5ETIA

Structure of dead kinase mapk14
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVRKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of dead kinase MAPK14
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 110
structure length 355
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etiA01
5IDNA 4C61A 1GAGA 1Q5KA 3ORNA 2YABA 3KK8A 2UZLA 3O8TA 4K77A 3A2CA 1YXUA 3ZO3A 3TCPA 3UOHA 3W2QA 2Q83A 1O6YA 2XIRA 5CZHA 5JZNA 3DK6A 4FKUA 4D2PA 2Y7JA 2I7QA 4C38A 2PVNA 4ZJJA 3FMLA 1OUKA 3CIKA 5F95A 2EXMA 2W5AA 3EQBA 4ZS4A 2YDJA 4JR7A 4QQCA 1U4DA 3PJ2A 4UY9A 2BRMA 4GFOA 2C6KA 3ROYA 1ATPE 4NM7A 4R6VA 2IPXA 2C1BA 5TT7A 1B6CB 2WHBA 3L1SA 2XIXA 2E9UA 4U5JA 4APPA 4PMPA 4APCA 3D5WA 4IAAA 4RVKA 2IZSA 2FO0A 3F5PA 3NYNA 3FY2A 3PZHA 5L4QA 2OZAA 2ZV7A 3NUXA 3NSZA 3TN8A 4ZXTA 5HBJA 4ZMEA 3C4WA 2JDTA 3IOPA 5JFSA 3V5QA 4CKRA 2F7XE 1XH6A 3OY3A 3BZ3A 5E8XA 3BYMA 3QGYA 3EQDA 4IH8A 3FLYA 5ITAA 2Z60A 2CNVA 3GU6A 3H30A 3LZBA 5AX9A 3KXNA 4ERWA 3I6WA 3QFVA 2XS0A 4BVUA 2QQ7A 3ZDUA 3PTGA 5JRSA 2H9VA 2UZEA 3AT4A 5CQWA 3R7YA 2BHEA 2C5XA 3UMWA 1ZOEA 2F2UA 2R3LA 5CT7A 3I79A 3LFFA 4MK0A 2WOUA 4EK5A 4FGBA 4DTBA 5E8TA 1U54B 3VRYA 5L2WA 3UO4A 1V0BA 1JKTA 3QZHA 3R21A 3PVUA 4H36A 4WA9A 3RK9A 4D2TA 4BDFA 4ANNA 3KXZA 4R5SA 2CKQA 2YIYA 5EM7A 1IAHA 3AMAA 1PYEA 3EN6A 3Q96A 3SDJA 4EQUA 1CKIA 2IW6A 4NJDA 4Z3VA 5IA3A 2CGVA 4M97A 4QTBA 4UZHA 3TDVA 3ZOSA 3U54A 3BU5A 4O0TA 4RIOA 5L2IA 3RI1A 4QD6A 3HRCA 2I6LA 4C59A 1PMEA 1TKIA 4OT6A 3A7JA 5FDXA 2F4JA 4FKIA 4HGLA 4NKSA 4F64A 3P5KA 5FQDC 4USDA 3KRXA 2VWWA 4GMYA 3JY9A 2UZVA 2WQMA 4FNXA 1FVVA 4FSYA 2PPQA 3ZXZA 5ACKA 4GVAA 1SZMA 4FNYA 5EKOA 5KMMA 4XV9A 4A9UA 2BRBA 5HIBA 5AAFA 4ENXA 4CXAA 3NYOA 4LOQA 5K5XA 3FMHA 3OT8A 4IVDA 3QBNA 4J71A 4EH3A 2FGIA 4TPTA 2PWLA 3RCJA 5BYYA 2BDWA 4ZK5A 2NP8A 2WMQA 3PE2A 3R02A 1U5RA 3NAXA 2HZNA 3TUCA 3B8QA 5IDPA 1REJA 3DKFA 3PG3A 4LFIA 1YKRA 3BHHA 3O8PA 2DQ7X 4W4XA 4XYFA 3NVMB 3DB8A 4D28A 3N4TA 2X8IA 3DS6A 4JBPA 4ZP5A 3HZTA 3HMIA 3KF4A 5GZ9A 3WARA 3PSCA 1U46A 4FMQA 5CLPA 4ACHA 3WF5A 4AF3A 4CFNA 5EDRA 4D0XA 2JKMA 3WBLA 5KMOA 1DI8A 1RDQE 4EH5A 5J5SA 3NMUF 2BAJA 4IAFA 3L9MA 3ROCA 4BC6A 4O84A 4C2WA 2UZTA 2PHKA 5EOBA 4FV0A 1FMKA 3FI3A 5AM6A 4ZTRA 4OTQA 3MH3A 4Z16A 4FEVA 2YZLA 5CVGA 4DCEA 2VTPA 3VJNA 2RFSA 4FA2A 4GFMA 2GTNA 5HOAA 5LMKC 3R0TA 3UO6A 4YTHA 3NRMA 3MW1A 5DPVA 4UWBA 2HK5A 3A8XA 4NUSA 4OR5A 3G51A 4L6QA 4Q9SA 2QR7A 3H9RA 5BYLA 1SVHA 2JD5A 3CTQA 2ITOA 2F7ZE 1GZOA 5HCYA 1JKKA 3PRFA 4B0GA 4CSVA 4QNAA 3JYAA 1V0OA 3F3WA 4DEHA 5J9LA 5IEYA 4Y83A 4FNZA 2RFNA 2XJ2A 2YLFA 4EOJA 5L6PA 5I9UA 3RPVA 3ZUVA 4E4NA 4JS8A 1UU9A 2E2BA 3C4CA 4TKSA 5GIPE 2BZJA 2C5OA 3MTLA 3POOA 5T6KA 4GKIA 2GPHA 4ACDA 3KRRA 3I0QA 4NW5A 3AG9A 3BELA 3GXLA 1YXSA 4W8EA 4D2SA 3EB0A 5HBEA 3PJ8A 2V7AA 4B4LA 4EORA 2QOCA 4RX8A 4QMZA 2WTVA 3W2SA 4F9WA 4O83A 2Y9QA 2C5YA 5FP5A 5C8NA 4MNEB 2VU3A 5JMSA 1UVRA 4ANQA 4FKQA 2CCIA 1VEBA 5LVLA 3FJQE 4QTDA 5LWNA 4L7FA 2YJSA 3ZUUA 1R78A 4BYIA 5FP6A 5C01A 2BIKB 4C7TA 4FSZA 4NU1A 2W9ZB 1YQJA 3N4UA 4W4WA 4UB7A 1W8CA 2B9JA 2BHHA 3C4ZA 3GFWA 3Q9ZA 3ATSA 1OZ1A 2ZM4A 4PMMA 3EL7A 1GZNA 3Q4CA 3UPXA 3W2RA 5GJGA 2OU7A 3BYVA 4UXLA 4EBWA 5C4KA 3UP2A 2X1NA 5BUJA 2WU6A 3HUBA 4KWPA 2RGPA 4WD5A 4QMMA 2X4ZA 4FV5A 4F7JA 4KSQA 3TL8A 3R73A 1QPEA 2W17A 2C6EA 3BX5A 4RA4A 1NW1A 1ZZLA 5JRQA 4XH6A 4TYHA 3PUPA 2PE1A 4U43A 2PVJA 3RHKA 2NNWB 5CI7A 2GS6A 4O2PA 3SV0A 4ENYA 2ZDUA 2VWZA 3FY0A 3MFTA 3U9NA 2RKUA 5DEYA 4LGDA 3ZSHA 3I5ZA 2O3PA 2XH5A 4ANLA 3QGWA 3TACA 2X39A 5CS6A 4TYGA 4JX3A 2J51A 3VHKA 4C57A 1JVPP 4R77A 2XB7A 3NUPA 1QPDA 3DU8A 3KB7A 4PNKA 2YWPA 3KKVA 3ZLSA 3EZRA 2W96B 3FLNC 4RLLA 5EYMA 3TIYA 4IAYA 5CAQA 5CENA 4P90A 5EI2A 5A4LA 5KCVA 2VTIA 4KBCA 4OTWA 5IQFA 3C4EA 3EZVA 3JVRA 4LL5A 4GJ2A 4RX7A 5IUHA 3KCKA 4KKHA 2VTMA 3AT3A 3U4UA 4E1ZA 4YTCA 5AA9A 4P2KA 3KQ7A 4S31A 2REIA 5C26A 2XRUA 2ITXA 4AZEA 3HEGA 2RG6A 5ANDA 4NFMA 4QTAA 4FSMA 3H3CA 5AP1A 5JH6A 3ZSGA 2XNOA 4CKJA 2OH4A 3FMNA 2YJRA 2QOQA 2WOTA 3HGKA 4PUZA 2GFSA 2Z7SA 3GGFA 4RJ5A 3PA4A 4U0IA 1KUTA 2WMRA 3I6UA 4IC7A 2EWAA 5CAUA 4RZWA 4D5KA 3IW7A 2WGJA 4FODA 1PHKA 3L9PA 2QD9A 3DA6A 5HO7A 4EJ7A 4XOYA 3Q5ZA 3KXMA 2BIYA 5FUTA 5CF5A 4PTGA 2G2HA 4FKLA 1YWRA 3OXTA 3EYGA 4CFUA 3KK9A 4DGGA 4ZTHA 2R4BA 3GFEA 4IAKA 3GT8A 4QMQA 5J5TA 3E7VA 4DGNA 5A6NA 4X2NA 5J8IA 4DFLA 2XIZA 3FZRA 4B9DA 4Z7GA 2UW9A 1E1VA 4WHZA 2ACXA 1MRUA 5HE2A 3R01A 5DBXA 3TTIA 5A54A 4BCHA 1TQPA 4FV1A 1K2PA 3LFNA 4I0SA 4BDCA 1QCFA 4CFMA 2QKWB 3DDPA 4PTCA 4BGQA 5CXHA 2WTDA 3OC1A 4ZJVA 1H00A 1PMUA 1P14A 1XH9A 5B0XA 3BQCA 4MX9A 2OIBA 4AWIA 3OUNB 3ERKA 3FYKX 4FC0A 4YLKA 5IA0A 2B9IA 3BE9A 5IEXA 4WBOA 5E90A 3R00A 3AD5A 4O21A 3R1SA 4BHNA 3AC8A 2YM8A 5E9EA 1U59A 2CLQA 4IJPA 3DB6A 3V04A 4FKOA 2WXVA 3C7QA 4IX4A 3P78A 3ENHA 4GYIA 5EQEA 4GH2A 4JDKA 5L2TA 2IJMA 4BCOA 4C4JA 5IZFA 4AN2A 4E4MA 2I0HA 3QD2B 2PVFA 4EC9A 5AR4A 2B52A 4TL0A 1WVXA 1YW2A 1MQBA 1YWVA 1IA9A 1M7QA 4QMVA 4MWHA 3T9TA 5AV4A 2YEXA 4DC2A 4CRSA 3VC4A 4MNEA 3EN4A 3E92A 2QG5A 4G9CA 4I21A 4M8TA 4RVLA 5EM8A 4BZOA 4ZSLA 1PKDA 5BUIA 2C3IB 3R28A 3RZBA 