5ETIA

Structure of dead kinase mapk14
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
355
structure length
355
Chain Sequence
MLEMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVRKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Structure of dead kinase MAPK14
rcsb
source organism Homo sapiens
total genus 110
structure length 355
sequence length 355
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5etiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5etiA01
2CCIA 2JC6A 4YJRA 4OTRA 1PYXA 5FUTA 2WMSA 3GI3A 2EUFB 5J95A 3AQVA 4NFNA 4J99A 4FYNA 4WRSA 3R8VA 3O2MA 2J7TA 2V22A 2VTQA 3BLHA 3EKKA 3ZO2A 4FTCA 4X3JA 3WYYA 4PMTA 3NPCA 5LCKA 4ANLA 2DYLA 2YN8A 4CFMA 2J50A 3DJ7A 4EH6A 4RFMA 1PXPA 5BUEA 4DN5A 3W2SA 3RPVA 2VTLA 3D14A 3Q4UA 4MEDA 5JFXA 1Q8WA 3ULZA 2FSOX 4CYIA 3TCPA 4CT2A 2GNFA 5HO6A 2YDIA 4CFNA 3TKIA 4MXXA 3HMOA 5FEQA 5KMMA 2CGWA 4AZFA 4CMUA 1Q8ZA 1JSVA 2C6EA 3C5UA 4M12A 3FQEA 5A4TA 1G5SA 1ZOGA 1XH9A 1PXOA 3FZPA 5L2IA 4XMOA 1NA7A 2R3FA 1U54A 4IAAA 3BYVA 4IIRA 4V01A 4MNFA 3HV5A 3NNUA 2V55A 4X7QA 5HG7A 5KMNA 3DXQA 3SG9A 3B8RA 3FPQA 2UW8A 3V8SA 4E7WA 4HPUE 5LMKA 1ZZ2A 5J9ZA 3KXXA 1W98A 4TXCA 4C4JA 4Y46A 3HLLA 3NLBA 3QKKA 1OVEA 4HZRA 4WKQA 3LFAA 4JXFA 3F3ZA 5CNOA 3CC6A 3CXWA 5M09A 2WTCA 5GINE 3RBWA 2XK7A 4RJ6A 3QGYA 4NCTA 4B0GA 1Y8GA 3S3IA 3QQGA 1YWVA 3W2CA 1YI3A 3FHIA 4OTIA 1PKGA 3AT2A 3GC8A 5JFWA 5CTPA 5H8BA 1VEBA 1OIRA 2F7ZE 5EI8A 5C8KA 5AV2A 1GNGA 3R2BA 2IW9A 4FK6A 2OJ9A 2B53A 4FV6A 4HNFA 4HOKA 4LUEA 3DZOA 3CTHA 3R7OA 2OO8X 4RWLA 3VWAA 4BCFA 1P4FA 1OPKA 3QCSA 4ASEA 5K5NA 3CD8A 3TNQB 3P7CA 4BCOA 3PY0A 4FEVA 3AT3A 3P1AA 5K5XA 2XKEA 3AGLA 5KKRB 3QRJA 2I1MA 3P79A 5AV0A 4NIFB 1XH5A 4ZTNA 2YM5A 4DC2A 4JT3A 1UWHA 5AEPA 4GK3A 2BRHA 3RK7A 3ZTXA 4BCJA 4D2SA 5HCXA 2BAJA 3TUCA 3UNZA 4UWBA 4FKIA 3SXFA 3PDTA 4YR8A 1BX6A 4I5HA 1FGIA 4RC3A 3VS3A 4IVDA 3VUGA 3FHRA 3KF7A 3I0QA 5DR9A 1OBDA 3PP1A 3R9RA 2WTIA 4ZJVA 4BGQA 3PVWA 4RT7A 4L01A 5B0XA 2UZLA 3OCGA 4YZ9A 5F9EA 5GIPE 3ZXTA 4AZSA 4A9RA 3C13A 4FI1A 4G1WA 5CU0A 4FIGA 3SLSA 5HE3A 4XOZA 4EOPA 4BI0A 3RHKA 3ZONA 5G6VA 4XH6A 3UNJA 4IZ7A 2XK6A 3OCTA 4FKLA 4NYEA 2C3JA 3HECA 5EI2A 3WILA 4ZAUA 3VJNA 4BF2A 4C4GA 3DJ6A 2J5FA 5GZ8A 4BZOA 3VN9A 5FQDC 4FNWA 2V7OA 3C9WA 3LMHA 2HYYA 1MRVA 4NM3A 3SG8A 4JAJA 5CZHA 4ZS0A 4CZUA 4I21A 4NT4A 3RPOA 3E92A 4FTNA 1BL7A 5JRQA 3M1SA 5HEZA 4UN0C 2OBJA 3C4WA 5HNGA 1I09A 4G31A 3D7TB 4RJ7A 4BGGA 4MYGA 5BVDA 4F4PA 3HV3A 1BI7A 4O91A 2R3RA 3FMEA 4MNEA 3MW1A 4TN6A 4ZS4A 4AA0A 4O1PA 4CG9A 2XJ1A 4IBMA 3KQ7A 5DMZA 4DEGA 2J0KA 3EYHA 2XM9A 4FV9A 4GJ2A 4DH3A 2KULA 3IW6A 3IGGA 2J6MA 4M8TA 2IN6A 5CYIA 1FMKA 4JBVA 3RM6A 5M53A 4OAVB 4FKVA 3C0IA 3P86A 4O86A 3OMVA 2JBPA 3A62A 4G5JA 4L8MA 4O0TA 4Y5QA 2V0DA 4E6QA 4QMYA 3LFCA 1TVOA 2XK3A 4J71A 3TV7A 4U9AA 5A3XA 3ODZX 4DCEA 2BZJA 2X8DA 3ALNA 3ITZA 3W32A 1PXJA 2VTAA 2W1FA 1MQ4A 4LOOA 2BR1A 5HNIX 2F2CB 2AC3A 4YTIA 4G2FA 3WF6A 4BCKA 1ZYSA 4FIFA 4QNYA 4C61A 5A4QA 4GK4A 5CQUA 5EHLA 3V5TA 4BBMA 2QO2A 4RBLA 2PVKA 4OLIA 4H3QA 5M56A 2JIUA 5TR6A 4DT9A 4U79A 3P9JA 3CGFA 1YVJA 5D1JA 5BVOA 3PE1A 1PXMA 5DNRA 2CLXA 4JR7A 4RZWA 4E4XA 2OIBA 3AT4A 3P08A 4XNEA 5BUJA 5E1SA 3ATSA 1V0OA 1H25A 4M15A 4FSMA 3KXZA 5EM5A 4HCVA 2CNVA 2Z02A 4DITA 2BZHB 3WYXA 3IGOA 2WGJA 4ALUA 2C0OA 3LMGA 3MIYA 4Z16A 2W1DA 1U4DA 3FC1X 1KE9A 5AA9A 4TT7A 3V6SA 5J5SA 4I94A 4DH5A 5HQ0A 4M84A 4NW5A 3VRZA 4KKGA 3FLZA 5FRIA 3SOCA 3VHKA 4EJNA 2E9NA 3ZM4A 4BN1A 4IB1A 1PXNA 1Y6AA 3MTLA 4BWPA 4K0YA 2HZ4A 2VX1A 3BU6A 3KVXA 4AN3A 4FBXA 4AOJA 1H0VA 2P3GX 5A4EA 3KXHA 3EL8A 3I0OA 2G2HA 5AV4A 2YA9A 4FSUA 3E64A 4FTKA 5C4KA 3H0YA 4LG4A 3NEWA 2UW5A 5FP5A 3PPKA 4RX9A 3MVMA 2PU8A 2F49A 4CV8A 4IHPA 3R1QA 1WBOA 3R30A 2I0YA 5FP6A 3IECA 3AXWA 2X9EA 4PF4A 2FYSA 3BEAA 3MWUA 5C03A 2OJGA 1CKIA 3HX4A 4DBNA 4I3ZA 2W05A 3M42A 1XBAA 5E92A 2PE2A 3LJ0A 3NUYA 2PY3A 1YI6A 4IM2A 3CJFA 1J7UA 3BQRA 2E9OA 4DH8A 2W1HA 3OC1A 3NUAA 4GFOA 2QC6A 3QL8A 2ZV8A 4C34A 2HZIA 4FTOA 3TTJA 4TL0A 3QC9A 4Z9LA 4FICA 1NY3A 5HLPA 3UG2A 4K9YA 5EYDA 3EYGA 4E26A 4KIPA 3BYUA 4XYFA 3MBLA 3U87A 3JVSA 3K5VA 4FEQA 3OS3A 4NM7A 2HZ0A 3QTZA 3L8XA 2X2LA 3SRVA 1A06A 2WB8A 4IX4A 5DA3A 5GJFA 4F9CA 4O0RA 2ERZE 3KF4A 2BILB 1WZYA 3VRYA 1TQPA 2ZJWA 3EJ1A 1MUOA 1Q8TA 3HYHA 4N4SA 5JGDA 5FG8A 4OBPA 4LV5A 4Y83A 4XHKB 3DKGA 4GJ3A 3UODA 4BDBA 4BVUA 2YIYA 4D28A 4LMNA 2YCSA 4JRVA 4NWMA 3C1XA 5ANOA 5L2QA 3D2IA 1K2PA 5FWKK 4FG9A 5JFSA 4KSPA 2YM3A 2OICA 1PXKA 4QQCA 4XG2A 3QD0A 5ETCA 5ETIA 4X0MA 1QL6A 1JKSA 3KREA 3Q04A 3VBTA 1M7NA 4A9SA 2XNNA 2PMLX 3P0MA 3QQHA 4E6AA 2UZVA 2CCHA 4QMXA 3LFBA 2EXMA 4I0TA 4U42A 3GGFA 3F2AA 3MY0A 3BU5A 4BTFA 3ORMA 2B9HA 3IDPA 3DY7A 3NCGA 1W7HA 3DK3A 4DFZE 5CZIA 4QMQA 3BEGA 5AR5A 4AGUA 3CIKA 3LZBA 3Q60A 2WMAA 2X9FA 4EK4A 5LVOA 4G16A 3FLQA 4F09A 2BFYA 3ORXA 2WIHA 3QTWA 5KKRC 2E9UA 3V8WA 2R9SA 3OT3A 2HY81 4QP8A 3WF5A 3F6XA 2J0IA 4FNYA 2PZIA 2X7OA 3DOGA 1ZRZA 1Z5MA 3PWYA 4RJ8A 2PMOX 4BBFA 5K0XA 3QU0A 4KIKB 4YZCA 1ZWSA 4P5QA 1E1XA 4BHNA 2JDSA 3TWJA 1H1WA 3KU2A 5DHJA 4FKOA 4FNZA 3EOCA 4V0GB 2QOLA 5DEWA 2JAVA 3AC3A 3FV8A 4I92A 