5ETIA

Structure of dead kinase mapk14
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVRKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structure of dead kinase MAPK14
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 355
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etiA01
4X3FA 4O0VA 3NYNA 2W1IA 3R9NA 4PTCA 3PP1A 1AQ1A 3B2TA 4Y83A 3H4JA 3UMXA 3LCDA 4X2NA 3SDJA 5HVKA 1H28A 3WARA 4G3DA 3A4PA 1Y57A 3FXWA 4ZZOA 2V22A 3AC4A 3HX4A 1CMKE 3AGMA 2VU3A 3RMFA 3K3IA 2CGXA 4CV8A 1WFCA 4UMTA 4IZ5A 3LCKA 2C0TA 3MA6A 4DLIA 3PIXA 4FZFB 2X7FA 2B9HA 3A2CA 3HP2A 3CTJA 5B2KA 1UU7A 1RDQE 5CU2A 4ANOA 5DMZA 2O2UA 4IWDA 2Y6MA 4I21A 2BRMA 3PVGA 1VZOA 3BPRA 4QTDA 1ZAOA 3T3VA 3UOHA 3QXPA 5JFWA 4RWKA 2ITWA 2FH9A 1OVEA 2WTKC 3RI1A 4GUEA 3RTPA 4RVKA 1F3MC 5EQEA 3KULB 1STCE 1OZ1A 1UKHA 4CLJA 5DNRA 3PY1A 1SVHA 4QP9A 2QNJA 4M7IA 1ZXEA 3ZXZA 4F9YA 2XM9A 1P5EA 2OG8A 4L45A 4BKYA 3FBVA 5D12A 2VD5A 3NVKI 3DV3A 2UZEA 3CBLA 5HIEA 4FT7A 5KHWA 1SMHA 4E6DA 2C6OA 1M2QA 2PVFA 4KABA 3DNEA 2C5YA 4XEYA 3ZFMA 5CAUA 4BCQA 5L2IA 4KWPA 3QCXA 3CTHA 4O0YA 4O84A 3SC1A 3K5VA 3HMOA 4R3PA 4DG0E 3Q9WA 3FQSA 5C8KA 3ENMA 4KBCA 3QF9A 2WMSA 5HU3A 4E7WA 4S32A 4FMQA 3V01A 5LVOA 4FT9A 4IWPA 3HMMA 4FL1A 2H9VA 3OEZA 3OROA 3C50A 4MBLA 4IH8A 3UZPA 3VBQA 4DT8A 2YISA 4UALA 4XV2A 1J3HA 3KF4A 3TV7A 2CN8A 4O86A 3H0ZA 3HV3A 5AIKA 1UWJA 4BCHA 2XKFA 3NX8A 4D4RA 1DAYA 2C68A 5H8EA 1FMOE 4FKPA 5E8UA 2XBJA 3TIZA 3NUPA 4AWIA 4CGAA 5IQDA 1JQHA 2B4SB 4FSWA 3UOKA 2YZAA 3MW1A 4YO4A 5IUIA 4UB7A 4V04A 2C6KA 3D5UA 3IK3A 3P86A 4TT7A 3SA0A 1BI8A 3DJ7A 3OHTA 4EQUA 4AUAA 4EZ3A 1M17A 3PYYA 4QPSA 3FMKA 4AT3A 3WF9A 3E8NA 4OBOA 3LFEA 4FK3A 1DI8A 4ACDA 3CGFA 4BCIA 4HGSA 3KXMA 3LFFA 3QC9A 5E8VA 2I7QA 4YTHA 4EYMA 3DK7A 4F65A 2WTWA 4FTNA 3VN9A 3R8LA 5J87A 5KBRA 4DBNA 4ACMA 4BVUA 2OO8X 2BZIB 4A07A 2GS2A 3LCSA 4M13A 4NFMA 4AFEA 2JKQA 5AR4A 3Q52A 5BYZA 3O23A 4BCKA 3UODA 3JR1A 2VTJA 3TNQB 3IW4A 3DOGA 4J95A 4I23A 1XBCA 1OM1A 4ERWA 3BYVA 1G3NA 1U46A 5LCKA 4GYIA 4E4MA 5IEXA 2OH0E 5K5XA 3COKA 3VUDA 2J50A 4DTAA 4FV4A 3PPKA 3MWUA 4YZDA 4CMUA 5BVNA 4ZSEA 3D94A 5E1EA 3DKOA 4G34A 3QD2B 3QHWA 4RJ8A 4WA9A 3QTUA 3IDBA 3S4QA 4E5BA 1L8TA 4IAZA 2J90A 1NXKA 2W99B 4I1ZA 5DR9A 4TWOA 2WMBA 1Q8TA 4DH1A 2LAVA 5EDQA 2W0JA 3LW0A 4O22A 3SRVB 5DPVA 3GQLA 4EUUA 1DS5A 1ZMUA 3R2BA 1ZWSA 2B7AA 5FP6A 3I81A 4MQ1A 3OF0A 4F9AA 4Z55A 4F6UA 1H08A 4J8MA 4JX7A 1NVSA 4A4XA 4AN2A 4JVGA 5J7BA 4XG3A 5BVWA 2C5VA 4JT3A 3EQFA 2YABA 5AA8A 4FIGA 3I60A 3QU0A 4ANSA 4USEA 4XG4A 3K54A 2PVNA 1M7QA 4ITHA 4ZLZA 3VS7A 5JQ5A 4X3FC 5E92A 2GQRA 1J7UA 4I6QA 3EN9A 4JQ8A 2C3JA 4GCJA 4X2FA 4ORKA 4FL2A 3HLLA 2BRGA 1REKA 4IW0A 4BHZA 3WZEA 3UG1A 4DFLA 4BFMA 4NM3A 4M69A 3IOPA 3ZEPA 3TTIA 5M44A 1OGUA 2DYLA 4GU9A 2IVTA 3MFTA 3QTSA 4YHTA 4FR4A 3KB7A 3U51A 4FGRA 2IWIA 3GUBA 4UMUA 3AMAA 1YXXA 4NK9A 3A7FA 5ANOA 5F95A 3DDQA 1U5QA 2XIYA 4L6QA 4Y46A 5DGZA 5K9IA 3BHVA 2QODA 3NW5A 1ZYLA 4BHNA 2PPQA 4AA0A 4N6YA 4Y72A 3R7EA 3QZIA 3R1QA 1UNHA 4YUQA 1XHAA 4YPSA 3I5NA 3E8DA 4YHFA 2A19B 1YW2A 2QHMA 3ERKA 3KEXA 3MIAA 4RRVA 4P5QA 2QG5A 4PV0A 1ZYSA 5KMIA 1W0XC 2OBJA 3FLYA 5DIAA 3UOJA 3PJ1A 3LFQA 3ZBXA 1WVWA 1QCFA 4TN6A 4I3ZA 1OB3A 2CPKE 1BI7A 1PXPA 4IJ9A 3VVHA 4DEHA 3W55A 2FYSA 4CV9A 5HCYA 3DJ5A 3ATSA 1UV5A 4TWPA 4FV7A 4EWHA 1XQZA 3E8EA 2YA9A 4G6LA 4FYOA 3O8UA 2WTDA 5C8NA 4M68A 3GC9A 2VTSA 1H1SA 5TOZA 5JQ8A 2R3OA 3NCZA 4TYGA 2IG7A 4BR3A 3FI2A 4JG8A 2OU7A 3PZHA 1YDSE 4FSYA 3DS6A 4KB8A 2YDIA 4X3FB 5FWKK 3DZQA 4GIHA 3EFJA 2VTRA 2I0VA 3IQ7A 5D10A 4Q2AA 2PHKA 3OP5A 1CDKA 4CSVA 2IZRA 2X2KA 4RJ6A 4WG3A 3QRJA 2IW9A 5F94A 4TYHA 3I6UA 3N4TA 2DS1A 4FV5A 2BRHA 4YTFA 4UX9A 5I9UA 4ZTMA 1QPCA 2JDVA 2BDWA 4XV3A 4F9WA 4HYIA 4HNFA 3KXGA 3KL8A 5EW9A 5M4FA 4UZDA 5EOBA 3PP0A 2YWVA 1MP8A 3MB6A 3RJCA 3G15A 4QO9A 5JMSA 4C61A 3VQUA 4BGQA 4ERKA 4C36A 2BAJA 1OKZA 3W2RA 4PQNA 3QWKA 1XBAA 3MPMA 4RX8A 4RVMA 4A9UA 1WBPA 4V0GA 3UC3A 4F9CA 5CAQA 1Q8YA 3V5JA 4RMZA 1Q99A 1JVPP 2JDOA 3OMVA 3FSFA 1R39A 4RWJA 2WELA 5CEIA 4GMYA 3UPXA 5IQIA 1WZYA 5E8YA 3QGWA 4OTFA 3LJ2A 4AFJA 4DAWA 4PMSA 4O6EA 4OTDA 3WF7A 2CLXA 4RIOA 3MTLA 2XJ1A 2VO0A 4YLKA 2XK7A 4QOXA 5F1ZA 2PUIA 3BV3A 5DWRA 3IECA 4IB0A 3QRIA 3W2PA 4EOQA 2R3KA 3HGKA 3R9OA 4EOPA 1E9HA 4CFFA 3HA8A 5LWMA 4KIKA 2WIPA 3M1SA 4AGCA 4KBKA 4BBFA 3W8LA 4CVAA 3V3VA 3IDPA 3RPSA 3TKIA 5IUHA 4XRJA 3LXKA 3R7GA 4FV6A 2JGZA 5CWZA 4EKKA 1H26A 4DTKA 4E6AA 4IAFA 2NO3A 3GGFA 4UWBA 3KKVA 4NM7A 3CTQA 2NRYA 2X8EA 3HA6A 2BPMA 4IB3A 2QOQA 2FVDA 3RAWA 2QC6A 4Y73A 3F69A 1PY5A 1UKIA 2XRUA 4MBIA 4K1BA 3OTVA 1XH6A 3A62A 5KCVA 4NM5A 4ENYA 5M07A 2XYUA 5CXHA 4X21A 5D9HA 2YJRA 2GPHA 3QRUA 3RK7A 3ZO2A 3BEAA 3LAUA 4R5YA 5A54A 5CEMA 2NNWB 2QO2A 4IVAA 3FY2A 4IIRA 3VBTA 2PVYA 3ALNA 4WSYA 1YI6A 2LGCA 5AUWA 4L46A 5IEVA 2BMCA 2R3QA 2YDJA 5J1WA 5E1SA 4F7SA 2C1BA 3NYVA 3WZJA 4FZDB 3UO6A 3SGCA 3KMWA 2CLQA 4GSBA 3H9OA 3FLZA 5E8SA 4PDOA 4FEXA 3RAIA 3LFBA 2O3PA 4M15A 4FC0A 3PY3A 5HI2A 4D4SA 1OIYA 5IA1A 2CKOA 4EH7A 5HIDA 3MS9A 2XCKA 3CY3A 5E8WA 5IPJA 5DA3A 2R5TA 3IPHA 3LMIA 4XYFA 4FV0A 4C4GA 2ERKA 