5ETIA

Structure of dead kinase mapk14
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
b'MLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVRKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structure of dead kinase MAPK14
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 355
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etiA01
3WBLA 3QQLA 3DNDA 1YRPA 1YDRE 4XBRA 3UO4A 3PP1A 2QOIA 4FEVA 4YBJA 3NUAA 5C1QB 5EYCA 3HV5A 4MH7A 3BHYA 2QR7A 5L3AA 4ITIA 4XOZA 3H4JA 1ZMWA 4QYYA 2X4ZA 4MNEA 3BI6A 4V0GA 3ZLYA 4L01A 1NA7A 4OTGA 2YM3A 3D2KA 4W9XA 2R3MA 4NW6A 1M2RA 3V6RA 3AMBA 1A9UA 3RK5A 2XBAA 4MXZA 4D2RA 3SG9A 3TJDA 3EKNA 3P0MA 1Z57A 2BDWA 3O7LB 4I4FA 4YLJA 3W10A 4DEEA 4TWOA 2OJIA 5AA9A 2XIRA 3OEZA 2C68A 3GVUA 4TXCA 1JAMA 2PUIA 2B4SB 2V7OA 2Q83A 4AS0A 4FIIA 2WELA 2WMWA 3RMFA 5LVLA 5DRDA 3M11A 5IA4A 3PXKA 3GENA 2WMXA 3DJ7A 5AR4A 2CMWA 3CTQA 2VWBA 5KBQA 4BDJA 2JEDA 4HGEA 3SXFA 5I9VA 4GL9A 2XM9A 3L9MA 3C4ZA 1CMKE 3OXZA 3HAVA 3QRKA 4RVKA 2Y4IB 3KGAA 3PE2A 2BRGA 3PVBA 3WZUA 2WIHA 2DUVA 4FEXA 3TKHA 4XYFA 3KMWA 2YZLA 4XS2A 3UIMA 4WNMA 2HW6A 4JQEA 2WQOA 2E9PA 3MI9A 3ZTXA 1UWHA 5FD2A 2QG7A 3DKFA 2H96A 2JIUA 4L43A 2DYLA 4GUEA 4KKGA 4LUDA 4HGSA 4P5ZA 4ALWA 3DAEA 4ZLYA 3COMA 2ITYA 3ET7A 4PY1A 3AGMA 4QT1A 2IW6A 2F57A 3ZONA 4R77A 4DTBA 2W0JA 5JGBA 3DDQA 3O8PA 3IGOA 3CKWA 2PVMA 4MF1A 4AT3A 2VWIA 3HV3A 4KSQA 3F7WA 5E90A 4IDVA 2YJRA 1H0WA 3AT2A 4HCUA 4NEUA 3WF9A 2ERKA 5JQ8A 3OY1A 4JR7A 3VBTA 3ZLXA 2QLUA 3FSKA 3PG1A 3U87A 3ITZA 4LOOA 3FZRA 4FKTA 3MYGA 1Q62A 4N6YA 4WSQA 4WSYA 2JDVA 4W4XA 5A4CA 1FMOE 5I3RA 3PA3A 4WRGA 1YW2A 1ZY4A 3RAWA 3FLZA 4EYMA 3FWQA 3GBZA 5LCKA 3SGCA 2WPAA 3THBA 3CTJA 2IW9A 4I6HA 5AAGA 1YOMA 3UG2A 1H1SA 4A7CA 4BTFA 4OBOA 4W8DA 3CLYA 4BIDA 2C6IA 3MIYA 4PPBA 3IDCA 4OTWA 3GC0A 2NNWB 4RWJA 3TI1A 2VTIA 2UZOA 4XX9A 3E7OA 5IQBA 2C0OA 2W96B 3VF8A 3WYXA 4BCHA 3PP0A 5IA2A 4FKQA 4R7BA 1AGWA 3LPBA 4JG6A 2ITQA 4PMMA 3ZXZA 4DTKA 5CSWA 5DR2A 4AXAA 1QMZA 3GP0A 3RHXA 5BYLA 4Y8DA 3GQIA 4ACCA 2NPQA 3F5GA 4D2VA 1JQHA 4E26A 4DFNA 4L45A 4UY9A 5ANDA 1PXIA 4RIXA 2IZRA 4GCJA 1R1WA 4Y5HA 5HVYA 1NVRA 1QL6A 2W5BA 2XK9A 4MCVA 4O6LA 2SRCA 4D4SA 3R7OA 2RSVA 1J7LA 2BAQA 5G1XA 5FTGA 2OI4X 3IW5A 5ETCA 3TTJA 1XKKA 5J7BA 4GK3A 5KCVA 3F61A 3LCTA 3LW0A 4O81A 2W17A 4Q9SA 5DYJA 2XNPA 5AUZA 4MAOA 3C5IA 1SYKA 4LGDA 5M4UA 2I0HA 3H9FA 4BDKA 3RPRA 3DNEA 3LJ0A 2YITA 1IR3A 2BALA 5CI6A 2XB7A 3PXZA 3R21A 4XBUA 2XNNA 1T45A 2IJMA 3MPMA 2YM8A 3ID6C 4ZS0A 4OBQA 4NFMA 4UB7A 3UIBA 3NYXA 2J0KA 5E92A 2GTMA 2KULA 5CVFA 5TR6A 4MQ1A 3DLSA 3VBXA 4JIKA 2JC6A 2XIYA 3G6HA 4RT7A 4AWIA 2BRNA 1WAKA 4AACA 3KCKA 3FLSA 4PL5A 3BV3A 4C58A 5JN2A 5JEBA 3FV8A 4AGDA 2WEVA 2YIXA 4FV4A 4JBVA 5LARA 5GHVA 3Q2MA 3EYHA 1GIIA 3ZUVA 3UZRA 2C5XA 3QCQA 3NUSA 2WQEA 4YTIA 2Y6OA 5FEQA 3BCEA 4K11A 2GTNA 2QOBA 4I5PA 2ONLA 2RFDA 4JLCA 4IQ6A 4IDTA 2X7FA 3FI3A 3SDJA 4Y95A 5GINE 4TT7A 5IUHA 3W2RA 5EQPA 2WEIA 4EOMA 1W8CA 3A7IA 2ETRA 3F3TA 4FYOA 4FK6A 1OBDA 3R8UA 3I4BA 3QQFA 2EWAA 4CEGA 2QOLA 3LFEA 3QFVA 3O8UA 3DU8A 4LMUA 1XH4A 5EI6A 4BGGA 2W1GA 1Y57A 3PXYA 4KAOA 3CIKA 3LCSA 4IB3A 4L68A 4BCKA 5FEDA 4NKAA 2VTOA 3DZQA 2ITUA 3KMMA 1J7UA 5E7RA 2P3GX 5EW3A 3I6WA 2OWBA 4E93A 4LI5A 1MQBA 3COIA 5IH6A 4F9WA 3FEGA 2PE0A 3AC8A 2W05A 2WD1A 3MJ2A 4XV9A 3Q4ZA 5AJQA 4UALA 1ZXEA 3Q9ZA 4FZFB 5JFWA 3ETAA 4YPDA 4D55A 3N4TA 2VWZA 3CPCA 2VTRA 4YJSA 4BDIA 3F69A 4NH1A 4UZDA 4QMOA 2F49A 5DHJA 2YHVA 2VX0A 5LMAA 3RK7A 4EOJA 4IJ9A 1OL1A 3P9JA 5B2KA 3R7YA 3V6SA 4HVSA 3O51A 4ZJIA 4BI1A 3VS6A 4F1OA 5HBJA 1YWVA 3B8QA 3HLLA 4NU1A 4FNWA 3FE3A 4FTKA 2WTJA 4ZEGA 4O0XA 3R9NA 4BKJA 3FY0A 2C0IA 2HW7A 3VBQA 2BZJA 3WZJA 4BHNA 5B0XA 3TUCA 3PSDA 4N4SA 3IK3A 5I4NA 3HMMA 4FT0A 2WMQA 3EQDA 5D10A 2QOKA 4QP9A 1J1CA 4TPTA 2RFEA 5BMMA 3BHUA 2I6LA 1K2PA 4F65A 3KULA 4JQ7A 2BKKA 4H36A 4MNFA 5M4FA 3P7BA 4O2PA 4BI2A 4R1VA 4LQMA 5HG9A 3FC1X 1VR2A 4N57A 3E88A 3QHWA 4CFFA 3DA6A 3QQKA 2QODA 5C01A 4AZSA 1JOWB 2ITWA 3HYHA 3D2IA 3HRFA 4O6EA 5E8ZA 4CNHA 3Q96A 3KC3A 4JS8A 4AFEA 4ZLOA 3P79A 1ATPE 2XJ2A 5AADA 3TG1A 4ERKA 2GFCA 4H39A 4WG5A 2QOHA 5IA5A 5HIBA 2XMYA 4UMQA 1WBNA 1WVYA 3DK7A 4QP2A 4RVLA 1YXTA 4BN1A 5FDXA 4CT1A 2DWBA 5T68A 3BELA 4JBPA 3O17A 3PPJA 4AP7A 4QPMA 3S4QA 4L6QA 2PZPA 2H9VA 2Z8CA 3UTOA 4IE9A 2AC3A 3ZZEA 2PYWA 3RALA 4K9YA 5H8GA 4NK9A 4BIEA 5DI1A 4X7QA 2GQRA 3OT8A 5T3QA 4IX3A 4IACA 4DEIA 1Q8WA 4K2RA 4ENYA 3DBFA 5K9IA 2YWVA 3NW7A 2B9IA 4O0UA 3BLQA 4JQ8A 4IX4A 3QBNA 2V55A 3P5KA 3PJ3A 2VAGA 2VGPA 4LL5A 4Q5HA 4V0GB 5J5TA 5J9ZA 2X7OA 4EZ7A 4UMPA 4ZZOA 2ACXA 2XM8A 4ASZA 3PUPA 2FYSA 5M08A 4GKHA 4X6QC 3A7JA 2Z2WA 3QTWA 2O63A 4YJUA 5IMXA 3FZTA 1H00A 3UVQA 2UVZA 4I5MA 4PDYA 4O0RA 1DI9A 1ZOGA 1Q8UA 2C6EA 2QKRA 3FZPA 4GH2A 4G3EA 2YM4A 5IQDA 1FMKA 3OTVA 2XKDA 2BROA 1V0BA 3ZOSA 1OGUA 1XBBA 4NM5A 4IFGA 4IJPA 2ITPA 4HYIA 4USDA 3VHEA 4MD9E 3OZ6A 4FTRA 4EORA 3JVSA 1VEBA 3KRXA 3VIDA 1BYGA 3R7GA 3F9NA 3SRVA 3IGGA 1JNKA 4IZ5A 4MD8E 3ATTA 2XRUA 4F9YA 4ZSJA 3ANRA 5HIEA 2CLQA 3ZO4A 4GT3A 4BCIA 4AA5A 3ULIA 4BKZA 4KSPA 4YZNA 4ZP5A 3EQBA 1UKHA 3O2MA 4C3RA 4L7SA 