4AG8A 2HW6A 5IEVA 3LCSA 1A06A 2GDOA 3RCDA 3QYZA 4IDVA 4ITHA 4U79A 4RJ3A 4BHZA 4EL9A 5HU3A 5CEOA 3VUHA 4C4HA 4X2FA 3OW4A 3FXXA 4EOMA 3FZPA 4DTAA 5ETFA 5HG8A 5D11A 2F2CB 2XKEA 3MV5A 3OZ6A 3PJ1A 4IXPA 2EUFB 3MY0A 4BKYA 3FLQA 3R8VA 4YHFA 2IZUA 4FV2A 5J7HA 4ZEGA 1ZXEA 4UMQA 1W82A 1BKXA 2XMYA 3DXNA 1YVJA 4HYIA 4I6FA 3MH2A 5IQCA 4C3RA 2ERKA 1H0VA 4O0UA 3PWDA 4UV0A 1OKVA 3ZS5A 2UZDA 2Y6OA 2PYWA 4MTAA 2WPAA 5DEWA 3RP9A 4AS0A 3QRJA 4MXOA 3KULB 2ZM3A 4XOZA 5IQAA 3E93A 3LFAA 5KZ0A 3KGAA 4QP4A 2YAKA 4N6ZA 1F0QA 3PE1A 2CKPA 4MXXA 1URCA 1LPUA 4DGLC 3SXFA 4FTCA 4N57A 3E8CA 4DYMA 3EQCA 2P3GX 4OTPA 4FVPA 4E4XA 1NY3A 2BR1A 2BUJA 4O0RA 5M44A 2QU5A 2BDJA 4FTQA 1CKPA 3IW4A 4BZDA 4IZ5A 5LVNA 2UW4A 2OI4X 4OGRA 4FKWA 4NCTC 1BI7A 1Q4LA 4KINA 2C0TA 4YZ9A 2OIDA 2IVTA 3H0ZA 3WYYA 3IG7A 5GZAA 4MF1A 2XBAA 4XG4A 3HVCA 3R9NA 3V5LA 5BVEA 2CGXA 3VW8A 4EH2A 5K9IA 5DYJA 2JAMA 2BTSA 4FKPA 4ZY6A 2XM8A 1FGKA 2FSLX 1WMKA 3NLBA 2CKOA 4AA5A 4TRLA 3FEGA 2YITA 2G01A 3I7CA 4CZYB 4XNEA 3BU3A 1XH7A 4NIFA 1YI4A 3BBTB 3L9LA 3Q3BA 1H28A 5FM2A 4CNHA 3QAME 2YACA 1ZYSA 3OCSA 4FTOA 4XP3A 4DG2E 5CSVA 5EHYA 4OBOA 3DCVA 3A62A 4QP7A 3C5IA 5CANA 4EH7A 4YP8A 3CJFA 1MQ4A 4EQCA 3AMBA 5GIOE 4NZWB 1BYGA 5AM7A 5HX8A 5IMEA 2V62A 5CSWA 3GQIA 2C5NA 2FVDA 4RWLA 2C6LA 2I0YA 2W05A 2YERA 4BCGA 4J98A 4AW5A 3FZTA 2QC6A 3HECA 5DI1A 2WB8A 2R3PA 3QD0A 1R0EA 2BALA 3BI6A 3QCYA 4EH6A 4F09A 1OIUA 5HHWA 5BVWA 1JKSA 4UWCA 3SG9A 3Q4UA 1GY3A 3ORKA 4WO5A 2G2FA 4BBFA 3TV6A 2J9MA 4ZTLA 3ZRKA 5J79A 3TJDA 3MB7A 4RMZA 2Y4PA 3QXPA 1JWHA 2QOBA 1G5SA 3QQLA 4K33A 2OG8A 4L3PA 3GOKA 4OT5A 4RFZA 4X0MA 3S3IA 5C4LA 1W7HA 5IUGA 3BYSA 3CGFA 1BX6A 3OF0A 4PY1A 2WO6A 4JX7A 4TWNA 3S95A 5G6VA 2LAVA 1KE5A 3BEAA 3EL8A 5DN3A 2RFDA 2WMWA 4IAIA 4RFMA 4ZZMA 2PVRA 3DV3A 5BVNA 4FZ7A 2C6DA 3DPKA 3HX4A 3KXGA 3MFSA 2HW7A 4YPDA 3DLZA 5E92A 3OOMA 4AA0A 5DLSA 4IX3A 1OECA 3DKCA 3FC1X 5LCJA 3RVGA 3UG2A 2CGUA 5FXQA 3PXQA 3MWUA 3KN5A 4E5BA 5JGAA 3TT0A 4JQEA 4MXYA 5H8EA 4B6LA 3FLSA 3GU4A 4BB4A 3R30A 5K4JA 4K8AA 4GIHA 3B2TA 2VV9A 3BRBA 4R3RA 4Y5QA 5TF9A 3GVUA 2R3JA 4B99A 4CYIA 4YHJA 1T45A 2P2IA 3NIZA 5FXSA 2QNJA 2PY3A 2R3MA 2ITUA 4WIHA 3UZRA 3G9LX 3K5UA 2XNBA 3MPAA 2Q0NA 3UE4A 1S9IA 3C4FA 5AP3A 4OUCA 2W1DA 4FTMA 4CQGA 2QKRA 3IDPA 5FDPA 2YIRA 2OH0E 2P0CA 2VWUA 3QQFA 4IHPA 2JIUA 3HMNA 2VX3A 3DBEA 4UYNA 4DEEA 5A4QA 3KA0A 2VO0A 5JN2A 5JFWA 3EQPA 2BPMA 4DH1A 4MXAA 4I0TA 4O7NA 4XUFA 3KRWA 4TTHB 3BYUA 3THBA 5IKWA 4K0YA 2JDSA 1DI9A 2BAQA 1I09A 3QYWA 5HESA 5LJJA 4ANSA 2QOHA 2OJIA 2XNGA 3DAEA 5JZJA 3FKOA 1PY5A 3EWHA 4KIOA 4LYNA 1T46A 1H1PA 4PWNA 3E63A 1YOMA 4G17A 3UGCA 2F49A 3GC8A 3KU2A 4BWKA 3HDMA 5A4EA 2IZTA 4J1RA 4QMPA 3MTFA 3LQ3A 4LUEA 4JIAA 5A4TA 3G0FA 4FBXA 5M57A 2BKZA 4F6SA 1CDKA 2G9XA 4FT5A 3FQSA 4IJ9A 3U51A 3MA3A 3OMVA 4BDIA 2XK7A 5FXRA 1MRYA 5AA8A 1H1SA 3QKLA 5HBHA 5AADA 5AEPA 3GC9A 3RPOA 3DZOA 4JLCA 4QP9A 3IPHA 5ACBC 3PY1A 5DH3A 3V5JA 3FI2A 3D7TB 3FHIA 3RM6A 5BYZA 3LJ2A 4MVFA 4YURA 4FK6A 2CSNA 4AOTA 3F66A 4O1OA 4RQKA 1WBTA 3TZ9A 4B8MA 5I9WA 3UOKA 3V01A 3OXIA 4C33A 3H4JA 4NM0A 5K5NA 3MPMA 3GENA 2CGWA 5TR6A 4PQNA 4GU9A 2OW3A 3OP5A 4R7HA 5A3XA 3COHA 2GNHA 3MVLA 1O9UA 3EQGA 4X3FB 4FG8A 5CNOA 4J53A 5IH5A 5J1VA 1ZY5A 3PJ3A 5GJDA 4XG3A 5AP2A 1Y6AA 5AR2A 4F7LA 1DM2A 3MSSA 4YTIA 5HLWA 4R7BA 4EHGA 4CVAA 5L6OA 3QTIA 1IRKA 3ZM4A 4DEBA 2QCSA 2G15A 3DTCA 4ALVA 4GV1A 4W8DA 4KRDA 1OL1A 4XJ0A 2VWXA 4FR4A 3QTXA 3F61A 1IEPA 3HRFA 5EQPA 4X3FA 2BZKB 2GNJA 4ASEA 3UZPA 2BILB 5CF6A 4KNBA 4AZSA 2IO6A 2Y4IB 2PVYA 1HCKA 5A6OA 3HMMA 1REKA 3IQ7A 5CU4A 3BHVA 5FLFA 1P5EA 3LQ5A 2HXQA 2VD5A 3VBQA 5CF8A 2FH9A 2YCQA 2IG7A 4BI1A 4LGHA 2QU6A 3KEXA 2B53A 3C0HA 5JKGA 3ORLA 3PYYA 3R2BA 4I1ZA 3ATTA 2DWBA 3KRJA 2WMVA 2OO8X 2QVSE 4UN0C 3IONA 5HO8A 2WMTA 5LMKA 2W4KA 3CCNA 2OXXA 5C8KA 2WMUA 1V1KA 4CMTA 4AW2A 2HYYA 3WE4A 4KIPA 4KAOA 4O7LA 4DFUA 1SNXA 5EHOA 2PUUA 1XBCA 4HYHA 2W1GA 3ALOA 1KE9A 3F2NA 1WBNA 5AR3A 4D55A 3VS1A 4DGMA 2BZHB 3MVMA 4IAZA 4DH8A 3QQUA 3ZHPC 1TVOA 3DLSA 3HRBA 3FQHA 4ITJA 5EM5A 4EYJA 3TWJA 1OL2A 3ZLYA 4J8MA 3UOJA 3ALNA 5J87A 3G6HA 3FXZA 4FV4A 3PWYA 4QTCA 1VR2A 5KO1A 2UUEA 4EZ3A 4BDDA 4FGRA 2JDVA 1OKYA 2YZAA 3KMUA 4IWDA 1H1WA 2HXLA 3W8QA 2F7EE 4BWPA 3PY3A 3C4XA 4QYYA 3UIMA 2C68A 2XJ1A 3S2PA 5TKDA 4EWHA 3NW6A 1PXJA 3CPCA 2WTCA 3LFSA 4FZFB 4RJ4A 4ZSAA 2VX0A 5KMJA 1XKKA 4C34A 5AP4A 4I4EA 5DT0A 4JL9A 4W9WA 1SNUA 5DHJA 3TNHA 4S2ZA 4ACMA 3T9IA 2VTHA 4O81A 4O7WA 4O0SA 3LE6A 3H9FA 5FG8A 4XBRA 4YNEA 3AMYA 4NT4A 3COMA 3TJCA 1J7IA 3R7UA 2Z2WA 4ZTQA 2WIPA 4D5HA 2Z7QA 4TXCA 5HEZA 5FTOA 1LP4A 1MRVA 2UW7A 5AUUA 2IVUA 4AFEA 3C13A 4FV6A 1VJYA 2A19B 2CJMA 2WU7A 3LCTA 3QRIA 3F7ZA 4YPSA 5KUPA 4FKJA 3LFQA 5IA5A 3DQWA 4O7YA 3PXZA 3R9DA 4ZZOA 4EUTA 4ZMFA 5CEKA 4TY1A 5CAVA 4QMXA 4XLVA 2ZV8A 4USEA 2JEDA 4PV0A 2WMSA 3GCSA 4C35A 3QLFA 5HO6A 3ZLWA 4QP1A 2ITZA 4FI1A 3R6XA 4QPAA 2QODA 4JAIA 4I3ZA 4C4FA 3FL5A 4E3CA 4WRSA 1BUHA 2PZ5A 1OGUA 1XH8A 4RPVA 4TW9A 2G2IA 3KMWA 3NUSA 3SC1A 3CP9A 3PVBA 4NWMA 4BDHA 5DIAA 4AP7A 3OEZA 4RZVA 3EFKA 4PDPA 5KBQA 3ELJA 3DFCB 4OBPA 5HX6A 3ZTXA 4E6AA 