1BYGA 4HGTA 4PTEA 2WMVA 3GC7A 3ORTA 4MWIA 4PWNA 4WOVA 3SOAA 4NL0A 3D5VA 4H36A 4RFYA 4BKJA 4UYNA 2UVZA 4I93A 2XNBA 3PY0A 2A0CX 4O96A 5HG8A 3Q96A 1WBTA 2E9UA 2W1DA 2WGJA 3ZHPC 4IWQA 4J53A 4K11A 2QOBA 2AC3A 3D15A 1LEWA 3ROCA 3DFCB 3W2OA 2YIYA 4L7FA 1ZY5A 3E7OA 1GZ8A 2B52A 5HORA 4O81A 4YJRA 2GCDA 1YWVA 3TEIA 5A14A 1JWHA 2YCSA 3D5WA 3RALA 4N6ZA 4NCTC 2R3JA 4HNIA 5AP7A 4CZYB 4RC4A 3I7CA 4AF3A 4YZCA 3OEFX 5A9UA 4G3EA 2O64A 2UZTA 2JAMA 4H39A 5JZNA 3TTJA 4DEDA 5IQHA 4FEQA 4F7LA 2ZB0A 2XH5A 2QOHA 1V0BA 2V0DA 3NW6A 3O8TA 4PPAA 4QMSA 2ITYA 3QZGA 3BI6A 4TY1A 3FI4A 4XP2A 3FZTA 4XP0A 2WIHA 3ODZX 4KKGA 3FEGA 3LZBA 3RGFA 3BQCA 5J95A 2VTIA 2RKUA 3VUIA 4CT1A 3G9NA 3COHA 5LVNA 1BKXA 3POZA 1SVGA 3UBDA 2QO9A 3ZLYA 2OJJA 4GFMA 4M69B 4FEVA 3POOA 4ENXA 4TRLA 4TPTA 2X7OA 4CG8A 3PWYA 4O0RA 2WB8A 2X6DA 3BGPA 3KN6A 3D7ZA 2EXCX 4G6OA 3VUTA 3PVBA 3UNKA 1PMUA 4FZ7A 5TO8A 4WD5A 1JOWB 3F61A 2V5QA 4I0SA 1SVEA 4FTKA 5ANEA 4BB4A 4XV9A 5IH4A 3PE1A 4ZTSA 2O5KA 5J5TA 5JGDA 4RX5A 2W1CA 2C5XA 3FZ1A 4U45A 4ZOGA 4C38A 3M11A 2QHNA 3RAKA 5JKGA 2RIOA 5EHOA 3UJGA 1M2PA 3UNZA 4MD9E 3W8QA 4C3FA 3SG9A 4U42A 5BX0A 3GI3A 2OIBA 3K2LA 2C1AA 4M84A 4MH7A 3MI9A 4GT3A 4CQGA 2XB7A 3TCPA 4S34A 3WE4A 4AX8A 4EWQA 4QP2A 2ETKA 2Z7QA 4JXFA 3EIDA 2E9PA 4K18A 1R1WA 1UVRA 4FOCA 4NEUA 5HLPA 4MNEA 5A4CA 5I9XA 3PIZA 5CVFA 3RZBA 3U9CA 3PDTA 5K4IA 3AD4A 3WOWA 4I6HA 2E9VA 4GL9A 5CU0A 2Y6OA 5EDPA 3UO5A 5L8KA 3G51A 4BCFA 3WF8A 3A7HA 3WZKA 4ZSAA 3EN7A 5BUJA 5KX8A 4ANBA 3MY1A 5K0XA 4EHVA 4C02A 3C5IA 3FDNA 4TYHB 4IHPA 5TF9A 4EEVA 2PMOX 4O7YA 4CXAA 3IOKA 3TDWA 2IJMA 1QMZA 2PWLA 4NH1A 2W1FA 3MVJA 5FG8A 4DHFA 3R8PA 3QGYA 5AAEA 5JFXA 2HELA 1OECA 1WMKA 4PPBA 5ANGA 1URCA 4JG7A 4ZZNA 5KBQA 2QOOA 5A4QA 2C30A 4QP1A 2YHVA 3EQHA 4FZAB 4X0MA 3TG1A 1DM2A 2OLCA 2PL0A 1P4OA 3SXFA 3NAYA 1I44A 3QQLA 1HOWA 2B1PA 4V0GB 4RIWA 3RZFA 3FQHA 4RJ4A 2WMRA 3AT3A 2VN9A 4DFXE 2C6EA 2HY81 3VBVA 3RAHA 4NUSA 1IEPA 4RWLA 3LM5A 2F9GA 2VTPA 2CJMA 4YTIA 3PJ3A 1ZZ2A 3Q4CA 4JR7A 4CMTA 4BTJA 3RHKA 3CD3A 3ORKA 5EKOA 3AD6A 2ZM1A 3DGKA 4D9TA 3R8ZA 4FTQA 5EKNA 4YZNA 2W1ZA 5HTIA 3GU4A 2JFLA 2ETRA 1PW2A 2R3NA 3G2FA 3Q9ZA 3BLHA 3G6HA 5EI8A 3MFUA 5F9EA 5ICPA 4L44A 3HUBA 3TUBA 3CY2A 2OK1A 4PL4A 3ITZA 2W5AA 3BGZA 4KIKB 3W2CA 2BKKA 3ZRLA 2QKRA 3R22A 4AZFA 4BICA 1UU8A 3EN5A 3IW6A 2JKKA 1YVJA 5GZ9A 3LLTA 4BBEA 2Z8CA 4F0GA 5AR8A 4L3LA 4AU8A 3FHIA 2Z7LA 2UW9A 4UBAA 4L43A 5CEOA 5AV0A 4OAUC 4DLJA 4YZBA 1W84A 4B99A 2UW7A 3ORXA 3AC3A 2JLDA 5FXSA 3GCSA 4RFZA 4OBPA 1DI9A 5AR3A 3THBA 2P33A 5JFVA 3MY5A 4ALWA 2BUJA 5EYKA 4ZIMA 3ORIA 4EH6A 1BLXA 4EH9A 4O1OA 5FP5A 1AGWA 4EH3A 3PZEA 5HCZA 3I0OA 4KKEA 1Q24A 4IZAA 5GINE 5CF4A 3FC2A 1ZYJA 3VUKA 2OXDA 2WOTA 3L9LA 4Q5EA 2VTHA 5GZAA 2XEYA 3EFKA 5EOLA 2ETMA 4L68A 2YFXA 4FTCA 2ERZE 2X81A 1G8SA 4FTIA 3E7VA 2BAQA 3RBWA 3OT8A 3DXQA 4XS2A 1R0PA 4G5JA 4IAIA 3DTWA 5TE0A 5A46A 5M4UA 4FSZA 2VO7A 5JT2A 5E8TA 5KZ0A 2NPQA 3P7BA 2WKMA 1FOTA 3KRXA 2B9JA 3EHAA 3CKWA 4LI5A 3U4UA 4F70A 4JDHA 4JL9A 4C3PA 2RFNA 5I0BA 5HLNA 1SYKA 3EQRA 4R3RA 4WG5A 1APME 3TNPC 5M51A 3KCKA 1E1VA 1PJKA 2XCHA 2X2LA 2CGVA 4IJPA 1ZMVA 1H0WA 1JSTA 5BYYA 4PY1A 5DFPA 5CSXA 2UUEA 3PFQA 4BCNA 2CKQA 4YBKA 2A2AA 4IX6A 4B9DA 4C57A 4BDKA 1W83A 2ZJWA 2HYYA 1ZRZA 2H6DA 3JY9A 2W1EA 3NEWA 3TNHA 5ACBC 4YHJA 5FGKA 3VS2A 3GEQA 1OUKA 3SVVA 3F3UA 4YJPA 3NYXA 3R6XA 4UMPA 3L8VA 4H1JA 4AOTA 4W4VA 3NR9A 5LQFA 2YJSA 4O7LA 3KN5A 4W4XA 4TWCA 3HMIA 2GMXA 3C4ZA 3U9NA 1A9UA 3Q4ZA 4O7NA 4HYHA 4FSUA 5H3QA 3BLQA 4DFZE 5L3AA 4RVLA 2C3IB 4O6LA 4W4YA 4EC8A 1P4FA 2B54A 4MD8E 2VWXA 4OTRA 4XOYA 4HGLA 2ZMDA 4HVDA 3W33A 4AZEA 1NVQA 1XR1A 2GFCA 4LYNA 2BILB 2UW6A 4C0TA 2P55A 5BYLA 2H8HA 4G17A 2VTNA 5LVLA 3SG8A 2WMQA 4QMMA 5IF1A 4QT1A 3T8OA 4EYJA 3GU7A 3QL8A 4Y85A 1ZLTA 4F6WA 1Y91A 3P79A 5I9WA 3NW7A 5DLSA 3FKOA 2YAKA 4TNDA 2J9MA 4YGAA 2WMAA 4UWCA 3DBEA 4F64A 4P5ZA 2GNFA 3GB2A 5GNKA 3TIYA 1GOLA 3EYGA 3CQUA 2BIYA 3NWWA 3PJCA 1P2AA 3V5LA 5LMKA 3HV5A 3BE9A 3R0TA 2XIXA 1J1BA 4HZRA 4BDIA 4F1TA 4ID7A 3T3UA 3EFWA 4ITIA 2OJIA 3UQFA 4ZSJA 5HBJA 4FTUA 4Y5QA 5ETCA 4FV1A 2V7OA 5C1QB 1M2RA 3HAMA 4QQJA 1J7IA 5ANKA 4IVDA 4C4JA 4XJ0A 3R8VA 3EL7A 2BROA 4HVIA 4U44A 2XVDA 4XNEA 4MNEB 3W2SA 4LOQA 5J5SA 3U87A 4JQ7A 5HKMA 4IANA 3P23A 1GY3A 3H3CA 2HXQA 5H8GA 3OVVA 3BBTB 1KE5A 5CI6A 3UVQA 1ZOGA 3W2QA 3R2YA 4J1RA 4ZTLA 3QD0A 2JKMA 4J99A 5L8JA 4ZY4A 5L2WA 1DAWA 2B53A 4BDFA 3OWJA 4YBJA 2XNOA 3DK3A 3O17A 2C6DA 4LGGA 2OW3A 1KUTA 3IKAA 3IGGA 4U3YA 4X7QA 3NMUF 3GVUA 3QALE 4AN9A 1W98A 4C34A 3F5GA 3G0FA 5CVGA 2XF0A 3PXYA 5T3QA 3ZRKA 4D2VA 5KMKA 2IZSA 2W4JA 3QYZA 2BTRA 5EDRA 2QU5A 3DQXA 5DI1A 5HNGA 3PIYA 3QKLA 4BF2A 3F2AA 3OWLA 3C7QA 4RIWB 3ET7A 2WMTA 2ITQA 4RLLA 5BPYA 3P1AA 4XG9A 3WZUA 4FTTA 1PYEA 2CN5A 2C6IA 2VWVA 3MY0A 3R28A 2CGWA 1YOJA 2PMLX 3G6GA 3U8WA 5IA5A 3OG7A 5CXZA 4RX9A 5L2SA 3F7WA 3VWAA 1B39A 3R04A 5CT7A 2UVYA 4IVCA 2EB2A 3GFEA 5EW3A 3MGYA 2XUUA 5DEYA 5G1XA 3OW4A 4ANNA 4CMOA 2OIQA 3LMGA 3L8XA 3FPQA 5JSMA 4FIHA 3B2WA 4LUDA 4EZ5A 4I94A 1H00A 2C5OA 4KNBA 4KIQA 4ASZA 3V5PA 4CZUA 4JNWA 3SQQA 3VQHA 2Q83A 3MJ1A 