3BE2A 3IW6A 4J99A 3ZYAA 4FTCA 4UMTA 5CF4A 3MVMA 4MXYA 3I6UA 3HKOA 3G2FA 4UN0C 2UVYA 5JQ5A 3Q9YA 4RQKA 4BCOA 3R7EA 5LJJA 4RIWB 3DOGA 2R3LA 5BMSA 4NIFA 4ASEA 3AQVA 4V04A 3NEWA 3I81A 4IWDA 4ZZMA 3DZOA 4AW0A 4E6DA 3UJGA 4FG9A 2P55A 4XG3A 4EH5A 5B2MA 2CNUA 2ZMCA 2C1AA 1UA2A 3E8EA 5HICA 4F6WA 3PPKA 2BR1A 4PTEA 4BYIA 2CLXA 4TWPA 1IRKA 3HDMA 2FSTX 2B7AA 3A99A 5CLPA 1SVHA 2WGJA 3Q9WA 4IVAA 3RZBA 4DGOA 4EH4A 1DS5A 4FUYA 1URCA 1GZOA 3FLYA 5DE2A 3TJCA 3QX2A 2X9EA 2B55A 4RG0A 2GNHA 4IAIA 3EFKA 2JITA 4QMXA 5EW8A 5AUUA 4L42A 1RW8A 1TQMA 4FKOA 1LPUA 4C35A 5CEPA 4XG2A 2GMXA 3QYZA 5AIRA 1O9UA 2F7ZE 3RNIA 3P4KA 4O0YA 4M84A 3G90X 3TNIA 4XV3A 5GJDA 3KN5A 2QU5A 4FSQA 4PDSA 3QTSA 3EH9A 5DR6A 3H0YA 3QWKA 1XHAA 4O27B 2JD5A 4JNWA 5AX3A 1I09A 2BKZA 4TWNA 4FKPA 2NO3A 1PMNA 2XKFA 5HEZA 4ZTLA 2CDZA 1MRYA 3W2QA 3WF8A 4E5BA 1IA9A 4WD5A 4RFMA 4UWYA 5HLPA 4EBWA 2BFYA 4LM5A 2EXMA 3OFMA 5I9XA 3QQJA 3PFQA 4ANNA 3ORMA 1GJOA 3GOPA 1OI9A 2ONLC 2UZEA 3DJ5A 1VZOA 4MBJA 4R7HA 4YHJA 3T8OA 3TZ8A 1M7NA 2CKOA 2WMRA 3OWPA 4F0GA 2VO7A 4UX9A 3TL8A 3U6HA 4A9SA 3HVCA 5CQWA 3MVHA 4I5CA 5F1ZA 3U8WA 2VO6A 3UP7A 5DA3A 1P2AA 1PXPA 5CVGA 2XZSA 4YU2A 4G3GA 3KB7A 4DH5A 4FTOA 4D1XA 4MXAA 1UU7A 3OW3A 3JY9A 5AMNA 4IX6A 2HYYA 3OD6X 4U3ZA 4G16A 4UWBA 2R5TA 1YXUA 1G3NA 4ANMA 3NCZA 2G2FA 4X3FA 4C57A 2IZSA 1WZYA 2AUHA 1YI3A 2GFSA 1H07A 4IB1A 4AOJA 1Q24A 4C38A 3C9WA 1Y91A 2UW8A 4FR4A 3OHTA 4CG8A 3LFBA 1H28A 1W7HA 3MFTA 3OG7A 2QOQA 4OTHA 4G3DA 2OXXA 4O7VA 3FZSA 2WTDA 4KIOA 5HNBA 1JSVA 1M52A 2IPXA 2UW4A 4FNYA 4RJ4A 2PY3A 5BX0A 2BHHA 2WTIA 3VHKA 5B7VA 2XYNA 2WOUA 3EQCA 3L8XA 1HCKA 1WFCA 4O91A 2UW9A 2QOFA 2E9OA 4KIKB 2XNMA 3RNYA 2B53A 4D1ZA 2R3QA 4QMTA 3KXMA 1BX6A 1Q61A 3R7UA 3E7VA 3L8PA 4KABA 4A4OA 2P2HA 4DFXE 5DEYA 3OF0A 4I94A 4F9CA 2Z7QA 4J53A 2QOOA 4QP7A 4RFYA 4I0SA 5E8SA 5HD7A 4EOKA 4FT7A 4FIEA 3VAPA 5A4TA 5IA0A 5I0BA 4NT4A 1G5SA 3H10A 4IBMA 4CYJA 2B0QA 2IWIA 5CZIA 4ANLA 3IDBA 5K3YA 4ITJA 3VUHA 4PTCA 3U9CA 2UW7A 4F9AA 4BRXA 2F9GA 4HGLA 4DFBA 4B7TA 4FKGA 2XNGA 4FSRA 4N70A 4YZBA 5CYIA 2W1DA 4XG7A 4APPA 5HX8A 1GZ8A 3PIYA 5BVNA 2H6DA 4YTCA 2RF9A 5HNGA 4LOPA 3I0OA 1JWHA 4ZOGA 2WQMA 2YEXA 3CJGA 2Z60A 2J2IB 4I0RA 1WBPA 2YZAA 1PXOA 4M97A 4AFJA 3QALE 3BHVA 4O7SA 1Y6AA 3KRWA 2X9FA 3LCKA 2ZJWA 3ZM9A 2W1FA 1YOJA 3E63A 5H3QA 3ZO3A 4ZJVA 3SQQA 2CNVA 4EZ3A 2VO3A 5FDPA 4TRLA 3UVPA 4FTNA 3EN6A 3PXFA 2QO7A 4MYGA 3R63A 4JDHA 2QONA 4Z7GA 2Y0AA 5HTIA 3CXWA 5CT0A 4D5HA 2FO0A 3C4WA 4FVRA 3MSSA 3RK9A 5F95A 4D2SA 2W4JA 3EL8A 3SW4A 4R78A 5D12A 3QUPA 4D0WA 4E4LA 5KKRC 5AWMA 3VUDA 2BFXA 5IUIA 1L3RE 3LM0A 2VWWA 3W2PA 3LKMA 4DYMA 4RX8A 2JKOA 3WIKA 5HTCA 3NAXA 3TZ7A 3R8LA 3EN5A 4KBCA 2XNEA 3WZEA 3D4QA 4P2KA 4ZY4A 1KUTA 4ENXA 5IA1A 5D1JA 3EMGA 4FV0A 4XG8A 1PXKA 2ZM1A 3DLZA 3DY7A 4K0YA 3LCOA 3TACA 4MEDA 2WTWA 2XIZA 3AMYA 3GC9A 3PVUA 4UXQA 4EUTA 4DGNA 2ITXA 3R73A 3LXPA 3HP2A 4Q5EA 4RJ3A 5AV1A 3FYJX 5JK3A 4RSSA 5IQAA 4KRCA 3EWHA 4HCVA 3T9TA 1XH5A 4B0GA 3A8XA 1W98A 3UP2A 4RWIA 5CU3A 1H4LA 2G2HA 4BTMA 5FRIA 1URWA 3PVGA 4AZEA 3BZ3A 1XO2B 3AG9A 2UW6A 1B39A 3DXNA 5HBHA 2XEZA 1ERKA 2YAAA 5K0XA 4DINA 3BLRA 4YGAA 3RM7A 5KMLA 3RAKA 3GEQA 4IVCA 4RX9A 4KKEA 2PMOX 4X0MA 3DK3A 1JSTA 4H3BA 2OIDA 5GZ9A 4BDHA 3F88A 1OPLA 4CFVA 3ZC5A 3D83A 3MJ1A 3GCUA 4J8NA 3WZKA 4AZFA 2ZM4A 4O7ZA 4FZAB 4O84A 3H9RA 1Q5KA 3PZHA 5TE0A 2EUFB 4DGMA 4E4NA 3GC7A 2ERZE 4B8LA 4O22A 5CAUA 4ZAUA 4AU8A 3RPSA 4DAWA 3R1SA 3L8VA 4F63A 2PMIA 3R1NA 4G5JA 3NMUF 4O0TA 5ACBC 5AFVA 2ZV2A 2PULA 5A4EA 5A6OA 3U4UA 1G8AA 1MQ4A 3OUKA 1UV5A 4GEOA 1Q8YA 4UWCA 4ZXTA 3OWLA 2NRYA 2ZB1A 4MXXA 4QQ5A 2YERA 2BVAA 4ANOA 4JOAA 4UYAA 4I3ZA 1T46A 3RTPA 4CFXA 5FLFA 5ANIA 4CYIA 4QMUA 4FV1A 4O38A 2I1MA 1STCE 1H24A 2PK9A 3I79A 1H25A 4FIGA 2ZVAA 2W7XA 4NCTA 3C0IA 5L6WL 5JZJA 5HQ0A 3SKCA 5HE1A 3ZU7A 2GS2A 2ITNA 4BDGA 4M69A 2CNQA 4QTDA 2OG8A 3VF9A 4DBNA 4Q2AA 1H1RA 2LGCA 5CAOA 3OS3A 3LFDA 3Q3BA 3UOKA 3OC1A 4HPUE 1YVJA 3AC2A 3CQWA 3CGFA 4ONAA 3GXLA 4HVIA 4O21A 3GGFA 3RWQA 1OL5A 3B8RA 4ORKA 1VYZA 3BYOA 5BYYA 4O1PA 3G0FA 4E3CA 3LJ1A 2UZTA 4C59A 4DGLC 3ZUUA 1BL6A 2VTLA 4X3FC 3D7TA 3BHTA 3E8NA 3AMAA 4JG8A 1SM2A 1BUHA 2PE2A 4IH8A 4LRKA 4MQ2A 4W4YA 1FGKA 3F5UA 4QMQA 4JR3A 3OCSA 4RJ6A 5AP3A 5ETFA 5HO7A 3EIDA 4KS7A 5AM6A 5AR7A 1XJDA 5LMKA 4FTTA 1U59A 1GNGA 1SVEA 3D94A 3RCJA 4D4RA 3RBWA 2F2CB 3QC4A 3FKLA 3ANQA 5CAPA 2PUNA 3NYNA 1H1QA 2ZV8A 4BBEA 4CFMA 3NPCA 5AEPA 2J6MA 1YHVA 1YOLA 1ZRZA 4KIPA 4KRDA 3SV0A 1BKXA 4A4XA 2WTKC 5CSHA 5HVJA 5IH4A 2GU8A 1QCFA 5AUTA 3E5AA 3HRCA 4HVDA 3Q6UA 3EJ1A 2YACA 1TQIA 3QKMA 4YJQA 4CZTA 1PMEA 2JFLA 4J1RA 1Q97A 4RZVA 3UGCA 5CSVA 2E2BA 4YZ9A 3RPYA 2HZIA 3KK8A 2X8IA 3E62A 3H9OA 4RFZA 4YNEA 5FEEA 5ANJA 3VN9A 4J98A 4C33A 2PU8A 5J79A 2GCDA 3NLBA 3QU0A 4M12A 3BQRA 3CC6A 4J95A 3HUBA 5CXHA 3RPVA 4ANBA 4R3RA 1GY3A 2ESMA 1UNHA 3KK9A 3CSVA 2QU6A 3MH1A 3SA0A 3AC4A 1CKIA 1WCCA 5D7VA 4QYEA 4RLLA 3OMVA 3FMJA 4D58A 3LAUA 2C6DA 4O7NA 4AX8A 4USEA 5IQHA 4ZTHA 3V8SA 4M14A 3LVPA 2BCJA 1LEWA 2R3JA 2A19B 2XK4A 4FNXA 5AP4A 1OL6A 3ZDIA 3JPVA 4LV8A 4JI9A 4BZOA 4EOSA 2RFNA 5L2WA 3TV4A 1SNXA 