3QD3A 3DAEA 1M2RA 3COMA 5GHVA 2B52A 2YCFA 2RIOA 2B9JA 4GRBA 4J8NA 3RJCA 4ANNA 4PX6A 1DAWA 3TIZA 4TYGA 4APCA 3U8WA 3A7GA 5LQFA 4PTEA 5IA2A 4C4IA 3HEGA 4KRCA 4O22A 4O0VA 2PVFA 5J87A 3R7UA 4RC4A 4CCBA 4EOJA 5JGBA 3E62A 2XYNA 2QQ7A 3EFJA 5B7VA 3F3WA 4IE9A 2CKQA 4E5WA 4O1OA 4YBJA 2J0MB 2X8EA 5J79A 4CZTA 2H96A 4TYHA 3I1AA 1R78A 3ZMMA 4XG9A 3FKNA 3HP2A 4HVHA 3MH1A 4QP6A 3DV3A 4NTTA 3R63A 3KVWA 3JXWA 2F9GA 3RAIA 3E63A 5G1XA 4EH5A 4OR5A 3PJ1A 4U0IA 2W1EA 5D11A 3KRWA 5FTQA 3BE2A 3IW7A 1M52A 4IVBA 4MH7A 4EH4A 5I5ZA 4C35A 3OEFX 4S31A 2C6KA 1DAYA 3FJQE 4PY1A 5HHWA 2QO7A 2WHBA 2YIXA 2O64A 5A6OA 1WVWA 5ANGA 3FBVA 2C5VA 5AX3A 4F9WA 3R22A 3IK3A 3FMHA 3L8PA 3UIBA 2XIYA 2R64A 4FKQA 3UDBA 2R3HA 2OXXA 2GFCA 2EWAA 1AQ1A 4YSMA 3S2PA 4QMUA 1KOAA 2P55A 2V62A 5C8NA 3W10A 5AR8A 2O63A 1H27A 2VWIA 1PYEA 5AR7A 4QO9A 4CKJA 4I24A 2YHVA 4G9RA 3CPCA 2YIRA 5FBNC 4TW9A 3WOWA 2KTYA 4M69A 3R83A 4YJVA 2AYPA 5L6PA 1SNXA 3RAHA 2W7XA 3GC9A 1LP4A 1O6YA 2P0CA 2PVJA 3LCDA 3ODYX 5CEMA 3R1NA 4HZSA 3F5XA 4K18A 1FQ1B 4NTSA 5I3RA 2GQRA 4D58A 4FZ6A 3W16A 3NW6A 3R8LA 2CKPA 5I3OA 4IDVA 5M06A 5AFVA 2Y4IC 4FSWA 5L2SA 5I0BA 2HW6A 4ANQA 5CASA 3O8UA 3ZC5A 4M7IA 4Q5EA 4IZYA 3HMMA 1KE5A 1JBPE 5KBQA 2QD9A 5FEDA 1UV5A 3GU5A 5HE2A 3UC4A 3HUBA 3NSZA 3RI1A 4GUEA 4A9UA 4YZDA 3U4WA 4EZ7A 4H36A 5LVLA 4UXLA 3UBDA 4GH2A 4IAZA 3KRLA 3SW7A 3VNTA 4Y73A 3OWKA 4RJ3A 5K4JA 5CEQA 4H3BA 3MSSA 2GQGA 4ZSAA 4HYIA 1PMNA 1YWNA 5IA3A 2WFYA 4II5A 3ACJA 4IAIA 4CYJA 3TUBA 5KBRA 4F6WA 4H05A 5ANEA 3R9DA 4F0FA 2A2AA 5DRBA 4YC3A 5ANIA 2PZ5A 4NU1A 3SHEA 4MVFA 1W84A 3GFEA 2OF4A 3LKMA 5L6OA 2UZDA 3ZSIA 1WBWA 5CF8A 2JKKA 3GUBA 4N6ZA 3IOKA 4MX9A 4B7TA 4CD0A 4AZTA 5M4UA 3OZ6A 2F57A 4FV7A 4HGLA 4K8AA 4NEUA 4QTEA 4FOBA 1XQZA 1PXIA 1ZYJA 3CQUA 3FC2A 3IDBA 5HIEA 3UC3A 3HRBA 2OIQA 3ZHPC 3NIZA 2JLDA 3EQHA 1GZKA 5CU6A 3WE8A 2IVTA 4HPTE 4AUAA 4O84A 1YHWA 2WMVA 5AV3A 2RG6A 2WPAA 3GNIB 1BMKA 2JAMA 4HNIA 5IQDA 3QUEA 4AE9A 4O2ZA 4CQGA 5ETAA 3W55A 3EFWA 4FKJA 3DZQA 4FV4A 4L00A 3FMDA 4FSQA 3HMNA 5HGIA 5BVEA 1IA9A 5CI7A 3ID6C 4FTUA 2YJSA 3FSFA 2JDOA 3MDYA 1FGKA 4HGTA 1QCFA 2UW9A 4J8MA 2X2KA 4KB8A 4X3FB 4XBRA 4PDPA 4YNOA 3GU4A 4JIAA 3WIGA 4JS8A 4CMOA 4J52A 5M4FA 4FKPA 2RKUA 1BUHA 3FY2A 4WHZA 5K3YA 2O5KA 3MB7A 4TTHB 3QZHA 4YU2A 4HVIA 4D1XA 2IO6A 5JQ5A 1OL2A 3VHEA 3BIZA 1T46A 3UJGA 2FH9A 5BVWA 2UZWE 4AN9A 5LWNA 4UV0A 4BCMA 4X2FA 3DGKA 1OECA 3V8TA 5AUWA 4G5PA 2R5TA 3Q9XA 3MA6A 1CMKE 3KCFA 4BKZA 4EC9A 4EQMA 3MTFA 3ZFMA 2J90A 3T3UA 3ZC6A 2OJFE 4N6YA 3FMKA 5LMAA 2WQEA 4L9IA 4O7NA 4LQMA 3ATTA 4XG3A 4WO5A 3ZFXA 4E5BA 2VO6A 1Y6BA 1H0WA 4IANA 3B2WA 4BIEA 4PPAA 2XUUA 2GS7A 3A4OX 1ZMVA 3AGMA 1RDQE 3EN4A 3O0GA 4FV2A 4AZWA 2HWOA 3LFDA 4DG0E 4BTJA 1QPEA 4JDIA 5EYMA 3LXNA 2W96B 3V5LA 3Q6WA 4NSTA 4P90A 5CVFA 3A7JA 4LL5A 5IDNA 4XUFA 4ZTRA 2PK9A 2PVNA 1PMVA 2VTIA 2JDTA 2OK1A 4R3CA 2XNGA 4MXZA 4BIDA 4EOOA 2ZDUA 4FZFB 3D83A 2XM8A 3H9OA 3NW5A 5HE0A 3LCOA 4P7EA 4Y5HA 4ZLYA 3ZO4A 3BGZA 5CAQA 2PULA 3UQCA 4IB0A 3VAPA 1FVRA 1P5EA 4DINA 1YXTA 3TJCA 2ZV9A 4AE6A 4RFZA 3FLYA 3S4QA 4DGGA 4BY9E 3BPRA 4D1ZA 4FKSA 2W1GA 3OXIA 1Q3WA 2CJMA 5DBXA 3KGAA 5IQHA 3EFKA 3Q96A 2YM4A 3R02A 4LV8A 4FZAB 4IJ9A 4I0SA 3O8TA 3F7ZA 5DGZA 5F1ZA 3CTQA 4MBIA 4AFEA 1YW2A 4XEYA 4F7LA 5E90A 5I9XA 1W82A 4EK5A 3SVVA 3OUNB 3QTRA 4O7TA 1A9UA 4TWOA 5CEIA 4IXPA 4JNWA 5H3QA 4L43A 4WBBB 5EOBA 3KRXA 1OGUA 4RQVA 2VO0A 4D2VA 3O17A 3PXZA 3O96A 4XLVA 4PP7A 5HLWA 1GZNA 2YM6A 2VGPA 4YZBA 4ZMFA 4NKSA 3ZO1A 2HAKA 3FMNA 4O6EA 3F5GA 4E4NA 5EK7A 4IB3A 2P4IA 1JQHA 3KULB 3MJ2A 3NUSA 4WG4A 4AACA 1UNGA 1R39A 2JIIA 2V7AA 2EU9A 3WF7A 3IONA 2ZAZA 5JRSA 5HZNA 4YC8A 4KKEA 3ZUVA 5KUPA 2IW6A 2QVSE 3GCQA 3RWPA 4O82A 1L3RE 3MN3A 3O7LD 4FT3A 5LJJA 4RIWB 3MIAA 5C8MA 3FKLA 4Y95A 5IDPA 3G6GA 3G33A 3C4CA 3PZEA 4U45A 2A1AB 3AC2A 3LMIA 2QOOA 4I93A 5HU3A 2QOCA 4NIFA 3H3CA 2VWWA 2GCDA 2J9MA 3R01A 3TACA 4XV2A 4HVGA 4HVSA 2UVXA 3P7BA 2IZTA 2UW7A 4K11A 2B9FA 3C4FA 3CPBA 2VTHA 3I79A 1U5QA 3AMAA 3LM0A 4BDDA 2WMXA 2FSMX 4X2JA 4YHJA 3PXRA 2PMIA 3GQIA 4BTMA 4C62A 4EEVA 3MFUA 2AUHA 3R21A 5I9UA 1GAGA 1QMZA 1J91A 3DT1A 4G6NA 2IZSA 4I4FA 4CT1A 4EOMA 3DFCB 5KCVA 3COKA 2UUEA 5HX6A 1LPUA 1G8AA 2WTKB 4I5CA 3ZDUA 4JVGA 4DEDA 4O0YA 5CALA 4F6UA 1GZOA 4WD5A 1OKYA 2VV9A 4GUBA 5L3AA 4IEBA 5DOSA 3WIKA 2PL0A 3SW4A 4MCVA 4QMWA 3DLSA 3Q3BA 3W2PA 5CT7A 4FTMA 3RZFA 5L8JA 4JIKA 4TWNA 3PLAE 3QHWA 4ZEGA 4H3PA 3VBVA 3PE2A 3V6RA 3DDPA 3OCBA 1XJDA 4IFCA 4MF0A 4O81A 4GEOA 1J1BA 2ITXA 3D7TA 5K0KA 5AUUA 3PXYA 4FV0A 4ASXA 1PKDA 1R1WA 1OL5A 4JOAA 5B2LA 3QUDA 3MPTA 4JQEA 5DN3A 2WMWA 5EQPA 2DQ7X 1UWJA 3NYXA 2F4JA 2RFSA 4WOVA 4PRJA 3RK5A 2JEDA 4PP9A 3U4UA 2Z60A 3MI9A 4AP7A 2GQSA 1ZARA 3NNVA 3TV4A 3RPRA 2ETRA 2ZM4A 3OXTA 4LL0A 5HVJA 3EIDA 2RG5A 2OI4X 5AP1A 5AP5A 3W1FA 2WQOA 2JFMA 3U6HA 3FZSA 1PY5A 4TNDA 3U6JA 4QMMA 4ERWA 3C51A 3NAXA 4U40A 4DCAA 3CY3A 4Y72A 2FSTX 2JDRA 4UMQA 4EOSA 3N9XA 5IQBA 4MD8E 5CXZA 2OZOA 4CFVA 4K1BA 4DFXE 4FTJA 3P7AA 3LXLA 2W99B 4O0XA 4JQ8A 4H1MA 3FXZA 3EWHA 3DS6A 2ONLA 4JBQA 4UYAA 3AD6A 3NMUF 3IW5A 5CX9A 4L52A 4QMSA 3UOKA 3HV6A 5AP6A 1YHVA 3R00A 3K2LA 