2HCKA 2XEZA 2PTKA 2CKEA 1PXKA 2WEIA 3GQLA 5DNRA 5CZIA 4BCKA 3BWJA 3FUPA 2QI8A 2V22A 4AN3A 3H9OA 3U6JA 4ID7A 3MN3A 4J97A 1FQ1B 4IIRA 3LAUA 4WT6A 1L3RE 4EEVA 2VUWA 3TV4A 3FZOA 4DH3A 2GNGA 4IVAA 4EHEA 3C0GA 3AC2A 3QUPA 3NYVA 3OEFX 4XG7A 4H39A 3CJGA 2HWOA 1KWPA 2Y0AA 2W1FA 4A4XA 3D15A 5BX0A 2JBOA 5B7VA 4ZSGA 4MBJA 4BKJA 3OWKA 3M1SA 4XP0A 4I5PA 4JRNA 2OFVA 3SW4A 4EK3A 4I4FA 5AIRA 3O50A 2PZYA 1UV5A 2WEVA 2XJ0A 4FL2A 4XS2A 3FBVA 1Z57A 3PPZA 5DWRA 4DLIA 5LWMA 3GI3A 3RALA 2ESMA 3F82A 4XX9A 3LFDA 4FEQA 5FBNC 5KNJA 2C4GA 3CBLA 4HVIA 2HELA 2ONLC 4G6OA 2F9GA 4HZSA 3BV2A 3DK3A 3VULA 4F6WA 1DAWA 2W99B 5LOHA 1IASA 3UQGA 3V5TA 4BTJA 4YJSA 4BICA 4CTBA 1K9AA 4YTFA 4O0XA 5AR8A 4UX9A 5IQEA 2YIWA 4KIQA 4TWCA 4C02A 1NVSA 3VS0A 4CGAA 4ZAUA 1OL5A 4O82A 4EOSA 3W16A 4IB5A 3GU5A 4OTGA 3D7ZA 3LW0A 5E8SA 5KZIA 5HU9A 3O96A 5FEEA 2FSTX 3W2CA 3W8LA 3WF9A 1QPCA 2ITPA 4ZTMA 3WE8A 4ANMA 4MNFA 3L8XA 4AX8A 3C5UA 1CTPE 3UPZA 2HIWA 4BYJA 1OKZA 1JPAA 3CS9A 3SW7A 3NX8A 1OI9A 1Z9XA 3OG7A 3GCPA 4AA4A 4QP6A 4ZLZA 4XHKB 1PXIA 5LVMA 5CX9A 4WNKA 4EOLA 3HDNA 3Q4TA 1J1BA 4J96A 4ZOGA 3R04A 4B7TA 3UMXA 4KS7A 3Q6UA 4RVMA 5J95A 2ETMA 2VTNA 3ODYX 4DEIA 2WMBA 4FSNA 5BMSA 4J95A 3FZ1A 1JSUA 3V51A 4QYFA 1FINA 1UNHA 3L8PA 3R22A 4R3CA 3JR1A 4EYMA 5JT2A 3FWQA 4GSBA 1YXTA 3P9JA 3UC3A 5M56A 4EOOA 4Z7HA 3EFJA 4X3JA 3R83A 4G5PA 3P7BA 3ACKA 5M53A 3O71A 3UTOA 2ZMCA 4GT3A 3ANRA 4JBVA 3F2AA 5E8VA 2PZPA 4F9YA 3LMIA 4RX5A 5AUVA 3LXLA 3P23A 2WTWA 3MVJA 3QZGA 4FF8A 4HGEA 2WQEA 1UNGA 2X2KA 3F69A 4E4LA 5KE0A 3K54A 2BFYA 1OPKA 4YBJA 4U7ZA 4ZS0A 3TNPC 2BCJA 3IOKA 4XEYA 2BFXA 3TXOA 3ZSIA 3SVVA 2JIVA 4D2WA 2WKMA 3F3TA 2WTJA 3EKNA 4WNPA 4YZBA 3P4KA 4RJ8A 4FIIA 3WIKA 4LUDA 1JBPE 4XCUA 2ZM1A 2R7IA 4BTKA 2Y6MA 4HPUE 3RGFA 4F0GA 3PXFA 2JBPA 1RQQA 3MDYA 1LEZA 5EW9A 5CU3A 2VO6A 4MKCA 3IO7A 3ZEWA 4C8BA 2IZRA 2XNEA 5EW3A 4E5AX 4J52A 1S9JA 5IPJA 3U6IA 2UVYA 1FVTA 3EN9A 4XV2A 4FUXA 3BU6A 1HCLA 2YFXA 3PXRA 3QRTA 4PMTA 1URWA 1F3MC 1IAJA 4G5JA 4S33A 2G1TA 4EOQA 4M66A 3MI9A 4BTFA 3GOPA 1PF8A 3TNIA 3C1XA 5E7RA 3UODA 2UVZA 2ITTA 3O17A 1OIYA 2YM3A 3S4QA 4LMNA 2YCFA 2QLUA 3GC7A 4NK9A 4F65A 3VQHA 3F3VA 4FV3A 5AFVA 4DINA 3SX9A 5AWMA 3PPKA 1PMVA 4GFGA 4YO6A 1KOAA 3F9NA 3AD4A 1H08A 3CD8A 4L01A 3QWKA 2E9NA 4TYEA 5HI2A 5T3QA 2J5FA 3UDBA 4A7CA 5FTGA 1R1WA 3P1AA 2FUMA 4JT3A 3R7GA 4IVCA 5HVYA 4OAVB 3UQFA 1PW2A 3E3PA 4GG7A 2WQOA 4IW0A 5IISA 2Z7LA 3CPBA 2IW9A 3RPRA 5LXMA 4TWOA 1M2PA 4AGDA 2Z02A 2J90A 2J5EA 2JDOA 4HVHA 4HCUA 4MD9E 4V04A 1M2QA 3HV3A 3GNIB 4IWQA 3U8WA 2V5QA 4WG5A 1YXXA 4FSWA 3V8WA 4B8LA 1Q3DA 5AR7A 5HNIX 4DN5A 1ND4A 3V5PA 2CHLA 4PX6A 3C51A 4W4YA 1JKLA 5D7AA 4WG4A 4C62A 1H25A 3A7GA 1P2AA 2V55A 3AOXA 1A9UA 3R1YA 5CASA 4RFYA 4C3PA 3R2YA 4HYUA 1ZMWA 2VAGA 1Q24A 3QRUA 4MXCA 5JQ5A 1OUYA 3BLRA 3RMFA 1J91A 3OCTA 2UZWE 4AZWA 4O27B 4JQ8A 3QTZA 3PJCA 4MQ1A 1YDTE 2WD1A 3ZRMA 5HE3A 3DBDA 4EH9A 1YOJA 2PVLA 3Q53A 4IZ7A 4YMJA 2C47A 4C4GA 4BCJA 4IANA 4YHTA 2ITQA 3LXNA 3VUMA 2C69A 2O0UA 4O7RA 3I5NA 4RC2A 3TNQB 2OIQA 2QOLA 3HA6A 3IGGA 1FGIA 3LXPA 1JAMA 4IADA 5AAEA 4FZAB 2XBJA 4FIEA 4G31A 3FMMA 4JDIA 4XV1A 5AUWA 3RKBA 1OL7A 4I92A 2BZIB 3R7EA 3ZFYA 5I4NA 4MD7E 2I0EA 2VTQA 1H01A 4L00A 2O8YA 3TUBA 3A8WA 1XJDA 4MBLA 3RK5A 4F1OA 4K18A 2YDKA 1GIJA 3OWPA 3PSBA 2Z8CA 4YJOA 1J3HA 1SMHA 5M4FA 4YLJA 5T68A 2OSCA 3HL7A 4AU8A 1OVEA 1ZYJA 2O2UA 1IA8A 2VTRA 2QO9A 4Q2AA 2XEYA 5H9BA 1OL6A 3CY2A 4KBKA 4FG7A 1ERKA 5DT3A 1WVYA 5BQ0A 5IQGA 2DYLA 4UMPA 2YLEA 3Q52A 3MJ1A 4JRVA 2ZJWA 3DOGA 2H34A 5DMZA 4H58A 4O96A 5CVFA 4EC8A 2OFUA 1Q8WA 3PPJA 3ZC6A 4YZDA 3W18A 5IQBA 3C0IA 3B8RA 4X2GA 5HLPA 3NUYA 4EH4A 3VO3A 4DTKA 2C6OA 5ETCA 1W83A 1ZMUA 5ANGA 2X7FA 4EONA 2PUNA 4ANOA 5JQ8A 4AZFA 3PSDA 3FLWA 4CFVA 5HG9A 3JVSA 2A4LA 4CV9A 5CU0A 3AC1A 2YA9A 4TN6A 3ZCLA 3UBDA 2O65A 1U54A 4TNBA 3PDTA 3MBLA 4I41A 4BDEA 3IK3A 3MIYA 4U6RA 4F63A 4D0WA 3S00A 3W33A 3M11A 3HV5A 5EFQA 5AP6A 3MJ2A 2C6TA 3D5XA 3MYGA 4F0IA 1X8BA 4IFGA 5LMAA 4USFA 4DBNA 5M51A 4WSYA 2C3KA 2WTIA 3G0EA 5HTBA 4YSJA 3N4VA 4NL0A 1ZWSA 5M06A 3MPTA 3PFQA 4FSQA 4QMSA 4PMSA 2YM5A 2C0OA 3GEQA 4NFNA 3T3UA 4FUYA 5L2QA 3A4OX 1XR1A 3Q60A 4I5MA 4HNFA 4YC8A 3O51A 1OPJA 4LM5A 3MS9A 4I6QA 1WBVA 5FWKK 2J2IB 3QZIA 3NCZA 5LARA 3QRKA 3QUEA 2NPQA 4CMUA 2QG7A 2OKRA 1FOTA 4G6NA 5CQUA 1OM1A 4CQEA 2YM6A 2YCRA 4FV8A 4ZTNA 4O91A 4O6EA 5HNBA 3GCVA 3I7BA 1TQIA 2R3RA 2W7XA 3LLTA 1J1CA 4I23A 3O0GA 3COIA 3ZC5A 2XVDA 5KKRC 1Q8YA 1SVGA 4I5HA 4IM2A 4PRJA 5HTCA 2EXEA 2JKQA 2XNMA 2E9PA 4UXQA 4E6DA 4CG8A 1GZ8A 1Q97A 3QQHA 4YBKA 1ZMVA 2OZOA 5KMIA 4O0YA 3ULIA 4BCMA 5CU2A 2HZ4A 3QQJA 3ZMMA 4D1XA 3FSFA 4E6CA 4AUAA 4NIFB 3SAYA 3ZBFA 4AQCA 2GQRA 5BVDA 4QMOA 2FSOX 3LM5A 3QHWA 4OW8A 4QP3A 1PXMA 1CM8A 1WCCA 3BKBA 3IW5A 4IB1A 4MBIA 3LFEA 3UC4A 2C6MA 3SXSA 3LXKA 4AAAA 2XKDA 3LOKA 3ORTA 5CYIA 3QC9A 4CMOA 2VNWA 3LHJA 2VGPA 4CCBA 4N70A 3PP1A 2X81A 3D5VA 5AX3A 3Q9XA 3BYOA 1PXOA 1SM2A 2PU8A 4H05A 1V0PA 2GCDA 2XF0A 2IVSA 2GNIA 4H3PA 4DHFA 3MY5A 2WTKB 3NNWA 3POZA 4L42A 5E8ZA 2PUIA 5ANIA 5AR5A 3VN9A 3MFRA 4YJNA 3KVWA 2ZB0A 3DJ7A 3GUBA 5ICPA 2WTKC 