2ZYBA 3PJ2A 2C3KA 1PRYA 2OLCA 3C4EA 5CF5A 3TNQB 2IG7A 4IAYA 3MPTA 4QTBA 5FTOA 3F2AA 3AXWA 4YJNA 5DMZA 5C4KA 2VV9A 3NRMA 3EQRA 3SX9A 3LXLA 5HE0A 3SOAA 4FTLA 4YURA 4EC8A 4EOOA 1KOBA 2GQGA 1Q3DA 3NUPA 4QNAA 5HCXA 3VRYA 3MTLA 2CGVA 3P23A 5HI2A 4DFYA 4P90A 2X2KA 3BYSA 5J1WA 3PJ1A 3KL8A 3UIUA 4L7FA 4PP9A 3TTIA 3N4VA 3E93A 2QR8A 4LG4A 3WARA 4R1YA 4CKIA 2CSNA 1Y6BA 1Y8GA 4M3QA 2G01A 2ZDTA 3POZA 4FI1A 1FGIA 2PVHA 2A0CX 5L8KA 1GZNA 4O7RA 3ZFYA 4GYGA 4I6QA 4KA3A 4F1TA 4G17A 5E1SA 2XKEA 3QL8A 4RQVA 4EI4A 3TNPC 3DBDA 4QP8A 3Q4CA 3EZRA 4BTKA 4F99A 2Z7LA 4ZLZA 1AD5A 1ZYSA 2HK5A 2IVTA 3C7QA 3HDNA 2FSLX 3VUMA 3A2CA 3CTHA 5HO6A 4FSMA 2R0UA 1OKVA 5EDQA 3UO6A 2C6KA 4G2FA 2UW5A 3QD4A 2R4BA 4OTFA 2JKKA 2ITVA 2FUMA 3Q60A 1O6YA 2VD5A 2P2IA 5IEVA 4DEDA 2W99B 4Z7HA 3ACKA 1XR1A 3WE8A 2B52A 5A4LA 3TEIA 4CMTA 4TNBA 4Y72A 3VUTA 1H1WA 5AA8A 1YWNA 1YDTE 4ZK5A 4JDKA 2QC6A 4HGTA 4O7TA 2R3NA 3R9HA 4BZDA 3OBJA 4RJ5A 3RHKA 4FIJA 5AIKA 1CKJA 1NY3A 2FB8A 2UW0A 2ZOQA 3KXGA 4FODA 3BE9A 4X2GA 2YA9A 4K18A 4C62A 3SD0A 1UNGA 3A61A 5LVNA 4O2ZA 3C0GA 4QP3A 3DT1A 4EH2A 3HV6A 2YN8A 4EONA 4YC3A 4U6RA 1P4FA 4YBKA 1KV1A 3EN7A 5IMEA 5ITAA 4RIYA 4U8ZA 4BCMA 3FMLA 4A4LA 4FL1A 2C6LA 3HZTA 4XP0A 2R7IA 3QTRA 4LV5A 4GT5A 5AUXA 3RCDA 3C4XA 4G6LA 3S95A 3F5XA 2F2UA 4XP3A 1WVWA 4GIHA 3BYMA 4R7IA 4XH6A 5LWMA 1OIYA 3V8TA 1WBOA 4QO9A 4TYHB 4MBIA 4X6RA 3KREA 5HKMA 2HENA 4R3PA 1MP8A 4PPCA 4BF2A 3RM6A 3P7CA 3S2PA 3UC3A 3UQCA 3OCGA 5J87A 4PWNA 4YO4A 4RC3A 1YI4A 2YLEA 3MVLA 5HCZA 4EOQA 2FH9A 3UVRA 5FXSA 4IHPA 3DPKA 4DG3E 2UZVA 3R71A 4TZRA 3AT3A 4TYGA 3PXQA 1IA8A 2XYUA 2XK8A 3PZEA 5EK7A 3BGZA 5DIAA 1O6LA 1P14A 2Y6MA 5KHXA 4QYFA 4ALUA 1KWPA 1UVRA 2JDOA 4NCTC 5E8UA 3MESA 3DJ6A 4JBQA 3UNKA 3R7IA 3V5TA 2W9FB 3FZ1A 2F7EE 1R39A 5IUGA 5CI7A 4BB4A 2YABA 4FKSA 4A06A 3IONA 3KF7A 3KN6A 4IW0A 2QHNA 3B2TA 5C4LA 4I23A 4TTHB 4PDOA 1XH6A 4GV1A 4EQMA 2W1ZA 5EFQA 3TNHA 5IQEA 4IVDA 4FUXA 3R9OA 2HY81 4L46A 4E73A 4KBKA 3Q9XA 3CCNA 4OW8A 3UYSA 5AV4A 4O82A 3V8WA 3ERKA 4FL2A 3ENHA 3ZEPA 3UDBA 4IWOA 1GIJA 2YIQA 3UODA 2B9JA 3BYUA 3HA8A 5HLNA 3LQ8A 4MKCA 4XNEA 5M4CA 4TN6A 3KCFA 3KF4A 4YP8A 4OT5A 4YUQA 4I5HA 1JSUA 4K6ZA 1BMKA 3O0GA 1J1BA 4X2FA 4M15A 5LMKC 4RWLA 3HUCA 3K3JA 3V51A 4DF3A 5C26A 5JFVA 2ITTA 1GIHA 2WO6A 5DVRA 5BVDA 5M57A 4BC6A 4EK4A 4D28A 3LJ2A 3LQ3A 4NTTA 4U9AA 2OF2A 2GHLA 3PE1A 5CF8A 2JIVA 2QQ7A 3K5VA 3R1YA 1NVSA 3IS5A 4FZ6A 4RGJA 4UBAA 5CU4A 5DH3A 3L9PA 4BTJA 1FINA 2JGZA 3MIAA 4FV2A 4HZRA 2PZ5A 5KMKA 2ITZA 3TNWA 3LIJA 3ACJA 3UC4A 4RC2A 3LMGA 4OLIA 1U4DA 4QD6A 4ASXA 2OFUA 2XA4A 4EOPA 2XIXA 2A27A 5JRSA 2W4OA 3VBYA 4CKJA 5CY3A 5CU6A 1DAYA 5J5SA 5FUTA 2OKRA 4FT5A 2BMCA 4DN5A 2VNYA 4QNYA 5B2LA 4TWCA 4YSJA 4PMSA 3VUGA 1IG1A 4G31A 1BLXA 3G0EA 5BNJA 2PVFA 4XEYA 4DG0E 4BGQA 4O7LA 1XBAA 3EFLA 3VNTA 4FL3A 4JDJA 3O8TA 4I6FA 4NM0A 2BZHB 3D7TB 3R28A 2OXDA 2XNOA 3LQ5A 4MBLA 4L52A 4Y73A 5EM8A 4YTFA 5CEOA 2CKPA 4YMJA 4O83A 4YSMA 3QUEA 5CEQA 2BILB 3MFSA 4LFIA 1PHKA 4MNEB 5CF6A 3R0TA 3NCGA 3NS9A 5M51A 3UOLA 4IVBA 4U40A 3UNJA 3VC4A 3NW6A 3FAAA 4EOLA 4MXCA 3WE4A 1OIRA 4AE6A 4FKJA 3TDWA 4X2KA 4U7ZA 2CKEA 1MRUA 3DQWA 2V7AA 3MY0A 3QCSA 3FL5A 2PMNX 4KKHA 4O0VA 4YZMA 1FPUA 2VO0A 3ORZA 4XG6A 5JGAA 3IQ7A 1OB3A 2GNLA 3Q53A 4G9CA 3IO7A 3IG7A 4KINA 4OTIA 4FIFA 3ORTA 3RAHA 3U9NA 3UMWA 3GFEA 3LFAA 4YLLA 4FSZA 5BUEA 3DV3A 4HCTA 5IPJA 3ZC6A 3QUDA 5L2SA 4BCQA 4CQEA 4EOIA 5KMMA 1V0OA 5AR2A 5HLWA 4DLIA 1Q41A 4YHTA 4CGAA 2PVNA 3DDPA 5KNJA 1KE5A 2VTAA 4CKRA 2ETKA 5LVMA 3ZMMA 3EHAA 3KXHA 3TCPA 2VTSA 1ZWSA 5TOZA 4X2NA 4PL4A 5CX9A 2X81A 3JS2A 3QZGA 5K4JA 1CKPA 2WHBA 2OJGA 1QPCA 4B4LA 2UZLA 2X6EA 1OECA 2HXQA 3E64A 3LCDA 3QGYA 3R30A 4FTAA 4NM7A 3TIYA 4U45A 1NW1A 2X2LA 2QD9A 3C50A 3PVWA 4NYEA 1LP4A 2C69A 2BIYA 3RVGA 3VS3A 4R8QA 3VULA 4C34A 4L9IA 5E9EA 3UG1A 3L9NA 4G9RA 3A4OX 5DEWA 4BHZA 4FV6A 2W9ZB 5DLSA 4FKUA 2OZAA 4MWIA 2GNIA 3AOXA 4JDIA 1F3MC 5KE0A 3KY2A 4DEBA 1H01A 2HOGA 3JXWA 4GUBA 5H8BA 2BRHA 5IDPA 4JAJA 4ZZNA 3R8PA 2XK3A 5IZFA 4GFMA 4RIOA 5A54A 2EVAA 2OIBA 4GW8A 4E5WA 4PDPA 2OICA 2XK7A 3BGQA 1H26A 4YC8A 2VTJA 4DEGA 1WBTA 2OZOA 3UQGA 3GCQA 4MXOA 1OL7A 3F82A 3ORXA 4E4MA 4ID7A 4U41A 4USFA 2JKMA 4RX5A 4W4WA 4E8AA 3ODYX 4AG8A 4WHZA 3LM5A 3A7HA 4KS8A 4OBPA 4P7EA 4XG4A 2OH4A 2I7QA 1GOLA 3BBWA 5CNOA 3MB6A 2J90A 3EQIA 2RKUA 4GMYA 4LGGA 4AOIA 4CQGA 4EK6A 2VGOA 4QYHA 3OW4A 3ZEWA 3UOJA 4BGHA 3CPBA 3PY1A 3QQGA 3UPZA 1MUOA 2WTVA 4Y83A 2ZB0A 4EL9A 4H3QA 4IAKA 4GK4A 1DAWA 4B6LA 3R04A 3NIZA 3Q32A 3A4PA 2WU6A 1ZARA 3EN4A 2WMBA 1XH8A 2WXVA 4RIXB 3R8MA 5EH0A 2XS0A 4OR5A 3GCPA 3DFCB 3ZSIA 4IAZA 5EHYA 4QMPA 5CXZA 3R83A 4CFUA 3PJCA 5E4HA 3R6XA 4FNZA 3C5UA 4KD1A 4DFUA 3RP9A 4IADA 4WIHA 2CGWA 4QMSA 5L6PA 3H0ZA 3QRTA 2W4KA 3Q2JA 1IAJA 3AC5A 3W2SA 4FGRA 3CEKA 5J9YA 4K1BA 3FY2A 3F66A 4LRJA 4F7NA 3DBEA 4AW2A 3N9XA 1Q4LA 2QHMA 3DK6A 4G5PA 4HNFA 4XHKB 4CLIA 3PSCA 4NWMA 5CU0A 4BDCA 3TUBA 2QCSA 3FSFA 2R2PA 2IVSA 4H05A 3QQUA 2O0UA 4G1WA 3C51A 4Y46A 5FGKA 4GK2A 4EEVA 4EH9A 2FSMX 3G9LX 3WF7A 4AA4A 3WYYA 4M8TA 4C0TA 4DBXA 3MS9A 5E8YA 2CCIA 2VWXA 3COHA 5BUJA 