5LVMA 4I6HA 4YPSA 4F99A 4NH1A 2GTNA 5J9YA 4B4LA 5J9LA 3BLQA 3MH0A 5EDRA 3MJ1A 3ZEPA 2VNYA 2JDVA 2RFEA 3DXNA 4W4WA 3VF9A 3CJGA 3G2FA 4FSZA 2C6TA 3VUTA 4BDAA 5LVPA 2BHEA 3QWJA 4I22A 5JFVA 4QP4A 2NPQA 5FLFA 4Z55A 3UO6A 4FMQA 4C0TA 1GIIA 4MXYA 4RVMA 3JUHA 3ZDIA 1WBTA 3PTGA 4G6LA 4JG7A 2XCHA 1CKJA 5IPJA 3N4UA 1PW2A 3RINA 4N70A 5HICA 5HBJA 2XK8A 4O0SA 3K5UA 3PA5A 5ANKA 5GZ9A 2R3KA 2X4FA 2XEYA 5AAEA 4X3FC 4D2RA 4LGDA 3MPAA 2XRUA 4ITHA 5E91A 4PMPA 3VBWA 3A8XA 2ZYBA 5M51A 4FSTA 3KN6A 2GDOA 3CKXA 3ZBXA 3ORLA 4DEHA 3UO5A 2BHHA 2IVUA 3H10A 3ANQA 1REJA 3NS9A 4G6OA 5HG8A 3VULA 4WNMA 2A27A 2R3OA 2BIKB 5IQGA 5LXMA 3RKBA 4K2RA 4QP7A 5CAVA 2WTJA 5GJDA 3TUDA 3GVUA 3T9TA 4MF1A 3LXKA 3ACKA 2XIXA 4DEBA 3DXPA 5IQCA 3E7VA 2OH0E 1VZOA 2FA2A 3DPKA 3QTSA 4AGDA 4GU9A 4M66A 1ZMWA 1G8SA 3OF0A 3SDJA 4CKIA 4FV5A 2W1IA 3Q2JA 3LCSA 4IWOA 5HKMA 4J95A 1JKTA 2PVLA 4L7FA 3U55A 2A4LA 5AP3A 4CRSA 4OAUC 4GS6A 4A7CA 5HX8A 2HY0A 4IWQA 3HKOA 4CCUA 1Z9XA 3E7OA 4DFUA 1IEPA 2GHLA 2W5BA 3GXLA 3Q32A 4ALVA 3ZLYA 3R71A 3BZ3A 2GHGA 4XS2A 3UG1A 4FKWA 2VWVA 4BIBA 3ORZA 3EMGA 4IZAA 1YXXA 4IDTA 3R7IA 3RWQA 2C6DA 4KKHA 2R7IA 4OUCA 3G0EA 4DH7A 3FEGA 3B8QA 5M57A 4EYJA 1IA8A 4W8DA 2YIQA 5DLSA 1P2AA 5CF5A 4U43A 5DEYA 4ZJJA 3QKMA 1SYKA 2ZM1A 2ITQA 3E5AA 4IM3A 5HIBA 3OG7A 2VO3A 3PXFA 1DS5A 4XCUA 4YJQA 4O2PA 2Y6OA 3PSDA 4KNBA 5ANJA 5FDPA 2HELA 1X8BA 4EWQA 2FO0A 2OG8A 4IAYA 2EB3A 2C6IA 3FMMA 4M0YA 5KE0A 5JSMA 1H00A 2C6MA 2W0JA 3DTWA 2C47A 3Q9WA 4YJOA 2XBAA 4EHZA 3QF9A 4HGSA 4YURA 4GMYA 1APME 1OI9A 4FEUA 4OTQA 4J53A 1ZLTA 2Y4IB 3C4XA 3COIA 3W8LA 5IQEA 4BFMA 2XVDA 3OWLA 4DAWA 4ENYA 4EUUA 5M4IA 4FTTA 4RWJA 1K3AA 4R5YA 1OKZA 3MFSA 5DYJA 4MXOA 4QOXA 5CY3A 1NVRA 3HNGA 4J97A 4BYIA 5K4IA 4EHGA 4HYUA 5FGKA 2ZB1A 3ALOA 3SV0A 2WMTA 3NAYA 4A9YA 5LARA 4O7WA 4TKSA 3FXXA 1WVYA 5HTCA 5FDXA 4BCIA 2QU6A 5JGAA 4I1ZA 1RW8A 4CLIA 3S1HA 3ZLWA 2ACXA 3LPBA 4PV0A 4I0RA 4O6LA 4ZSEA 5E9EA 1JKLA 1ZOEA 3F69A 4FT7A 4ZSLA 4USEA 3AOXA 3HMPA 2OWBA 3R28A 5DFPA 4LOQA 5AR2A 2BKKA 1ZOHA 3CY2A 2UZTA 1BYGA 4X6QC 5ETFA 4U5JA 4ACGA 4CV9A 5D10A 5DE2A 4IM0A 4KIKA 2HXLA 3NYVA 4IFGA 1LR4A 4QYFA 1TQMA 1GIJA 4AW1A 5KMLA 4G3GA 4F1MA 3PYYA 5J5TA 2X1NA 4V0GA 3DBDA 2R2PA 5CLPA 4FT9A 5TO8A 3SGCA 2UW3A 1IAJA 1OZ1A 4F70A 4D0WA 2VUWA 3FWQA 4FT0A 4F08A 4RG0A 1B39A 3HVCA 4A4XA 1YDTE 3HL7A 3KA0A 4YTCA 1HCLA 2WTKC 3FZRA 4MBLA 3K54A 4J1RA 3BWFA 2C0TA 5FTOA 4QTBA 2QO9A 4AU8A 2CHLA 1Q4LA 3FL5A 1UU7A 1R3CA 5CVGA 3HUCA 4CRLA 5IH5A 5F4NA 5BMMA 2FGIA 3QQFA 4KIQA 2YCRA 4NK9A 3DFAA 3R2YA 4O0WA 4QMVA 4ZSGA 4A4OA 4ARKA 2GU8A 5KO1A 1KE6A 3CQWA 3Q5IA 4R8QA 1Y91A 1VYZA 4F65A 4A07A 2PUNA 5F20A 3FZ1A 4UY9A 3QD2B 3QQLA 4DG3E 3FLWA 3D7ZA 5EYKA 3BI6A 3FQSA 4OTGA 2HENA 3I81A 3KY2A 2BUJA 5A4CA 2R3LA 3DQWA 1JNKA 2VX3A 4G34A 1H08A 3OWPA 1CKPA 2CLQA 3QA8A 3R9OA 3TIYA 5CT0A 3UOHA 4I23A 2I0VA 2IVSA 3G90X 2X4ZA 3QFVA 4WUNA 4R7IA 1WBPA 5B2KA 4UX9A 4PL4A 2UZUE 4E93A 1WAKA 1HCKA 2YM7A 1IAHA 3VUHA 4KAOA 4E73A 5IH6A 3LCTA 3NWWA 3WE4A 4NM0A 5HU9A 3Q53A 3UPXA 4BWXA 5AP7A 4AN2A 5FM2A 3VBYA 3QCXA 3EQFA 3PFQA 2WTWA 3V01A 2PHKA 3LQ8A 4RMZA 1H26A 4Y8DA 3L8VA 1FVTA 2WQNA 5H9BA 3ROYA 4CNHA 3IKAA 1U59A 4XG6A 2CKEA 5TKDA 3LCKA 2VWYA 1YRPA 1OITA 2BDJA 3DB6A 5E8UA 5EW3A 2W4JA 3G6HA 1FOTA 5TE0A 4AGWA 2BDWA 4ACDA 3R1YA 2R7BA 1PXLA 3VF8A 3KXMA 2Y0AA 5AADA 4BR3A 3DKFA 4IB5A 4LRKA 3LXPA 1PHKA 4LUDA 1S9IA 5FD2A 4C2WA 3Q4CA 5CANA 4GVAA 4JDKA 3LQ5A 4OTFA 5AMNA 4OTPA 3V5PA 4ZOGA 2CNQA 2R0IA 3NCZA 4XBUA 4Y85A 2WTVA 3CR0A 2BMCA 4EC8A 2YACA 3PA4A 4WIHA 1DM2A 1YHSA 2G15A 3GOPA 4NKAA 3PVGA 3VQUA 3CQEA 3LE6A 3OOMA 3DDQA 2VTNA 3HRCA 5HG9A 3UYTA 2B1PA 2HIWA 2OF2A 3TEIA 3IS5A 5ICPA 4NFMA 3LJ2A 2CGVA 4FSNA 4AWIA 3I5NA 4FIJA 4H58A 4QNAA 4DLJA 3FDNA 2BZIB 4S33A 4B6LA 5T6KA 5BYZA 3VS5A 3GFWA 2J5EA 1H4LA 4DBXA 3VJOA 4XG7A 3R9NA 5I9WA 3U51A 5CEPA 2WQMA 4IMYA 3BHVA 3L9LA 3ZS5A 3HDNA 3Q4TA 2R3JA 3FPMA 2A0CX 2IW8A 2QOQA 1QPJA 3RK9A 1R0EA 4YJSA 3AC1A 3POOA 5IEYA 2XNPA 3ZEWA 5DIAA 5IU2A 2BROA 3PJ2A 3TNPC 3AD5A 2HWPA 5EQEA 1H1RA 1SNUA 4BYJA 2VNWA 1WVXA 4JR3A 2PPQA 3DAKA 3N51A 4U97A 3EQDA 3F3UA 4L53A 3LHJA 2F2UA 1ZY4A 4RVTA 5HO8A 4MBJA 4AT3A 3L8SA 3AC5A 2YZAA 4XP3A 4JL9A 5HLNA 2WEVA 3HGKA 4MD7E 2BDFA 2GMXA 2BAQA 2GNJA 4FZDB 4KA3A 3NX8A 3MY5A 2C6OA 3KC3A 3OOGA 3TXOA 5LCJA 5M08A 5EM8A 3PSBA 5CEKA 3UE4A 2JGZA 2GNHA 2XZSA 2BFXA 2VTRA 5E8SA 4D2TA 5IZFA 5JMSA 3TDVA 4FL1A 1NW1A 2OFUA 4D5KA 5JEBA 4FVRA 1CDKA 5BNJA 3OTVA 3EHAA 3NRMA 2JKOA 4OT5A 4PL3A 3ZYAA 4C57A 1WCCA 4KIOA 4UZDA 3PRFA 4G3EA 4IVAA 4ZTMA 3JS2A 5H2UA 5EKOA 3QX2A 2WMRA 3LW0A 4RVLA 2ITOA 3LFQA 4B99A 1S9JA 4E6DA 2OJJA 4C3FA 5CS6A 4YGAA 4ZLZA 4L3LA 3DK7A 3UTOA 5J7BA 4CXAA 5AUYA 3MVJA 2WD1A 4K6ZA 4RIYB 1BL6A 5HOAA 3KMWA 5DT4A 5AAFA 2PSQA 3FI2A 2VWBA 3OVVA 4QTDA 2E2BA 5LWMA 4JG6A 3DAJA 4FKRA 2QG5A 5LMKC 2RFNA 3A60A 4DGNA 2WMQA 1OMWA 3CCNA 3SOAA 4LYNA 3G5DA 4TWCA 5HESA 3WZKA 5E1EA 3ZLSA 2YAAA 3FE3A 4RPVA 3VS6A 3C0GA 4YLLA 1UU8A 3L9NA 4HCUA 3EZVA 4O7ZA 3F2RA 1PMUA 5D12A 3F82A 4ZSJA 3RCDA 5BYLA 2JITA 3GCUA 4EZ5A 3BHHA 3MH2A 3FSKA 4CFFA 5HTBA 3DBQA 3QTXA 3TJDA 4F0GA 5EQYA 