3E64A 3HMOA 4G2FA 4JG7A 4E73A 2V7OA 1M17A 2VTSA 2C0IA 5DFPA 4K1BA 3DKGA 4LGGA 3UIUA 4X6QC 2JDRA 3LCKA 5JSMA 2BRNA 3PA5A 3R71A 4ZY5A 5DG5A 4LMUA 4E8AA 3BCEA 3OTVA 5D7VA 2J6MA 3NPCA 3W10A 4FKRA 4JBQA 3ZUTA 2JC6A 3DXPA 4QO9A 4O7TA 3ZFMA 4FT9A 5CALA 3RAIA 2P55A 1YHSA 3EOCA 3QX4A 5AJQA 2WMXA 2PVMA 3VW6A 2F57A 2GMXA 4U80A 2VTOA 3U55A 4FTIA 5CI6A 4RT7A 5F94A 4BRXA 4QYEA 4RC3A 3VF9A 1H8FA 4YZNA 4GK2A 5AV2A 3IW8A 1ZOHA 1Q3WA 3AD6A 4RJ7A 3EQFA 3WI6A 2NRYA 4F08A 3K5VA 3BHYA 3RTPA 4XMOA 2VTTA 3R8MA 2B7AA 4CG9A 4XG8A 4U9AA 4RJ6A 3AC5A 4N4SA 1NA7A 3HYHA 4RA5A 4YZCA 5F4NA 3VBWA 1PMNA 3PY0A 3RNYA 4UZDA 4Y73A 5EOLA 5IH6A 3R8UA 1OIQA 2C1AA 3KRLA 2J0MB 4M15A 1GNGA 5KX8A 3Q9WA 5E8YA 3TG1A 1APME 2JKOA 4BWXA 1JNKA 5A14A 2UZOA 4JG6A 2XNPA 1M14A 3KREA 3VUKA 2OZAB 3VBYA 4NTTA 4RWJA 4EKKA 1QL6A 4GT4A 1UNLA 4GS6A 4S30A 1G8SA 3WIGA 3TDWA 3U87A 3OUKA 3AGLA 4AGCA 2RL5A 5FRIA 5BMMA 2W06A 4KIKA 3ZFXA 3UVRA 3QD3A 5M09A 2R2PA 3K3JA 1F5QA 1XWSA 2GNLA 1G8AA 1Y57A 3KFAA 2Z7RA 4YJTA 4A9TA 4MAOA 4F9BA 3E8EA 1CKJA 2R3GA 4G3EA 1UKHA 5I3OA 2PE2A 4EZ7A 4DGOA 3GCQA 5K4IA 4A9RA 3RWQA 2YM7A 3SG8A 1UKIA 5LVOA 4G3FA 4QYGA 3CKWA 4AOJA 5I9ZA 5GZ8A 2PMIA 3OS3A 4JOAA 3WOWA 5J9ZA 2XKFA 3N51A 3U4WA 4QYHA 2BRGA 5IQHA 4FNWA 4O7ZA 2GS2A 3P79A 3CR0A 2J4ZA 4FIGA 3IGOA 5CSXA 3NWWA 4RIXB 3M2WA 3CXWA 4FT3A 1Q8UA 1YI6A 3G33A 4R1YA 3E87A 2FSMX 5IA2A 3AC4A 5AP5A 4G3CA 4H3BA 4L52A 3VS3A 3ETAA 3UIXA 4MHAA 5I5ZA 2FA2A 1YDRE 1GOLA 4CZUA 4M12A 1M2RA 4DFXE 2CLXA 1ZY4A 4HZRA 4DEAA 4J8NA 4H1JA 4LQMA 4UEUA 3RAHA 2GHLA 3UNKA 2XZSA 4R1VA 3KULA 4J99A 4F4PA 3UJGA 2PL0A 4WSQA 2OF4A 3IDCA 3ZZWA 1WBPA 3REPA 3WZDA 4QNYA 4AOIA 3SRVB 5EQYA 5JK3A 5KMLA 4IM0A 1W0XC 3O7LD 2XA4A 4OTIA 4W9XA 2R0IA 3FLZA 3VS4A 5LVPA 5M4CA 1Y8YA 3UNJA 4F70A 3QKMA 5HIDA 5AV3A 3ORPA 3VIDA 1JSTA 4F0FA 4G6LA 5A46A 2GQGA 2VWIA 3CY3A 4FTAA 5KMKA 2VN9A 2QHNA 1GJOA 3L8SA 5EI8A 3U6HA 4YJPA 2IN6A 4H1MA 5L2SA 2YN8A 2QURA 5H3QA 4PL3A 2JFLA 3LM0A 5EI6A 4EHZA 2R3FA 4FYNA 3PA3A 5F1ZA 3D5UA 4C4EA 1L8TA 4FKGA 2XUUA 4WKQA 1JOWB 4D1ZA 4DEDA 4EJNA 3ULZA 2X2LA 4II5A 4HW7A 1XH4A 1SVEA 2VX1A 5CU6A 3TZMA 4CV8A 4BCIA 4TYHB 4P7EA 5AUXA 1UWJA 2R64A 4FIHA 2EVAA 3HP2A 4NSTA 2SRCA 3QTRA 4YJUA 1ZLTA 3VUTA 4DEGA 3I0OA 4KRCA 5IQIA 1CMKE 1I44A 1OPLA 4M13A 2CN5A 4FZDB 5DGZA 5A4CA 4DITA 3FSKA 2WNTA 3NAYA 1B39A 1H4LA 1XBBA 2A27A 5EDQA 4CZTA 4O7VA 4BF2A 3Q2MA 4NW6A 3UYTA 2BKKA 2XNNA 1WFCA 4BDKA 5HQ0A 2HWPA 2ZV9A 1H07A 4UBAA 3DQXA 4AN9A 2XCKA 5E1SA 3N9XA 4CFXA 2R3KA 5IMXA 2UW0A 3HKOA 2YAAA 4FSUA 2PK9A 4EQMA 2CNQA 3LCOA 3OHTA 4DF3A 5CVHA 4FTJA 3VF8A 4ZIMA 4FG9A 2RIOA 4DFNA 4CCUA 5BPYA 4RIWB 3CC6A 3F6XA 3I81A 1FMOE 3QQGA 5HE0A 4Y46A 3CGOA 5EH0A 4KKEA 3W32A 1QPJA 1PXLA 2C6IA 4M0YA 4HVSA 4D4RA 2QO2A 4H3QA 3P86A 4U41A 2J0KA 3GP0A 2BVAA 3OBGA 1OITA 3ZYAA 4NJ3A 5CEPA 3OWJA 5I3RA 4PTEA 2H96A 1WBOA 5L6WL 1PJKA 2HENA 3NZ0A 3MESA 4LRMA 3QA8A 4M68A 4RSSA 3E7OA 4MQ2A 4V0GA 3EMGA 5HG7A 3RM7A 3UO5A 4BY9E 3D9VA 4FEWA 3R63A 3NCGA 4O38A 3QD4A 4L44A 4GU6A 4FTTA 4DG3E 5FBOA 3VS2A 1Q99A 3LFCA 2O5KA 1RW8A 2B9FA 5D10A 4QOXA 2GTMA 4OTRA 2W9FB 3A7FA 5EDPA 3LMGA 5CY3A 3BHTA 4EHVA 4A9SA 3IDBA 4WUAA 4L3LA 4G1WA 2WIHA 3T8OA 3VQUA 4M84A 2X6EA 4FIFA 3CLYA 3ZH8A 4ZJIA 3QQKA 3AC3A 3JS2A 4IBMA 3P08A 2UVXA 1R0PA 1WVWA 2B4SB 4KS8A 3FKNA 4JVGA 4S32A 4M14A 2J7TA 4L45A 2BDFA 4EZ5A 5BVFA 2W1CA 5AUTA 5EW8A 1R3CA 2QOFA 3OTUA 3R8PA 1G3NA 4BGHA 3UQCA 2GU8A 4X7QA 2HAKA 2HY0A 5GNKA 4EUUA 3NUUA 4Q5EA 2OF2A 4NYEA 3A7HA 4IX5A 5E4HA 3HV6A 2IWIA 1XBAA 4JR3A 4EKLA 2X7GA 3DZQA 3QA0A 2AC3A 4BDGA 3LPBA 4K6ZA 5FGKA 3W2OA 2QHMA 4U3YA 4OTHA 5DOSA 5AAGA 3PP0A 4O86A 3NUNA 5HKMA 3PRIA 3R7IA 1FVRA 1E1XA 5EYDA 3KVXA 5E8UA 2X6DA 4TT7A 5CEQA 3CTHA 4NTSA 5DRBA 5FTQA 4ARKA 3OBJA 3FQEA 2XCHA 4FYOA 3GC0A 4DE4A 4A9YA 3IS5A 5C1QB 1OMWA 3UOLA 3Q5IA 4FIJA 3NNXA 3EN7A 4MH7A 3V8TA 3RZFA 3QCSA 3VRZA 3VS6A 3WZKA 3JXWA 4FTNA 4IZAA 4YJRA 4P5ZA 3AT2A 5L3AA 1PXPA 3CE3A 4EOKA 4ANBA 2VTAA 5ANJA 3VBVA 3F5XA 3ODZX 1E9HA 3VBTA 4WRGA 4GIIA 1NVRA 3VJOA 3SLSA 2YISA 4BCPA 4UMUA 3C9WA 4F7NA 4I93A 4E93A 4BTMA 3D94A 4DFZE 4BKZA 1OKWA 4FVQA 1ZAOA 5JFXA 2VTJA 1Y8GA 2JKKA 2OJGA 2XIYA 3CKXA 2HOGA 3PIXA 1CSNA 1KE7A 3OVVA 3PIYA 3DAJA 4D1SA 5F9EA 2A2AA 5EM6A 4ZSJA 4MD8E 4PPCA 1WBWA 1JLUE 4HGTA 5AP0A 4F1MA 4YO4A 5JGDA 1A48A 3RPYA 2WZJA 1AQ1A 1KSWA 4HOKA 3ID6C 3OY1A 4KABA 4Q5HA 2QO7A 2Y8OA 3SQQA 2X9FA 4LOPA 5M4IA 3PZEA 4KD1A 2W0JA 4ONAA 2NRUA 2UW5A 3SD0A 3DT1A 2CN8A 2ETKA 2KTYA 3PIZA 4KKGA 4JAJA 4FZ6A 4L46A 4Z9LA 5HD7A 2YCSA 4FICA 5EKNA 2J0IA 2YHVA 2VRXA 3DDQA 5CNNA 5H8BA 3QCXA 4ASDA 4BCNA 4LOOA 5HICA 5GJFA 3W55A 4HCVA 3TUDA 3VAPA 4BCQA 1FBNA 4BIEA 5FM3A 2OJJA 4Z55A 3ORIA 3ORMA 3E8NA 4OLIA 2XM9A 2QOOA 2OWBA 4U42A 2R3OA 4PPAA 4PP9A 1OB3A 3VS7A 3W2PA 4A4OA 2H6DA 5E1EA 1H0WA 4FV9A 2X2MA 4O0WA 3SGCA 2A1AB 2GNFA 3WF8A 2UW8A 4D2VA 3O2MA 2OGVA 4JNWA 5BVKA 3RNIA 3TKUA 2B55A 2PE0A 2J50A 2UV2A 2UZUE 2VO3A 3PG1A 5I0BA 1OBGA 2DUVA 2BROA 2JFMA 3HP5A 4RWKA 3GB2A 5HCXA 2XIKA 4IMYA 3W1FA 4PL4A 1Q8ZA 4EBVA 5K0XA 2YIQA 2W1IA 4GT5A 4CLJA 3TKIA 3RINA 3LCDA 1P4FA 