3C0HA 3LFCA 4XP2A 2IZTA 4U44A 3ZRKA 5BVOA 4KBAA 2VTMA 3R9RA 3FMNA 2IZUA 3PSBA 4U42A 4YHFA 2HZ0A 4ACMA 3QLFA 2OBJA 3A7FA 4ZTMA 5HX6A 4QMMA 5EKOA 1Q8ZA 4BI0A 2YDIA 5GNKA 3NYVA 4C2WA 3PY3A 4OTPA 2W1HA 3QA0A 4PV0A 5BYZA 4DH7A 3IW4A 4Z16A 5M56A 1JVPP 5BPYA 1KOAA 1M14A 4E6AA 3TV7A 3ALOA 2R9SA 3VS1A 1QPJA 1YXSA 3VS4A 5HNIX 3S00A 2BTRA 4IEBA 3EQPA 3PRFA 3HNGA 3NUYA 4MF0A 4BDDA 3FZOA 2OJJA 4K33A 3OWJA 3FI4A 4MVFA 5KO1A 3PDTA 3TXOA 4X21A 2W1EA 2OIQA 1UNLA 3QTQA 4JIAA 4R3CA 3ZSGA 1OMWA 2YM5A 5M55A 2DS1A 4GFGA 4U5JA 4EHGA 4DGGA 2YDJA 4FSTA 3RAIA 2BRMA 5EW9A 3II5A 1WBVA 4RRVA 4DEAA 4F7SA 4E4XA 4F70A 3V5PA 4BYJA 5L6OA 4QTCA 5TT7A 2XUUA 3IW7A 1V0PA 3BWFA 3QAME 2X6DA 1KSWA 4APCA 4CRLA 3E8DA 4QMWA 2FVDA 3E3PA 3RZFA 4BDEA 3QGWA 3OEFX 4OTRA 4XUFA 3QCYA 4FSYA 3I1AA 3TIZA 4IZ7A 2HIWA 4EH7A 4FTUA 4D2TA 5A4QA 3TDVA 3OP5A 4I0TA 2J0MB 4LMNA 5AR5A 3OY3A 3ZDUA 4XLVA 3WF5A 1J91A 2VTQA 1SNUA 3JY0A 3DCVA 4DITA 5A3XA 5J8IA 1E1XA 4HPTE 3LFFA 4IAAA 4RA5A 2C3JA 4R5YA 1P5EA 3QKLA 2XCKA 3NNXA 5IF1A 3IOKA 3OCBA 3QTZA 3EFJA 2FSOX 2YJSA 1G8SA 2CGXA 4BWKA 2VX1A 4GG5A 4IC8A 4I24A 1OKYA 2O64A 5EOLA 4YTHA 3KULB 5K5XA 5TF9A 3QD2B 3Q52A 4CG9A 5HO8A 5GIOE 3R1QA 4AGCA 3T9IA 3CS9A 1OUYA 1UU8A 3OBGA 2QNJA 2FA2A 2IVVA 4FBXA 5GIPE 2PUUA 2BAKA 4YJTA 5C27A 2OGVA 5I9YA 2JBPA 2R3RA 3D7ZA 3V5QA 3S0OA 2PTKA 1XBCA 4EK3A 2AC5A 1H8FA 3FMKA 4PMPA 2C3IB 3ALNA 2BTSA 4MD7E 4R6VA 3BHHA 2J0IA 4G6OA 4AT4A 4V05A 2C1BA 4U43A 2XNBA 3CJFA 4BZNA 3I60A 3VBVA 3U6JA 4J52A 3QZFA 4QRCA 2C0TA 4EQUA 2W5AA 5EDPA 3FMEA 3WILA 4ANSA 2VUWA 1YKRA 4GJ3A 5E8XA 3FI2A 4EHEA 1PYEA 4Z55A 1OKWA 2PMLX 2VNWA 4XJ0A 5IG1A 4GU9A 4EJ7A 3TN8A 2Y9QA 2J9MA 4DFZE 5HVKA 5FQDC 1RJBA 5KKRB 5AP6A 4S2ZA 3VJNA 4S30A 2HZNA 3HA6A 5LXMA 1PXMA 3FJQE 4LRMA 1M2PA 5E8TA 3N4UA 4QYGA 4FVQA 4L00A 3G5DA 1CM8A 2QOCA 3GU5A 1ZLTA 3QZIA 4QPSA 1U46A 4WT6A 4YLKA 3FMMA 4U3YA 2J51A 2PVJA 4Z3VA 3D0EA 3C13A 2C30A 3F7ZA 5JFXA 5AV2A 3UNZA 5KBRA 4QMZA 4KUJA 3M42A 3NIEA 2YWPA 4FV7A 3DBCA 5D41A 1PMUA 4IC7A 5EM6A 3R8ZA 5LVOA 2WMAA 4L44A 2HAKA 4WG3A 4CCBA 5I9ZA 3L1SA 4EYJA 3SRVB 5AAEA 2E9UA 5AUWA 3FLQA 3HECA 5I5ZA 4F4PA 4NUSA 5E8WA 4C4GA 2YLFA 3CD8A 4J96A 4RVTA 5FBOA 4NKSA 4EWQA 5H9BA 5AP5A 3DKGA 4GG7A 3MFUA 3ORIA 5HE2A 4B8MA 2OXYA 3ENMA 4QMYA 5C8MA 3ORPA 3P86A 3VBWA 3R01A 4XMOA 3V5LA 4CCUA 4PP7A 3FKOA 4RVMA 4QQTA 4D2WA 1FQ1B 2QLQA 1X8BA 3I7CA 3ZHPC 2PL0A 5E8VA 2X4FA 3TWJA 4II5A 3K3IA 5K5NA 3FUPA 3KVXA 4NIFB 3UPXA 4C2VA 3OXTA 4FEUA 5DR9A 5DT3A 5DRBA 3V04A 2GNJA 4NSTA 4LGHA 4YNOA 2C4GA 3QCXA 5AP2A 5FP6A 2YCFA 4C8BA 5A46A 5EKNA 4C4EA 5ETIA 5AX9A 4TYJA 5TKDA 3NNUA 3EZVA 4PNIA 4DH8A 4DTAA 3Q04A 3NNVA 3ODZX 4XRJA 4BVUA 2RFSA 3IPHA 4TL0A 5AV0A 3LLAA 4YJVA 3BIZA 4EQCA 3QX4A 3JUHA 4FV3A 5EYDA 3FLNC 5BVEA 4EH6A 3HAMA 2LAVA 1Q99A 4F0FA 2R3OA 3ULZA 4AN2A 1PJKA 5EDRA 3NUUA 4WNOA 1FVVA 2R7BA 2X39A 2IN6A 3T3VA 2XRWA 2Y4IC 4FV8A 2E9NA 3ORKA 4O1OA 1W84A 1FVRA 1APME 4M0ZA 3MY5A 5ANGA 4IM0A 4F08A 1O6KA 4WRSA 5DG5A 3RI1A 4CV9A 3A7GA 3CY3A 3D15A 5DT0A 2J5FA 2G9XA 5CEMA 3R00A 5HCYA 5EHOA 3GFWA 1ZMUA 3KEXA 4EKKA 4FSWA 1OBGA 2XEYA 3EQGA 4O7WA 4I6BA 1LEZA 2KTYA 4QTEA 3MH2A 5KMOA 3DB6A 4IAFA 1ND4A 4F6SA 4BR3A 4F7LA 3FL4A 4JBOA 5L8JA 1U5RA 4P5QA 3MVJA 3VUIA 4ZSEA 1FBNA 1QPDA 1PYXA 2CN5A 2GNFA 4O0SA 1QPEA 3VS5A 4AA0A 3W2OA 4JVGA 5F9EA 4FZDB 4YO6A 4CTBA 5M44A 1YQJA 3ZZWA 1FVTA 5EG3A 3TM0A 4RZWA 3P08A 4HZSA 4D9TA 3FMHA 4QMVA 4HW7A 1OVEA 5DFPA 2VWYA 2UZBA 3ZLSA 3OUNB 5CSPA 2WMVA 3W32A 3KA0A 3W8QA 4KIQA 5AP0A 4FT9A 3EB0A 4XOYA 4U97A 3MB7A 4U80A 1A06A 4BICA 3BEGA 1R0PA 4X3FB 3U51A 3KKVA 4YR8A 4UMUA 3F2RA 2VWVA 3UQFA 3LE6A 2B9FA 1R0EA 2R3GA 1JKTA 5CZHA 1SZMA 2JIIA 5AUYA 2NP8A 5CU2A 3LFNA 1OUKA 4G6NA 5EM5A 4DA5A 4FG7A 5JFSA 3NVMB 3HV7A 3RGFA 3KRJA 3QWJA 4FV9A 2JBOA 4FT3A 2VZ6A 1OITA 3HMIA 5C8NA 2A1AB 3WF6A 3FPMA 3MA3A 3C4FA 3GB2A 1DM2A 3LMHA 1OM1A 4S34A 5KZ0A 4I93A 2W5HA 3SHEA 2WTKB 5HBEA 2BZKB 4AF3A 1UU3A 3JR1A 4RIWA 2I0YA 4JAIA 4U81A 3DXQA 4FX3A 4DT9A 1KE6A 3A60A 5GJGA 3QLGA 4TNDA 4CFNA 5L4QA 5CEIA 4E1ZA 2QO2A 3R2YA 2J50A 3KFAA 1PY5A 2IVUA 5CWZA 2UV2A 1YDSE 2C5YA 5HD4A 2HWOA 2O5KA 4IFCA 2XP2A 3DS6A 3TKIA 3I0QA 5HESA 1TKIA 5KUPA 1UWJA 3AD5A 3NW5A 5I9WA 5EYMA 4AAAA 4YJPA 1PMVA 4FOCA 2I0EA 3BV2A 4FTJA 3QXOA 4WUNA 1H08A 1BL7A 2CPKE 3W33A 2PUPA 5EQYA 2I40A 5IH5A 4GIIA 3KU2A 4XCUA 4IZAA 4EC9A 2CCHA 4I21A 5CVHA 1FOTA 4AW1A 1RDQE 3ZSHA 4HVHA 3ZUTA 2YAKA 2WAJA 4HYUA 4NM3A 2VX3A 3CBLA 4UEUA 4NJDA 4FTMA 2P0CA 2X7GA 3KRRA 3FDNA 3POOA 2OK1A 1PXLA 2G1TA 2YFXA 5DNRA 4AZVA 2QG5A 3MN3A 5IU2A 4FEQA 3D5VA 2OF4A 4IB0A 4PMTA 4DCAA 2BHEA 4FICA 2B9HA 4TYIA 2O2UA 2WB8A 1R3CA 1ZYCA 2OU7A 3HX4A 3F2NA 3DTWA 2P33A 4LUEA 3TZ9A 5J1VA 5EQEA 2PVLA 3Q5ZA 4PQNA 5ICPA 2Q0BA 4WUAA 3CQUA 3ROCA 3AT4A 4AZTA 4IM2A 3FYKX 4YZCA 3UYTA 3E92A 4ZJJA 4F09A 4AZWA 4JXFA 1CDKA 5AR8A 4ZTQA 3GU6A 1JKLA 4EKLA 4M7IA 5M53A 3DXPA 3CE3A 4MX9A 1UU9A 3PY0A 3RJCA 2X8DA 4RA4A 3FXWA 4RJ7A 3KRLA 5JZNA 1TVOA 5J9LA 3F3VA 3OOGA 4AW5A 5CT7A 2UVXA 1Z5MA 3QRJA 4EWHA 3O23A 1UKIA 2VTTA 1IASA 2E9VA 2WMSA 3RKBA 3U55A 2R0IA 3UE4A 2PZRA 3DFAA 