3OP5A 4M14A 5JH6A 4C36A 4EORA 3ROCA 3E8CA 3IO7A 3OWJA 3TNIA 3UYSA 5IQIA 3RZBA 3CBLA 4MWHA 3ZSHA 2H34A 1UKHA 2QNJA 3LFSA 2PZPA 2QOHA 3FZTA 4E5AX 4QTAA 4XX9A 5KHWA 4I6FA 5HD4A 3IDCA 4L67A 1KWPA 2H6DA 3TKHA 3DKCA 1REKA 5C27A 3RHXA 3VVHA 2OIDA 3HV4A 5EG3A 3KMUA 2VO7A 3RAKA 1YXSA 1PMEA 1RJBA 4H1JA 5E8ZA 5HCYA 3FL4A 4O38A 5EDPA 4YTFA 5IA4A 4AX8A 2BIYA 3UIXA 3R8UA 1GY3A 4EHEA 2O8YA 1FPUA 4ZTHA 3ORKA 1F3MC 4AOIA 4WT6A 2WIPA 4YBKA 4YZNA 4ZY6A 2YAKA 3KULA 1XKKA 5HG5A 4RA4A 2QOBA 3TZMA 3DQXA 1XH8A 3QUPA 4AW2A 4ZY4A 2UVYA 4PL5A 2XIKA 4FX3A 2VTMA 5E7RA 3TN8A 1MQBA 3UP2A 4JDJA 4GCJA 5GNKA 4RIWA 4BC6A 4FR4A 1Y57A 4DE4A 4R1YA 4N57A 1UNHA 4QPMA 4BHZA 5A6NA 3OXZA 5IH4A 4RRVA 4BRXA 3M2WA 4CFXA 4CQEA 3BGPA 3R8PA 2P2HA 2W1ZA 4MHAA 3ZZWA 4UMRA 3ZU7A 3VS1A 3BHUA 5KMKA 1KUTA 5IEXA 3OY3A 4ANOA 2I40A 2X6DA 3OW3A 3ZZEA 5CSXA 3AD4A 4FUYA 5J1WA 2C30A 5EDQA 3W2OA 4V05A 1JWHA 3KFAA 2QODA 4IX6A 4D4SA 2OKRA 4ZTSA 3EQRA 4NW6A 4DFBA 3H0ZA 3QRTA 2VWZA 3QBNA 4JQ7A 4L46A 4W8EA 1YOLA 4ANSA 3PSCA 3IW4A 3FI4A 1YDSE 4BDKA 2QI8A 3UP7A 3VQHA 3A2CA 4DFLA 4DTBA 4F9AA 1F5QA 5LVNA 2X8IA 5BVNA 1ZZLA 5C4LA 4QPSA 2W9ZB 4DFNA 3RNIA 4FE2A 4WSYA 1YXUA 3QXPA 3GEQA 4WRGA 3LLTA 1WMKA 1URCA 1BLXA 4FIEA 1W8CA 4G17A 1OL7A 4QYEA 1ATPE 3IQ7A 1J3HA 4AQCA 2XKFA 4S34A 4FKUA 2PVMA 2Z7QA 4FVQA 2HOGA 3BQCA 3PP0A 4XV3A 3R8MA 3TZ7A 3VS7A 2XCKA 3CKWA 4XRJA 1Q8UA 2XS0A 2XH5A 4QP3A 5I9ZA 5BYYA 4FEWA 5IISA 3N4VA 4L6QA 3H9FA 5CSVA 1J1CA 2Y4PA 4ITIA 4CFUA 2XK4A 4YO6A 3VBXA 5AR4A 3RVGA 4LRJA 3B2TA 2OGVA 3IW8A 4BDJA 3D2KA 3E3BX 2BKZA 2SRCA 2ZMCA 3E88A 4P5ZA 3NW7A 5A54A 3P78A 3Q5ZA 2W9FB 4X21A 3CSVA 4U3YA 4XV1A 4DEEA 5EOLA 4I5MA 4NUSA 4UBAA 4A4LA 4M0ZA 2XRWA 3SD0A 4HJOA 1OUKA 2VTSA 5EW9A 1GZ8A 3DBFA 5CF4A 1J7IA 1ZY5A 2C68A 4EBVA 4PMSA 1R0PA 3VBQA 3Q9YA 4PPBA 5TOZA 4U41A 3OD6X 4M67A 3R6XA 5T3QA 4UWYA 2H9VA 2R3MA 3KK8A 2Z7LA 4BDGA 5L2TA 1OPLA 4R5SA 3PLSA 2XNEA 3PY3A 4ANBA 2PVRA 4F9BA 1OPJA 3V5WA 3E93A 3ZSGA 4MQ1A 3VC4A 1UKIA 2O3PA 2PTKA 4X2NA 3DLZA 1ZXEA 2F7EE 4L3PA 1KV1A 3F61A 4W9XA 3GCPA 4PNIA 4Z3VA 4RZVA 3MB6A 3BYMA 4BCPA 4MQ2A 4AAAA 5L8LA 2QKRA 4BKJA 2WO6A 5CEOA 2XIZA 3UGCA 2WNTA 4GW8A 2NO3A 2QR8A 4BDHA 4BCNA 2ETKA 4WBOA 3EQGA 3C5IA 3JR1A 4IX5A 5AM6A 4BCQA 3NUPA 3UNKA 1CSNA 1OUYA 4JRNA 4YJPA 4ACMA 5CENA 1B38A 2ITWA 3G9NA 3UZTA 3DU8A 4Q5HA 2X81A 2XIRA 2IVVA 3A7HA 3QYWA 2Z7RA 2VAGA 2FB8A 3JY9A 3VUDA 4OBOA 4AF3A 5C26A 1T45A 4EK8A 2BTRA 4AGCA 1URWA 4IVCA 3HRFA 4HGEA 4XJ0A 5M55A 3Q4ZA 4JX7A 5C01A 1GIHA 3VIDA 3ZOSA 2QOFA 3F7WA 5ANDA 4YLKA 3OFMA 5L8KA 4QMOA 3LLAA 4EQCA 5IA0A 3QYZA 5CU4A 3V51A 4IJPA 4C2VA 2J0LA 3KMMA 3UMWA 4E1ZA 3DBCA 4QQJA 2QOKA 2CSNA 4DGLC 3FI8A 3BV3A 2R3PA 3W2RA 5L6WL 2OH4A 5IKWA 5D7AA 3T9IA 3DBEA 3FYJX 1XH7A 3RGFA 2GNGA 5D41A 1KE8A 3HAMA 2VTOA 4JG8A 5EW8A 2OLCA 1ZMUA 4NJ3A 4LFIA 5JQ8A 1XHAA 3F5UA 4BBEA 4EUTA 1XR1A 1UU3A 3QX4A 4O7RA 4YZMA 4E4LA 4F6SA 4QP2A 4F7SA 3P5KA 4FTRA 4JBOA 4AT5A 3AC8A 1Q5KA 4FK3A 5HBEA 4K33A 3F88A 3FZOA 4AA4A 2XNOA 5EI6A 2HCKA 4IZ5A 3EB0A 1FMOE 3SXSA 3SAYA 4GK2A 3E8EA 4A06A 4ENXA 4RX7A 2VGOA 1MP8A 4Q2AA 4B8MA 4B8LA 3MH3A 1QPDA 1H24A 4PDYA 2QONA 3GENA 3KXNA 3QHRA 4TZRA 5E8VA 4F64A 4GFMA 4O7VA 1JSTA 4RJ5A 4C33A 4C3RA 4EZ3A 4WNPA 5CSPA 4JBPA 3I6WA 4D2PA 4QQTA 4G3DA 3BYSA 2QURA 4YJNA 2Y9QA 4U80A 4YNEA 3HA6A 5AUTA 2OU7A 1P4OA 4LGHA 4S2ZA 1XH4A 2REIA 3K3JA 3WBLA 2RFDA 3EL7A 4FGBA 4TYIA 3BBTB 3GU6A 3SXRA 2FUMA 1V0BA 5F95A 3A61A 4U3ZA 4DF3A 1Q99A 1Q41A 3OBGA 1MRYA 3OBJA 2C3LA 2W4OA 4FG7A 3GC7A 5IUIA 3WI6A 4RX8A 3GP0A 3F3VA 3I4BA 4W4VA 2PUUA 2C69A 4YJUA 5M44A 4KUJA 4R78A 3PRIA 2P2IA 3NNXA 4MXAA 4S32A 4PMMA 3W18A 4QTCA 5GZAA 4QMPA 1EH4A 1M7QA 2WXVA 2UZEA 4IQ6A 3EFLA 3H9RA 2WQBA 4UMUA 3SA0A 3D0EA 1AD5A 2ZM3A 4FSRA 4DHFA 4F9YA 4DFYA 5CNNA 5AAGA 2PYWA 3E3PA 3QTQA 3CEKA 3D94A 3VUMA 4D0XA 3ZO3A 3LIJA 2GTMA 3ZM9A 1ZYCA 1RQQA 2VWUA 3UQFA 5L4QA 2ZVAA 4RIXB 2C6LA 5AV1A 3PJ3A 4I6QA 3MVHA 5TF9A 4BDEA 3FLNC 5CSHA 2X39A 5D9HA 3DKOA 5AX9A 4DA5A 2WU7A 3EQPA 2VTJA 2XA4A 1KOBA 5DG5A 3C50A 4AZVA 1O9UA 1H01A 3BGQA 3ORIA 5CXHA 5E8WA 2OW3A 4BI1A 2OZAB 5AR3A 3HMIA 4FV1A 4UWCA 1JSUA 4W4XA 3ZCLA 3DNEA 4F0IA 1LUFA 5JZNA 4EK3A 5FTGA 4XP2A 3V5JA 4YO4A 5E8TA 4FNXA 3MVLA 4O7YA 3QAME 1W83A 2P33A 2C3KA 5BVFA 3SX9A 2ZOQA 3HP5A 2PZYA 2C0IA 3MGYA 2YJRA 4YJTA 4ZZNA 2R0UA 3I5ZA 4I41A 4UYNA 2O2UA 3MV5A 2ERKA 4FTQA 2QHNA 5J1VA 3M11A 3PIXA 5AIKA 3NYOA 4USDA 3MFRA 4F7JA 4FUXA 3S00A 3ZBFA 3K3IA 4R6VA 2WEIA 4QMZA 2YISA 1SM2A 3OW4A 3UQGA 2J51A 4YMJA 4ACHA 4R77A 3D15A 2YFXA 4WA9A 2C5NA 4FTIA 3KL8A 4FV8A 3TG1A 3HA8A 4ERKA 1ERKA 3PIYA 4E8AA 3UZPA 4R7HA 4UB7A 4RVKA 4BZDA 4GG7A 3R0TA 1M2PA 2VTPA 4FTLA 4UEUA 1IRKA 3PG1A 4FG8A 3Q6UA 1WFCA 5KMJA 1H8FA 3I60A 1KSWA 5LMBA 2X2MA 4IW0A 2WTDA 3VS2A 3WF9A 4USFA 3VO3A 3QTUA 2Y7JA 3NVKI 4GYIA 3R7VA 2E9VA 5IA1A 3ET7A 4D4RA 4AZEA 2PVYA 3TNHA 4EH3A 4M97A 5C9CA 1OM1A 4GSBA 3CD3A 4IWPA 4WG3A 4ORKA 2IJMA 5GJGA 2VD5A 3QGWA 2HK5A 2PMNX 4QPAA 1YKRA 3MFTA 5H8EA 5DR2A 5TT7A 4MD9E 1OIQA 3I7CA 3EQCA 3C4EA 3FI3A 1JAMA 3PPZA 4RLKA 1Q24A 2LGCA 2ZDTA 4OTHA 2CMWA 3COHA 1SVEA 5KMIA 3QQKA 4IX3A 