4D2RA

Human igf in complex with a dyrk1b inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
300
Chain Sequence
DVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
publication title Discovery and Optimization of a Novel Series of Dyrk1B Kinase Inhibitors to Explore a Mek Resistance Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 300
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d2rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d2rA01
3FI2A 3TZ7A 4I24A 3DY7A 4IFGA 4M12A 1XO2B 3ZOSA 4BDIA 2CCIA 5AR5A 1U54B 4CXAA 5CALA 4ZOGA 4RZWA 1H0WA 4TYGA 3FKOA 1OB3A 5CU0A 3MB7A 5HE2A 4CMTA 4IMYA 3KK9A 2QG5A 5F20A 4MD7E 4GU9A 1JKKA 1Y8YA 4FSNA 5ANEA 4WIHA 3UTOA 4IB1A 5F4NA 4BWXA 5HG5A 3CTJA 1P14A 5L2IA 4DLJA 2GQRA 2J0MB 3PIZA 4UBAA 4OGRA 2JD5A 5L2TA 4ANLA 3Q52A 2H9VA 3D9VA 5IA1A 3DKFA 3EN4A 5M56A 4FGBA 3U4WA 3PRFA 3QUEA 2WD1A 4U5JA 3VBYA 2Z8CA 1Q41A 2FGIA 3CQWA 4FSZA 1UWHA 3CQEA 3IPHA 3OUNB 2VTIA 4RT7A 5J7BA 1QL6A 4U42A 4BDEA 3ZO1A 2XNNA 1G8AA 4L42A 3KCFA 4OT5A 5JFSA 3CLYA 4MQ1A 2ITZA 3PA3A 2PE2A 3R7EA 5CEKA 5DT4A 4PDOA 4Y95A 4D2RA 4X2NA 3LIJA 2OK1A 4HVIA 3MH0A 4IB0A 5TO8A 3V3VA 4BVUA 2BDFA 2VTJA 4RA5A 3H9OA 1YOLA 2UVYA 3IS5A 2VTRA 5EYCA 4PPBA 3KRWA 3EKNA 4MAOA 4TYHB 3UC4A 5I4NA 3TUBA 3M1SA 1Q5KA 2XUUA 3LPBA 4J53A 4MXOA 4FE2A 3CS9A 2XJ2A 5HICA 1QPEA 1BYGA 4R3CA 2Q0BA 5F9EA 4JIAA 1FINA 5DG5A 2YLFA 3NNVA 2WTWA 3AD4A 4O7YA 2W9ZB 4TRLA 4XLVA 2Z7QA 3B8RA 2YEXA 3H9RA 4K1BA 4DFLA 4NTSA 2V62A 3O8PA 3IW4A 4IM0A 5FTOA 2VTSA 3BGZA 4PTGA 4ZMEA 1H24A 3MI9A 3R00A 4Y83A 3FMDA 1PMEA 4CTCA 2W1ZA 3OHTA 3T9TA 3R04A 2GSFA 1DS5A 4BICA 5LMAA 3OCTA 3ZDUA 3GC9A 3EMGA 4G3FA 4YTIA 4M84A 5A9UA 4J7BA 3RK5A 3OBGA 5BPYA 2CGXA 5E8XA 3TWJA 4Q9SA 4KUJA 3DPKA 4KIQA 1W82A 2A0CX 2VO0A 3WYYA 2BZHB 4RVMA 2Y4PA 1KE5A 4WNPA 2BPMA 4IAZA 5HKMA 1FVTA 3ODYX 3VS2A 