4U79A 4UXLA 4L8MA 3B2WA 3E8CA 5HZNA 3VQHA 4FIHA 4L53A 3QTXA 3PA5A 3RPOA 5ANOA 3CKXA 5FG8A 3VS7A 3NX8A 4DHFA 3CR0A 1R78A 2PHKA 4IIRA 5BVWA 5LOHA 4O0WA 1Q3WA 3UMXA 3PRIA 4RPVA 2GHMA 2HZ4A 4KIKA 4E6QA 1YHWA 2OW3A 3BYVA 3PXRA 4H1JA 1DI8A 3DTCA 4NZWB 4U0IA 5IKWA 5JRQA 5IQIA 2RL5A 5CEKA 4MWHA 3FPQA 5IEYA 3NNWA 5DN3A 3R9DA 4J8MA 5JKGA 1BI7A 1AQ1A 1HCLA 2WQNA 2YIRA 3OTUA 3HL7A 4FKIA 4AE9A 2WOTA 4ZTSA 5CNNA 1H27A 1NXKA 5BVKA 4JRVA 3SG8A 1VYWA 3FHIA 5DT4A 3BWJA 4BCGA 5CAVA 3PIXA 3MGYA 2R3FA 4PL3A 3FKNA 4L3PA 4R5SA 1YXVA 1JBPE 2F7XE 4N6ZA 4WO5A 2GDOA 3QRIA 4IANA 5HG7A 2BRBA 4GT4A 2CJMA 2YCSA 3UBDA 4WNKA 1ZMVA 2G15A 2R3PA 4LYNA 2HELA 4AGUA 1WVXA 1OPKA 5DPVA 3GC8A 2PWLA 3EQFA 1F5QA 4RJ8A 2YDKA 3UZPA 1KE9A 3S3IA 2ZDUA 3G51A 4CVAA 2V22A 3EN9A 4LL0A 3CGOA 4Y5QA 2YIWA 3ZBFA 4PTGA 1YWRA 4GS6A 3ZBXA 1Y8YA 4MK0A 1OKZA 1U54A 2J5EA 2A2AA 3HV4A 4GFOA 1PXNA 3VW6A 4M13A 4ACGA 3C1XA 2XBJA 4OGRA 2Y8OA 2WTCA 3BLHA 5JT2A 3RINA 3PA4A 2PZYA 2ZM3A 4NW5A 2YCQA 2BPMA 5CENA 3MA6A 1OPJA 2RG5A 4IXPA 4O7YA 5F94A 4AOTA 3WIGA 2GHGA 3KMUA 4XV1A 3ZXTA 4DCEA 4A9TA 3DBQA 4M69B 4ITHA 4X3JA 5JSMA 3KXXA 3AD4A 4JG7A 4WOVA 4O96A 4XLIA 3PJ8A 2GQSA 5EYKA 4EK8A 5ACKA 2WZJA 2WU7A 4RWKA 3MV5A 4GVAA 4Z9LA 4NTSA 4DFLA 3ZCLA 5LWNA 3D5WA 4W8EA 3PWDA 2CN8A 3F3ZA 2JDSA 2PPQA 3JVRA 4FOBA 1LUFA 2BZIB 4J71A 3O50A 4KNBA 3PG3A 3IECA 1B6CB 4OAUC 2G2IA 3PYYA 3ZS5A 1VJYA 3EKKA 5AP7A 2F4JA 2OFVA 5D7AA 3VQUA 4W9WA 5D9HA 5LQFA 3NGAA 3MY1A 4C4HA 3GU7A 2RGPA 2QO9A 3D5UA 3I5ZA 5KZIA 3V5JA 4CZUA 3E87A 2EB2A 5AR3A 3FQSA 4D9UA 3H3CA 4BBMA 5FXQA 2QVSE 3L8SA 3GI3A 3W18A 3WZDA 4H58A 1S9JA 3QC9A 2XH5A 1Z9XA 2C6TA 3ORNA 4CMOA 1E1VA 3O96A 1ZYLA 2ZV7A 3R2BA 4EZ5A 4C02A 3KQ7A 4E6CA 2WNTA 4CV8A 1GAGA 3U4WA 4ARKA 3K2LA 3DQXA 4F7JA 3KXNA 3FI8A 2OJFE 3G9NA 4DLJA 4IWPA 3T3UA 3UOHA 2V62A 4IB5A 4TW9A 1JKKA 2Z02A 4FEWA 3BEAA 4O86A 5HGIA 1ZAOA 1ZZLA 3GU8A 2IO6A 3N51A 4YJOA 3QD3A 5C8KA 4WKQA 4YPSA 4KWPA 4F64A 2GPHA 3A8WA 2R3HA 3D14A 2V0DA 4S32A 4XG9A 4EK5A 3OROA 5K4IA 3K54A 1YI6A 1ZZ2A 3L9LA 3Q5IA 3IW8A 3IDPA 1PKDA 4X2JA 4PX6A 4LOQA 5IEXA 1CTPE 3BU5A 4C4JA 1SVGA 4RX7A 2BIKB 3MWUA 2O3PA 1U5QA 3D5XA 3ZO2A 3LFSA 3EYGA 3PLSA 2XJ0A 4NJ3A 4QPAA 4JX7A 3W8LA 4QMLA 4D0XA 2ZV9A 2VTNA 5DBXA 4GRBA 4KB8A 4OUCA 4RMZA 5J7HA 3FQEA 4CTCA 2O8YA 3HRBA 4DT8A 5CQUA 3BBTB 4ANQA 5JGDA 5ANEA 3VJOA 3SLSA 3QRUA 3C4CA 5F20A 3AD6A 3QZHA 3P78A 1E9HA 4NFNA 4NL0A 1OL2A 1XQZA 1RQQA 1P4OA 1M17A 3TV6A 2B54A 4DG2E 4ERWA 1WMKA 2UUEA 4FTIA 5H2UA 3F3UA 3VUKA 3VO3A 3VRZA 4RLKA 4UV0A 3LXKA 2XK6A 3O7LD 4ASDA 2GNGA 2Y7JA 4JJRA 3NZ0A 4GKIA 4FKVA 3QTUA 2RG6A 3V5WA 5L2IA 5CALA 2QI8A 2CHLA 2EXEA 2CGUA 4F0IA 4F1MA 4QQJA 3SXRA 4D4VA 4S31A 1J7IA 4IX5A 1V1KA 3P7AA 4CD0A 5AP1A 4C4FA 4Y85A 5L2QA 5E91A 2C6OA 4BFMA 2X8EA 3K5UA 4L3LA 1B38A 5KMJA 2YIYA 3DKCA 3O71A 3Q4UA 5LMBA 2CKQA 4FSNA 4HJOA 4BDAA 5GZ8A 2YM7A 2P4IA 3NWWA 4JRNA 1Q8TA 2W1CA 5FM3A 3W55A 4WNPA 1PW2A 1ZY5A 5FTQA 2C47A 1W0XC 5FBNC 4QP4A 5L2TA 3MDYA 4BCNA 4XRLA 3VWAA 5HG8A 3R22A 2YM6A 3QXPA 2UZDA 4ACDA 3GCSA 1LR4A 5FM2A 1ZOEA 3SOCA 3NYOA 3V01A 5M4IA 3ROYA 3FXZA 2ZAZA 4EH3A 4QMNA 3Q6WA 4YC6A 2EB3A 4CSVA 4ZSAA 3HEGA 4ZMEA 3HP5A 2UW3A 3R8VA 3D9VA 3OVVA 3NUNA 4P4CA 3S1HA 2HCKA 5AM7A 4ZY5A 4FV5A 4B99A 2JLDA 4FG8A 4MTAA 4I20A 3BGPA 4RIYB 4V01A 5HG5A 3GOKA 4BDBA 5A14A 3NDMA 1OZ1A 5M06A 5HIDA 2ETMA 4FSUA 4L3JA 3BQCA 4QP1A 3QA8A 5K0KA 2WIPA 1NVQA 5DOSA 2V5QA 5AUVA 1WBSA 4RC4A 4EUUA 4CFWA 3TUDA 4QTAA 3MFRA 1SMHA 2H34A 2UZUE 4I4EA 4UYNA 4WBBB 5EM7A 5HU9A 1H1PA 4K8AA 5JH6A 1A48A 3BRBA 2C3LA 5IISA 4XV2A 5FXRA 4CRSA 5FWKK 4ZTNA 3I7BA 2VRXA 4I22A 3CY2A 4GSBA 4TYEA 3SAYA 4M67A 3FC2A 3VS2A 1F0QA 3QTIA 3U6IA 5G6VA 4BBFA 5ETAA 4OTDA 1WBWA 3GUBA 3KVWA 2QURA 5DGZA 2YCRA 4FE2A 3H30A 4PUZA 4BCJA 4H3PA 3ZM4A 4D2PA 2Q0NA 4ZS4A 3QKKA 4ACHA 4ZY6A 2VTPA 1JKSA 4FTQA 4AN9A 4QP6A 2Z7SA 2VTHA 5ANKA 4F9BA 2FGIA 4CMUA 4CZYB 3SC1A 5A9UA 3JYAA 4C37A 1ZYJA 3R7VA 4D5KA 3ZFMA 3V3VA 1MRVA 4B9DA 5M09A 4AUAA 2GS7A 3QF9A 2YISA 2OJ9A 3ZRMA 2PZIA 3CD3A 5HOAA 4IM3A 1NT2A 3FLWA 3PWYA 1J3HA 4ZMFA 3RWPA 2C6MA 2R64A 3G6GA 2UZWE 2VU3A 1W83A 4IZYA 3TT0A 4C4IA 4F6UA 5IQGA 2BUJA 3MW1A 3F5PA 4M68A 1ZOHA 2PVYA 3DB8A 4W4VA 1PKGA 4BWPA 4EBVA 3GNIB 3OXIA 2X1NA 4DE4A 4IWQA 4FKRA 4QOXA 2W06A 2PE1A 4YZDA 3IKAA 2AYPA 4CT2A 5CAQA 5CSXA 4BIBA 3HGKA 2WKMA 5AV3A 3QHRA 4UMRA 4BCFA 3G33A 5HORA 2WMUA 3EL7A 3EQHA 4A9UA 1XH7A 5CASA 5IA3A 4DEHA 3Q4TA 3AGLA 3FBVA 1JPAA 1U54B 2EU9A 5I3OA 5T6KA 3LXNA 4D4YA 4EJNA 1M7QA 3W1FA 3PLAE 2I0VA 3IOPA 1TQPA 2NRUA 2XJ1A 3VS0A 3ZH8A 2O65A 4A9RA 3VVHA 4HYHA 2XKCA 5KX8A 1RE8A 1REJA 2HWPA 3SW7A 5CTPA 3QYWA 4JX3A 4Q9ZA 3I5NA 4ZIMA 5F4NA 3PTGA 3A62A 4K77A 3M1SA 5EI2A 2WFYA 5HU3A 4S33A 1W82A 4FF8A 2BDFA 5C03A 5A6NA 3F3WA 3CQEA 3GCVA 2BAJA 4GYIA 1KV2A 3FMDA 4FKLA 2C5OA 2RIOA 3F6XA 3BKBA 3LLTA 4PF4A 5LVPA 2OO8X 3AC3A 2C5VA 3OOMA 1GZKA 3BU3A 2B1PA 2H8HA 2QKWB 2XIKA 3BX5A 3EOCA 5EOBA 4AN3A 3UZTA 3U54A 3NAYA 4C3PA 2BDJA 2W1IA 2X2MA 2IW8A 5KHWA 3M2WA 1K3AA 3DAKA 4J7BA 4AGWA 4TKSA 4HNIA 4TYHA 4FGBA 1BI8A 2EXCX 2JAVA 4QQCA 3SVVA 2GS6A 3DKOA 