2V5QA 1JVPP 1CM8A 1G3NA 3VW8A 2BTSA 3KCKA 5FXRA 1ZYDA 4FEXA 4CG8A 3D4QA 4JDHA 3RPSA 3PVBA 4GT5A 1U54B 4C8BA 4L42A 5AUVA 3BKBA 2XP2A 5E8YA 2G9XA 4LRMA 4U6RA 4J96A 3QC4A 5AWMA 4U44A 4CVAA 3QA0A 3O23A 3KXGA 4BCGA 2UW4A 2DS1A 1J7LA 2R4BA 2IZUA 3FY0A 3A8WA 3MYGA 2C5OA 3II5A 1XBBA 3PIZA 4OW8A 3EH9A 4ALWA 4DYMA 4O7LA 3NIEA 1H28A 3POZA 4QD6A 4KBCA 4XV9A 4EH2A 2UVZA 3QZFA 2PE0A 1STCE 3BYOA 3GOKA 5HE1A 4TPTA 3ZUTA 5A14A 5EYCA 4HYHA 4OTWA 1Q97A 3QCYA 3OUKA 4EKLA 3QLGA 4C4EA 4FGRA 3U54A 2W5HA 1OIYA 2VZ6A 3OTUA 3BLRA 5HIDA 4CLJA 2I0HA 4UMTA 4C38A 3ULIA 1ZAOA 4MKCA 1Q8YA 3LFFA 1K9AA 4BDFA 1OB3A 4Q9ZA 2GSFA 4EHVA 5BVKA 2YWVA 4W9WA 3AG9A 3BELA 2YLEA 4GFGA 4WG5A 4EBWA 3NVMB 2ITUA 5AJQA 3NNWA 3LOKA 3TZ8A 2HXQA 3BHTA 4OBQA 4BZNA 3JY0A 3QQJA 4NZWB 3T3VA 5IG1A 4WNKA 2J4ZA 4FF8A 5EM7A 3PY1A 4ZTQA 4QMNA 4FT5A 3GB2A 4RFYA 3UVPA 4XRLA 4KWPA 5K9IA 4E6CA 4BDCA 5IEVA 4XP0A 1YOMA 4R3RA 4B9DA 4EOKA 5HD7A 2I6LA 3L9PA 4C4FA 4I5PA 3SKCA 4EK6A 2W17A 2BRBA 1A48A 4RWKA 4ZK5A 4ZXTA 2ITTA 3VUKA 4YHTA 5FXQA 1H1PA 3D9VA 4ZZMA 5KX8A 3TT0A 4G3FA 2WAJA 4OGRA 1UNLA 4EONA 2BALA 2GNLA 4UZHA 3NDMA 5BMSA 2GFSA 5HNBA 3TTIA 3MS9A 1Y8YA 2RGPA 4JLCA 4L7SA 3E8DA 4EWHA 5I4NA 3D5WA 3O51A 4YHFA 3HZTA 4D1SA 4APPA 4RIOA 5HBHA 5DRDA 2R3QA 4EOIA 2PZRA 4XG4A 3E8NA 3VS4A 3Q2MA 1JOWB 3CS9A 4P2KA 1YXVA 4KRDA 2YEXA 2ITZA 3R7YA 2ESMA 3QD4A 1NVSA 2YLFA 4GV1A 5FM3A 5A46A 2PUPA 3CLYA 3GU7A 2GNIA 2JD5A 4EI4A 2GHMA 4WSQA 1OL6A 4UMPA 3GC0A 4MNEB 1JPAA 3QRKA 4FODA 4RX5A 4EH7A 3KRJA 2CN5A 2R3GA 3UVQA 2IG7A 3PVUA 4MTAA 5DWRA 2A19B 1PF8A 4RIYA 4RSSA 1VR2A 4ZTLA 1ZYLA 2C1BA 4WNOA 3LM5A 2X7FA 2B55A 1L8TA 3PXQA 4GT3A 4CTCA 5E4HA 3THBA 4UXQA 1F0QA 4CZYB 2EVAA 4MXCA 4PTGA 4U8ZA 4XOYA 3V3VA 4FL2A 5JT2A 3BWJA 3TL8A 4PPCA 4TRLA 4D2WA 2C3IB 2CPKE 3PG3A 1WBSA 4O83A 3V04A 4TY1A 2I7QA 4HVDA 1U5RA 4E20A 4C58A 1M14A 4IAFA 4BCHA 5A9UA 3RNYA 4F63A 2B7AA 4ZZOA 2AC5A 3QCQA 4I6BA 1B6CB 2CKOA 3D5XA 4EYMA 2R3IA 3NR9A 3SC1A 3ENMA 5HI2A 3TI1A 3WF8A 2OJIA 3ZRMA 3CE3A 2R3NA 4KBKA 1Q61A 2WOTA 5DT3A 5CF6A 3RPYA 3G51A 3R73A 5DH3A 3UOLA 4PTCA 3PXKA 2BRGA 3OY1A 1Q3DA 3LVPA 3OHTA 5HTIA 5JN2A 4RLLA 1XWSA 5HVYA 2C1AA 3ZUUA 4C02A 4D5HA 3BU3A 1PJKA 3C0HA 3CP9A 4K77A 5AUXA 4HCTA 4CTBA 1BKXA 3F66A 3P4KA 3RCJA 4O96A 4H39A 4OT6A 2XB7A 2YABA 4MWIA 3UZRA 3EKNA 2ZB0A 5KNJA 5JK3A 2YIWA 5AP0A 3R04A 3QRUA 4M13A 4Q9SA 3PJ8A 5CSWA 3ZRKA 5JKGA 2BRMA 2OSCA 3FLSA 3KB7A 3QRIA 4D55A 4DEIA 2B9IA 2ZMDA 4RJ4A 4F1OA 3ORPA 5T68A 2Z2WA 2XMYA 5GIOE 1V0PA 3F5PA 4TWPA 4YTHA 2OXYA 3JPVA 5AP4A 2QHMA 4EH8A 3O50A 2CDZA 5CVHA 3S0OA 3GCVA 2XKDA 4L44A 2YWPA 3U9NA 4GVJA 2UZBA 5ITAA 5AUZA 5L2WA 1FINA 1YDRE 4RGJA 4HYSA 4DEAA 2C5YA 2VRXA 1JLUE 2X6EA 4RC2A 1MRUA 3I6UA 2J2IB 4IADA 3TKUA 2XBJA 3OEZA 4RA5A 2NRUA 3KN5A 5HO7A 5CAUA 3LFNA 5BX0A 2Y8OA 5EKNA 4QRCA 4A9TA 5HVKA 5J7HA 1GOLA 4X6RA 1OKWA 3R7EA 3REPA 4KS7A 4FV3A 3AMYA 3E87A 5BQ0A 3UOJA 2C5XA 3D5UA 2BPMA 4L68A 4X3FA 5CWZA 4GU6A 3RM7A 5IA5A 5EHOA 3OT8A 4BL1A 3FMJA 3ZRLA 1ND4A 2Q0BA 1O6KA 1SVHA 4ZY5A 3U6IA 3G15A 4FA2A 4QP9A 4FYOA 4YPDA 4BTKA 3DTCA 3HV7A 3PA3A 3VW6A 3ZH8A 3F2NA 4BICA 4ZIMA 5F94A 4IAKA 3PWDA 5AM7A 3QZIA 4TYJA 2B4SB 5IMXA 2QLUA 4V04A 5KMOA 4L3JA 1YWRA 2ITYA 4BKYA 3LQ3A 2YDJA 4R3PA 3Q9ZA 2PWLA 4EQUA 3A7IA 1KE7A 5B2MA 2YCQA 3R9HA 3UIUA 2B54A 2PE1A 3WZDA 4DTAA 4D4VA 5M07A 2G1TA 4KBAA 4QQ5A 1NT2A 3PZHA 2B0QA 3QLFA 4X2KA 3TZ9A 3VUIA 5CAOA 3SRVB 2QG7A 1IASA 1XBCA 3KK9A 3GQLA 4CMTA 1FVVA 4GIHA 2ZV7A 4ZJIA 3NZ0A 4JJRA 2IWIA 1I44A 2ITPA 3DJ5A 4PWNA 2WMBA 1UU9A 3FQHA 4PNKA 5C1QB 2UZNA 1E1VA 2CGUA 2VU3A 2X0GA 2CGXA 2XNMA 4PQNA 4C3PA 3BX5A 4ASDA 4CEGA 5CQWA 4GKIA 4CGAA 3QZGA 3PJCA 5I9VA 1M2QA 4IC7A 3NUNA 4NCTC 4KD1A 2PUIA 4O27B 4M3QA 3QXOA 5DI1A 4J7BA 4G9CA 4QYYA 4BGHA 1SZMA 4FKGA 5IQAA 3QALE 5FXSA 2ONLC 2VWXA 3PPJA 2JKMA 3IPHA 2IPXA 5KZIA 1YOJA 4NJDA 3VS0A 1IR3A 3TM0A 3DNDA 3H30A 1M17A 4BB4A 2XJ0A 2E9PA 2OFVA 1TQIA 2QOIA 3EN9A 3IOPA 2XNBA 3QQUA 2HZNA 4N0SA 5EH0A 5J8IA 2F7XE 2YITA 1RE8A 2XYUA 4TNBA 3LJ1A 4CFWA 2CNUA 2H8HA 3AMBA 2XEZA 3QWKA 3CGOA 4GL9A 4MK0A 3AC4A 3RALA 1NVQA 4JAIA 3W2QA 4RWIA 3C4ZA 4DG2E 3TDWA 4LGGA 4WUAA 3DCVA 5CI6A 1OBGA 3U9CA 2GPHA 3UIMA 4GKHA 4I20A 2UV2A 4FL3A 2XJ2A 2QU5A 2CN8A 1GJOA 2I0EA 5FEEA 2W5AA 5KHXA 5ACBC 3R1SA 4KABA 1OL1A 2QKWB 3WZUA 3MA3A 3N4TA 3GBZA 3EN7A 3ENHA 2FSLX 2Y6MA 3UVRA 4BWKA 4OTDA 4EOQA 3WARA 2WU6A 3UO4A 1VYWA 1TKIA 1H07A 2Q0NA 2WZJA 4FIHA 2O65A 3F3TA 3DB8A 4YUQA 5DPVA 5DR6A 3S95A 2XF0A 3ORTA 2G2FA 4S30A 2ZV2A 4J98A 4LOPA 4XLIA 3HAVA 4E3CA 5A4LA 1YI4A 4G3CA 2HW7A 3BCEA 3TNWA 4EOLA 4F1TA 2G01A 3EQBA 5BPYA 3FXWA 5E8XA 4TYHB 2EB2A 2WKMA 4HW7A 1WBVA 1H1QA 4AW0A 4KSQA 4F7NA 1LEWA 1O6LA 2WELA 3MESA 4ZMEA 4W4YA 3ERKA 1WBNA 4AA5A 4IC8A 3P23A 4NL0A 4DTKA 5EHYA 5CU3A 4C37A 4IACA 4QT1A 4ZP5A 5HCZA 4D9UA 5D7VA 4AOTA 3G0FA 1HOWA 5AP2A 4DGMA 3ORNA 2YM8A 4PUZA 3GCSA 2YDKA 5ACKA 4AFJA 1JKKA 2W1CA 3MY1A 4EL9A 5IQFA 5BUIA 3QTIA 5HORA 5IMEA 1SVGA 4ACCA 2WMUA 4LMUA 4O7SA 2C4GA 4ASZA 5JZJA 4C7TA 2ETMA 4DLIA 4C4HA 2ITNA 3BE9A 2Z7SA 4GIIA 3UMXA 3RTPA 3WZEA 4M69B 3O71A 4FVPA 4U7ZA 4QMLA 3CTJA 4PDSA 