVA 4RVMA 4FTCA 3GU5A 4YJRA 3HMOA 4BTMA 1XBBA 2OZAB 1W0XC 2XK8A 2VWIA 2FSTX 4PL3A 1YXXA 4O4CA 2XIKA 1XMMA 3G0EA 4UMQA 2PMNX 4WNKA 5D9HA 3QXOA 5K9IA 4DFZE 3LMGA 3KKVA 4AZTA 2OXDA 2GNIA 3L9PA 4V01A 2F49A 4QTCA 4RGJA 5HGIA 4ZTQA 2H8HA 2XRUA 4CD0A 2BPMA 4IWDA 2XEYA 4FGBA 2C0TA 4MKCA 5FEDA 1CTPE 1JVPP 4FZFB 4ERKA 3BHVA 3RCDA 2QOLA 3FZTA 4G9RA 3BL9A 4FT7A 2VO7A 4GL9A 5GHVA 2JLDA 4A4OA 4RQVA 3QA8A 3D4QA 2B0QA 3TCPA 4IJPA 4X2GA 2J0LA 4WBOA 3HYHA 4IVBA 3R1YA 2FVDA 4F08A 2UVZA 4JAJA 1VYZA 3MYGA 3QYWA 4D58A 3BRBA 3FSKA 3O8TA 1ZRZA 3N51A 3PY0A 4U42A 2PTKA 5AP1A 4O1O