3UOLA 3CGOA 3QTXA 2C3LA 4EOIA 3P08A 5FBNC 2REIA 4P7EA 2QD9A 4O82A 3DXPA 3AC1A 3VJNA 5AA9A 2GNHA 3BIZA 3HP5A 4YJSA 1Z9XA 4IC8A 2Y7JA 3TZ8A 2IN6A 5KMLA 4BI1A 4FV2A 3N9XA 3FL4A 2WTIA 1LP4A 4XH6A 4RA4A 2B9FA 1TVOA 3COIA 2C6MA 2XK4A 4EC9A 1G8AA 5CX9A 2OKRA 4HVSA 4I5MA 5K0KA 3KK9A 4O0XA 4ANQA 2OI4X 5D1JA 3TN8A 4U9AA 1HCKA 2YWPA 4A7CA 5CVHA 5J9YA 4FE2A 2QOFA 3NLBA 3V6SA 2XYNA 4APPA 1W82A 1O6KA 2QOIA 2B0QA 2XK9A 5CQWA 2VNWA 3HAVA 1GZKA 1U4DA 4YJQA 1ZOEA 4G16A 4QMWA 3V8SA 4QMLA 3DBQA 4DG3E 4F7JA 2PZ5A 3TV6A 2HZ0A 4O7VA 3O51A 5M06A 2YLFA 1FVTA 4QMVA 2XEZA 3FSKA 4YU2A 3OCSA 4APCA 3MH0A 2XKDA 4CNHA 4LRKA 2WQBA 4EHEA 3NYOA 3BX5A 4U40A 3LKMA 3Q3BA 3UQGA 1IRKA 3F5UA 5KE0A 3UC4A 2X4ZA 3SV0A 5LVMA 3JY0A 1J7LA 1TQIA 5LXMA 4JOAA 4MF1A 4PMTA 4U81A 5M53A 2WOUA 5AV1A 3RVGA 3TKUA 3R7VA 5CS6A 2X8DA 4E26A 5AUTA 2ZV2A 4ALVA 2IVUA 5I9ZA 1QPEA 1R78A 4CYJA 5J8IA 2BDJA 4IQ6A 3TZMA 1RJBA 3VS5A 4E93A 2BDFA 3KMMA 3KXNA 4JX3A 5HTCA 3JS2A 3D14A 4D0WA 4IWOA 4G1WA 4LRMA 3NNVA 2VAGA 4ZAUA 4ITJA 2FA2A 4QMNA 4TL0A 5FLFA 3DKGA 2JC6A 1YXUA 4AGWA 3PXZA 4FT3A 4O21A 2OZAA 2VUWA 2HENA 4QPMA 3F5XA 3LFSA 4I5CA 2XM8A 4FTMA 2OSCA 4OTQA 5ETIA 3VRZA 4BGHA 4LRJA 4CZTA 4DC2A 5LARA 4MXXA 2YZLA 3AT2A 3VHKA 1FVRA 2F57A 1XO2B 3MH3A 5DYJA 3G33A 4GFOA 4Q5HA 5I4NA 2RFEA 4YURA 3FZOA 4PMMA 4U79A 3R1SA 4PRJA 4UXLA 4DEIA 3R00A 4GK2A 3VW6A 5FD2A 3E3PA 3MVMA 4I5HA 4YJTA 3E64A 5DBXA 1NY3A 1SM2A 4RX7A 4GV1A 2W5HA 4FT0A 4C8BA 3QA0A 4RZWA 5CENA 3U6JA 4FKVA 4H3BA 4OT6A 3ZYAA 2A1AB 4XP3A 1IA8A 3DNDA 2WU6A 3V8TA 2P2IA 2WMWA 2X9FA 4IAYA 5AP5A 3WE8A 3ZFXA 4DN5A 2CNUA 5A6NA 4DGMA 3EKKA 3E92A 2WAJA 3VHEA 4N0SA 4NWMA 5AP4A 4BTMA 3OOMA 1H1RA 2SRCA 2G9XA 4O2ZA 3LVPA 3KQ7A 3P5KA 1GIHA 3PRIA 4IC7A 3AMYA 4PP7A 4CRLA 1OKVA 4Q9SA 2C0IA 1FPUA 3H30A 4O0TA 5AX3A 3TV4A 3MFRA 4EONA 4EH8A 1IAJA 3ODYX 4NM0A 3RNYA 2BRBA 5M56A 5AX9A 3NNWA 3A7JA 5AP3A 1G5SA 4OUCA 2QLUA 3VUGA 3FY0A 1T46A 4GK3A 1IR3A 3F3VA 3NUXA 3VBWA 4IZ7A 2JDSA 3PSBA 3R02A 2QURA 4LV5A 1I09A 4DGGA 2ZAZA 2WU7A 3MIYA 3ORZA 3F3ZA 3CR0A 4E4LA 3DAJA 1Y8YA 4F9BA 3EQCA 1JBPE 5E90A 4DGLC 4OR5A 3PUPA 1W7HA 4FKGA 4UZHA 4DH8A 2YIRA 2F4JA 3BYOA 3DPKA 4OTPA 4C59A 3ZRMA 4EOKA 3DK6A 3UQCA 3ZTXA 2UZLA 4O7ZA 2OXXA 4I24A 2F2CB 3ALOA 5FUTA 4ZTRA 5A3XA 3FE3A 2GSFA 3ZZWA 4IZYA 5AP0A 4YJVA 2CHLA 4W8DA 3AOXA 2EB3A 1JNKA 2VGOA 3NGAA 1Q8WA 2EXMA 2PTKA 1YHVA 3T9IA 5K4JA 4ZLOA 4ZK5A 3NUUA 4IX5A 2ITPA 3F7ZA 3O7LB 4KINA 5F20A 4BDAA 4UMRA 3TUCA 2Z7RA 5B2MA 4CFNA 1YHSA 3ORNA 4FK6A 3EKNA 5A4LA 3MJ2A 3HDNA 4ZEGA 4U5JA 5JFSA 4RVTA 4TTHB 5LOHA 3QQUA 5IQFA 3QZFA 2YIXA 4QTAA 2C4GA 4U0IA 5CU4A 5K3YA 4TYIA 4FNXA 2R0IA 4I4EA 4E20A 2JFMA 5DT4A 3VUHA 4L3JA 5EI6A 3EJ1A 5EM7A 4C4EA 2PMIA 3ORLA 1QL6A 4RGJA 3WYYA 4YC3A 2UW0A 4XX9A 1U54B 4EI4A 3C0HA 3ZSHA 4QP4A 4E4NA 3NZ0A 4ONAA 2JDRA 4KSPA 3F5PA 1OL5A 2WD1A 3PA3A 3LQ5A 1MRUA 4G31A 4I20A 4I92A 4QP7A 5ETAA 5LWNA 4C35A 4GKIA 2BCJA 3KRRA 4WNOA 3SLSA 2QG7A 2R0UA 4XLVA 4QMUA 2PZRA 5HNIX 4PL3A 3BU3A 3DZOA 2DWBA 2YM7A 4J7BA 5CLPA 5LJJA 2J0IA 3SHEA 4DE4A 3UO4A 3R8MA 2ONLA 2OZOA 3IO7A 4FSTA 4X2JA 2YERA 2QLQA 4FOBA 4Y8DA 2F7XE 4I0TA 5KMOA 5EH0A 2GQSA 1B6CB 5CANA 1VEBA 1WBOA 5CZHA 5CI7A 4YJNA 4EK8A 4R5SA 4AA5A 5JGAA 4B8LA 4HVHA 4BYJA 5C01A 4HOKA 4IDVA 4BI0A 2CNQA 3RCJA 4BGGA 3PLSA 1GZOA 2EU9A 4FV8A 1QPDA 1CM8A 2OGVA 5TKDA 2R2PA 2G1TA 2PULA 4YC6A 5AJQA 4MNFA 4MAOA 3LFAA 3MPAA 2JKOA 5ACKA 2OJFE 3QUPA 3RKBA 4BRXA 3U6HA 4FKSA 1ATPE 2R3LA 1KWPA 2VX0A 4G5PA 4LOOA 4X2GA 3DFAA 5ANJA 3ZFYA 4BDJA 4EK6A 3QKKA 2W1HA 4RIYA 3SKCA 4FNYA 2OF4A 4CFUA 3ZLXA 4PNIA 3VIDA 3F2NA 2R3HA 3IONA 4BTKA 4ACCA 4IBMA 4R7IA 4TXCA 2OJ9A 4EOMA 2O63A 3OCTA 2VWZA 4L3PA 3DLSA 3FYKX 5IQEA 5J1VA 1PXIA 3QAME 2BFXA 2YCFA 5AWMA 4QP6A 3H9FA 2G01A 4AP7A 3KMUA 3MESA 1H1WA 3FLQA 3R9RA 3FHRA 3UZRA 1H07A 4C33A 3CKXA 4MYGA 3V04A 2Y8OA 1YOMA 3DB8A 2PVMA 4ZTQA 3G90X 3HYHA 3KY2A 4BDHA 3RWPA 4PDSA 1GIJA 1Z5MA 2XIZA 3ACJA 3C0IA 3H9RA 3GU5A 5M4IA 3A7IA 5AM7A 1H1QA 3O50A 4BDBA 1JKSA 3NAXA 3G9LX 4E73A 2XK8A 3ORPA 4LM5A 1PXKA 5EYMA 1RE8A 3AQVA 4O91A 2BTSA 4KRCA 4C3RA 4D1ZA 5L6WL 5J9LA 5FEDA 2ITXA 4HCUA 2FGIA 3SW7A 2FSLX 3PXFA 5H8BA 4R8QA 4R1VA 2WEVA 3ULZA 3EQBA 2FUMA 3BRBA 4JLCA 4ZTHA 4NKSA 4J97A 5LVPA 2BKZA 5H2UA 2QVSE 2IW6A 3MSSA 4MWHA 2BRNA 3RP9A 1OUYA 3O96A 4S2ZA 3SX9A 1JAMA 3HUCA 2X2MA 3Q4UA 5AR7A 4FV3A 1UA2A 3QQFA 4AZSA 4CCUA 2OZAB 3BCEA 4JRVA 1A48A 1OBDA 2RSVA 2UZOA 4MTAA 4QP8A 1ZY4A 3BYUA 4LMNA 4FEUA 2GNLA 4FNWA 2FSTX 4AGUA 1TKIA 2GS7A 2I1MA 4F99A 4WT6A 2BIKB 5AUXA 4IACA 4M8TA 4A9TA 5I3RA 4CKIA 4F0IA 4GKHA 4GG5A 5AUVA 1OL7A 4A9YA 3KF7A 4D28A 4EUTA 4WIHA 3KVXA 2PUPA 4ZLYA 3MH2A 3ZMMA 3QD3A 3UZTA 3PJ2A 1KOBA 2UZBA 4FKTA 4IX4A 1AD5A 1XH9A 3ETAA 2VV9A 4RIXA 5L6OA 3LQ8A 4KRDA 3LXPA 4FIIA 1ZOHA 4D2SA 4R78A 4X6RA 1ZYCA 1BUHA 1XKKA 4HCTA 5CNNA 4D5HA 3LCOA 3KK8A 4ANMA 1M7NA 4FYNA 5DVRA 3VW8A 4NTTA 4RFMA 5IKWA 1YRPA 2O65A 4UYAA 4D1XA 5CEKA 3GOPA 5CTPA 4KBAA 1CSNA 2QONA 1LUFA 1WBWA 5AUZA 5CF6A 5HBEA 1PKDA 4XG2A 4AGDA 4G9RA 3Q6UA 2UW8A 3OTUA 3AC5A 2RGPA 2GS6A 1M52A 2WEIA 2Y0AA 3S0OA 4AZVA 5AAGA 