5FBOA 1V1KA 3ELJA 2UW6A 3ZXZA 4GG5A 4EKKA 3FAAA 5CAPA 3EN6A 4DT8A 2EXEA 1DI9A 2DWBA 4FC0A 4D9TA 1U46A 3HDMA 4ITJA 4FKTA 1IG1A 4U81A 2W06A 4ANMA 2RF9A 1CTPE 1BI8A 4IWDA 5IUGA 4R7BA 2VX0A 3F9NA 5EFQA 3LAUA 3QKLA 2JKQA 2QLQA 4EH9A 1PRYA 2JIVA 3BRBA 4AG8A 4JI9A 2VN9A 3I7BA 4O0UA 4RQKA 4D4YA 3KEXA 1VJYA 2BAKA 2IZRA 4KINA 4JX3A 4UALA 4DH1A 4Z7GA 3FKOA 4EJ7A 3GU8A 4LM5A 3EQIA 5M4CA 3FUPA 3H4JA 2X7GA 4I4EA 4E4MA 1E9HA 3PUPA 4LI5A 1W0XC 2LAVA 4YSJA 4NM5A 4FZ7A 3D5VA 5H8GA 3NYNA 4ZLOA 3NUUA 3BV2A 3W8QA 2ITVA 3L1SA 1FBNA 1XO2B 3R8ZA 3EN5A 5KZ0A 4GYGA 2XK9A 4AXAA 3C7QA 3FMLA 1OKVA 3UPZA 2QCSA 4O21A 1UA2A 3JVRA 3WZJA 4YP8A 2RL5A 1H1SA 3L9MA 1DI8A 3O7LB 4KS8A 3TV6A 2YZLA 2OXDA 1UVRA 2EXCX 4ID7A 1P14A 3ETAA 4RIXA 5AIRA 5EM6A 4MAOA 3RAWA 3EZRA 2QR7A 1LEZA 2FVDA 2BRNA 3A7FA 4M68A 3SQQA 3BBWA 2G2IA 2RSVA 4CSVA 2VTTA 4DGOA 4YLJA 4GT4A 4PDOA 3W33A 1Q62A 4R1VA 4L45A 4FSYA 1SMHA 1AGWA 3DA6A 2OZAA 3O8PA 2BZKB 4IH8A 3R7GA 2DUVA 1YQJA 3KRRA 3A99A 3Q52A 4AS0A 2YERA 3DK6A 4C59A 1KV2A 3G9LX 4BDIA 4CKRA 4QYGA 3ZFYA 4TYEA 1QPCA 2PVHA 2GS2A 2UW0A 5AA8A 5I9YA 4Z7HA 3JYAA 3V5QA 2XKCA 4P4CA 4FIIA 2Q83A 4ONAA 5CU2A 1XH6A 2J0JA 5DVRA 1OIUA 3IG7A 3A4PA 3KKVA 3OCSA 4YC6A 3RMFA 3T8OA 2UZOA 1NXKA 3ZLXA 4X2GA 4QMTA 3NGAA 4QYHA 5LOHA 2JFLA 3OROA 2Z8CA 5IF1A 3FYKX 4AT4A 3ANRA 5DT0A 1Z57A 4BI2A 4FTAA 4QP1A 3NUXA 2BCJA 3RP9A 3BHYA 3MPMA 4XG8A 2NP8A 2JBOA 2WOUA 5IUHA 2NNWB 3GT8A 2BVAA 3LFEA 2W4KA 2GS6A 4AW5A 2O0UA 4FOCA 2NRYA
chains in the Genus database with same CATH superfamily
2CCIA 2JC6A 4YJRA 4OTRA 1PYXA 5FUTA 2WMSA 3GI3A 2EUFB 5J95A 3AQVA 4NFNA 4J99A 4FYNA 4WRSA 3R8VA 3O2MA 2J7TA 2V22A 2VTQA 3BLHA 3EKKA 3ZO2A 4FTCA 4X3JA 3WYYA 4PMTA 3NPCA 5LCKA 4ANLA 2DYLA 2YN8A 4CFMA 2J50A 3DJ7A 4EH6A 4RFMA 1PXPA 5BUEA 4DN5A 3W2SA 3RPVA 2VTLA 3D14A 3Q4UA 4MEDA 5JFXA 1Q8WA 3ULZA 2FSOX 4CYIA 3TCPA 4CT2A 2GNFA 5HO6A 2YDIA 4CFNA 3TKIA 4MXXA 3HMOA 5FEQA 5KMMA 2CGWA 4AZFA 4CMUA 1Q8ZA 1JSVA 3TYKA 2C6EA 3C5UA 4M12A 3FQEA 5A4TA 1G5SA 1ZOGA 1XH9A 1PXOA 3FZPA 5L2IA 1TZDA 4XMOA 1NA7A 2R3FA 1U54A 4IAAA 3BYVA 4IIRA 4V01A 4MNFA 3HV5A 3NNUA 2V55A 4X7QA 5HG7A 5KMNA 3DXQA 3SG9A 3B8RA 3FPQA 2UW8A 3V8SA 4E7WA 4HPUE 5LMKA 1ZZ2A 5J9ZA 3KXXA 1W98A 4TXCA 4C4JA 4Y46A 3HLLA 3NLBA 3QKKA 1OVEA 4HZRA 4WKQA 3LFAA 4JXFA 3F3ZA 5CNOA 3CC6A 3CXWA 5M09A 2WTCA 5GINE 3RBWA 2XK7A 4RJ6A 3QGYA 4NCTA 4B0GA 1Y8GA 3S3IA 3QQGA 1YWVA 3W2CA 1YI3A 3FHIA 4OTIA 1PKGA 4BJJB 3AT2A 3GC8A 5JFWA 5CTPA 5H8BA 1VEBA 1OIRA 2F7ZE 5EI8A 5C8KA 5AV2A 1GNGA 3R2BA 2IW9A 4FK6A 2OJ9A 2B53A 4FV6A 4HNFA 4HOKA 4LUEA 3DZOA 3CTHA 3R7OA 2OO8X 4RWLA 3VWAA 4BCFA 1P4FA 1OPKA 3QCSA 4ASEA 5K5NA 3CD8A 3TNQB 3P7CA 4BCOA 3PY0A 4FEVA 3AT3A 3P1AA 5K5XA 2XKEA 3AGLA 5KKRB 3QRJA 2I1MA 3P79A 5AV0A 4NIFB 1XH5A 4ZTNA 2YM5A 4DC2A 4JT3A 1UWHA 5AEPA 4GK3A 2BRHA 3RK7A 3ZTXA 4BCJA 4D2SA 5HCXA 2BAJA 3TUCA 3UNZA 4UWBA 4FKIA 3SXFA 3PDTA 4YR8A 1BX6A 4I5HA 1FGIA 4RC3A 3VS3A 4IVDA 3VUGA 3FHRA 3KF7A 4DHIB 3I0QA 5DR9A 1OBDA 3PP1A 3R9RA 2WTIA 4ZJVA 4BGQA 3PVWA 4RT7A 4L01A 5B0XA 2UZLA 3OCGA 4YZ9A 5F9EA 5GIPE 3ZXTA 4AZSA 4A9RA 3C13A 4FI1A 4G1WA 5CU0A 4FIGA 3SLSA 5HE3A 4XOZA 4EOPA 4BI0A 3RHKA 3ZONA 5G6VA 4XH6A 3UNJA 4IZ7A 2XK6A 3OCTA 4FKLA 4NYEA 2C3JA 3HECA 5EI2A 3WILA 4ZAUA 3VJNA 4BF2A 4C4GA 3DJ6A 2J5FA 5GZ8A 3W0NA 4BZOA 3VN9A 5FQDC 4FNWA 2V7OA 3C9WA 3LMHA 2HYYA 1MRVA 4NM3A 3SG8A 4JAJA 5CZHA 4ZS0A 4CZUA 4I21A 4NT4A 3RPOA 3E92A 4FTNA 1BL7A 5JRQA 3M1SA 5HEZA 4UN0C 2OBJA 3C4WA 5HNGA 1I09A 4G31A 3D7TB 4RJ7A 4BGGA 4MYGA 5BVDA 4F4PA 3HV3A 1BI7A 4O91A 2R3RA 3FMEA 4MNEA 3MW1A 4TN6A 4ZS4A 4AA0A 4O1PA 4CG9A 2XJ1A 4IBMA 3KQ7A 5DMZA 4DEGA 2J0KA 3EYHA 2XM9A 4FV9A 4GJ2A 4DH3A 2KULA 3IW6A 3IGGA 2J6MA 4M8TA 3PFYA 2IN6A 5CYIA 1FMKA 4JBVA 3RM6A 5M53A 4OAVB 4FKVA 3C0IA 3P86A 4O86A 3OMVA 2JBPA 3A62A 4G5JA 4L8MA 4O0TA 4Y5QA 2V0DA 4E6QA 4QMYA 3LFCA 1TVOA 2XK3A 4J71A 3TV7A 4U9AA 5A3XA 3ODZX 4DCEA 2BZJA 2X8DA 3ALNA 3ITZA 3W32A 1PXJA 2VTAA 2W1FA 1MQ4A 4LOOA 2BR1A 5HNIX 2F2CB 2AC3A 4YTIA 4G2FA 3WF6A 4BCKA 1ZYSA 4FIFA 4QNYA 4C61A 5A4QA 4GK4A 5CQUA 5EHLA 3V5TA 4BBMA 2QO2A 4RBLA 2PVKA 4OLIA 4H3QA 5M56A 2JIUA 5TR6A 4DT9A 4U79A 4F78A 3P9JA 3CGFA 1YVJA 5D1JA 5BVOA 3PE1A 1PXMA 5DNRA 2CLXA 4JR7A 4RZWA 4E4XA 2OIBA 3AT4A 3P08A 4XNEA 5BUJA 5E1SA 3ATSA 1V0OA 1H25A 4M15A 4FSMA 3KXZA 5EM5A 4HCVA 2CNVA 2Z02A 4DITA 2BZHB 3WYXA 3IGOA 2WGJA 4ALUA 2C0OA 3LMGA 3MIYA 4Z16A 2W1DA 1U4DA 3FC1X 1KE9A 5AA9A 4TT7A 3V6SA 5J5SA 4I94A 4DH5A 5HQ0A 4M84A 4NW5A 3VRZA 4KKGA 3FLZA 5FRIA 3SOCA 3VHKA 4EJNA 2E9NA 3ZM4A 4BN1A 4IB1A 1PXNA 1Y6AA 3MTLA 4BWPA 4K0YA 2HZ4A 2VX1A 3BU6A 3KVXA 4AN3A 4FBXA 4AOJA 1H0VA 2P3GX 5A4EA 3KXHA 3EL8A 3I0OA 2G2HA 5AV4A 2YA9A 4FSUA 3E64A 4FTKA 5C4KA 3H0YA 4LG4A 3NEWA 2UW5A 5FP5A 3PPKA 4RX9A 3MVMA 2PU8A 2F49A 4CV8A 4IHPA 3R1QA 1WBOA 3R30A 2I0YA 5FP6A 3IECA 3AXWA 2X9EA 4PF4A 1TFFA 2FYSA 3BEAA 3MWUA 5C03A 2OJGA 1CKIA 3HX4A 4DBNA 4I3ZA 2W05A 3M42A 1XBAA 5E92A 2PE2A 3LJ0A 3NUYA 2PY3A 1YI6A 4IM2A 3CJFA 1J7UA 3BQRA 2E9OA 4DH8A 2W1HA 3OC1A 3NUAA 4GFOA 2QC6A 3QL8A 2ZV8A 4C34A 2HZIA 4FTOA 3TTJA 4TL0A 3QC9A 4Z9LA 4FICA 