2WQBA 1EH4A 3DAJA 3GQLA 4HOKA 2OSCA 4I92A 5HHWA 4FYNA 3ATSA 4G3FA 2VN9A 2Z7RA 3VW8A 5HE3A 3UIXA 3ZLWA 3GT8A 4G34A 4BWXA 4HYSA 4AQCA 4JT3A 1PF8A 2J0JA 3LHJA 3QD0A 4E20A 1YXXA 4L67A 4ZSLA 4YJRA 5IQCA 4I41A 4A07A 1S9IA 3MH0A 4ZTRA 2J7TA 2R3KA 2DQ7X 3E3BX 3FXXA 4N0SA 3REPA 4BDFA 5CANA 3WOWA 1XWSA 2PVRA 4M0YA 4M66A 2JAMA 2XF0A 3OWKA 4AT5A 4GVJA 4PPAA 4C61A 4WBOA 3HMPA 3MH3A 2JDTA 3NSZA 3SXSA 1H0VA 3NUXA 3EFWA 2WMTA 4UZHA 3W16A 4MHAA 5EI8A 3OT3A 3MBLA 3DGKA 2PSQA 4C36A 3ZRLA 3OCTA 3ZFXA 3BPRA 1KE7A 3LFQA 4FVPA 1IEPA 4ALVA 1M2QA 2VWUA 1IAHA 5DWRA 3LMIA 3UO5A 5AAFA 3FQHA 2JDRA 4WA9A 3W2CA 5JMSA 3LZBA 5E1EA 4EH8A 4H1MA 3PPZA 4D1SA 4DH1A 3ORLA 2GSFA 3COKA 2XCHA 3PIZA 3KXZA 2HY0A 4G3CA 4EHZA 1JLUE 5BQ0A 4PNKA 4GU6A 4FZ7A 1I44A 5KMIA 4FC0A 4E7WA 4IMYA 1CSNA 1PXJA 3TKUA 5HTBA 4BY9E 4OAVB 5L8LA 1HOWA 4PRJA 2XVDA 3ELJA 3TZMA 1XH9A 5IDNA 4A9YA 5D11A 3CP9A 1KE8A 1ZYDA 3LOKA 1L8TA 2JKQA 4FKWA 5M07A 4I1ZA 4J97A 2J0LA 2JFMA 4OTQA 3NR9A 4CXAA 4BL1A 3HMNA 2ITOA 1OIQA 2X0GA 4RBLA 4FA2A 2J4ZA 4DH3A 4ZSGA 3AC1A 4DC2A 4OT6A 4EHVA 3GU4A 4JL9A 5BVFA 2UZNA 1K9AA 2PVKA 3MPAA 2OZAB 4E5AX 1OIUA 3MTFA 5H8EA 4BKYA 4HVGA 5J95A 4C7TA 2A4LA 2HXLA 5CS6A 5KMNA 2C5NA 2OH0E 2R3IA 4FK3A 4CLJA 4WG4A 3BU6A 5LCJA 4GJ2A 2Y4PA 3FHRA 5FP5A 5BUIA 5GZAA 5EHLA 5C9CA 3HMOA 3R02A 5GJFA 3ZO1A 3G15A 4BCPA 2ZMDA 5I9UA 4FMQA 3QQHA 5IQFA 3NVKI 3P1AA 1REKA 5TO8A 1YHSA 4C3FA 2REIA 3WI6A 4TY1A
chains in the Genus database with same CATH superfamily
3WBLA 3QQLA 3DNDA 1YRPA 1YDRE 4XBRA 3UO4A 3PP1A 2QOIA 4FEVA 4YBJA 3NUAA 5C1QB 5EYCA 3HV5A 4MH7A 3BHYA 2QR7A 5L3AA 4ITIA 4XOZA 3H4JA 1ZMWA 4QYYA 2X4ZA 4MNEA 3BI6A 4V0GA 3ZLYA 4L01A 1NA7A 4OTGA 2YM3A 3D2KA 4W9XA 2R3MA 4NW6A 1M2RA 3V6RA 3AMBA 1A9UA 3RK5A 2XBAA 4MXZA 4D2RA 3SG9A 1W2DA 3TJDA 3EKNA 3P0MA 1Z57A 2BDWA 3O7LB 4I4FA 4YLJA 3W10A 4DEEA 4TWOA 2OJIA 5AA9A 2XIRA 3OEZA 2C68A 3GVUA 4TXCA 1JAMA 2PUIA 2B4SB 2V7OA 2Q83A 4AS0A 4FIIA 2WELA 2WMWA 3RMFA 5LVLA 5DRDA 3M11A 5IA4A 3PXKA 3GENA 2WMXA 3DJ7A 5AR4A 2CMWA 3CTQA 2VWBA 5KBQA 4BDJA 2JEDA 4HGEA 3SXFA 5I9VA 4GL9A 2XM9A 3L9MA 3C4ZA 1CMKE 3OXZA 3HAVA 3QRKA 4RVKA 2Y4IB 3KGAA 3PE2A 2BRGA 3PVBA 3WZUA 2WIHA 2DUVA 4FEXA 3TKHA 4XYFA 3AKLA 3KMWA 2YZLA 4XS2A 3UIMA 4WNMA 2HW6A 4JQEA 2WQOA 2E9PA 3MI9A 3ZTXA 1UWHA 5FD2A 2QG7A 3DKFA 2H96A 2JIUA 4L43A 2DYLA 4GUEA 4KKGA 4LUDA 4HGSA 4P5ZA 4ALWA 3DAEA 4ZLYA 3COMA 2ITYA 3ET7A 4PY1A 3AGMA 4QT1A 2IW6A 2F57A 3ZONA 4R77A 1VLRA 4DTBA 2W0JA 5JGBA 3DDQA 3O8PA 3IGOA 3CKWA 2PVMA 4MF1A 4AT3A 2VWIA 3HV3A 4KSQA 3F7WA 5E90A 4IDVA 2YJRA 1H0WA 3AT2A 4HCUA 4NEUA 3WF9A 2ERKA 5JQ8A 3OY1A 4JR7A 3VBTA 3ZLXA 2QLUA 3FSKA 3PG1A 3U87A 3ITZA 4LOOA 3FZRA 4FKTA 3MYGA 1Q62A 4N6YA 4WSQA 4WSYA 2JDVA 4W4XA 5A4CA 1FMOE 5I3RA 3PA3A 4WRGA 1YW2A 1ZY4A 3RAWA 3FLZA 4EYMA 3FWQA 3GBZA 5LCKA 3SGCA 2WPAA 3THBA 3CTJA 2IW9A 4I6HA 5AAGA 1YOMA 3UG2A 1H1SA 4A7CA 4BTFA 4OBOA 4W8DA 3CLYA 4BIDA 2C6IA 3MIYA 4PPBA 3IDCA 4OTWA 3GC0A 2NNWB 4RWJA 3TI1A 2VTIA 2UZOA 4XX9A 3E7OA 5IQBA 2C0OA 2W96B 3VF8A 3WYXA 4BCHA 3PP0A 5IA2A 4FKQA 4R7BA 1AGWA 3LPBA 4JG6A 2ITQA 4PMMA 3ZXZA 4DTKA 5CSWA 5DR2A 4AXAA 1QMZA 3GP0A 3RHXA 5BYLA 4Y8DA 3GQIA 4ACCA 2NPQA 3F5GA 4D2VA 1JQHA 4E26A 4DFNA 4L45A 3PFYA 4UY9A 5ANDA 1PXIA 4RIXA 2IZRA 4GCJA 1R1WA 4Y5HA 5HVYA 1NVRA 1QL6A 2W5BA 2XK9A 4MCVA 4O6LA 2SRCA 4D4SA 3R7OA 2RSVA 1J7LA 2BAQA 5G1XA 5FTGA 2OI4X 3IW5A 5ETCA 3TTJA 1XKKA 5J7BA 4GK3A 5KCVA 3F61A 3LCTA 3LW0A 4O81A 2W17A 4Q9SA 5DYJA 2XNPA 5AUZA 4MAOA 3C5IA 1SYKA 4LGDA 5M4UA 2I0HA 3H9FA 4BDKA 3RPRA 3DNEA 3LJ0A 4AAYA 2YITA 1IR3A 2BALA 5CI6A 2XB7A 3PXZA 3R21A 4XBUA 2XNNA 1T45A 2IJMA 3MPMA 2YM8A 3ID6C 4ZS0A 4OBQA 4NFMA 4UB7A 3UIBA 3NYXA 4QDVA 2J0KA 5E92A 2GTMA 2KULA 5CVFA 5TR6A 4MQ1A 3DLSA 3VBXA 4JIKA 4LV7A 2JC6A 2XIYA 3G6HA 4RT7A 4AWIA 2BRNA 1WAKA 4AACA 3KCKA 3FLSA 4PL5A 3BV3A 4C58A 5JN2A 5JEBA 3FV8A 4AGDA 2WEVA 2YIXA 4FV4A 4JBVA 5LARA 5GHVA 3Q2MA 3EYHA 1GIIA 3ZUVA 3UZRA 2C5XA 3QCQA 3NUSA 2WQEA 4YTIA 2Y6OA 5FEQA 3BCEA 4K11A 2GTNA 2QOBA 4I5PA 2ONLA 2RFDA 4JLCA 4IQ6A 4IDTA 2X7FA 3FI3A 3SDJA 4Y95A 5GINE 4TT7A 3TIYA 5IUHA 3W2RA 5EQPA 2WEIA 4EOMA 1W8CA 3A7IA 2ETRA 3F3TA 4FYOA 4FK6A 1OBDA 3R8UA 3I4BA 3QQFA 2EWAA 4CEGA 2QOLA 3LFEA 3QFVA 3O8UA 3DU8A 4LMUA 1XH4A 5EI6A 4BGGA 2W1GA 1Y57A 3PXYA 4KAOA 3CIKA 3LCSA 4IB3A 4L68A 4BCKA 5FEDA 4NKAA 2VTOA 3DZQA 2ITUA 3KMMA 1J7UA 5E7RA 2P3GX 5EW3A 3I6WA 2OWBA 4E93A 4LI5A 1MQBA 3COIA 5IH6A 4F9WA 3FEGA 2PE0A 3AC8A 2W05A 2WD1A 3MJ2A 4XV9A 3Q4ZA 5AJQA 4UALA 1ZXEA 3Q9ZA 4FZFB 5JFWA 3ETAA 4YPDA 4D55A 3N4TA 2VWZA 3CPCA 2VTRA 4YJSA 4BDIA 3F69A 4NH1A 4UZDA 4QMOA 2F49A 5DHJA 2YHVA 2VX0A 5LMAA 3RK7A 4EOJA 4IJ9A 1OL1A 3P9JA 5B2KA 3R7YA 3V6SA 4HVSA 3O51A 4ZJIA 4BI1A 3VS6A 4F1OA 5HBJA 1YWVA 2X0OA 3B8QA 3HLLA 4NU1A 4FNWA 3FE3A 4FTKA 2WTJA 4ZEGA 4O0XA 3R9NA 4BKJA 3FY0A 2C0IA 2HW7A 3VBQA 2BZJA 3WZJA 4BHNA 5B0XA 3TUCA 3PSDA 4N4SA 3IK3A 5I4NA 3W0PA 3HMMA 4FT0A 2WMQA 3EQDA 5D10A 2QOKA 4QP9A 1J1CA 4TPTA 2RFEA 5BMMA 3BHUA 2I6LA 1K2PA 4F65A 3KULA 4JMQA 4JQ7A 2BKKA 4H36A 4MNFA 5M4FA 3P7BA 4O2PA 4BI2A 4R1VA 4LQMA 5HG9A 3FC1X 