4EK3A 5IUGA 3ID6C 4C58A 4FBXA 1Q8UA 1KE7A 2IO6A 2J0JA 4TWNA 3ZLSA 4JBOA 4F0FA 5EQYA 3OCGA 3AD5A 1KE9A 2UZWE 3UP7A 4GT4A 1WAKA 5HD4A 3R21A 3LIJA 3ZUUA 3NIEA 4FA2A 3QRTA 5L4QA 4L01A 1CKIA 3QTZA 3LHJA 2ONLC 2XNNA 3C4EA 4IM2A 3PXQA 2KULA 3DQWA 4ZJJA 3HEGA 3VF8A 1VYWA 5I5ZA 3FXXA 4O83A 1OITA 2BAKA 5IA3A 2R3GA 2XJ2A 2PE1A 1IAHA 2Q0NA 2XS0A 2VTOA 2W7XA 3S1HA 1XJDA 3NVMB 3D7TA 3CQWA 5JZJA 5DG5A 1JLUE 5EI2A 5GZ8A 2V55A 3QCQA 4QYEA 2WQEA 2YM6A 2WTJA 2GFSA 5HG5A 4B0GA 3F88A 4U3ZA 4C37A 1W8CA 3QQGA 2YEXA 4RJ3A 2PZYA 4CG9A 3S3IA 5ANIA 5DOSA 2WFYA 4WNKA 4RSSA 2Y4IB 4C4HA 4HW7A 2P4IA 3IDCA 3OZ6A 4YSJA 2WTCA 4ANLA 5M57A 3R9HA 2NP8A 4BI2A 3ELJA 5FTGA 1JSVA 5IZFA 5DE2A 2JDTA 2XIRA 3E63A 2X7GA 2PU8A 4MKCA 2WHBA 3ZO4A 5B0XA 5KNJA 3UG2A 4MEDA 4RPVA 3HDMA 3D2KA 4S33A 4O7SA 5L8LA 3ACKA 3E8CA 3RK5A 1OPKA 4QTBA 5CSHA 3ATTA 4CCBA 2P3GX 4F63A 5DR2A 4FZ6A 4J71A 5LCJA 2VO3A 4BN1A 4DH7A 4B4LA 1R0EA 3V6RA 4BY9E 3EFLA 2BHEA 3GENA 1F0QA 3L9MA 4H3PA 3ZBFA 4AW2A 4BDEA 3VBYA 3VS1A 4IFGA 3QCYA 5HLWA 4AS0A 2XNGA 4FKJA 3E93A 2CKEA 5HE3A 3PG3A 2E9NA 2HY0A 4MCVA 2B9IA 1H25A 3DAEA 4GS6A 3RPRA 3WI6A 1FQ1B 4EJNA 3I6WA 4CKJA 3UGCA 5HE2A 4EOSA 3ANRA 3DU8A 1KOAA 3QX4A 5AR2A 4W8EA 4D2WA 3RM6A 3FLWA 3HV7A 3H0YA 5BUEA 3KRJA 3LE6A 4YC8A 4N70A 2KTYA 3CEKA 1Y6AA 4DEGA 4NT4A 2WTVA 4W9WA 2BHHA 4FTRA 4X2KA 3TXOA 4DFYA 3O0GA 3LJ1A 2CNVA 3EZVA 5FEEA 2FSMX 4KUJA 5HBHA 1JPAA 2R4BA 4AA4A 3A7GA 3UYSA 4RC3A 3MDYA 4JDKA 1UU9A 4MXZA 4MF0A 3L9PA 3E3BX 3MVHA 3OUKA 3U54A 4OTHA 4QMOA 4HZSA 3OOGA 4WKQA 3JVSA 5BMMA 4WBOA 4FSQA 1URWA 4KIPA 4AZTA 3D5XA 3OWKA 3CD8A 2VZ6A 4YLJA 3HMPA 3GBZA 4RIYB 5DH3A 3UVRA 4IEBA 4D9UA 3RPOA 4GVAA 3BHHA 1OL2A 3DDPA 3R1YA 5EYCA 3FPMA 3ZM4A 5CASA 5JRQA 3LFNA 3TT0A 3HRCA 3ZXTA 1YWRA 2QU6A 4M66A 4FG9A 3UTOA 4FNZA 4ASDA 3PLAE 2BALA 2PMNX 3GCVA 3GCUA 2R7BA 3HRBA 3LJ0A 2VNYA 3IS5A 4GYGA 1KV2A 2I40A 2EUFB 2QKWB 3C51A 5CAPA 1V0PA 3V51A 3GXLA 3HV6A 1H8FA 1ZYDA 2ZV7A 3LFCA 3VF9A 4O0UA 2YAAA 2JIIA 3TUDA 2XK3A 3P78A 3WF6A 1K2PA 4N4SA 3KXXA 2RF9A 1MRVA 3OBJA 5CQUA 3KVWA 2HXLA 4N57A 3EQDA 3BELA 4BC6A 4EQCA 3LLAA 5BUIA 3AMBA 3SD0A 3ZUVA 4CRSA 2QOLA 3Q4TA 5A6OA 3ROYA 4MBJA 2W1GA 5KKRB 4GW8A 2OXYA 3FLSA 1YDTE 5GIPE 4WUAA 2Z60A 4FKIA 3LOKA 4PP9A 4KSQA 2GHMA 3D9VA 1WVYA 3GFWA 4YSMA 2PVRA 3CPCA 3L9NA 1PXLA 3F6XA 3QCSA 3QTQA 3LPBA 4TYJA 4XBRA 3DY7A 5HO6A 4LQMA 2UW3A 2YN8A 4IMYA 5AUUA 3M2WA 5BVOA 4QP3A 5AUYA 5KMNA 1FINA 3FKLA 2JIUA 4LUEA 5GJDA 5CALA 4EOLA 4FSNA 3DB6A 2GU8A 3NIZA 2PVKA 4A9RA 3V5QA 3COMA 5HD7A 3ZOSA 3ZC5A 3I5ZA 2F2UA 4IAKA 4M0YA 1OPJA 3BQRA 3GU8A 5DRBA 4JI9A 3RNIA 5CF5A 3ZO1A 3BHUA 3VS3A 5HZNA 4L53A 4KS8A 4RIXB 2WQMA 1O6YA 2BZKB 3FV8A 3ORMA 2GNGA 4YTCA 2CCHA 3TNWA 4WHZA 1WBVA 2PUUA 5F4NA 5M09A 4F7NA 4ZTNA 4AT5A 5JN2A 4LV8A 2YLEA 4LGHA 3HMNA 5GJGA 4C4FA 1ZZLA 4JRNA 1OIRA 4MD7E 4QYGA 2VWUA 3FMNA 3GC8A 4YPDA 5FTQA 2X4FA 3PVWA 5GHVA 4AN3A 3CC6A 3MH1A 5DT3A 1Q61A 2OICA 2W05A 4ASXA 2IZUA 3EQPA 1RW8A 2YCQA 1IG1A 3R7OA 5C4KA 1O6LA 3ZC6A 5AAFA 3QZHA 4GG7A 4H05A 5G6VA 4QMQA 3ZO3A 2JIVA 4FICA 4BWKA 3RPYA 4K77A 3UPZA 4EHZA 1OPLA 2I0EA 2ZDTA 1F5QA 4QRCA 4K9YA 3C4XA 1WBSA 4GK4A 4IADA 4JBPA 3UIUA 1CTPE 2PY3A 4XV1A 4RBLA 5HX8A 1Q97A 1Q4LA 2QR7A 1WVXA 4GH2A 4Z3VA 5A4TA 5H9BA 5HOAA 3CPBA 3HKOA 4NIFA 1NW1A 3DBFA 3R1NA 4FIJA 5L6PA 4HGEA 3D7TB 1A06A 2RG5A 5CY3A 1NVRA 1YWNA 4JQEA 2RFDA 4IE9A 5HG7A 2PE2A 3R63A 3BLRA 4BZOA 4DA5A 1UWHA 5AADA 3HVCA 3Q60A 5KZIA 4PTGA 4QQCA 3HL7A 1J1CA 2ZM3A 4EOOA 1GJOA 1U54A 3W16A 1MQ4A 4UEUA 4UY9A 1JKTA 4FKRA 1BL7A 1IASA 3L1SA 3KC3A 4QMYA 4Y5HA 3PPZA 5HEZA 4B7TA 4IM0A 3CXWA 5E4HA 5FQDC 2X8IA 2Z7SA 5HESA 4ZXTA 2R3RA 3A60A 2R9SA 2XNMA 2R7IA 4ZZMA 1IA9A 4P4CA 4P2KA 4EKLA 3BGQA 4QQTA 3TI1A 3SXSA 3A99A 5IQGA 2VTMA 4YJUA 4TKSA 1UNGA 4NW6A 3B8RA 4OAVB 3QLFA 5IMXA 3IW7A 4FTLA 3MYGA 3PE2A 4G3GA 4ARKA 4W4WA 4Z16A 3K5UA 4WG4A 3BYSA 3BZ3A 2UZNA 4MXOA 4M14A 3KA0A 3PXKA 2XKEA 3UNJA 4RQVA 3R7IA 1V0OA 1E1XA 4XHKB 1Y6BA 2PVHA 3DAKA 2WZJA 5FBOA 4QNAA 2ZM4A 2XIKA 3C1XA 3FAAA 3OWPA 4DITA 2ITNA 4FUXA 3BHYA 2C0OA 3ZEWA 1H0VA 1Q62A 3NUAA 4WNPA 4YNEA 5HQ0A 5J79A 2QI8A 4IB5A 3LCTA 3CSVA 1PRYA 1B38A 1YI3A 1P14A 3BHTA 4ZJIA 2I0YA 4NYEA 4LMUA 1PXOA 1XH8A 2XKCA 3QFVA 3C4CA 4GJ3A 4YP8A 4A4LA 4IDTA 3DTCA 3EWHA 2Y4PA 5EHLA 2R3MA 2BZJA 3PA5A 3S95A 3WBLA 2FB8A 1YXSA 2R3FA 3P7AA 4F6SA 2YIQA 2X6EA 4DF3A 4FVRA 4AW0A 5C8MA 1S9IA 2WTKB 4BBMA 2OFUA 3DJ6A 4FTJA 4GIIA 3II5A 3QWJA 3FLNC 4I4FA 3RWQA 4I6BA 4GUBA 4HPUE 4OT5A 1FVVA 5HO7A 4GT5A 2R64A 4H58A 3FC1X 4QMXA 3JVRA 3C0GA 3I79A 1OKYA 5AP2A 2ZV8A 1Q8ZA 2I6LA 4XUFA 4WNMA 5DHJA 4YO6A 1UNLA 2R3IA 4L67A 5EK7A 3W10A 2V7AA 4TYEA 4RC2A 5LMKC 2W4KA 2OFVA 4WBBB 3DCVA 1LEZA 3EH9A 5HHWA 4E6CA 5IDNA 4XRLA 1XBBA 5AEPA 3T9TA 4BCMA 4R7BA 4JDIA 3I7BA 4IX3A 5HE0A 3L8SA 2YCRA 5HCXA 4RWIA 5M55A 5CU6A 4U97A 5D7VA 3E62A 3TM0A 5IQCA 1K3AA 3JPVA 2QOKA 1LPUA 5FEQA 5EQPA 5BVFA 2BR1A 2XMYA 3D83A 2R3PA 4CFXA 3OY1A 2XNPA 1OL6A 3UIBA 1ERKA 4EHGA 2CDZA 4FT5A 3WILA 1PMVA 3QUDA 1BL6A 4D2TA 1GAGA 4K6ZA 1REJA 1NA7A 4NW5A 4U41A 3QXOA 1K9AA 3L8PA 5EFQA 3NS9A 4FTAA 