1NY3A 5HLPA 3UG2A 4K9YA 5EYDA 3EYGA 4E26A 4KIPA 3BYUA 4XYFA 3MBLA 3U87A 3JVSA 3K5VA 4FEQA 3OS3A 4NM7A 2HZ0A 3QTZA 3L8XA 2X2LA 3SRVA 1A06A 2WB8A 4IX4A 5DA3A 5GJFA 4F9CA 4O0RA 2ERZE 3KF4A 2BILB 1WZYA 3VRYA 1TQPA 2ZJWA 3EJ1A 1MUOA 1Q8TA 3HYHA 4N4SA 5JGDA 5FG8A 4OBPA 4LV5A 4Y83A 4XHKB 3DKGA 4GJ3A 3UODA 4BDBA 4BVUA 2YIYA 4D28A 4LMNA 2YCSA 4JRVA 4NWMA 3W0OA 3C1XA 5ANOA 5L2QA 3D2IA 1K2PA 5FWKK 4FG9A 5JFSA 4KSPA 2YM3A 2OICA 1PXKA 4QQCA 4XG2A 3QD0A 5ETCA 5ETIA 4X0MA 1QL6A 1JKSA 3KREA 3Q04A 3VBTA 1M7NA 4A9SA 2XNNA 2PMLX 3P0MA 3QQHA 4E6AA 2UZVA 2CCHA 4QMXA 3LFBA 2EXMA 4I0TA 4U42A 3GGFA 3F2AA 3MY0A 3BU5A 4BTFA 3ORMA 2B9HA 3IDPA 3DY7A 3NCGA 1W7HA 3DK3A 4DFZE 5CZIA 4QMQA 3BEGA 5AR5A 4AGUA 3CIKA 3LZBA 3Q60A 2WMAA 2X9FA 4EK4A 5LVOA 4G16A 3FLQA 4F09A 2BFYA 3ORXA 2WIHA 3QTWA 5KKRC 2E9UA 3V8WA 2R9SA 3OT3A 2HY81 4QP8A 3WF5A 3F6XA 2J0IA 4FNYA 2PZIA 2X7OA 3DOGA 1ZRZA 1Z5MA 3PWYA 4RJ8A 2PMOX 4BBFA 5K0XA 3QU0A 4KIKB 4YZCA 1ZWSA 4P5QA 1E1XA 4BHNA 2JDSA 3TWJA 1H1WA 3KU2A 5DHJA 4FKOA 4FNZA 3EOCA 4V0GB 2QOLA 5DEWA 2JAVA 3AC3A 3FV8A 4I92A 3QD3A 3DAEA 1M2RA 3COMA 5GHVA 2B52A 2YCFA 2RIOA 2B9JA 4GRBA 4J8NA 3RJCA 4ANNA 4PX6A 1DAWA 3TIZA 4TYGA 4APCA 3U8WA 3A7GA 5LQFA 4PTEA 5IA2A 4C4IA 3HEGA 4KRCA 4O22A 4O0VA 2PVFA 5J87A 3R7UA 4RC4A 4CCBA 4EOJA 5JGBA 3E62A 2XYNA 2QQ7A 3EFJA 5B7VA 3F3WA 4IE9A 2CKQA 4E5WA 4O1OA 4YBJA 2J0MB 2X8EA 5J79A 4CZTA 2H96A 4TYHA 3I1AA 1R78A 3ZMMA 4XG9A 3FKNA 3HP2A 4HVHA 3MH1A 4QP6A 3DV3A 4NTTA 3R63A 3KVWA 3JXWA 2F9GA 3RAIA 3E63A 5G1XA 4EH5A 4OR5A 3PJ1A 4U0IA 2W1EA 5D11A 3KRWA 5FTQA 3BE2A 3IW7A 1M52A 4IVBA 4MH7A 4EH4A 5I5ZA 4C35A 3OEFX 4S31A 2C6KA 1DAYA 3FJQE 4PY1A 5HHWA 2QO7A 2WHBA 2YIXA 2O64A 5A6OA 1WVWA 5ANGA 3FBVA 2C5VA 5AX3A 4F9WA 3R22A 3IK3A 3FMHA 3L8PA 3UIBA 2XIYA 2R64A 4FKQA 3UDBA 2R3HA 2OXXA 2GFCA 2EWAA 1AQ1A 4YSMA 3S2PA 4QMUA 1KOAA 2P55A 2V62A 5C8NA 3W10A 5AR8A 2O63A 1H27A 2VWIA 1PYEA 5AR7A 4QO9A 4CKJA 4I24A 2YHVA 4G9RA 3CPCA 2YIRA 5FBNC 4TW9A 3WOWA 2KTYA 4M69A 3R83A 4YJVA 2AYPA 5L6PA 1SNXA 3RAHA 2W7XA 3GC9A 1LP4A 1O6YA 2P0CA 2PVJA 3LCDA 3ODYX 5CEMA 3R1NA 4HZSA 3F5XA 4K18A 1FQ1B 4NTSA 5I3RA 2GQRA 4D58A 4FZ6A 3W16A 3NW6A 3R8LA 2CKPA 5I3OA 4IDVA 5M06A 4I6LA 2Y4IC 4FSWA 5L2SA 5I0BA 5AFVA 2HW6A 4ANQA 5CASA 3O8UA 3ZC5A 4M7IA 4Q5EA 4IZYA 3HMMA 1KE5A 1JBPE 5KBQA 2QD9A 5FEDA 1UV5A 3GU5A 5HE2A 3UC4A 3HUBA 3NSZA 3RI1A 4GUEA 4A9UA 4YZDA 3U4WA 4EZ7A 4H36A 5LVLA 4UXLA 3UBDA 4GH2A 4IAZA 3KRLA 3SW7A 3VNTA 4Y73A 3OWKA 4RJ3A 5K4JA 5CEQA 4H3BA 3MSSA 2GQGA 4ZSAA 4HYIA 1PMNA 1YWNA 5IA3A 2WFYA 4II5A 3ACJA 4IAIA 4CYJA 3TUBA 5KBRA 4F6WA 4H05A 5ANEA 3R9DA 4F0FA 2A2AA 5DRBA 4YC3A 5ANIA 2PZ5A 4NU1A 3SHEA 4MVFA 1W84A 3GFEA 2OF4A 3LKMA 5L6OA 2UZDA 3ZSIA 1WBWA 5CF8A 2JKKA 3GUBA 4N6ZA 3IOKA 4MX9A 4B7TA 4CD0A 4AZTA 5M4UA 3OZ6A 2F57A 4FV7A 4HGLA 4K8AA 4NEUA 4QTEA 4FOBA 1XQZA 1PXIA 1ZYJA 3CQUA 3FC2A 3IDBA 5HIEA 3UC3A 3HRBA 2OIQA 3ZHPC 3NIZA 2JLDA 3EQHA 1GZKA 5CU6A 3WE8A 2IVTA 4HPTE 4AUAA 4O84A 3NFGB 1YHWA 2WMVA 5AV3A 2RG6A 2WPAA 3GNIB 1BMKA 2JAMA 4HNIA 4AXCA 5IQDA 3QUEA 4AE9A 4O2ZA 4CQGA 5ETAA 3W55A 3EFWA 4FKJA 3DZQA 4FV4A 4L00A 3FMDA 4FSQA 3HMNA 5HGIA 5BVEA 1IA9A 5CI7A 3ID6C 4FTUA 2YJSA 3FSFA 2JDOA 3MDYA 1FGKA 4HGTA 1QCFA 2UW9A 4J8MA 2X2KA 4KB8A 4X3FB 4XBRA 4PDPA 4YNOA 3GU4A 4JIAA 3WIGA 4JS8A 4CMOA 4J52A 5M4FA 4FKPA 2RKUA 1BUHA 3FY2A 4WHZA 5K3YA 2O5KA 3MB7A 4TTHB 3QZHA 4YU2A 4HVIA 4D1XA 2IO6A 5JQ5A 1OL2A 3VHEA 3BIZA 1T46A 3UJGA 2FH9A 3W0PA 5BVWA 2UZWE 4AN9A 5LWNA 4UV0A 4BCMA 4X2FA 3DGKA 1OECA 3V8TA 5AUWA 4G5PA 2R5TA 3Q9XA 3MA6A 1CMKE 3KCFA 4BKZA 4EC9A 4EQMA 3MTFA 3ZFMA 2J90A 3T3UA 3ZC6A 2OJFE 4N6YA 3FMKA 5LMAA 2WQEA 4L9IA 4O7NA 4LQMA 1W2FA 3ATTA 4XG3A 4WO5A 3ZFXA 4E5BA 2VO6A 1Y6BA 1H0WA 4IANA 3B2WA 4BIEA 4PPAA 2XUUA 2GS7A 3A4OX 1ZMVA 3AGMA 1RDQE 3EN4A 3O0GA 4FV2A 4AZWA 2HWOA 3LFDA 4DG0E 4BTJA 1QPEA 4JDIA 5EYMA 3LXNA 2W96B 3V5LA 3Q6WA 4NSTA 4P90A 5CVFA 3A7JA 4LL5A 5IDNA 4XUFA 4ZTRA 2PK9A 2PVNA 1PMVA 2VTIA 2JDTA 2OK1A 4R3CA 2XNGA 4MXZA 4BIDA 4EOOA 2ZDUA 4FZFB 3D83A 2XM8A 3H9OA 3NW5A 5HE0A 3LCOA 4P7EA 4Y5HA 4ZLYA 3ZO4A 3BGZA 5CAQA 2PULA 3UQCA 4IB0A 3VAPA 1FVRA 1P5EA 4DINA 1YXTA 3TJCA 2ZV9A 4O4DA 4AE6A 4RFZA 3FLYA 3S4QA 4DGGA 4BY9E 3W0QA 3BPRA 4D1ZA 4FKSA 2W1GA 3OXIA 1Q3WA 2CJMA 5DBXA 3KGAA 5IQHA 3EFKA 3Q96A 2YM4A 3R02A 4LV8A 4FZAB 4IJ9A 4I0SA 3O8TA 3F7ZA 5DGZA 5F1ZA 3CTQA 4MBIA 4AFEA 1YW2A 4XEYA 4F7LA 5E90A 5I9XA 1W82A 4EK5A 3SVVA 3OUNB 3QTRA 4O7TA 1A9UA 4TWOA 5CEIA 4IXPA 3BL9A 4JNWA 5H3QA 4L43A 4WBBB 5EOBA 3KRXA 1OGUA 4RQVA 2VO0A 4QEBA 4BJJA 4D2VA 3O17A 3PXZA 3O96A 4XLVA 4PP7A 5HLWA 1GZNA 2YM6A 2VGPA 4YZBA 4ZMFA 4NKSA 3ZO1A 2HAKA 3FMNA 4O6EA 3F5GA 4E4NA 5EK7A 4IB3A 2P4IA 1JQHA 3KULB 3MJ2A 3NUSA 4WG4A 4AACA 1UNGA 1R39A 2JIIA 2V7AA 2EU9A 3WF7A 4AQKA 3IONA 2ZAZA 5JRSA 5HZNA 4YC8A 4KKEA 3ZUVA 5KUPA 2A98A 4MUQA 2IW6A 2QVSE 3GCQA 3RWPA 4O82A 1L3RE 3MN3A 3O7LD 4FT3A 5LJJA 4RIWB 3MIAA 5C8MA 3FKLA 4Y95A 5IDPA 3G6GA 3G33A 3C4CA 3PZEA 4U45A 2A1AB 3AC2A 3LMIA 2QOOA 4I93A 5HU3A 2QOCA 4NIFA 3H3CA 2VWWA 2GCDA 2J9MA 3R01A 3TACA 2IF8A 4XV2A 4HVGA 4HVSA 2UVXA 3P7BA 2IZTA 2UW7A 