3LLAA 4O0VA 4AT3A 2WELA 5BVOA 4RIYA 4F9CA 2CCHA 3MA6A 3RK7A 5KMNA 3R9HA 5IA1A 2HZ0A 3DBFA 5K0KA 4S34A 5A9UA 4QTEA 2PUPA 4O1PA 3NUAA 3BHUA 1XH5A 1AGWA 3DNDA 3ZO4A 3LJ0A 3DBCA 3LVPA 4RLKA 1JSVA 3NS9A 2X4FA 4AZVA 2P2HA 3ENMA 4OTFA 3UNZA 3FI8A 3F3ZA 3QCQA 4QMTA 3V6RA 2AUHA 4M69B 5AP7A 4BN1A 2BRHA 4E7WA 4IWPA 4IACA 3KL8A 3TNWA 3ZLXA 1IG1A 3CQEA 3QZFA 4Y5HA 2W5BA 3PLSA 4AE9A 3ORXA 4XV3A 3HLLA 3UP7A 2NO3A 4KB8A 4KUJA 2E9VA 3MIAA 3VS5A 3VUDA 2EB3A 5EHLA 1Z5MA 4M67A 4O6LA 4AACA 4AGUA 2B1PA 1UU3A 3VHEA 2PSQA 5LQFA 1GIIA 3HMPA 4FEUA 2ERZE 4GW8A 4D4YA 3CTJA 2I40A 5C8MA 3QLGA 1BL7A 4JDHA 4L3JA 4U81A 2ONLA 3NGAA 4GG5A 3R7OA 3DGKA 3R8ZA 4C4IA 2PULA 2C3JA 1P4OA 4QQTA 2GFCA 3ACJA 3GU8A 5EK7A 1PXNA 4ALWA 5M07A 5CT0A 3FHRA 5FEQA 1DS5A 1IR3A 1YHVA 4IFCA 5J1WA 3BWFA 4CTCA 2X8DA 4LRJA 4TNDA 2RG5A 4G3DA 1U5QA 3FMKA 4MEDA 3BQRA 2C5VA 3FL4A 5CSHA 3FI4A 5D12A 4A4LA 5CXZA 4DCAA 4K11A 4BGGA 3EJ1A 2RF9A 2R5TA 2ZMDA 3Q9YA 3SOCA 3E3BX 5I9XA 1YOLA 4FOCA 4O22A 4CYJA 4DBXA 2GSFA 2R9SA 2VWVA 5IH4A 2VWBA 4CRLA 1KOBA 4FX3A 4I94A 3QHRA 5KBRA 4QMLA 3MB6A 3SXRA 5CF4A 4I20A 3GU7A 1HOWA 3CD3A 2WQBA 3OWLA 4L67A 2VTLA 3RHXA 3NW5A 3BGZA 3II5A 2OK1A 5HCZA 1ZZ2A 4K2RA 2EB2A 3VNTA 3LMHA 3KY2A 4RRVA 5CEMA 1PKGA 4M3QA 4AZTA 5IF1A 5DA3A 2WFYA 4YC3A 5JEBA 2JIIA 3V6SA 4U40A 4BCFA 5JGBA 1NVQA 2ZV2A 3BLQA 1ZYCA 2ITYA 3BIZA 1YRPA 3EN5A 3OCBA 2QOIA 4IC8A 2OLCA 5EG3A 3QF9A 2XK4A 3MGYA 4FTRA 5HTIA 4TWPA 5IA4A 2XP2A 4UALA 2W4OA 5D1JA 3LFBA 5ANKA 1R39A 4BI2A 2UW6A 4GRBA 3ZRLA 4MCVA 4QQJA 5BUEA 4FKTA 1JQHA 4DA5A 3NNUA 2X8EA 4OTDA 1H1RA 2A0CX 2KULA 2UZBA 4FTKA 4C0TA 3EFWA 2W1ZA 4GJ3A 3RAWA 5D41A 4NCTA 5K3YA 2OXDA 4TYIA 5DT4A 4U97A 1WAKA 1Q41A 3R1QA 3AQVA 4LRKA 3P7CA 5ETIA 4UMTA 3DJ5A 3TIZA 4U8ZA 1H1QA 4KBAA 5DE2A 3BV3A 4R78A 2EXCX 4RG0A 4G34A 3UZTA 4FKVA 2RSVA 1BL6A 5HZNA 3DXQA 1GIHA 2DS1A 2R3HA 4PNIA 5TE0A 2CPKE 2Y4IC 5HE1A 1YI3A 3COKA 4YGAA 2AC5A 2W1HA 3HV7A 3ET7A 2XRWA 3HUCA 4TZRA 3BLHA 4QMWA 4LG4A 4FKSA 1MP8A 1WBSA 2JAVA 1BI8A 4R8QA 2WQNA 3Q4ZA 4NM5A 3SRVA 4OAUC 3E5AA 4E5WA 2BMCA 5CTPA 1GZKA 3FXWA 4X21A 1YDSE 3EFLA 3FZSA 4YSMA 4GK3A 2XK3A 1Y6BA 4FL1A 2ITNA 3F3UA 4I6HA 3VUIA 4MYGA 4OBQA 1J7UA 4CKIA 1H26A 4RVTA 3ZM9A 4FSRA 3P7AA 4QMUA 3O7LB 4AGWA 3OFMA 3FC2A 4XG9A 3O8UA 5AV0A 3BPRA 4L8MA 3ZBXA 4N0SA 2I1MA 2B9HA 3QXOA 2AYPA 2BTRA 3K2LA 4V01A 3A99A 3A61A 1Y91A 2LGCA 1LUFA 3HV4A 3S1HA 2RFEA 3UYSA 4I24A 4Q9ZA 3WILA 4X6RA 3Q2JA 1RE8A 3FDNA 3BBWA 3D2IA 3RWPA 5TOZA 1UA2A 2UZNA 3DTWA 3EHAA 5DR9A 4DFYA 5BNJA 5B2LA 3P0MA 4YNOA 3PXKA 2B54A 4GUEA 2XYNA 3ZXTA 2YWVA 1M52A 3JPVA 1KE6A 4C2VA 2O63A 1ZRZA 4MF0A 4QPMA 4LL0A 3IECA 5IUIA 4QP2A 4AT4A 3FKLA 3D14A 4XBUA 4DT8A 3NDMA 2YDIA 4FVRA 4HPTE 4RX9A 2IW8A 3NR9A 2ITVA 3I4BA 3G15A 4GVJA 5F20A 1YHWA 3EQRA 4IDTA 4QMNA 4YU2A 5ANEA 3QUDA 4ORKA 4C37A 5CSPA 1DAYA 3TV7A 4X2JA 4BDJA 4L9IA 3QTSA 3HNGA 4JQ7A 2JLDA 3R9RA 3OXZA 4XP2A 3DFAA 3GBZA 4YZMA 4GUBA 3KCFA 4JXFA 4QMYA 4CD0A 3D7TA 4CLIA 3KF7A 2J0JA 4IX6A 3NW7A 3WF7A 3WZEA 3FMDA 2QONA 3F5GA 3FAAA 4N6YA 4AE6A 3KC3A 1FPUA 5AV1A 4ITIA 1BMKA 2PZRA 4WG3A 4EK6A 2UW3A 3ANQA 4LI5A 5D9HA 5IG1A 3OD6X 3KN6A 5J9YA 5L8KA 1PRYA 3NNVA 5M08A 4EH8A 3EQIA 4YJVA 3IW6A 2VGOA 3E88A 5L8LA 4BFMA 3R7VA 1VYWA 5HG5A 4ACGA 5LMBA 4U45A 3T3VA 4CT1A 3EQHA 3C50A 2GQSA 2P4IA 3DAKA 3ZO1A 2ZVAA 4JDJA 5DRDA 3TEIA 4ZLOA 1Q61A 1STCE 4QPSA 5CWZA 3TKHA 3K3IA 4WUNA 3WYXA 3OW3A 3NIEA 3B2WA 3HA8A 4JBOA 4J7BA 3OCGA 3BE2A 4M7IA 2OJFE 4KA3A 5H8GA 2QR8A 2PMOX 4ALUA 4BIBA 4GCJA 1O6KA 2GS7A 3G6GA 4G16A 5HLNA 3G90X 2I0VA 3Q6WA 2OBJA 4IB3A 5G1XA 2QOKA 3QX2A 3GCUA 3KMMA 4HVDA 2VO7A 3PVWA 2V0DA 4L68A 2P33A 3A60A 4LV8A 4EK4A 5KHWA 3SHEA 4EI4A 3LIJA 3FYJX 3UVQA 5ETAA 5E91A 4O7SA 2EU9A 2VZ6A 3UIBA 4MWIA 1VZOA 4FEXA 4W4VA 4U44A 4LV5A 1B38A 2PVHA 3TM0A 3ZU7A 3I60A 2BAKA 2R0UA 5HGIA 2XK8A 4ZSEA 4ASXA 4BBMA 3F2RA 2O64A 2Q0BA 4D9TA 3KXHA 4IM3A 5CEIA 4F7SA 4G3GA 4F6UA 4HNIA 4A07A 4AW1A 4I0RA 4Y95A 2VNYA 4JI9A 4PDYA 4NH1A 1NT2A 1AD5A 5HORA 4HYSA 5AIKA 4QP8A 3EIDA 1NXKA 5HVKA 1OIRA 3DNEA 2QLQA 4IVBA 3TTJA 3JY0A 3MH1A 3NYXA 4WNMA 4BI0A 3UG1A 4DH7A 3V8SA 3D2KA 3VUGA 3V5WA 3CQWA 4RBLA 4YUQA 4R3PA 1MUOA 3WZJA 1XHAA 4EOPA 2PMLX 4ZTSA 1RJBA 3SA0A 4P5QA 4IB0A 4FK3A 4GYGA 4XG2A 1XO2B 4PDOA 5DVRA 4PP7A 4V05A 5M55A 5HNGA 4JIKA 4AT5A 2GHMA 3BEGA 4RGJA 4U3ZA 4RQVA 1UU7A 3AGMA 4XG6A 2ETRA 4UMRA 1Q8TA 1J7LA 2E9OA 4AW0A 2ZOQA 2WAJA 3E62A 4DT9A 3L8VA 4L7SA 5H2UA 3ZZEA 3TI1A 4FT7A 3D0EA 4BL1A 4BIDA 5HIEA 4DLJA 4DG0E 3R8LA 1WZYA 1YXVA 3RPSA 2HZIA 3G5DA 2XK9A 4L53A 3CQUA 1KV1A 3U9CA 1XQZA 2PVKA 4FT0A 3WF6A 3QALE 4ERKA 4HGSA 2ZB1A 4YLLA 3IKAA 3DKOA 3M42A 1QMZA 3ZDIA 5KHXA 2CDZA 5EYCA 3G2FA 2OJ9A 4JJRA 2B0QA 4R7IA 4K9YA 3A7IA 5C9CA 4FSTA 1TQMA 4PDSA 4X2KA 3H10A 2FYSA 2OICA 3ORZA 3FPQA 4YR8A 3UVPA 4L43A 4WNOA 4RIXA 3A4PA 5AUYA 3SKCA 3NVKI 5GINE 4WBBB 4BDAA 3PLAE 4QT1A 3F88A 3TZ7A 3NEWA 1LR4A 4CEGA 1W98A 1EH4A 4FV7A 4R5YA 4EWQA 3MH0A 4WOVA 5L8JA 4GKHA 2PZIA 3O23A 3FMJA 4YJQA 5TO8A 2HY81 2OXYA 4TYJA 4BZNA 4C3FA 1H24A 2ITWA 4GL9A 4D9UA 4XRJA 4F9AA 5JFVA 2R3IA 4Y8DA 5C27A 