4R77A 4IM3A 4LOPA 3ZCLA 3LXNA 3TJDA 3HV4A 3Q2JA 1PXJA 3FMMA 4R7HA 5FDPA 3V5WA 4FL3A 4PX6A 3VAPA 3W1FA 4C2WA 4DYMA 2RFSA 2G2HA 3U55A 2BFYA 4JG6A 3Q9XA 2GHLA 4QD6A 4WSQA 5IA2A 2P2HA 3QQJA 1GNGA 2X1NA 5HVYA 4A4OA 1OKWA 3QQHA 4I6FA 4UWYA 2WQNA 2QO7A 4UMQA 3CS9A 3OCBA 4BL1A 2HZIA 5C27A 4FVQA 4IVBA 5E8XA 3VS4A 2J6MA 4KAOA 2G2IA 4LL0A 3ZSGA 3F3WA 4RG0A 2ZV9A 2WNTA 4FKUA 3WYXA 2VRXA 5IG1A 4H1MA 5EM8A 4OGRA 3BWFA 5A4EA 2AC5A 3AT4A 2JBPA 3ZUTA 3FUPA 3VNTA 3VS0A 4CQEA 4QYHA 4DBXA 2EXEA 3H10A 3BWJA 2E2BA 3NNXA 5JRSA 4K33A 2C5NA 2PK9A 1MRYA 5LMBA 4XG7A 1GZNA 2CSNA 4FVPA 4NFNA 4V01A 4LGDA 3Q5IA 4F1OA 1H27A 2V62A 4FKQA 5CEQA 4CD0A 2UZDA 1VYZA 4D4VA 5IH6A 4O7TA 2YM3A 4RJ5A 4TW9A 4NCTA 4DTBA 5JK3A 4GJ2A 5ETFA 3OT3A 4L8MA 4NSTA 2IVSA 4AW1A 3GOKA 3PJ8A 4MHAA 5EHYA 5KMJA 4EJ7A 5BVKA 3F3TA 4BKZA 1SZMA 4UXQA 2W96B 3BKBA 2UW4A 2CGUA 4ACHA 3OUNB 5IH5A 3MB7A 2E9OA 2JEDA 2WPAA 4A9SA 5AV3A 3SOCA 2VO6A 5IDPA 1LR4A 2XNEA 3F9NA 4CTCA 4S31A 3HZTA 3VBXA 4U80A 2F7ZE 4BIBA 4DFBA 2PE0A 2XBAA 4F09A 3LQ3A 1YDRE 5FRIA 5HVJA 5GIOE 5C9CA 4NIFB 3FMDA 3C4FA 2YITA 3AC2A 3EOCA 4CFWA 3BV2A 4HPTE 4AT4A 3P4KA 3GNIB 2IVVA 3KREA 1UU3A 3SAYA 4CTBA 4L00A 2VWWA 4W9XA 3UIXA 4BCJA 4DFUA 5E9EA 2ACXA 2W17A 4EBWA 3FWQA 4XBUA 3ENHA 3PTGA 2Q0BA 2YM4A 2C6TA 4IFCA 5IEYA 4GU6A 4AXAA 3N51A 4Z7HA 5KO1A 3FMHA 4FTOA 2F49A 2VX3A 4FG7A 4EK5A 4BDDA 2A27A 3MA3A 3EB0A 4K8AA 3KRWA 1X8BA 3Q32A 5HNBA 3U4WA 4FKOA 4K0YA 3FZRA 3DT1A 4WRGA 5AIRA 4ZS0A 2GNJA 4BDGA 3O8PA 1WCCA 3KCFA 5IA4A 1J91A 3WIKA 4BDCA 4EK4A 3GCQA 2WXVA 3O2MA 4Q9ZA 5CYIA 4YMJA 1PXMA 4IXPA 4ZY6A 2GQGA 5IMEA 2G2FA 4KS7A 3QA8A 1PKGA 3BYMA 3ZDIA 2HW6A 4PDYA 3I1AA 3AXWA 5DN3A 4FKLA 4C4IA 4E3CA 3E87A 1H01A 1YHWA 2O0UA 3MTFA 4CLIA 5BVDA 2YACA 3BU6A 3KXZA 4FGBA 4FIFA 4EBVA 5EM5A 2NRUA 2ZOQA 5C03A 5HX6A 5HGIA 2A4LA 2B55A 2BVAA 4Z9LA 3TKHA 4DCEA 3DKCA 4PDPA 3TZ9A 4JBQA 4BTFA 2O8YA 5L2QA 3VULA 2ESMA 4MXAA 1U59A 4NU1A 3UVPA 5TT7A 4RA5A 3UDBA 4C62A 2IW8A 3NPCA 4BWXA 1XH4A 3I0QA 4ZSLA 2Z2WA 2GTMA 3MPTA 3OXTA 4M12A 3TL8A 3Q2MA 2EVAA 3ZONA 1R3CA 3S2PA 3D0EA 3GCPA 3GQIA 2J5FA 1H4LA 4H3QA 5FTOA 2VWYA 4KA3A 5D7AA 5B2LA 4C7TA 4G3CA 2ZDUA 4USFA 5J7HA 4M67A 4D58A 2JITA 5C4LA 4ZS4A 4EOJA 4LL5A 5KUPA 1S9JA 3ZDUA 2FO0A 4TZRA 4XG6A 3ZM9A 1BX6A 3IW8A 3K3JA 3PPJA 4WUNA 5DEWA 4BCOA 2DUVA 3WZDA 3R7YA 5CU3A 3MN3A 1VR2A 1JKLA 2W4OA 2XK6A 3QUEA 5FM2A 4A06A 2OJGA 3P0MA 2VWIA 4D55A 4D5KA 1PMNA 2VTQA 4YZ9A 4YNOA 5I9VA 3V5TA 2ZVAA 4DH3A 4EL9A 3PWDA 4ZSGA 5HG9A 4U43A 3ZS5A 1YQJA 4O0WA 1CKPA 2PSQA 4DEAA 2VGPA 4FI1A 3UIMA 2YM5A 1XWSA 4FF8A 5CSVA 3Q04A 2BZHB 4ALUA 3BBWA 4DH5A 4CT2A 4HCVA 4WRSA 4I0RA 1T45A 4O1PA 2GDOA 4F4PA 4DINA 2J0KA 4QMTA 5CAVA 1YXTA 3FMJA 3TWJA 3QC4A 3HRFA 4B6LA 4ZJVA 3EL8A 4R1YA 4S30A 3LM0A 2J7TA 3QTRA 4YJOA 4AZWA 4CFMA 2HZ4A 4D4YA 4MQ2A 4AQCA 4FIEA 2UVXA 2X0GA 3FJQE 4AE9A 1TQPA 1FMKA 4P90A 4JBVA 5D41A 2QQ7A 4EH4A 4FSRA 3UE4A 1Z57A 3N4UA 1MUOA 4PL5A 5HIBA 4QNYA 4RT7A 4U6RA 1WBNA 3GT8A 1Q41A 4XMOA 3EYHA 3R73A 4YZMA 3RINA 3R7UA 3CLYA 3C9WA 3UYTA 2Z02A 1MQBA 5EYDA 5L2TA 3NUSA 1SNUA 4BYIA 3R71A 4HYSA 4II5A 3CJGA 4DT9A 2X9EA 2FSOX 5T68A 4DCAA 1VJYA 1PMEA 3WF5A 3OY3A 2VX1A 5FXQA 3OBGA 3S00A 2ITTA 2Y4IC 3OXZA 4I5PA 4QMPA 3D2IA 1XH7A 4M3QA 4F1MA 2OIDA 1Q3WA 4F08A 3TDVA 2VTAA 3FMEA 4QMZA 3ZH8A 4QQ5A 5BVEA 3Q9YA 4ACGA 2ZYBA 3QKMA 2PUNA 2ITOA 5FDXA 4O2PA 3DKFA 4BZDA 2ZMCA 3FQEA 2C6LA 1FGKA 3NSZA 3OD6X 2W9ZB 3P9JA 1ND4A 3B8QA 4AE6A 4B8MA 5JEBA 2W5BA 2YDKA 1PF8A 4RLKA 4JDJA 4CEGA 3IW5A 3FZPA 5HU9A 2ITVA 4Y95A 5HICA 5IU2A 3Q6WA 4BZNA 3JXWA 5KHXA 3TZ7A 4GVJA 3FI8A 3MFSA 3NNUA 3CJFA 2GHGA 3OXIA 1TQMA 3QD4A 3SXRA 3W32A 3EN6A 1OI9A 3RM7A 3RHXA 4I41A 3JYAA 2H34A 3EQIA 3MBLA 5AM6A 3F2RA 2YM8A 3E88A 3KXHA 3F66A 2X39A 3NCGA 3UMWA 3BE2A 5M4CA 4DEBA 3PG1A 4QPAA 1O9UA 5IISA 2XP2A 3FYJX 3FZSA 2HCKA 2XJ0A 3ZLWA 4L9IA 2VWBA 4AOIA 4ZMFA 5ANDA 4FSMA 3FI3A 4USDA 1FGIA 2I0HA 3P7CA 5FXRA 1FBNA 5AP6A 3VO3A 5AMNA 4ASEA 5BQ0A 3O7LD 5CSWA 1H1PA 4E6QA 5IQAA 4AW5A 4FODA 2HOGA 3FXZA 2EWAA 3ULIA 2HZNA 1PHKA 3CIKA 3C4WA 3KULA 1OMWA 4L42A 5AV2A 3CQEA 5BNJA 2HAKA 3IG7A 1KE6A 3QX2A 2RL5A 5DT0A 4OTWA 1NT2A 3VUMA 2WQOA 3AG9A 3PA4A 2W06A 4K2RA 4NTSA 4QTEA 3O71A 4U7ZA 3SW4A 4J98A 2Y9QA 5CF8A 3RPVA 1PXNA 5HE1A 3EMGA 2PZIA 2WMXA 3M42A 5E8ZA 3EZRA 4IB1A 4L52A 5EW8A 2OWBA 5IA0A 4MK0A 4EORA 1ZARA 4JR3A 4AAAA 2F7EE 2QR8A 3QBNA 4I22A 5DR6A 4ZY5A 5ITAA 5TR6A 2XA4A 3MV5A 3DLZA 1SNXA 4OLIA 2UV2A 4GEOA 3ZSIA 4D1SA 4ZMEA 2DQ7X 4EZ7A 2RG6A 3VC4A 4V05A 5B7VA 3QQKA 4HYUA 4M0ZA 4UV0A 1QPJA 4FG8A 3TNIA 3NRMA 2CMWA 4PUZA 5EG3A 4E4XA 4M97A 5I9YA 3PVUA 2HWOA 3EQGA 5KKRC 3C13A 4JIAA 5HO8A 1OIUA 2IZTA 4AACA 2UZUE 3QHRA 4NKAA 1EH4A 4QYYA 3LXLA 3QTWA 2OH4A 1Q3DA 4MXCA 3C5UA 4G9CA 5GJFA 1KE8A 2J0MB 3FMLA 4PMPA 3G0EA 4E5WA 1CKJA 3OS3A 3NUNA 4OTIA 5K5NA 3EN4A 5CT0A 4MVFA 3QRKA 4GFGA 3MVLA 5AP1A 4EQMA 3BU5A 3FKNA 3VS6A 4AOJA 4UN0C 3KU2A 2WO6A 2XZSA 2C47A 5CSPA 5JH6A 2C69A 2HWPA 1KV1A 2CCIA 2HK5A 3PXRA 4O38A 5M08A 2H96A 3OFMA 2AYPA 5CZIA 2JD5A 2PVJA 3I4BA 4D2RA 1XH5A 4EH5A 4WO5A 3BEGA 3IGOA 1YI4A 