4K11A 2B9FA 3C4FA 3CPBA 2VTHA 3I79A 1U5QA 3AMAA 3LM0A 4BDDA 2WMXA 2FSMX 4X2JA 4YHJA 3PXRA 2PMIA 3GQIA 4BTMA 4C62A 4EEVA 3MFUA 2AUHA 3R21A 5I9UA 1GAGA 1QMZA 1J91A 3DT1A 4G6NA 2IZSA 4I4FA 4CT1A 4EOMA 3DFCB 5KCVA 3COKA 2UUEA 5HX6A 1LPUA 1G8AA 2WTKB 4I5CA 3ZDUA 4JVGA 4DEDA 4O0YA 5CALA 4F6UA 1GZOA 4WD5A 1OKYA 2VV9A 4GUBA 5L3AA 4IEBA 5DOSA 3WIKA 2PL0A 3SW4A 4MCVA 4QMWA 3DLSA 3Q3BA 3W2PA 5CT7A 4DDGA 4FTMA 3RZFA 5L8JA 4JIKA 4TWNA 3PLAE 3QHWA 4ZEGA 4H3PA 3VBVA 3PE2A 3V6RA 3DDPA 3OCBA 1XJDA 4IFCA 4MF0A 4O81A 4GEOA 1J1BA 2ITXA 3D7TA 5K0KA 5AUUA 3PXYA 4FV0A 4ASXA 1PKDA 1R1WA 1OL5A 4JOAA 5B2LA 3QUDA 3MPTA 4JQEA 5DN3A 2NYAA 4QDEA 2WMWA 5EQPA 2DQ7X 1UWJA 3NYXA 2F4JA 2RFSA 4WOVA 4PRJA 3RK5A 2JEDA 4PP9A 3U4UA 2Z60A 3MI9A 4AP7A 2GQSA 1ZARA 3NNVA 3TV4A 3RPRA 2ETRA 2ZM4A 3OXTA 4LL0A 5HVJA 3EIDA 2RG5A 2OI4X 5AP1A 5AP5A 3W1FA 2WQOA 2JFMA 3U6HA 3FZSA 1PY5A 4TNDA 3U6JA 4QMMA 4ERWA 3C51A 3NAXA 4U40A 4DCAA 3CY3A 4Y72A 2FSTX 2JDRA 4UMQA 4EOSA 3N9XA 5IQBA 4MD8E 5CXZA 2OZOA 4CFVA 4K1BA 4DFXE 4FTJA 3P7AA 3LXLA 2W99B 4O0XA 4JQ8A 4H1MA 3FXZA 3EWHA 3DS6A 2ONLA 4JBQA 4UYAA 3AD6A 3NMUF 3IW5A 5CX9A 4L52A 4QMSA 3UOKA 3HV6A 5AP6A 1YHVA 3R00A 3K2LA 5LVMA 4I6HA 4YPSA 4F99A 4NH1A 2GTNA 5J9YA 4B4LA 5J9LA 3BLQA 3MH0A 5EDRA 3MJ1A 3ZEPA 2VNYA 2JDVA 2RFEA 3DXNA 4W4WA 3VF9A 3CJGA 3G2FA 4FSZA 2C6TA 3VUTA 4BDAA 5LVPA 2BHEA 3QWJA 4I22A 5JFVA 4QP4A 2NPQA 5FLFA 4Z55A 3W0SA 3UO6A 4FMQA 4C0TA 1GIIA 4MXYA 4RVMA 3JUHA 3ZDIA 1WBTA 3PTGA 4G6LA 4JG7A 2XCHA 1CKJA 5IPJA 3N4UA 1PW2A 3RINA 4N70A 5HICA 5HBJA 2XK8A 4O0SA 3K5UA 3PA5A 5ANKA 5GZ9A 2R3KA 2X4FA 2XEYA 4AXFA 5AAEA 4X3FC 4D2RA 4LGDA 3MPAA 2XRUA 4ITHA 5E91A 4PMPA 3VBWA 3A8XA 2ZYBA 5M51A 4FSTA 3KN6A 2GDOA 3TMOA 3CKXA 3ZBXA 3ORLA 4DEHA 3UO5A 2BHHA 2IVUA 3H10A 3ANQA 1REJA 3NS9A 4G6OA 5HG8A 3VULA 4WNMA 2A27A 2R3OA 2BIKB 5IQGA 5LXMA 3RKBA 4K2RA 4QP7A 5CAVA 4O4FA 2WTJA 5GJDA 3TUDA 3GVUA 3T9TA 4MF1A 3LXKA 3ACKA 3UDTA 2XIXA 4DEBA 3DXPA 5IQCA 3E7VA 2OH0E 1VZOA 2FA2A 3DPKA 3QTSA 4AGDA 4GU9A 4M66A 1ZMWA 1G8SA 3OF0A 3SDJA 4CKIA 4FV5A 2W1IA 3Q2JA 3LCSA 4IWOA 5HKMA 4J95A 1JKTA 2PVLA 4L7FA 3U55A 2A4LA 5AP3A 4CRSA 4OAUC 4GS6A 4A7CA 5HX8A 2HY0A 4IWQA 3HKOA 4CCUA 1Z9XA 3E7OA 4DFUA 1IEPA 2GHLA 2W5BA 3GXLA 3Q32A 4ALVA 3ZLYA 3R71A 3BZ3A 2GHGA 4XS2A 3UG1A 4FKWA 2VWVA 4BIBA 3ORZA 3EMGA 4IZAA 1YXXA 4IDTA 3R7IA 3RWQA 2C6DA 4KKHA 2R7IA 4OUCA 3G0EA 4DH7A 3FEGA 3B8QA 5M57A 4EYJA 1IA8A 4W8DA 2YIQA 5DLSA 1P2AA 5CF5A 4U43A 5DEYA 4ZJJA 3QKMA 1SYKA 2ZM1A 2ITQA 3E5AA 4IM3A 5HIBA 3OG7A 2VO3A 3PXFA 1DS5A 4XCUA 4YJQA 4O2PA 2Y6OA 3PSDA 4KNBA 5ANJA 5FDPA 2HELA 1X8BA 4EWQA 2FO0A 2OG8A 4IAYA 2EB3A 2C6IA 3FMMA 4M0YA 5KE0A 5JSMA 1H00A 2C6MA 2W0JA 3DTWA 2C47A 3Q9WA 4YJOA 2XBAA 4EHZA 3QF9A 4HGSA 4YURA 4GMYA 1APME 1OI9A 4FEUA 4OTQA 4J53A 1ZLTA 2Y4IB 3C4XA 3COIA 3W8LA 5IQEA 4BFMA 2XVDA 3OWLA 4DAWA 4ENYA 4EUUA 5M4IA 4FTTA 4RWJA 1K3AA 4R5YA 1OKZA 3MFSA 5DYJA 4MXOA 4QOXA 5CY3A 1NVRA 3HNGA 4J97A 4BYIA 5K4IA 4EHGA 4HYUA 5FGKA 2ZB1A 3ALOA 3BLAA 3SV0A 2WMTA 3NAYA 4A9YA 5LARA 4O7WA 4TKSA 3FXXA 1WVYA 5HTCA 5FDXA 4BCIA 2QU6A 5JGAA 4I1ZA 1RW8A 4CLIA 3S1HA 3ZLWA 2XAMA 2ACXA 3LPBA 4PV0A 2IEWA 4I0RA 4O6LA 4ZSEA 5E9EA 1JKLA 1ZOEA 3F69A 4FT7A 4ZSLA 4USEA 3AOXA 3HMPA 2OWBA 3R28A 5DFPA 4LOQA 5AR2A 2BKKA 1ZOHA 3CY2A 2UZTA 1BYGA 4X6QC 5ETFA 4U5JA 4ACGA 4CV9A 5D10A 5DE2A 4IM0A 4KIKA 2HXLA 3NYVA 4IFGA 1LR4A 4QYFA 1TQMA 1GIJA 4AW1A 5KMLA 4G3GA 4F1MA 3PYYA 5J5TA 2X1NA 4V0GA 3DBDA 2R2PA 5CLPA 4FT9A 5TO8A 3SGCA 2UW3A 1IAJA 1OZ1A 4F70A 4D0WA 2VUWA 3FWQA 4FT0A 4F08A 4RG0A 1B39A 3HVCA 4A4XA 1YDTE 3HL7A 3KA0A 4YTCA 1HCLA 2WTKC 3FZRA 4MBLA 3K54A 4J1RA 3BWFA 2C0TA 5FTOA 4QTBA 2QO9A 4AU8A 2CHLA 1Q4LA 3FL5A 1UU7A 1R3CA 5CVGA 3HUCA 4CRLA 5IH5A 5F4NA 5BMMA 2FGIA 3QQFA 3UDZA 4KIQA 2YCRA 4NK9A 3DFAA 3R2YA 4O0WA 4QMVA 4ZSGA 4A4OA 4ARKA 2GU8A 5KO1A 1KE6A 3CQWA 3Q5IA 4R8QA 1Y91A 1VYZA 4F65A 4FRFA 4A07A 2PUNA 5F20A 3FZ1A 4UY9A 3QD2B 3QQLA 4DG3E 3FLWA 3D7ZA 5EYKA 3BI6A 3FQSA 4QDVA 4OTGA 2HENA 3I81A 3KY2A 2BUJA 5A4CA 2R3LA 3DQWA 1JNKA 2VX3A 4G34A 1H08A 3OWPA 1CKPA 2CLQA 3QA8A 3R9OA 3TIYA 5CT0A 3UOHA 4I23A 2I0VA 2IVSA 3G90X 2X4ZA 3QFVA 4WUNA 4R7IA 1WBPA 5B2KA 4UX9A 4PL4A 2UZUE 4E93A 1WAKA 1HCKA 2YM7A 1IAHA 3VUHA 4KAOA 4E73A 5IH6A 3LCTA 3NWWA 3WE4A 4NM0A 5HU9A 3Q53A 3UPXA 4BWXA 5AP7A 4AN2A 5FM2A 3VBYA 3QCXA 3EQFA 3PFQA 2WTWA 3V01A 2PHKA 3LQ8A 4RMZA 1H26A 4Y8DA 3L8VA 1FVTA 2WQNA 5H9BA 3ROYA 4CNHA 3IKAA 4FJVA 1U59A 4XG6A 2CKEA 5TKDA 3LCKA 2VWYA 1YRPA 1OITA 2BDJA 3DB6A 5E8UA 5EW3A 2W4JA 3G6HA 1FOTA 2XAOA 5TE0A 4AGWA 2BDWA 4ACDA 3R1YA 2R7BA 1PXLA 3VF8A 3KXMA 2Y0AA 5AADA 1XMMA 4BR3A 3BL7A 4JMQA 3DKFA 4IB5A 4LRKA 3LXPA 1PHKA 4LUDA 1S9IA 5FD2A 4C2WA 3Q4CA 5CANA 4GVAA 4JDKA 3LQ5A 4OTFA 5AMNA 4OTPA 3V5PA 4ZOGA 2CNQA 2R0IA 3NCZA 4XBUA 4Y85A 2WTVA 3CR0A 2BMCA 4EC8A 2YACA 3PA4A 4WIHA 1DM2A 1YHSA 2G15A 3GOPA 4NKAA 3PVGA 3VQUA 3CQEA 3LE6A 3OOMA 3DDQA 2VTNA 3HRCA 5HG9A 3UYTA 2B1PA 2HIWA 2OF2A 3TEIA 3IS5A 5ICPA 4NFMA 3LJ2A 2CGVA 4FSNA 4AWIA 3I5NA 4FIJA 4H58A 4QNAA 4DLJA 2XANA 3FDNA 2BZIB 4S33A 4B6LA 5T6KA 5BYZA 3VS5A 3GFWA 2J5EA 1H4LA