1VR2A 4N57A 3E88A 3QHWA 4CFFA 3DA6A 3QQKA 2QODA 5C01A 4AZSA 1JOWB 2ITWA 3HYHA 3D2IA 3HRFA 4O6EA 5E8ZA 4CNHA 3Q96A 3KC3A 4JS8A 4AFEA 4ZLOA 3P79A 1ATPE 2XJ2A 5AADA 3TG1A 4ERKA 2GFCA 4H39A 4WG5A 2QOHA 5IA5A 5HIBA 2XMYA 4UMQA 1WBNA 1WVYA 3DK7A 4QP2A 4RVLA 1YXTA 4BN1A 5FDXA 4CT1A 2DWBA 5T68A 3BELA 4JBPA 3O17A 3PPJA 4AP7A 4QPMA 3S4QA 4L6QA 2PZPA 2H9VA 2Z8CA 3UTOA 4IE9A 2AC3A 3ZZEA 2PYWA 3RALA 4K9YA 5H8GA 4NK9A 4BIEA 5DI1A 4X7QA 2GQRA 3OT8A 5T3QA 4IX3A 4IACA 4DEIA 1Q8WA 4K2RA 4ENYA 3DBFA 5K9IA 2YWVA 3NW7A 2B9IA 4O0UA 3BLQA 4JQ8A 4IX4A 3QBNA 2V55A 3P5KA 3PJ3A 2VAGA 2VGPA 4LL5A 4Q5HA 4V0GB 5J5TA 5J9ZA 2X7OA 4EZ7A 4UMPA 4ZZOA 2ACXA 2XM8A 4ASZA 3PUPA 2FYSA 5M08A 4GKHA 4X6QC 3A7JA 2Z2WA 3QTWA 2O63A 4YJUA 5IMXA 3FZTA 1H00A 3UVQA 2UVZA 4I5MA 4PDYA 4O0RA 1DI9A 1ZOGA 1Q8UA 2C6EA 2QKRA 3FZPA 4GH2A 4G3EA 2YM4A 5IQDA 1FMKA 3OTVA 2XKDA 2BROA 1V0BA 3ZOSA 1OGUA 1XBBA 4NM5A 4IFGA 4IJPA 2ITPA 4HYIA 4USDA 3VHEA 4MD9E 3OZ6A 4FTRA 4EORA 3JVSA 1VEBA 3KRXA 3VIDA 1BYGA 3R7GA 3F9NA 3SRVA 3IGGA 1JNKA 4IZ5A 4MD8E 3ATTA 2XRUA 4F9YA 4ZSJA 3ANRA 5HIEA 2CLQA 3ZO4A 4GT3A 4BCIA 4AA5A 3ULIA 4BKZA 4KSPA 4YZNA 4ZP5A 3EQBA 1UKHA 3O2MA 4C3RA 4L7SA 3BE2A 3IW6A 4J99A 3ZYAA 4FTCA 4UMTA 5CF4A 3MVMA 4MXYA 3I6UA 3HKOA 3G2FA 4UN0C 2UVYA 5JQ5A 3Q9YA 4RQKA 4BCOA 3R7EA 5LJJA 4RIWB 3DOGA 2R3LA 5BMSA 4NIFA 4ASEA 3AQVA 4V04A 3NEWA 3I81A 4IWDA 4ZZMA 3DZOA 4AW0A 4E6DA 3UJGA 4FG9A 2P55A 4XG3A 4EH5A 5B2MA 2CNUA 2ZMCA 2C1AA 1UA2A 3E8EA 5HICA 4F6WA 3PPKA 2BR1A 4PTEA 4BYIA 2CLXA 4TWPA 1IRKA 3HDMA 2FSTX 2B7AA 3A99A 5CLPA 1SVHA 2WGJA 3Q9WA 4IVAA 3RZBA 4DGOA 4EH4A 1DS5A 4FUYA 1URCA 1GZOA 3FLYA 5DE2A 3TJCA 3QX2A 2X9EA 2B55A 4RG0A 2GNHA 4IAIA 3EFKA 2JITA 4QMXA 5EW8A 5AUUA 4L42A 1RW8A 1TQMA 4FKOA 1LPUA 4C35A 5CEPA 4XG2A 2GMXA 3QYZA 5AIRA 1O9UA 2F7ZE 3RNIA 3P4KA 4O0YA 4M84A 3G90X 3TNIA 4XV3A 5GJDA 3KN5A 2QU5A 4FSQA 4PDSA 3QTSA 3EH9A 5DR6A 3H0YA 3QWKA 1XHAA 4O27B 2JD5A 4JNWA 5AX3A 1I09A 2BKZA 4TWNA 4FKPA 2NO3A 3W0SA 1PMNA 2XKFA 5HEZA 4ZTLA 2CDZA 1MRYA 3W2QA 3WF8A 4E5BA 1IA9A 4WD5A 4RFMA 4UWYA 5HLPA 4EBWA 2BFYA 4LM5A 2EXMA 3OFMA 5I9XA 3QQJA 3PFQA 4ANNA 3ORMA 1GJOA 3GOPA 1OI9A 2ONLC 2UZEA 3DJ5A 1VZOA 4MBJA 4R7HA 4YHJA 3T8OA 3TZ8A 1M7NA 2CKOA 2XANA 2WMRA 3OWPA 4F0GA 2VO7A 4UX9A 3TL8A 3U6HA 4A9SA 3HVCA 5CQWA 3MVHA 4I5CA 5F1ZA 3U8WA 2VO6A 3UP7A 5DA3A 1P2AA 1PXPA 5CVGA 3W0OA 2XARA 2XZSA 4YU2A 4G3GA 3KB7A 4AQKA 4DH5A 4FTOA 4D1XA 4MXAA 1UU7A 3OW3A 3JY9A 5AMNA 4IX6A 2HYYA 3OD6X 4U3ZA 4G16A 4UWBA 2R5TA 1YXUA 1G3NA 4ANMA 3NCZA 2G2FA 4X3FA 4C57A 2IZSA 1WZYA 2AUHA 1YI3A 2GFSA 1H07A 4IB1A 4AOJA 3UDTA 1Q24A 4C38A 3C9WA 1Y91A 2UW8A 4FR4A 3UDZA 3OHTA 4CG8A 3LFBA 1H28A 1W7HA 3MFTA 3OG7A 2QOQA 4OTHA 4G3DA 2OXXA 4O7VA 3FZSA 2WTDA 4KIOA 5HNBA 1JSVA 1M52A 2IPXA 2UW4A 4FNYA 4RJ4A 2PY3A 5BX0A 2BHHA 2WTIA 3VHKA 5B7VA 2XYNA 2WOUA 3EQCA 3L8XA 1HCKA 1WFCA 4O91A 2UW9A 2QOFA 2E9OA 4KIKB 2XNMA 3RNYA 2B53A 4D1ZA 2R3QA 4QMTA 3KXMA 1BX6A 1Q61A 3R7UA 3E7VA 3L8PA 4KABA 4A4OA 2P2HA 4DFXE 5DEYA 3OF0A 4I94A 4F9CA 2Z7QA 4J53A 2QOOA 4QP7A 4RFYA 4I0SA 5E8SA 5HD7A 4EOKA 4FT7A 4FIEA 3VAPA 5A4TA 5IA0A 5I0BA 4NT4A 1G5SA 3H10A 4IBMA 4CYJA 2B0QA 2IWIA 5CZIA 4ANLA 3IDBA 5K3YA 4ITJA 3VUHA 4PTCA 3U9CA 2UW7A 4F9AA 4BRXA 2F9GA 4HGLA 4DFBA 4B7TA 4FKGA 2XNGA 4FSRA 4N70A 4YZBA 5CYIA 2W1DA 4XG7A 4APPA 5HX8A 1GZ8A 3PIYA 5BVNA 2H6DA 4YTCA 2RF9A 5HNGA 4LOPA 3I0OA 1JWHA 4ZOGA 1XMMA 2WQMA 2YEXA 3CJGA 2Z60A 2J2IB 4LDTA 4I0RA 1WBPA 2YZAA 1PXOA 4M97A 4AFJA 3QALE 3BHVA 4O7SA 1Y6AA 3KRWA 2X9FA 3LCKA 2ZJWA 3ZM9A 2W1FA 1YOJA 3E63A 5H3QA 3ZO3A 4ZJVA 3SQQA 2CNVA 4EZ3A 2VO3A 5FDPA 4TRLA 3UVPA 4FTNA 3EN6A 3PXFA 2QO7A 4MYGA 3R63A 4JDHA 2QONA 4Z7GA 2Y0AA 5HTIA 3CXWA 5CT0A 4D5HA 2FO0A 3C4WA 4FVRA 3MSSA 3RK9A 5F95A 4D2SA 2W4JA 3EL8A 3SW4A 4R78A 5D12A 3QUPA 4D0WA 4E4LA 5KKRC 5AWMA 3VUDA 2BFXA 5IUIA 1L3RE 3LM0A 2VWWA 3W2PA 3LKMA 4DYMA 4RX8A 2JKOA 3WIKA 5HTCA 3NAXA 4O4CA 3R8LA 3EN5A 4KBCA 3TZ7A 2XNEA 3WZEA 3D4QA 4P2KA 4ZY4A 1KUTA 4ENXA 5IA1A 2X0QA 5D1JA 3EMGA 4FV0A 4XG8A 1PXKA 2ZM1A 3DLZA 3DY7A 4K0YA 3LCOA 3TACA 4MEDA 2WTWA 2XIZA 3AMYA 3GC9A 3PVUA 4UXQA 4EUTA 4DGNA 2ITXA 3R73A 3LXPA 3HP2A 4Q5EA 4RJ3A 5AV1A 3FYJX 5JK3A 4RSSA 5IQAA 4KRCA 3EWHA 4HCVA 3T9TA 1XH5A 4B0GA 3A8XA 1W98A 3UP2A 4RWIA 5CU3A 1H4LA 2G2HA 4BTMA 5FRIA 1URWA 3PVGA 4AZEA 3BZ3A 1XO2B 3AG9A 3W0NA 2UW6A 1B39A 3DXNA 5HBHA 2XEZA 1ERKA 2YAAA 5K0XA 4DINA 3BLRA 4YGAA 3RM7A 5KMLA 3RAKA 3GEQA 4IVCA 4RX9A 4KKEA 2PMOX 4X0MA 3DK3A 1JSTA 4H3BA 2OIDA 5GZ9A 4BDHA 3F88A 1OPLA 4CFVA 3ZC5A 3D83A 3MJ1A 3GCUA 4J8NA 3WZKA 4AZFA 2ZM4A 4O7ZA 4FZAB 4O84A 3H9RA 1Q5KA 3PZHA 5TE0A 2EUFB 4DGMA 4E4NA 3GC7A 2ERZE 4B8LA 4O22A 5CAUA 4ZAUA 4AU8A 3RPSA 2NYAA 4DAWA 3R1SA 3L8VA 4F63A 2PMIA 3R1NA 4G5JA 3NMUF 4O0TA 5ACBC 5AFVA 2ZV2A 2PULA 5A4EA 5A6OA 3U4UA 1G8AA 1MQ4A 3OUKA 1UV5A 4GEOA 3NFGB 1Q8YA 4UWCA 4ZXTA 3OWLA 2NRYA 2ZB1A 4MXXA 4QQ5A 2YERA 2BVAA 4ANOA 4JOAA 4UYAA 4I3ZA 1T46A 3RTPA 4CFXA 5FLFA 5ANIA 4CYIA 1XMLA 4QMUA 4FV1A 4O38A 2I1MA 1STCE 1H24A 2PK9A 3I79A 1H25A 4FIGA 2ZVAA 2W7XA 4NCTA 3C0IA 5L6WL 5JZJA 5HQ0A 3SKCA 5HE1A 