1SYKA 3MVHA 1O6LA 4P4CA 4KIKB 1Q62A 4UWYA 3CEKA 2XYUA 3KXXA 2FB8A 3DJ6A 3H0YA 4FL3A 4XRLA 4C58A 3F5UA 3PXYA 2YIXA 4ZY4A 2R7BA 2W4JA 4FTLA 1UWHA 3R1NA 4O2ZA 4E26A 2YM4A 5I9YA 5LCKA 2W5HA 2R3NA 3DY7A 4D2RA 4IZYA 3CSVA 5DR2A 3RAKA 3V3VA 3ZONA 4RWIA 4BBEA 4G9RA 4DAWA 3BGPA 4D58A 3ZO2A 2CNUA 3QC4A 4NM3A 2ZDTA 2X0GA 5ANOA 5CAOA 5J7BA 5C03A 5IQDA 2R3QA 3AXWA 1K3AA 1H27A 2J0LA 3BGQA 3QWJA 4AXAA 3SOAA 4E20A 4EOIA 5HD4A 3ITZA 5E8WA 1OBDA 4KSPA 5KKRB 3QKKA 4HJOA 3LKMA 5FD2A 4MXZA 3I1AA 4BR3A 3VWAA 4GEOA 5DR6A 2GHGA 4FOBA 3TZ8A 3QL8A 3OROA 3EH9A 1W84A 3D4QA 2W1EA 5I9VA 3VBXA 3L9NA 4FE2A 5EYKA 4CFWA 4EK8A 1VYZA 4A06A 3DK7A 4DFBA 3QU0A 1PYXA 4I5CA 1UU8A 3DBQA 4V0GB 1YWNA 2H8HA 3LJ1A 2CMWA 4E6QA 3HAMA 3QTUA 2XKCA 4XLIA 1KE8A 4DH5A 4C36A 3EYHA 2C3LA 1BLXA 2ZAZA 3Q04A 3VVHA 3OT3A 2JITA 2C30A 3QTWA 4FTUA 3G9NA 3QTQA 3RBWA 3F7WA 5B2KA 5AMNA 3Q32A 3ZEPA 4F1TA 2XK6A 4F99A 4YC6A 2WMAA 4ACCA 3FMEA 3S0OA 3PVGA 1ZOGA 4PF4A 4RIWA 4Y85A 4CFFA 4UYAA 4PL5A 4GK4A 4X3FC 3D83A 4HCTA 4AFJA 1M7NA 1KV2A 3R9OA 2PMNX 1LEWA 3FPMA 3E8DA 4NKAA 1ZARA 4JG8A 4QQ5A 4RIYB 5HVJA 4D4SA 3WZUA 4ZZNA 5CAPA 5B2MA 4IQ6A 3EKKA 4RC4A 4CT2A 1ZYLA 2X9EA 3FV8A 2ZYBA 4PPBA 4D4VA 2X7OA 4M0ZA 2JGZA 5GHVA 5M4UA 5FEDA 5AUZA 4IEBA 3RJCA 4I6BA 4ZLYA 4Y72A 4IE9A 3MFUA 3FE3A 1ZYDA 3HAVA 3LQ8A 4IWOA 4I22A 3MY1A 4HVGA 2VWYA 5IU2A 4QRCA 4NEUA 4BDBA 3OOGA 4ASZA 3JUHA 4M69A 2IVVA
chains in the Genus database with same CATH superfamily
5IDNA 4C61A 1GAGA 1Q5KA 3ORNA 2YABA 3KK8A 2UZLA 3O8TA 4K77A 3A2CA 1YXUA 3ZO3A 3TCPA 3UOHA 3W2QA 2Q83A 1O6YA 2XIRA 5CZHA 5JZNA 3DK6A 4FKUA 4D2PA 2Y7JA 2I7QA 4C38A 2PVNA 4ZJJA 3FMLA 1OUKA 3CIKA 5F95A 2EXMA 2W5AA 3EQBA 4ZS4A 2YDJA 4JR7A 4QQCA 1U4DA 3PJ2A 4UY9A 2BRMA 4GFOA 1VLRA 2C6KA 3ROYA 1ATPE 4NM7A 4R6VA 2IPXA 2C1BA 5TT7A 1B6CB 2WHBA 3L1SA 2XIXA 2E9UA 4U5JA 4APPA 4PMPA 4APCA 3D5WA 4IAAA 4RVKA 2IZSA 2FO0A 3F5PA 3NYNA 3FY2A 3PZHA 5L4QA 2OZAA 2ZV7A 3W0OA 3NUXA 3NSZA 3TN8A 1OGYA 4ZXTA 5HBJA 4ZMEA 3C4WA 2JDTA 3IOPA 5JFSA 3V5QA 4CKRA 2F7XE 1XH6A 3OY3A 3BZ3A 5E8XA 3BYMA 3QGYA 3EQDA 4IH8A 3FLYA 5ITAA 2Z60A 2CNVA 3GU6A 3H30A 3LZBA 5AX9A 3KXNA 4ERWA 3I6WA 3QFVA 2XS0A 4BVUA 2QQ7A 3ZDUA 3PTGA 5JRSA 2H9VA 2UZEA 3AT4A 5CQWA 3R7YA 2BHEA 2C5XA 3UMWA 1ZOEA 2F2UA 2R3LA 5CT7A 3I79A 3LFFA 4MK0A 2WOUA 4EK5A 4FGBA 4DTBA 5E8TA 1U54B 3VRYA 5L2WA 3UO4A 1V0BA 1JKTA 3QZHA 3R21A 3PVUA 4H36A 4WA9A 3RK9A 4D2TA 4BDFA 4ANNA 3KXZA 4R5SA 2CKQA 2YIYA 5EM7A 1IAHA 3AMAA 1PYEA 3EN6A 3Q96A 3SDJA 4EQUA 1CKIA 2IW6A 4NJDA 4Z3VA 5IA3A 2CGVA 4M97A 4QTBA 4UZHA 3TDVA 3ZOSA 3U54A 3BU5A 4O0TA 4RIOA 5L2IA 3RI1A 4QD6A 3HRCA 2I6LA 4C59A 1PMEA 1TKIA 4OT6A 3A7JA 5FDXA 2F4JA 4FKIA 4HGLA 3TMOA 4NKSA 4F64A 3P5KA 5FQDC 4USDA 3KRXA 2VWWA 4GMYA 3JY9A 2UZVA 2WQMA 4FNXA 1FVVA 4FSYA 2PPQA 3ZXZA 5ACKA 4GVAA 1SZMA 4FNYA 5EKOA 1ST4A 5KMMA 4XV9A 1TFFA 4A9UA 2BRBA 5HIBA 5AAFA 4ENXA 4CXAA 3NYOA 4LOQA 5K5XA 3FMHA 3OT8A 4IVDA 3QBNA 4J71A 4EH3A 2FGIA 4TPTA 2PWLA 3RCJA 5BYYA 2BDWA 4ZK5A 2NP8A 2WMQA 3PE2A 3R02A 1U5RA 3NAXA 2HZNA 3TUCA 3B8QA 5IDPA 1REJA 3DKFA 3PG3A 4LFIA 1YKRA 3BHHA 3O8PA 2DQ7X 4W4XA 4XYFA 3NVMB 3DB8A 4D28A 3N4TA 2X8IA 3DS6A 4JBPA 4ZP5A 3HZTA 3HMIA 3KF4A 5GZ9A 3WARA 3PSCA 1U46A 4FMQA 5CLPA 4ACHA 3WF5A 4AF3A 4CFNA 5EDRA 4D0XA 2JKMA 3WBLA 5KMOA 1DI8A 4MUQA 1RDQE 4EH5A 5J5SA 3NMUF 2BAJA 4IAFA 3L9MA 3ROCA 4BC6A 4O84A 4C2WA 2UZTA 2PHKA 5EOBA 4FV0A 1FMKA 3FI3A 5AM6A 4ZTRA 4OTQA 3MH3A 4Z16A 4FEVA 2YZLA 5CVGA 4DCEA 2VTPA 3VJNA 2RFSA 4FA2A 4GFMA 2GTNA 5HOAA 5LMKC 3R0TA 3UO6A 4YTHA 3NRMA 3MW1A 5DPVA 4UWBA 2HK5A 3A8XA 4NUSA 4OR5A 3G51A 4L6QA 4Q9SA 2QR7A 3H9RA 5BYLA 1SVHA 2JD5A 1TZDA 3CTQA 2ITOA 2F7ZE 1GZOA 5HCYA 1JKKA 3PRFA 4B0GA 4CSVA 4QNAA 3JYAA 1V0OA 3F3WA 4DEHA 5J9LA 5IEYA 4Y83A 4FNZA 2RFNA 2XJ2A 2YLFA 4EOJA 5L6PA 5I9UA 3RPVA 3ZUVA 4E4NA 3AKKA 4JS8A 1UU9A 2E2BA 3C4CA 4TKSA 5GIPE 2BZJA 2C5OA 3MTLA 3POOA 5T6KA 4GKIA 2GPHA 4ACDA 3KRRA 3I0QA 4NW5A 3AG9A 3BELA 3GXLA 1YXSA 4W8EA 4D2SA 3EB0A 5HBEA 3PJ8A 2V7AA 4B4LA 4EORA 2QOCA 4RX8A 4QMZA 2WTVA 3W2SA 4F9WA 4O83A 2Y9QA 2C5YA 5FP5A 5C8NA 4MNEB 2VU3A 5JMSA 1UVRA 4ANQA 4FKQA 2CCIA 1VEBA 5LVLA 3FJQE 4QTDA 5LWNA 4L7FA 2YJSA 3ZUUA 1R78A 4BYIA 4FRFA 5FP6A 5C01A 2BIKB 4C7TA 4FSZA 4NU1A 2W9ZB 1YQJA 4O4BB 3N4UA 4W4WA 4UB7A 1W8CA 2B9JA 2BHHA 3C4ZA 3GFWA 3Q9ZA 3ATSA 1OZ1A 2ZM4A 4PMMA 3EL7A 1GZNA 3Q4CA 3UPXA 3W2RA 5GJGA 2OU7A 3BYVA 4UXLA 4EBWA 5C4KA 3UP2A 2X1NA 5BUJA 2WU6A 3HUBA 4KWPA 2RGPA 4WD5A 4QMMA 2X4ZA 4FV5A 4F7JA 4KSQA 3TL8A 3R73A 1QPEA 2W17A 2C6EA 3BX5A 4RA4A 1NW1A 1ZZLA 5JRQA 4XH6A 4TYHA 3PUPA 2PE1A 4U43A 2PVJA 3RHKA 2NNWB 5CI7A 2GS6A 4O2PA 3SV0A 4ENYA 2ZDUA 2VWZA 3FY0A 3MFTA 3U9NA 2RKUA 5DEYA 4LGDA 3ZSHA 3I5ZA 2O3PA 2XH5A 4ANLA 3QGWA 3TACA 2X39A 5CS6A 4TYGA 4JX3A 2J51A 3VHKA 4C57A 1JVPP 4R77A 2XB7A 3NUPA 1QPDA 3DU8A 3KB7A 4PNKA 2YWPA 3KKVA 3ZLSA 3EZRA 2W96B 3FLNC 4RLLA 5EYMA 3TIYA 4IAYA 5CAQA 5CENA 4P90A 5EI2A 5A4LA 5KCVA 2VTIA 4KBCA 4OTWA 5IQFA 3C4EA 3EZVA 3JVRA 4LL5A 4GJ2A 4RX7A 5IUHA 3KCKA 4KKHA 2VTMA 3AT3A 3U4UA 4E1ZA 4YTCA 5AA9A 4P2KA 3KQ7A 4S31A 2REIA 5C26A 