2J0LA 3KFAA 4HJOA 2GNIA 4X6QC 4PPCA 5CAOA 4RQKA 3NDMA 3TACA 4KD1A 4O7WA 4BCGA 1M14A 4OTGA 5AR5A 2J2IB 3W18A 2PYWA 4O7RA 4J96A 3CCNA 2YIWA 4ZP5A 4DFNA 3FL5A 2P0CA 3REPA 5DRDA 3DBDA 4E1ZA 4R3CA 4BIDA 2UW5A 2HW7A 3PSCA 5J9ZA 4U8ZA 4DG2E 4GRBA 4CYIA 4XCUA 1YOLA 3A8WA 5AFVA 3RCDA 4BWPA 2JBOA 3Q5ZA 1HCLA 4CFVA 1JKKA 3SRVA 2QCSA 4IAAA 3ZZEA 5AV4A 5HTBA 4KKHA 4L7SA 1OBGA 2OF2A 3QYWA 3DXNA 2JAVA 1OL1A 4EH2A 3GU6A 2J5EA 4O27B 1GIIA 1Y8GA 4PF4A 4XOZA 4J52A 5EM6A 1RQQA 4DGOA 1YKRA 4Z7GA 2XRWA 3DA6A 4X3JA 3CE3A 1ZMWA 3KRLA 2QOCA 4RZVA 3A8XA 3D4QA 4G6NA 4KIOA 4FUYA 2CKPA 4D0XA 3QLGA 4BCPA 2PVLA 4MXYA 4OW8A 3R9DA 5CNOA 3PRFA 3PSDA 5KMMA 3NUYA 3HECA 4JAIA 2UZVA 5C26A 3CP9A 1U5RA 1BMKA 4QYFA 5D11A 4R6VA 4C2VA 3R30A 2ZB1A 4PNKA 4J8NA 5IQBA 4MX9A 3R01A 4JIKA 4CKRA 4RJ7A 4NZWB 5BMSA 1V1KA 4JS8A 4D2PA 3N4VA 4O0SA 1OIQA 3OC1A 4XG8A 4DGNA 2IPXA 3F82A 1KSWA 2GTNA 3JUHA 4XLIA 5E91A 4HVGA 4G2FA 3DBCA 4FX3A 3V8WA 4BIEA 3LMHA 1JSUA 5E7RA 2C3KA 3RK9A 3AGLA 3R8UA 4QTCA 5CEPA 1H24A 3A4OX 1YXVA 3E5AA 5FM3A 3QTIA 4DEEA 3AC8A 3OW3A 2G15A 5I3OA 3ZU7A 2J4ZA 4YR8A 3HNGA 1PYXA 3GP0A 3Q53A 4NJDA 4JJRA 2WMUA 3UP2A 2ITZA 4OBQA 4E5AX 2W9FB 1L3RE 3A61A 3ANQA 3R83A 3VJOA 3TJCA 4TNBA 3G5DA 4LFIA 3VRYA 2J51A 3U6IA 4YLLA 4AG8A 4NJ3A 4LG4A 4FEWA 3GC0A 3KGAA 4FKWA 3LFDA 5T6KA 2ITUA 4G3FA 2AUHA 5LMAA 4JAJA 5JGBA 4FV9A 3WIGA 2VTTA 2HIWA 2PZPA 1Q5KA 4E8AA 2VTLA
chains in the Genus database with same CATH superfamily
4X3FA 4O0VA 3NYNA 2W1IA 3R9NA 4PTCA 3PP1A 1AQ1A 3B2TA 4Y83A 3H4JA 3UMXA 3LCDA 4X2NA 3SDJA 5HVKA 1H28A 3WARA 4G3DA 3A4PA 1Y57A 3FXWA 4ZZOA 2V22A 3AC4A 3HX4A 1CMKE 3AGMA 2VU3A 3RMFA 3K3IA 2CGXA 4CV8A 1WFCA 4UMTA 4IZ5A 3LCKA 2C0TA 3MA6A 4DLIA 3PIXA 4FZFB 2X7FA 2B9HA 3A2CA 3HP2A 3CTJA 5B2KA 1TZDA 1UU7A 1RDQE 5CU2A 3TMOA 4ANOA 5DMZA 2O2UA 4IWDA 2Y6MA 4I21A 2BRMA 3PVGA 1VZOA 3BPRA 2IF8A 4QTDA 1ZAOA 3T3VA 3UOHA 3QXPA 5JFWA 4RWKA 2ITWA 2FH9A 1OVEA 2WTKC 3RI1A 4GUEA 3RTPA 4RVKA 1F3MC 5EQEA 3KULB 1STCE 1OZ1A 1UKHA 4CLJA 5DNRA 3PY1A 1SVHA 4QP9A 2QNJA 4M7IA 4AAYA 1ZXEA 3ZXZA 4F9YA 2XM9A 1P5EA 2OG8A 4L45A 4BKYA 3FBVA 5D12A 2VD5A 1VLRA 3DV3A 2UZEA 3NVKI 3CBLA 5HIEA 4FT7A 5KHWA 1SMHA 3ML1A 4E6DA 2C6OA 1M2QA 2PVFA 4KABA 3DNEA 2C5YA 4XEYA 3ZFMA 5CAUA 4BCQA 5L2IA 4KWPA 3QCXA 3CTHA 4O0YA 4O84A 3SC1A 3K5VA 3HMOA 4R3PA 4DG0E 3Q9WA 3FQSA 5C8KA 3ENMA 4KBCA 3QF9A 2WMSA 5HU3A 4E7WA 4S32A 4FMQA 3V01A 5LVOA 4FT9A 4IWPA 3HMMA 4FL1A 2H9VA 3OEZA 3OROA 3C50A 4MBLA 4IH8A 3UZPA 3VBQA 4DT8A 2YISA 4UALA 4XV2A 1J3HA 3KF4A 3TV7A 2CN8A 4O86A 3H0ZA 3HV3A 5AIKA 1UWJA 4BCHA 2XKFA 3NX8A 4D4RA 1DAYA 2C68A 5H8EA 1FMOE 4FKPA 5E8UA 2XBJA 3TIZA 3NUPA 4AWIA 4CGAA 5IQDA 1JQHA 2B4SB 4FSWA 3UOKA 2YZAA 3MW1A 4YO4A 5IUIA 4UB7A 4V04A 2C6KA 3D5UA 3IK3A 3P86A 4TT7A 3SA0A 1BI8A 3DJ7A 3OHTA 4EQUA 4AUAA 4EZ3A 1M17A 3PYYA 4QPSA 3FMKA 4AT3A 3WF9A 3E8NA 4OBOA 3LFEA 4FK3A 1DI8A 4ACDA 3CGFA 4BCIA 4HGSA 3KXMA 3LFFA 3QC9A 5E8VA 2I7QA 4YTHA 4EYMA 3DK7A 4F65A 2WTWA 4FTNA 3VN9A 3R8LA 5J87A 5KBRA 4DBNA 4ACMA 4BVUA 2OO8X 2BZIB 4A07A 2GS2A 3LCSA 4M13A 4NFMA 4AFEA 2JKQA 5AR4A 3Q52A 5BYZA 3O23A 4BCKA 3UODA 3JR1A 2VTJA 3TNQB 3IW4A 3DOGA 4J95A 4I23A 1XBCA 1OM1A 4ERWA 3BYVA 1G3NA 1U46A 5LCKA 4GYIA 4E4MA 5IEXA 2OH0E 5K5XA 3COKA 3VUDA 2J50A 4DTAA 4FV4A 3PPKA 3MWUA 4YZDA 4CMUA 5BVNA 4ZSEA 3D94A 5E1EA 3DKOA 4G34A 3QD2B 3QHWA 4RJ8A 4WA9A 3QTUA 3IDBA 3S4QA 4E5BA 1L8TA 4IAZA 2J90A 1NXKA 2W99B 4I1ZA 5DR9A 4TWOA 2WMBA 1Q8TA 4DH1A 2LAVA 5EDQA 2W0JA 3LW0A 4O22A 3SRVB 5DPVA 3GQLA 4EUUA 1DS5A 1ZMUA 3R2BA 1ZWSA 2B7AA 5FP6A 3I81A 4MQ1A 3OF0A 4F9AA 4Z55A 4F6UA 1H08A 4J8MA 4JX7A 1NVSA 4A4XA 4AN2A 4JVGA 5J7BA 4XG3A 5BVWA 2C5VA 4JT3A 3EQFA 2YABA 5AA8A 4FIGA 3AKKA 3I60A 3QU0A 4ANSA 4USEA 4XG4A 3K54A 2PVNA 1M7QA 4ITHA 4ZLZA 3VS7A 5JQ5A 4X3FC 5E92A 2GQRA 1J7UA 4I6QA 3EN9A 4JQ8A 2C3JA 4GCJA 4X2FA 4ORKA 4FL2A 3HLLA 2BRGA 1REKA 4IW0A 4BHZA 3WZEA 3UG1A 4DFLA 4BFMA 4NM3A 4M69A 3IOPA 3ZEPA 3TTIA 5M44A 1OGUA 2DYLA 4GU9A 2IVTA 3MFTA 3QTSA 4YHTA 4FR4A 3KB7A 3U51A 4FGRA 2IWIA 3GUBA 4UMUA 3AMAA 1YXXA 4NK9A 3A7FA 5ANOA 5F95A 3DDQA 1U5QA 2XIYA 4L6QA 4Y46A 5DGZA 5K9IA 3BHVA 2QODA 3NW5A 1ZYLA 4BHNA 2PPQA 4AA0A 4N6YA 4Y72A 3R7EA 3QZIA 3R1QA 1UNHA 4YUQA 1XHAA 4YPSA 3I5NA 3E8DA 4YHFA 2A19B 1YW2A 2QHMA 3ERKA 3KEXA 3MIAA 4RRVA 4P5QA 2QG5A 4PV0A 1ZYSA 5KMIA 1W0XC 2OBJA 3FLYA 5DIAA 3UOJA 3PJ1A 3LFQA 3ZBXA 1WVWA 1QCFA 4TN6A 4I3ZA 1OB3A 2CPKE 1BI7A 1PXPA 4IJ9A 3VVHA 4DEHA 3W55A 2FYSA 4CV9A 5HCYA 3DJ5A 3ATSA 1UV5A 4TWPA 4FV7A 4EWHA 1XQZA 4I6LA 3E8EA 2YA9A 4G6LA 3O5AA 4FYOA 3O8UA 4QDVA 2WTDA 5C8NA 4M68A 3GC9A 2VTSA 1H1SA 5TOZA 5JQ8A 2R3OA 3NCZA 4TYGA 2IG7A 4BR3A 3FI2A 4JG8A 2OU7A 3PZHA 1YDSE 4FSYA 3DS6A 4KB8A 2YDIA 4X3FB 5FWKK 3DZQA 4GIHA 3EFJA 2VTRA 2I0VA 3IQ7A 5D10A 4Q2AA 2PHKA 3OP5A 1CDKA 4CSVA 2IZRA 2X2KA 4RJ6A 4WG3A 3QRJA 2IW9A 5F94A 4TYHA 3I6UA 3N4TA 2DS1A 4FV5A 2BRHA 4YTFA 4UX9A 5I9UA 4ZTMA 1QPCA 2JDVA 2BDWA 4XV3A 4F9WA 4HYIA 4HNFA 3KXGA 3KL8A 5EW9A 5M4FA 4UZDA 5EOBA 3PP0A 2YWVA 1MP8A 3MB6A 3RJCA 3G15A 4QO9A 5JMSA 1TFFA 4C61A 3VQUA 4BGQA 4ERKA 4C36A 2BAJA 