3ZU7A 2GS2A 2ITNA 4BDGA 4M69A 2CNQA 4QTDA 2OG8A 3VF9A 4DBNA 4Q2AA 1H1RA 2LGCA 5CAOA 3OS3A 3LFDA 3Q3BA 3UOKA 3PUFC 3OC1A 4HPUE 1YVJA 3AC2A 3CQWA 3CGFA 4ONAA 3GXLA 4HVIA 4O21A 3GGFA 3RWQA 1OL5A 3B8RA 4ORKA 1VYZA 3BYOA 5BYYA 4O1PA 3G0FA 4E3CA 3LJ1A 2UZTA 4C59A 4DGLC 3ZUUA 1BL6A 2VTLA 4X3FC 3D7TA 3BHTA 3E8NA 3AMAA 4JG8A 1SM2A 1BUHA 2PE2A 4IH8A 4LRKA 4MQ2A 4W4YA 1FGKA 3F5UA 4QMQA 4JR3A 3OCSA 4RJ6A 5AP3A 5ETFA 5HO7A 3EIDA 4KS7A 5AM6A 5AR7A 1XJDA 5LMKA 4FTTA 1U59A 1GNGA 1SVEA 3D94A 3RCJA 4D4RA 3RBWA 2F2CB 3QC4A 3FKLA 3ANQA 5CAPA 2PUNA 3NYNA 1H1QA 2ZV8A 4BBEA 4CFMA 3NPCA 5AEPA 2J6MA 1YHVA 1YOLA 1ZRZA 4KIPA 4KRDA 3SV0A 1BKXA 4A4XA 2WTKC 5CSHA 5HVJA 5IH4A 2GU8A 1QCFA 3ML1A 5AUTA 3E5AA 3HRCA 4HVDA 3Q6UA 3EJ1A 2YACA 1TQIA 3QKMA 4YJQA 4CZTA 1PMEA 2JFLA 4J1RA 1Q97A 4RZVA 3UGCA 5CSVA 2E2BA 4YZ9A 3RPYA 2HZIA 3KK8A 2X8IA 3E62A 3H9OA 4RFZA 4YNEA 5FEEA 5ANJA 3VN9A 4J98A 4C33A 2PU8A 5J79A 2GCDA 3NLBA 3QU0A 4M12A 3BQRA 3CC6A 4J95A 3HUBA 5CXHA 3RPVA 4ANBA 4R3RA 1GY3A 2ESMA 1UNHA 3KK9A 3CSVA 2QU6A 3MH1A 3SA0A 3AC4A 1CKIA 1WCCA 5D7VA 4QYEA 4RLLA 3OMVA 3FMJA 4D58A 3LAUA 2C6DA 4O7NA 4AX8A 4USEA 5IQHA 4ZTHA 3V8SA 4M14A 3LVPA 2BCJA 1LEWA 2R3JA 2A19B 2XK4A 4FNXA 5AP4A 1OL6A 3ZDIA 3JPVA 4LV8A 4JI9A 4BZOA 4EOSA 2RFNA 5L2WA 3TV4A 1SNXA 2ZYBA 3PJ2A 2C3KA 1TZDA 1PRYA 3C4EA 2OLCA 5CF5A 3TNQB 2IG7A 4IAYA 3MPTA 4QTBA 5FTOA 3F2AA 3AXWA 4YJNA 5DMZA 5C4KA 2VV9A 3NRMA 3EQRA 3SX9A 3LXLA 5HE0A 3SOAA 4FTLA 4YURA 4EC8A 4EOOA 1KOBA 2GQGA 1Q3DA 3NUPA 4QNAA 5HCXA 3VRYA 3MTLA 2CGVA 3P23A 5HI2A 4DFYA 4P90A 2X2KA 3BYSA 5J1WA 3PJ1A 3KL8A 3UIUA 4L7FA 4PP9A 3TTIA 3N4VA 3E93A 2QR8A 4LG4A 3WARA 4R1YA 4CKIA 2CSNA 1Y6BA 1Y8GA 4M3QA 2G01A 2ZDTA 3POZA 4FI1A 1FGIA 2PVHA 2A0CX 5L8KA 1GZNA 4O7RA 3ZFYA 4GYGA 4I6QA 4KA3A 4F1TA 4DDGA 4G17A 4AXFA 5E1SA 2XKEA 3QL8A 4RQVA 4EI4A 3TNPC 3DBDA 4QP8A 3Q4CA 3EZRA 4BTKA 4F99A 2Z7LA 4ZLZA 1AD5A 1ZYSA 2HK5A 2IVTA 3C7QA 3AKKA 3HDNA 2FSLX 3VUMA 3A2CA 3CTHA 5HO6A 4FSMA 2R0UA 1OKVA 5EDQA 3UO6A 2C6KA 4G2FA 2UW5A 3QD4A 2R4BA 4OTFA 2JKKA 2ITVA 2FUMA 3Q60A 1O6YA 2VD5A 2P2IA 5IEVA 4DEDA 2W99B 4Z7HA 3ACKA 1XR1A 3WE8A 2B52A 5A4LA 3TEIA 4CMTA 4TNBA 4Y72A 3VUTA 1H1WA 5AA8A 1YWNA 1YDTE 4ZK5A 4JDKA 2QC6A 4HGTA 4O7TA 2R3NA 3R9HA 4BZDA 3OBJA 4RJ5A 3RHKA 4FIJA 5AIKA 1CKJA 1NY3A 2FB8A 2UW0A 2ZOQA 3KXGA 4FODA 3BE9A 4X2GA 2YA9A 4K18A 4C62A 3SD0A 1UNGA 3A61A 5LVNA 4O2ZA 3C0GA 4QP3A 3DT1A 4EH2A 3HV6A 2YN8A 4EONA 4YC3A 4U6RA 1P4FA 4YBKA 1KV1A 3EN7A 5IMEA 5ITAA 4RIYA 4U8ZA 3W0QA 4BCMA 3FMLA 4A4LA 4FL1A 2C6LA 3HZTA 4XP0A 2R7IA 3QTRA 4LV5A 4GT5A 5AUXA 3RCDA 3C4XA 4G6LA 3S95A 3F5XA 2F2UA 4XP3A 1WVWA 4GIHA 3BYMA 4R7IA 4XH6A 5LWMA 1OIYA 3V8TA 1WBOA 4QO9A 4TYHB 4MBIA 4X6RA 3KREA 5HKMA 2HENA 4R3PA 1MP8A 4PPCA 4BF2A 3RM6A 3P7CA 3S2PA 3UC3A 3UQCA 3OCGA 5J87A 4PWNA 4YO4A 4RC3A 1YI4A 2YLEA 3MVLA 5HCZA 4EOQA 4DHIB 2FH9A 3UVRA 5FXSA 4IHPA 3DPKA 4DG3E 2UZVA 3R71A 4TZRA 3AT3A 4TYGA 3PXQA 1IA8A 2XYUA 3W0MA 2XK8A 3PZEA 5EK7A 3BGZA 5DIAA 3BL9A 1O6LA 1P14A 2Y6MA 5KHXA 4QYFA 4ALUA 1KWPA 4DHZA 1UVRA 2JDOA 4NCTC 5E8UA 3MESA 4BJJA 3DJ6A 4JBQA 3UNKA 3R7IA 3V5TA 2W9FB 3FZ1A 2F7EE 1R39A 5IUGA 5CI7A 4BB4A 2YABA 4FKSA 4A06A 3IONA 3KF7A 3KN6A 4IW0A 2QHNA 3B2TA 5C4LA 4I23A 4TTHB 4PDOA 1XH6A 4GV1A 4EQMA 2W1ZA 5EFQA 3TNHA 5IQEA 4IVDA 4FUXA 3R9OA 2HY81 4L46A 4E73A 4KBKA 3Q9XA 3CCNA 4OW8A 3UYSA 5AV4A 4O82A 3V8WA 3ERKA 4FL2A 3ENHA 3ZEPA 3UDBA 4IWOA 1GIJA 2YIQA 3UODA 2B9JA 3BYUA 3HA8A 5HLNA 3LQ8A 4MKCA 4XNEA 5M4CA 4TN6A 3KCFA 3KF4A 4YP8A 4OT5A 4YUQA 4I5HA 1JSUA 4K6ZA 1BMKA 3O0GA 1J1BA 4X2FA 4M15A 5LMKC 4RWLA 3HUCA 3K3JA 3V51A 4DF3A 5C26A 5JFVA 2ITTA 1GIHA 2WO6A 5DVRA 5BVDA 5M57A 4BC6A 4EK4A 4D28A 3LJ2A 3LQ3A 4NTTA 4U9AA 2OF2A 2GHLA 3PE1A 5CF8A 2JIVA 2QQ7A 3K5VA 3R1YA 1NVSA 3IS5A 4FZ6A 4RGJA 4UBAA 5CU4A 5DH3A 3L9PA 4BTJA 1FINA 2JGZA 3MIAA 4FV2A 4HZRA 2PZ5A 5KMKA 2ITZA 3TNWA 3LIJA 3ACJA 3UC4A 4RC2A 3LMGA 4OLIA 1U4DA 4QD6A 4ASXA 2OFUA 2XA4A 4EOPA 2XIXA 2A27A 5JRSA 2W4OA 3VBYA 4CKJA 5CY3A 5CU6A 1DAYA 5J5SA 5FUTA 2AQXA 2OKRA 4FT5A 2BMCA 4DN5A 2VNYA 4QNYA 5B2LA 4TWCA 4YSJA 4PMSA 3VUGA 1IG1A 4G31A 1BLXA 3G0EA 5BNJA 2PVFA 4XEYA 4DG0E 4BGQA 4O7LA 1XBAA 3EFLA 3VNTA 4FL3A 4JDJA 3O8TA 4I6FA 4NM0A 2BZHB 3D7TB 3R28A 3W0RA 2OXDA 2XNOA 3LQ5A 4MBLA 4L52A 4Y73A 5EM8A 4YTFA 5CEOA 2CKPA 4YMJA 4O83A 4YSMA 3QUEA 5CEQA 2BILB 3MFSA 4LFIA 1PHKA 4MNEB 5CF6A 3R0TA 3NCGA 3NS9A 5M51A 2XAOA 3UOLA 4IVBA 4U40A 3UNJA 2A98A 3VC4A 3NW6A 3FAAA 4EOLA 4MXCA 3WE4A 1OIRA 4AE6A 4FKJA 3TDWA 4X2KA 4U7ZA 2CKEA 1MRUA 3DQWA 2V7AA 3MY0A 3QCSA 3FL5A 2PMNX 4KKHA 4O0VA 4YZMA 1FPUA 2VO0A 3ORZA 4XG6A 4QDEA 5JGAA 3IQ7A 1OB3A 2GNLA 3Q53A 4G9CA 3IO7A 3IG7A 4KINA 4OTIA 4FIFA 3ORTA 3RAHA 3U9NA 3UMWA 3GFEA 3LFAA 4YLLA 4FSZA 5BUEA 3DV3A 4HCTA 5IPJA 3ZC6A 4DDIA 3QUDA 5L2SA 4BCQA 4CQEA 4EOIA 5KMMA 1V0OA 5AR2A 5HLWA 4DLIA 1Q41A 4YHTA 4CGAA 2PVNA 3DDPA 5KNJA 1KE5A 2VTAA 4CKRA 2ETKA 5LVMA 3ZMMA 3EHAA 3KXHA 3TCPA 2VTSA 1ZWSA 5TOZA 4X2NA 4PL4A 5CX9A 2X81A 3JS2A 3QZGA 5K4JA 1CKPA 2XAMA 2WHBA 2OJGA 1QPCA 4B4LA 2UZLA 2X6EA 1OECA 2HXQA 3E64A 3LCDA 2X0PA 3QGYA