2XRUA 2ITXA 4AZEA 3HEGA 2RG6A 5ANDA 4NFMA 4QTAA 4FSMA 3H3CA 5AP1A 5JH6A 3ZSGA 2XNOA 4CKJA 2OH4A 3FMNA 2YJRA 2QOQA 2WOTA 3HGKA 4PUZA 2GFSA 2Z7SA 3GGFA 4RJ5A 3PA4A 4U0IA 1KUTA 2WMRA 3I6UA 4IC7A 2EWAA 5CAUA 4RZWA 4D5KA 3IW7A 2WGJA 4FODA 1PHKA 3L9PA 2QD9A 3DA6A 5HO7A 4EJ7A 4XOYA 3Q5ZA 3KXMA 2BIYA 5FUTA 5CF5A 4PTGA 2G2HA 4FKLA 1YWRA 3OXTA 3EYGA 4CFUA 3KK9A 4DGGA 4ZTHA 2R4BA 3GFEA 4IAKA 3GT8A 4QMQA 5J5TA 3E7VA 4DGNA 2X0QA 4X2NA 5A6NA 5J8IA 4DFLA 2XIZA 3FZRA 4B9DA 4Z7GA 2UW9A 1E1VA 4WHZA 2ACXA 1MRUA 5HE2A 3R01A 5DBXA 3TTIA 5A54A 4BCHA 1TQPA 4FV1A 1K2PA 3LFNA 4I0SA 4BDCA 1QCFA 4CFMA 2QKWB 3DDPA 4PTCA 4BGQA 5CXHA 2WTDA 3OC1A 4ZJVA 1H00A 1PMUA 1P14A 1XH9A 5B0XA 3BQCA 4MX9A 2OIBA 4AWIA 4AXCA 3OUNB 3ERKA 3FYKX 4FC0A 4YLKA 5IA0A 2B9IA 3BE9A 5IEXA 4WBOA 5E90A 3R00A 3AD5A 4O21A 3R1SA 4BHNA 3AC8A 2YM8A 5E9EA 1U59A 2XARA 2CLQA 4IJPA 3DB6A 3V04A 4FKOA 2WXVA 3C7QA 4IX4A 3P78A 3ENHA 4GYIA 5EQEA 4GH2A 4JDKA 5L2TA 2IJMA 4BCOA 4C4JA 5IZFA 4AN2A 4E4MA 2I0HA 3QD2B 2PVFA 4EC9A 5AR4A 2B52A 4TL0A 1WVXA 1YW2A 1MQBA 1YWVA 1IA9A 1M7QA 4QMVA 4MWHA 3T9TA 5AV4A 2YEXA 4DC2A 4CRSA 3VC4A 4MNEA 3EN4A 3E92A 2QG5A 4G9CA 4I21A 4M8TA 4RVLA 5EM8A 4BZOA 4ZSLA 1PKDA 5BUIA 2C3IB 3R28A 3RZBA 4AG8A 2HW6A 5IEVA 3LCSA 1A06A 2GDOA 3RCDA 3QYZA 4IDVA 4ITHA 4U79A 4RJ3A 4BHZA 4EL9A 5HU3A 5CEOA 3VUHA 4C4HA 4X2FA 3OW4A 3FXXA 4EOMA 3FZPA 4QDVA 4DTAA 5ETFA 5HG8A 5D11A 2F2CB 2XKEA 3MV5A 3OZ6A 3PJ1A 4IXPA 2EUFB 3MY0A 4BKYA 3FLQA 3R8VA 4YHFA 2IZUA 4FV2A 5J7HA 4ZEGA 1ZXEA 4UMQA 1W82A 1BKXA 2XMYA 3DXNA 1YVJA 4HYIA 4I6FA 3MH2A 5IQCA 4C3RA 2ERKA 1H0VA 4O0UA 3PWDA 4UV0A 1OKVA 3ZS5A 2UZDA 2Y6OA 2PYWA 4MTAA 2WPAA 5DEWA 3RP9A 4AS0A 3QRJA 4MXOA 3KULB 2ZM3A 4XOZA 5IQAA 3E93A 3LFAA 5KZ0A 3KGAA 4QP4A 2YAKA 4N6ZA 1F0QA 3PE1A 2CKPA 4MXXA 1URCA 1LPUA 4DGLC 3SXFA 4FTCA 4N57A 3E8CA 4DYMA 3EQCA 2P3GX 4OTPA 4FVPA 4E4XA 1NY3A 2BR1A 2BUJA 4O0RA 5M44A 2QU5A 2BDJA 4FTQA 1CKPA 3IW4A 4BZDA 4IZ5A 5LVNA 2UW4A 2OI4X 4OGRA 4FKWA 4NCTC 1BI7A 1Q4LA 4KINA 2C0TA 4YZ9A 2OIDA 2IVTA 3H0ZA 3WYYA 3IG7A 5GZAA 4MF1A 2XBAA 4XG4A 3HVCA 3R9NA 3V5LA 5BVEA 2CGXA 3VW8A 4EH2A 5K9IA 5DYJA 2JAMA 2BTSA 4FKPA 4ZY6A 2XM8A 1FGKA 2FSLX 1WMKA 3NLBA 2CKOA 4AA5A 4TRLA 3FEGA 2YITA 2G01A 3I7CA 4CZYB 4XNEA 3BU3A 1XH7A 4NIFA 1YI4A 3BBTB 3L9LA 3Q3BA 1H28A 5FM2A 4CNHA 2X0OA 3QAME 2YACA 3TYKA 1ZYSA 3OCSA 4FTOA 4XP3A 4DG2E 5CSVA 5EHYA 4OBOA 3DCVA 3A62A 4QP7A 3C5IA 5CANA 4EH7A 4YP8A 3CJFA 3AKJA 1MQ4A 4EQCA 3AMBA 5GIOE 4NZWB 1BYGA 5AM7A 5HX8A 5IMEA 2V62A 5CSWA 3GQIA 2C5NA 2FVDA 4RWLA 1G8KA 2C6LA 2I0YA 2W05A 2YERA 4BCGA 4J98A 4AW5A 3FZTA 2QC6A 3HECA 5DI1A 2WB8A 2R3PA 4AQKA 3QD0A 1R0EA 2BALA 3BI6A 3QCYA 4EH6A 4F09A 1OIUA 5HHWA 5BVWA 1JKSA 4UWCA 3SG9A 3Q4UA 1GY3A 3ORKA 4WO5A 2G2FA 4BBFA 3TV6A 2J9MA 4ZTLA 3ZRKA 5J79A 3TJDA 3MB7A 4RMZA 2Y4PA 3QXPA 1JWHA 2QOBA 1G5SA 3QQLA 4K33A 2OG8A 4L3PA 3GOKA 4OT5A 4RFZA 4X0MA 3S3IA 5C4LA 4LV7A 1W7HA 5IUGA 3BYSA 3CGFA 1BX6A 3OF0A 4PY1A 2WO6A 4JX7A 4TWNA 3S95A 5G6VA 2LAVA 1KE5A 3BEAA 3EL8A 5DN3A 2RFDA 2WMWA 4IAIA 4RFMA 4ZZMA 2PVRA 3DV3A 5BVNA 4FZ7A 2C6DA 3DPKA 3HX4A 3KXGA 3MFSA 4DDGA 2HW7A 4YPDA 3DLZA 5E92A 3OOMA 4AA0A 5DLSA 3AKLA 4IX3A 1OECA 3DKCA 3FC1X 3NFFB 5LCJA 3RVGA 3UG2A 2CGUA 5FXQA 3PXQA 3MWUA 3KN5A 4E5BA 5JGAA 3TT0A 4JQEA 4MXYA 5H8EA 4B6LA 3FLSA 3GU4A 4BB4A 3R30A 5K4JA 4K8AA 4GIHA 3B2TA 2VV9A 3BRBA 4R3RA 4Y5QA 5TF9A 3GVUA 2R3JA 4B99A 4CYIA 4YHJA 1T45A 2P2IA 3NIZA 5FXSA 2QNJA 2PY3A 2R3MA 2ITUA 4WIHA 3UZRA 3G9LX 3K5UA 2XNBA 3MPAA 2Q0NA 3UE4A 1S9IA 3C4FA 5AP3A 1W2CA 4OUCA 2W1DA 4FTMA 4CQGA 2QKRA 3IDPA 5FDPA 2YIRA 2OH0E 2P0CA 2VWUA 3QQFA 4IHPA 2JIUA 3HMNA 2VX3A 3DBEA 4UYNA 4DEEA 5A4QA 3KA0A 2VO0A 5JN2A 5JFWA 3EQPA 2BPMA 4DH1A 4MXAA 4I0TA 4O7NA 4XUFA 3KRWA 4TTHB 3BYUA 3THBA 5IKWA 4K0YA 2JDSA 1DI9A 2BAQA 1I09A 3QYWA 5HESA 5LJJA 4ANSA 2QOHA 2OJIA 2XNGA 3DAEA 5JZJA 3FKOA 1PY5A 3EWHA 4KIOA 4LYNA 1T46A 1H1PA 4PWNA 3E63A 1YOMA 4G17A 3UGCA 2F49A 3GC8A 3KU2A 4BWKA 1G8JA 3HDMA 5A4EA 2IZTA 4J1RA 4QMPA 3MTFA 3LQ3A 4LUEA 4JIAA 5A4TA 3G0FA 4FBXA 5M57A 2BKZA 4F6SA 1CDKA 2G9XA 4FT5A 3FQSA 4IJ9A 3U51A 3MA3A 3OMVA 4BDIA 2XK7A 5FXRA 1MRYA 5AA8A 1H1SA 3QKLA 5HBHA 5AADA 5AEPA 3GC9A 3RPOA 3DZOA 4JLCA 4QP9A 3IPHA 5ACBC 3PY1A 5DH3A 3V5JA 3FI2A 3D7TB 3FHIA 3RM6A 5BYZA 3LJ2A 4MVFA 4YURA 4FK6A 2CSNA 4AOTA 3F66A 4O1OA 4RQKA 1WBTA 3TZ9A 4B8MA 5I9WA 3UOKA 3V01A 3OXIA 4C33A 3H4JA 4NM0A 5K5NA 3MPMA 3GENA 2CGWA 5TR6A 4PQNA 4GU9A 2OW3A 3OP5A 4R7HA 5A3XA 3COHA 2GNHA 3MVLA 1O9UA 3EQGA 4X3FB 4FG8A 5CNOA 4J53A 5IH5A 5J1VA 3P5JC 1XMLA 1ZY5A 3PJ3A 5GJDA 4XG3A 5AP2A 1Y6AA 5AR2A 4F7LA 2NYAA 1DM2A 3MSSA 4YTIA 5HLWA 4R7BA 4EHGA 4CVAA 5L6OA 3QTIA 1IRKA 3ZM4A 4DEBA 2QCSA 2G15A 3DTCA 4ALVA 4GV1A 4W8DA 4KRDA 1OL1A 4XJ0A 2VWXA 4FR4A 3QTXA 3F61A 1IEPA 3HRFA 5EQPA 4X3FA 2BZKB 2GNJA 4ASEA 3UZPA 2BILB 5CF6A 4KNBA 4AZSA 2IO6A 2Y4IB 2PVYA 1HCKA 5A6OA 3HMMA 1REKA 3IQ7A 5CU4A 3BHVA 5FLFA 1P5EA 3LQ5A 2HXQA 2VD5A 3VBQA 5CF8A 2FH9A 2YCQA 2IG7A 4BI1A 4LGHA 2QU6A 3KEXA 2B53A 3C0HA 5JKGA 3ORLA 3PYYA 3R2BA 4I1ZA 3ATTA 2DWBA 3KRJA 2WMVA 2OO8X 2QVSE 4UN0C 