1OKZA 3W2RA 4PQNA 3QWKA 1XBAA 3MPMA 4RX8A 4RVMA 4A9UA 1WBPA 4V0GA 3UC3A 4F9CA 5CAQA 1Q8YA 3V5JA 4RMZA 1Q99A 1JVPP 2JDOA 3OMVA 3FSFA 1R39A 4RWJA 2WELA 5CEIA 4GMYA 3UPXA 5IQIA 1WZYA 5E8YA 3QGWA 4OTFA 3LJ2A 4AFJA 4DAWA 4PMSA 4O6EA 4OTDA 3WF7A 2CLXA 4RIOA 3MTLA 2XJ1A 2VO0A 4YLKA 2XK7A 4QOXA 5F1ZA 2PUIA 3BV3A 5DWRA 3IECA 4IB0A 3QRIA 3W2PA 4EOQA 2R3KA 3HGKA 3R9OA 4EOPA 1E9HA 4CFFA 3HA8A 2NYAA 5LWMA 4KIKA 2WIPA 3M1SA 4AGCA 4QEBA 4KBKA 4BBFA 3W8LA 4CVAA 3V3VA 3IDPA 3RPSA 3TKIA 5IUHA 4XRJA 3LXKA 3R7GA 4FV6A 2JGZA 5CWZA 4EKKA 1H26A 4DTKA 4E6AA 4IAFA 2NO3A 3GGFA 4UWBA 3KKVA 4NM7A 3CTQA 2NRYA 2X8EA 3HA6A 2BPMA 4IB3A 2QOQA 2FVDA 3RAWA 2QC6A 4Y73A 3F69A 1PY5A 1UKIA 2XRUA 4MBIA 4K1BA 3OTVA 1XH6A 3A62A 5KCVA 4NM5A 4ENYA 5M07A 2XYUA 5CXHA 4X21A 5D9HA 2YJRA 2GPHA 3QRUA 3RK7A 3ZO2A 3BEAA 3LAUA 4R5YA 5A54A 5CEMA 2NNWB 2QO2A 4IVAA 3FY2A 4IIRA 3VBTA 2PVYA 3ALNA 4WSYA 1YI6A 2LGCA 5AUWA 4L46A 5IEVA 2BMCA 2R3QA 2YDJA 5J1WA 5E1SA 4F7SA 2C1BA 3NYVA 3WZJA 4FZDB 3UO6A 3SGCA 3KMWA 2CLQA 4GSBA 3H9OA 3FLZA 5E8SA 4PDOA 4FEXA 3RAIA 3LFBA 2O3PA 4M15A 4FC0A 3PY3A 5HI2A 4D4SA 1OIYA 5IA1A 2CKOA 4EH7A 5HIDA 3MS9A 2XCKA 3CY3A 5E8WA 5IPJA 5DA3A 2R5TA 3IPHA 3LMIA 4XYFA 4FV0A 4C4GA 2ERKA 1BYGA 4HGTA 4PTEA 2WMVA 3GC7A 3ORTA 4MWIA 4PWNA 4WOVA 3SOAA 4NL0A 3D5VA 4H36A 4RFYA 4BKJA 4UYNA 2UVZA 4I93A 2XNBA 3PY0A 2A0CX 4O96A 5HG8A 3Q96A 1WBTA 2E9UA 2W1DA 2WGJA 3ZHPC 4IWQA 4J53A 4K11A 2QOBA 2AC3A 3D15A 1LEWA 3ROCA 3DFCB 3W2OA 2YIYA 4L7FA 1ZY5A 3E7OA 1GZ8A 2B52A 5HORA 4O81A 4YJRA 2GCDA 1YWVA 3TEIA 5A14A 1JWHA 2YCSA 3D5WA 3RALA 4N6ZA 4NCTC 2R3JA 4HNIA 5AP7A 4CZYB 4RC4A 3I7CA 4AF3A 4YZCA 3OEFX 5A9UA 4G3EA 2O64A 2UZTA 2JAMA 4H39A 5JZNA 3TTJA 4DEDA 5IQHA 4FEQA 4F7LA 2ZB0A 2XH5A 2QOHA 1V0BA 2V0DA 3NW6A 3O8TA 4PPAA 4QMSA 2ITYA 3QZGA 3BI6A 4TY1A 3FI4A 4XP2A 3FZTA 4XP0A 2WIHA 3ODZX 4KKGA 3FEGA 3LZBA 3RGFA 3BQCA 5J95A 2VTIA 2RKUA 3VUIA 4CT1A 3G9NA 3COHA 5LVNA 1BKXA 3POZA 1SVGA 3UBDA 2QO9A 3ZLYA 2OJJA 4GFMA 4M69B 4FEVA 3POOA 2XAMA 4ENXA 4TRLA 4TPTA 2X7OA 4CG8A 3PWYA 4O0RA 2WB8A 2X6DA 3BGPA 3KN6A 3D7ZA 2EXCX 4G6OA 3VUTA 3PVBA 3UNKA 1PMUA 4FZ7A 5TO8A 4WD5A 3NFGB 1JOWB 3F61A 2V5QA 4I0SA 1SVEA 4FTKA 5ANEA 4BB4A 4XV9A 5IH4A 3PE1A 4ZTSA 2O5KA 5J5TA 5JGDA 4RX5A 2W1CA 2C5XA 3FZ1A 4U45A 4ZOGA 4C38A 3M11A 2QHNA 3RAKA 5JKGA 2RIOA 5EHOA 3UJGA 1M2PA 3UNZA 4MD9E 3W8QA 4C3FA 3SG9A 4U42A 5BX0A 4O4DA 3GI3A 2OIBA 3K2LA 2C1AA 4M84A 4MH7A 3MI9A 4GT3A 4CQGA 2XB7A 3TCPA 4S34A 3WE4A 4AX8A 4EWQA 4F78A 4QP2A 2ETKA 2Z7QA 4JXFA 3EIDA 2E9PA 4K18A 1R1WA 1UVRA 4FOCA 4NEUA 5HLPA 4MNEA 5A4CA 5I9XA 3PIZA 5CVFA 3RZBA 3U9CA 3PDTA 5K4IA 3AD4A 3WOWA 4I6HA 3AKLA 2E9VA 4GL9A 5CU0A 2Y6OA 5EDPA 3UO5A 5L8KA 3G51A 4BCFA 3WF8A 3A7HA 3WZKA 4ZSAA 3EN7A 5BUJA 5KX8A 4ANBA 3MY1A 5K0XA 4EHVA 4C02A 3C5IA 3FDNA 4TYHB 4IHPA 5TF9A 4EEVA 2PMOX 4O7YA 4CXAA 3IOKA 3TDWA 2IJMA 1QMZA 2PWLA 4NH1A 2W1FA 3MVJA 5FG8A 4DHFA 3R8PA 3QGYA 5AAEA 5JFXA 2HELA 1OECA 1WMKA 4PPBA 5ANGA 1URCA 4JG7A 4ZZNA 5KBQA 2QOOA 5A4QA 2C30A 4QP1A 2YHVA 3EQHA 4FZAB 4X0MA 3TG1A 1DM2A 2OLCA 2PL0A 1P4OA 3SXFA 3NAYA 1I44A 3QQLA 1HOWA 3UDSA 2AQXA 2B1PA 4V0GB 4RIWA 3RZFA 3FQHA 4RJ4A 2WMRA 3AT3A 2VN9A 4DFXE 2C6EA 2HY81 3VBVA 3RAHA 4NUSA 1IEPA 4RWLA 3LM5A 2F9GA 2VTPA 2CJMA 4YTIA 3PJ3A 1ZZ2A 3Q4CA 4JR7A 4CMTA 4BTJA 4FRFA 3RHKA 3CD3A 3ORKA 5EKOA 3AD6A 2ZM1A 3DGKA 4D9TA 3R8ZA 4FTQA 5EKNA 4YZNA 2W1ZA 5HTIA 3GU4A 2JFLA 2ETRA 1PW2A 2R3NA 3G2FA 3Q9ZA 3BLHA 3G6HA 5EI8A 3MFUA 5F9EA 5ICPA 4L44A 3HUBA 3TUBA 3CY2A 2OK1A 4PL4A 3ITZA 2W5AA 3BGZA 4KIKB 3W2CA 2BKKA 3ZRLA 2QKRA 3R22A 4AZFA 4BICA 1UU8A 3EN5A 3IW6A 2JKKA 1YVJA 5GZ9A 3LLTA 4BBEA 2Z8CA 4F0GA 5AR8A 4L3LA 4AU8A 3FHIA 2Z7LA 2UW9A 4UBAA 4L43A 5CEOA 5AV0A 4OAUC 4DLJA 4YZBA 1W84A 4B99A 2UW7A 3ORXA 3AC3A 2JLDA 5FXSA 3GCSA 4RFZA 4OBPA 1DI9A 5AR3A 3THBA 2P33A 5JFVA 3MY5A 4ALWA 2BUJA 5EYKA 4ZIMA 3ORIA 4EH6A 1BLXA 4EH9A 4O1OA 5FP5A 1AGWA 4EH3A 3PZEA 5HCZA 3I0OA 4KKEA 1Q24A 4IZAA 5GINE 5CF4A 3FC2A 1ZYJA 3VUKA 2OXDA 2WOTA 3L9LA 4Q5EA 2VTHA 5GZAA 2XEYA 3EFKA 5EOLA 2ETMA 4L68A 2YFXA 4FTCA 2ERZE 2X81A 1G8SA 4FTIA 3E7VA 2BAQA 3RBWA 3OT8A 3DXQA 4XS2A 1R0PA 4G5JA 4IAIA 3DTWA 5TE0A 5A46A 5M4UA 4FSZA 2VO7A 5JT2A 5E8TA 5KZ0A 2NPQA 3P7BA 2WKMA 1G8JA 1FOTA 3KRXA 2B9JA 3EHAA 3CKWA 4LI5A 3U4UA 4F70A 4JDHA 4JL9A 4C3PA 2RFNA 5I0BA 5HLNA 1SYKA 3EQRA 4R3RA 4WG5A 1APME 3TNPC 5M51A 3KCKA 1E1VA 1PJKA 2XCHA 2X2LA 2CGVA 4IJPA 1ZMVA 1H0WA 1JSTA 5BYYA 4PY1A 5DFPA 5CSXA 2UUEA 3PFQA 4BCNA 2CKQA 4YBKA 2A2AA 4IX6A 4B9DA 4C57A 4BDKA 1W83A 2ZJWA 2HYYA 1ZRZA 2H6DA 3JY9A 2W1EA 3NEWA 3TNHA 5ACBC 4YHJA 5FGKA 3VS2A 3GEQA 1OUKA 3SVVA 3F3UA 4YJPA 3NYXA 3R6XA 4UMPA 3L8VA 4H1JA 4AOTA 4W4VA 3NR9A 5LQFA 2YJSA 4O7LA 3KN5A 4W4XA 4TWCA 3HMIA 2GMXA 3C4ZA 3U9NA 1A9UA 3Q4ZA 4O7NA 4HYHA 4FSUA 5H3QA 3BLQA 4DFZE 5L3AA 4RVLA 2C3IB 4O6LA 4W4YA 4EC8A 1P4FA 2B54A 4MD8E 2VWXA 4OTRA 4XOYA 4HGLA 2ZMDA 4HVDA 3W33A 4AZEA 1NVQA 1XR1A 2GFCA 4LYNA 2BILB 2UW6A 4C0TA 2P55A 5BYLA 2H8HA 4G17A 2VTNA 5LVLA 3SG8A 2WMQA 4QMMA 5IF1A 4QT1A 3T8OA 4EYJA 3GU7A 3QL8A 4Y85A 1ZLTA 4F6WA 1Y91A 3P79A 5I9WA 4LDTA 3NW7A 5DLSA 3FKOA 2YAKA 4TNDA 2J9MA 4YGAA 2WMAA 4UWCA 3DBEA 4F64A 3W0RA 4P5ZA 2GNFA 3GB2A 5GNKA 3TIYA 1GOLA 3EYGA 3CQUA 2BIYA 3NWWA 3PJCA 1P2AA 3V5LA 5LMKA 3HV5A 3BE9A 3R0TA 2XIXA 1J1BA 4HZRA 4BDIA 4F1TA 4ID7A 3T3UA 3EFWA 4ITIA 2OJIA 3UQFA 4ZSJA 5HBJA 4FTUA 4Y5QA 5ETCA 4FV1A 2V7OA 5C1QB 1M2RA 3HAMA 4QQJA 1J7IA 5ANKA 4IVDA 4C4JA 4XJ0A 3R8VA 3EL7A 2BROA 4HVIA 4U44A 2XVDA 4XNEA 4MNEB 3W2SA 1XMMA 4LOQA 5J5SA 3U87A 4JQ7A 5HKMA 4IANA 3P23A 1GY3A 3H3CA 2HXQA 5H8GA 3OVVA 3BBTB 1KE5A 5CI6A 3UVQA 1ZOGA 3W2QA 3R2YA 4J1RA 4ZTLA 3QD0A 2JKMA 4J99A 5L8JA 4ZY4A 5L2WA 1DAWA 2B53A 4BDFA 3OWJA 4YBJA 2XNOA 3DK3A 3O17A 2C6DA 4LGGA 2OW3A 1KUTA 3IKAA 3IGGA 4U3YA 2XAOA 4X7QA 3NMUF 3GVUA 3QALE 4AN9A 1W98A 4C34A 3F5GA 3G0FA 5CVGA 2XF0A 3PXYA 5T3QA 1G8KA 3ZRKA 4D2VA 5KMKA 2IZSA 2W4JA 3QYZA 2BTRA 5EDRA 2QU5A 3DQXA 5DI1A 5HNGA 3PIYA 3QKLA 4BF2A 3F2AA 3OWLA 3C7QA 4RIWB 3ET7A 2WMTA 2ITQA 4RLLA 5BPYA 3P1AA 4XG9A 3WZUA 4FTTA 1PYEA 2CN5A 2C6IA 2VWVA 3MY0A 3R28A 2CGWA 1YOJA 2PMLX 3G6GA 3U8WA 5IA5A 3OG7A 5CXZA 4RX9A 5L2SA 3F7WA 3VWAA 1B39A 3R04A 1ST4A 5CT7A 2UVYA 4IVCA 2EB2A 3GFEA 5EW3A 3MGYA 2XUUA 5DEYA 5G1XA 3OW4A 4AXDA 4ANNA 4CMOA 2OIQA 3LMGA 3L8XA 3FPQA 5JSMA 4FIHA 3B2WA 4LUDA 4EZ5A 4I94A 1H00A 2C5OA 4KNBA 4KIQA 4ASZA 3V5PA 4CZUA 4JNWA 3SQQA 3VQHA 2Q83A 3MJ1A 3UOLA 3CGOA 3QTXA 2C3LA 4EOIA 3P08A 5FBNC 2REIA 4P7EA 2QD9A 4O82A 3DXPA 3AC1A 3VJNA 5AA9A 2GNHA 3BIZA 3HP5A 4YJSA 1Z9XA 4IC8A 2Y7JA 3TZ8A 2IN6A 5KMLA 4BI1A 4FV2A 3N9XA 3FL4A 2WTIA 1LP4A 4XH6A 4RA4A 2B9FA 1TVOA 3COIA 2C6MA 2XK4A 4EC9A 1G8AA 5CX9A 2OKRA 4HVSA 4I5MA 5K0KA 3KK9A 4O0XA 4ANQA 2OI4X 5D1JA 3TN8A 4U9AA 1HCKA 2YWPA 4A7CA 5CVHA 5J9YA 4FE2A 2QOFA 3NLBA 3V6SA 2XYNA 4APPA 1W82A 1O6KA 2QOIA 2B0QA 2XK9A 5CQWA 2VNWA 3HAVA 1GZKA 1U4DA 4YJQA 1ZOEA 4G16A 4QMWA 3V8SA 4QMLA 3DBQA 4DG3E 4F7JA 2PZ5A 3TV6A 2HZ0A 4O7VA 3O51A 5M06A 2YLFA 1FVTA 4QMVA 2XEZA 3FSKA 4YU2A 3OCSA 4APCA 3MH0A 2XKDA 4CNHA 4LRKA 2WQBA 4EHEA 3NYOA 3BX5A 4U40A 3LKMA 3Q3BA 4O4BB 3UQGA 1IRKA 3F5UA 5KE0A 3UC4A 4BJJA 2X4ZA 3SV0A 5LVMA 3JY0A 1J7LA 1TQIA 5LXMA 4JOAA 4MF1A 4PMTA 4U81A 5M53A 2WOUA 5AV1A 3RVGA 3TKUA 3R7VA 5CS6A 2X8DA 4E26A 5AUTA 2ZV2A 4ALVA 2IVUA 5I9ZA 1QPEA 1R78A 4CYJA 5J8IA 2BDJA 4IQ6A 3TZMA 1RJBA 3VS5A 4E93A 2BDFA 3KMMA 3KXNA 4JX3A 5HTCA 3JS2A 3D14A 4D0WA 4IWOA 4G1WA 4LRMA 3NNVA 2VAGA 4ZAUA 4ITJA 2FA2A 4QMNA 4TL0A 5FLFA 3DKGA 2JC6A 1YXUA 4AGWA 3PXZA 4FT3A 4O21A 2OZAA 2VUWA 2HENA 4QPMA 3F5XA 3LFSA 4I5CA 2XM8A 4FTMA 2OSCA 4OTQA 5ETIA 3VRZA 4BGHA 4LRJA 4CZTA 4DC2A 5LARA 4MXXA 2YZLA 3AT2A 3VHKA 1FVRA 2F57A 1XO2B 3MH3A 5DYJA 3G33A 4GFOA 4Q5HA 5I4NA 2RFEA 4YURA 3FZOA 4PMMA 4U79A 3R1SA 4PRJA 4UXLA 4DEIA 3R00A 4GK2A 3VW6A 5FD2A 3E3PA 3MVMA 4I5HA 4YJTA 3E64A 4AXEA 5DBXA 1NY3A 1SM2A 4RX7A 4GV1A 2W5HA 4FT0A 4C8BA 3QA0A 4RZWA 5CENA 3U6JA 4FKVA 4H3BA 4OT6A 3ZYAA 2A1AB 4XP3A 1IA8A 3DNDA 2WU6A 3V8TA 2P2IA 2WMWA 2X9FA 4IAYA 5AP5A 3WE8A 3ZFXA 4DN5A 2CNUA 5A6NA 4DGMA 3EKKA 3E92A 2WAJA 3VHEA 4N0SA 4NWMA 5AP4A 4BTMA 3OOMA 1H1RA 2SRCA 2G9XA 4O2ZA 3LVPA 3KQ7A 3P5KA 1GIHA 3PRIA 4IC7A 3AMYA 4PP7A 4CRLA 1OKVA 4Q9SA 2C0IA 1FPUA 3H30A 4O0TA 5AX3A 3TV4A 3MFRA 4EONA 4EH8A 1IAJA 3ODYX 4NM0A 3RNYA 2BRBA 5M56A 2X0PA 5AX9A 3NNWA 3A7JA 5AP3A 1G5SA 4OUCA 2QLUA 3VUGA 3FY0A 1T46A 1ST0A 4GK3A 3KIOC 1IR3A 3F3VA 3NUXA 3VBWA 4IZ7A 2JDSA 3PSBA 3R02A 2QURA 4LV5A 1I09A 4DGGA 2ZAZA 2WU7A 3MIYA 3ORZA 3F3ZA 3CR0A 4E4LA 3DAJA 1Y8YA 4F9BA 3EQCA 1JBPE 5E90A 4DGLC 4OR5A 3PUPA 1W7HA 4FKGA 4UZHA 4DH8A 2YIRA 2F4JA 3BYOA 3DPKA 4OTPA 4C59A 3ZRMA 4EOKA 3DK6A 3UQCA 3ZTXA 2UZLA 2XALA 2OXXA 4I24A 2F2CB 3ALOA 4O7ZA 5FUTA 4ZTRA 5A3XA 3FE3A 2GSFA 3ZZWA 4IZYA 5AP0A 4YJVA 3NFFB 2CHLA 4W8DA 3AOXA 2EB3A 1JNKA 2VGOA 3NGAA 1Q8WA 2EXMA 2PTKA 1YHVA 3T9IA 5K4JA 4ZLOA 4ZK5A 3NUUA 4IX5A 2ITPA 3F7ZA 3O7LB 4KINA 5F20A 4BDAA 4UMRA 3TUCA 2Z7RA 5B2MA 4CFNA 1YHSA 3ORNA 4FK6A 3EKNA 5A4LA 3MJ2A 3HDNA 4ZEGA 4U5JA 5JFSA 4RVTA 4TTHB 5LOHA 3QQUA 5IQFA 3QZFA 2YIXA 4QTAA 2C4GA 4U0IA 5CU4A 5K3YA 4TYIA 4FNXA 2R0IA 4I4EA 4E20A 2JFMA 5DT4A 3VUHA 4L3JA 5EI6A 3EJ1A 5EM7A 4C4EA 2PMIA 3ORLA 1QL6A 4RGJA 3WYYA 4YC3A 2UW0A 4XX9A 1U54B 4EI4A 3C0HA 3ZSHA 4QP4A 4E4NA 3NZ0A 4ONAA 2JDRA 4KSPA 3F5PA 1OL5A 2WD1A 3PA3A 3LQ5A 1MRUA 4G31A 4I20A 4I92A 4QP7A 5ETAA 5LWNA 4C35A 4GKIA 2BCJA 3KRRA 4WNOA 3SLSA 2QG7A 2R0UA 4XLVA 4QMUA 2PZRA 5HNIX 4PL3A 3BU3A 3DZOA 2DWBA 2YM7A 4J7BA 5CLPA 5LJJA 2J0IA 3SHEA 4DE4A 3UO4A 3R8MA 2ONLA 2OZOA 3IO7A 4FSTA 4X2JA 2YERA 2QLQA 4FOBA 4Y8DA 2F7XE 4I0TA 5KMOA 5EH0A 2GQSA 1B6CB 5CANA 1VEBA 1WBOA 5CZHA 5CI7A 4YJNA 4EK8A 4R5SA 4AA5A 5JGAA 4B8LA 4HVHA 4BYJA 5C01A 4HOKA 4IDVA 4BI0A 2CNQA 3RCJA 4BGGA 3PLSA 1GZOA 2EU9A 4FV8A 1QPDA 1CM8A 2OGVA 5TKDA 2R2PA 2G1TA 2PULA 4YC6A 5AJQA 4MNFA 4MAOA 3LFAA 3MPAA 2JKOA 5ACKA 2OJFE 3QUPA 3RKBA 4BRXA 3U6HA 4FKSA 1ATPE 2R3LA 1KWPA 2VX0A 4G5PA 4LOOA 4X2GA 3DFAA 5ANJA 3ZFYA 4BDJA 4EK6A 3QKKA 2W1HA 4RIYA 3SKCA 4FNYA 2OF4A 4CFUA 3ZLXA 4PNIA 3VIDA 3F2NA 2R3HA 3IONA 4BTKA 4ACCA 4IBMA 4R7IA 4TXCA 2OJ9A 4EOMA 2O63A 3OCTA 2VWZA 4L3PA 3DLSA 3FYKX 5IQE