3IONA 5HO8A 2WMTA 5LMKA 2W4KA 3CCNA 2OXXA 5C8KA 2WMUA 1V1KA 4CMTA 4AW2A 2HYYA 3WE4A 4KIPA 4KAOA 4O7LA 4DFUA 1SNXA 5EHOA 2PUUA 1XBCA 4HYHA 2W1GA 3ALOA 1KE9A 3F2NA 1WBNA 5AR3A 4D55A 3VS1A 4DGMA 2BZHB 3MVMA 4IAZA 4DH8A 3QQUA 3ZHPC 1TVOA 3DLSA 3HRBA 3FQHA 4ITJA 5EM5A 4EYJA 3TWJA 1OL2A 3ZLYA 4J8MA 3UOJA 3ALNA 5J87A 3G6HA 3FXZA 4FV4A 3PWYA 4QTCA 1VR2A 5KO1A 2UUEA 4EZ3A 4BDDA 4FGRA 2JDVA 1OKYA 2YZAA 3KMUA 4IWDA 1H1WA 2HXLA 3W8QA 2F7EE 4BWPA 3PY3A 3C4XA 4QYYA 3UIMA 2C68A 2XJ1A 3S2PA 5TKDA 4EWHA 3NW6A 1PXJA 3CPCA 2WTCA 3LFSA 4FZFB 4RJ4A 4ZSAA 2VX0A 5KMJA 1XKKA 4C34A 5AP4A 4I4EA 5DT0A 4JL9A 4W9WA 1SNUA 5DHJA 3TNHA 4S2ZA 4ACMA 3T9IA 2VTHA 4O81A 4O7WA 4O0SA 3LE6A 3H9FA 5FG8A 4XBRA 4YNEA 3AMYA 4NT4A 3COMA 3TJCA 1J7IA 3R7UA 2Z2WA 4ZTQA 2WIPA 4D5HA 2Z7QA 4TXCA 5HEZA 5FTOA 1LP4A 1MRVA 2UW7A 5AUUA 2IVUA 4AFEA 3C13A 4FV6A 1VJYA 2A19B 2CJMA 2WU7A 3LCTA 3QRIA 3F7ZA 4YPSA 5KUPA 4FKJA 3LFQA 5IA5A 3DQWA 4O7YA 3PXZA 3R9DA 4ZZOA 4EUTA 4ZMFA 5CEKA 3BLAA 4TY1A 5CAVA 4QMXA 4XLVA 2ZV8A 4USEA 2JEDA 4PV0A 2WMSA 3GCSA 4C35A 3QLFA 5HO6A 3ZLWA 4QP1A 2ITZA 4FI1A 3R6XA 4QPAA 2QODA 4JAIA 4I3ZA 4C4FA 3FL5A 4E3CA 4WRSA 1BUHA 2PZ5A 1OGUA 1XH8A 4RPVA 4TW9A 2G2IA 3KMWA 3NUSA 2AEGA 3SC1A 3CP9A 3PVBA 4NWMA 4BDHA 5DIAA 4AP7A 3OEZA 3UDZA 4RZVA 3EFKA 4PDPA 5KBQA 3ELJA 3DFCB 4OBPA 5HX6A 3ZTXA 4E6AA 2HCKA 2XEZA 2PTKA 2CKEA 1PXKA 2WEIA 3GQLA 5DNRA 5CZIA 4BCKA 3BWJA 3FUPA 4QDEA 2QI8A 2V22A 2XAMA 4AN3A 3H9OA 3U6JA 4ID7A 3MN3A 4J97A 1FQ1B 4IIRA 3LAUA 4WT6A 1L3RE 4EEVA 2VUWA 3TV4A 3FZOA 4DH3A 2GNGA 4IVAA 4EHEA 3C0GA 3AC2A 3QUPA 3NYVA 3OEFX 4XG7A 4H39A 3CJGA 2HWOA 1KWPA 2Y0AA 2W1FA 4A4XA 3D15A 5BX0A 2JBOA 5B7VA 4ZSGA 4MBJA 4BKJA 3OWKA 3M1SA 4XP0A 4I5PA 4JRNA 2OFVA 3SW4A 4EK3A 4I4FA 5AIRA 3O50A 2PZYA 1UV5A 2WEVA 2XJ0A 4FL2A 4XS2A 3FBVA 1Z57A 3PPZA 5DWRA 4DLIA 5LWMA 3GI3A 3RALA 2ESMA 3F82A 4XX9A 3LFDA 4FEQA 5FBNC 5KNJA 2C4GA 3CBLA 4HVIA 2HELA 2ONLC 4G6OA 2F9GA 4HZSA 3BV2A 3DK3A 3VULA 4F6WA 1DAWA 2W99B 5LOHA 1IASA 3UQGA 3V5TA 4BTJA 4YJSA 4BICA 4CTBA 1K9AA 4YTFA 4O0XA 5AR8A 4UX9A 3W0MA 5IQEA 2YIWA 4KIQA 4TWCA 4C02A 1NVSA 3VS0A 4CGAA 4ZAUA 1OL5A 4O82A 4EOSA 3W16A 4IB5A 3GU5A 4OTGA 3D7ZA 3LW0A 5E8SA 5KZIA 5HU9A 3O96A 5FEEA 2FSTX 3W2CA 3W8LA 3WF9A 1QPCA 2ITPA 4ZTMA 3WE8A 4ANMA 4MNFA 3L8XA 4AX8A 3C5UA 1CTPE 3UPZA 2HIWA 4BYJA 1OKZA 1JPAA 3CS9A 3SW7A 3NX8A 1OI9A 1Z9XA 3OG7A 3GCPA 4AA4A 4QP6A 4ZLZA 4XHKB 1PXIA 5LVMA 5CX9A 4WNKA 4EOLA 3HDNA 3Q4TA 1J1BA 4J96A 4ZOGA 3R04A 4B7TA 3UMXA 4KS7A 3Q6UA 4RVMA 5J95A 2ETMA 2VTNA 3ODYX 4DEIA 2WMBA 4FSNA 5BMSA 4J95A 3FZ1A 1JSUA 3ML1A 3V51A 4QYFA 1FINA 1UNHA 3L8PA 3R22A 4R3CA 3JR1A 4EYMA 5JT2A 3FWQA 4GSBA 1YXTA 3P9JA 3UC3A 5M56A 4EOOA 4Z7HA 4JMQA 3EFJA 4X3JA 3R83A 4G5PA 3P7BA 3ACKA 5M53A 3O71A 3UTOA 2ZMCA 4GT3A 1XMMA 3ANRA 4JBVA 3F2AA 5E8VA 2PZPA 4F9YA 3LMIA 4RX5A 5AUVA 3LXLA 3P23A 2WTWA 3MVJA 3QZGA 4FF8A 4HGEA 2WQEA 1UNGA 2X2KA 3F69A 4E4LA 5KE0A 3K54A 2BFYA 1OPKA 4YBJA 4U7ZA 4ZS0A 3TNPC 2BCJA 3IOKA 4XEYA 2BFXA 3TXOA 3ZSIA 3SVVA 2JIVA 4D2WA 2WKMA 3F3TA 2WTJA 3EKNA 4WNPA 4YZBA 3P4KA 4RJ8A 4FIIA 3WIKA 4LUDA 1JBPE 4XCUA 2ZM1A 2R7IA 4BTKA 2Y6MA 4HPUE 3RGFA 4F0GA 3PXFA 2JBPA 1RQQA 3MDYA 1LEZA 5EW9A 5CU3A 2VO6A 4MKCA 3IO7A 3ZEWA 4C8BA 2IZRA 2XNEA 5EW3A 4E5AX 4J52A 1S9JA 5IPJA 3U6IA 2UVYA 1FVTA 3EN9A 4XV2A 4FUXA 3BU6A 1HCLA 2YFXA 3PXRA 3QRTA 4PMTA 1URWA 1F3MC 1IAJA 4G5JA 4S33A 2G1TA 4EOQA 4M66A 3MI9A 4BTFA 3GOPA 4O4CA 1PF8A 3TNIA 3C1XA 5E7RA 3W0PA 3UODA 2UVZA 2ITTA 3O17A 1OIYA 2YM3A 3S4QA 4LMNA 2YCFA 2QLUA 3GC7A 4NK9A 4F65A 3VQHA 3F3VA 4FV3A 5AFVA 4DINA 3SX9A 5AWMA 3PPKA 1PMVA 4GFGA 4YO6A 1KOAA 3F9NA 3AD4A 1H08A 3CD8A 4L01A 3QWKA 2E9NA 4TYEA 5HI2A 5T3QA 2J5FA 3UDBA 4A7CA 5FTGA 1R1WA 3P1AA 2FUMA 4JT3A 3R7GA 4IVCA 5HVYA 4OAVB 3UQFA 1PW2A 3E3PA 4LDTA 4GG7A 2WQOA 4IW0A 5IISA 2Z7LA 3CPBA 2IW9A 3RPRA 5LXMA 4TWOA 1M2PA 4AGDA 4AAYA 3BL7A 2Z02A 2J90A 2J5EA 2JDOA 4HVHA 4HCUA 4MD9E 4V04A 1M2QA 1W2DA 3HV3A 3GNIB 4IWQA 3U8WA 2V5QA 4WG5A 1YXXA 4FSWA 3V8WA 4B8LA 1Q3DA 5AR7A 5HNIX 4DN5A 1ND4A 3V5PA 2CHLA 4PX6A 3C51A 4W4YA 1JKLA 5D7AA 4WG4A 4C62A 1H25A 3A7GA 1P2AA 2V55A 3AOXA 1A9UA 3R1YA 5CASA 4RFYA 4C3PA 3R2YA 4HYUA 1ZMWA 2VAGA 1Q24A 3QRUA 4MXCA 5JQ5A 1OUYA 3BLRA 3RMFA 1J91A 3OCTA 4O4EA 2UZWE 4AZWA 2ZFYA 4O27B 4JQ8A 3QTZA 3PJCA 4MQ1A 3UDSA 1YDTE 2WD1A 3ZRMA 5HE3A 3DBDA 4EH9A 1YOJA 2PVLA 3Q53A 4IZ7A 4YMJA 2C47A 4C4GA 4BCJA 4IANA 4YHTA 2ITQA 3LXNA 3VUMA 2C69A 2O0UA 4O7RA 3I5NA 4RC2A 3TNQB 2OIQA 2QOLA 3HA6A 3IGGA 1FGIA 3LXPA 1JAMA 4IADA 5AAEA 4FZAB 2XBJA 4FIEA 4G31A 3FMMA 4JDIA 4XV1A 5AUWA 3RKBA 1OL7A 4I92A 2BZIB 3R7EA 3ZFYA 5I4NA 4MD7E 2I0EA 2VTQA 1H01A 4L00A 2O8YA 3TUBA 3A8WA 1XJDA 4MBLA 3RK5A 4F1OA 4K18A 2YDKA 1GIJA 3OWPA 3PSBA 2Z8CA 4YJOA 1J3HA 1SMHA 5M4FA 4YLJA 5T68A 2OSCA 2A98A 3HL7A 1OVEA 1ZYJA 2O2UA 1IA8A 4AU8A 2VTRA 2QO9A 4Q2AA 2XEYA 5H9BA 1OL6A 3CY2A 4KBKA 4FG7A 1ERKA 5DT3A 1WVYA 5BQ0A 5IQGA 2DYLA 4UMPA 2YLEA 3Q52A 3MJ1A 4JRVA 2ZJWA 3DOGA 2H34A 5DMZA 4H58A 4O96A 5CVFA 4EC8A 2OFUA 1Q8WA 3PPJA 3ZC6A 4YZDA 3W18A 5IQBA 3C0IA 3B8RA 4X2GA 5HLPA 3NUYA </