5CYIA 1M52A 4O7RA 4HOKA 2IW8A 4E5AX 5IQCA 2BIKB 4XUFA 2AC3A 2JIUA 3ROCA 4PV0A 2JKOA 4DLIA 5HTBA 3NUAA 4NZWB 3RHKA 2CKQA 5CENA 3Q3BA 4E4NA 4L8MA 3SGCA 1PXIA 2YAKA 4DBNA 4HYUA 4DG2E 3NYNA 5ANKA 5E8TA 4RWJA 5DRDA 5GINE 4O0RA 4G5PA 4BWPA 5ETIA 5HNIX 4IZYA 2WTIA 2VTAA 1UNHA 3FDNA 5DI1A 3U4UA 5TF9A 2XK3A 3SG9A 2OG8A 5FEDA 2WMWA 3Q4CA 3ORNA 3KA0A 3EQBA 5HD7A 2Y6OA 4JL9A 4O7VA 3I81A 4B4LA 3NVKI 3ET7A 5AX3A 1YDRE 2X4ZA 4U3ZA 3E87A 3V5PA 4ANOA 3OXIA 2C4GA 5M4CA 3VBQA 5A54A 3D2IA 1WVWA 4CYJA 3NEWA 3HV5A 4QYHA 2W9FB 4BIDA 3CTHA 3I6WA 3V5QA 4TTHB 3ZLXA 4UXLA 3V8TA 3NW7A 2WTJA 5C9CA 2Q0NA 4KAOA 4APPA 2I0YA 2W17A 4FSMA 3SDJA 3EOCA 5FDPA 4LM5A 3VRZA 2B1PA 1QCFA 3NNXA 3TZ9A 5AA8A 2G9XA 5CF6A 3KVXA 4A4OA 2XKFA 2Y6MA 4OAUC 2Z2WA 4ERWA 2ERZE 2X2LA 4OR5A 3OD6X 4F7JA 5KE0A 3IK3A 4JDKA 2ZMDA 4IQ6A 3QTRA 2GMXA 3DAKA 3VHEA 4V0GB 3OWLA 4UALA 4UX9A 3DS6A 3NSZA 4AFJA 1IG1A 3Q2JA 4HCTA 2QOCA 3R7VA 5GZAA 4OBPA 3UPZA 3NR9A 3NX8A 4ANQA 3RCDA 5J9ZA 4YZMA 3W32A 5BVEA 2FYSA 1ZMUA 2XYNA 5TT7A 2ZVAA 3GCPA 2JIIA 4BCHA 2X2KA 5KNJA 2HZ0A 3QA0A 4BHZA 2ZV7A 2G2HA 4UZDA 2CGUA 5IMEA 3RZFA 3UVQA 4E4LA 4GT3A 5CT0A 4QOXA 3K2LA 3KCKA 4XHKB 4FTRA 3LHJA 2PVHA 3Q53A 4FTNA 2XNOA 3HV7A 3DV3A 3QTZA 4CFXA 3HLLA 2VWYA 4HGLA 3NYVA 3UOHA 3QYWA 4IZAA 3OF0A 3AOXA 2JDRA 3NLBA 3QCQA 3QTSA 4ERKA 3COKA 2PTKA 5KMLA 5CWZA 2QOKA 3R1YA 4IX6A 4QD6A 2REIA 1E9HA 1H1PA 4L3PA 2F9GA 4U97A 5BMSA 2O0UA 4R3RA 3IONA 4EH3A 5CEPA 5F94A 4S33A 4FZ6A 2XRUA 3T3UA 3FL5A 1XH7A 3OXZA 3TNHA 4AQCA 2UVZA 3NIZA 5AAEA 2WMUA 4IAIA 4IWPA 3LFDA 1S9JA 2HW7A 4FOCA 2PWLA 3VQHA 3FXZA 4QMMA 1SNXA 3FC1X 1SVEA 4O86A 2PVYA 5LMKA 4P7EA 4NK9A 4TT7A 2YIWA 3A7JA 4OAVB 2W5HA 2VUWA 4RPVA 3QHWA 5KBRA 4XBUA 3L8VA 3R8MA 1JKSA 1H01A 4MWIA 2DWBA 3UIUA 2ITVA 4NW6A 4EJNA 1H0VA 3VS1A 3RK7A 4ORKA 3JXWA 5ANGA 4V05A 3MYGA 3QBNA 1Q3WA 4YU2A 3QTIA 4OTFA 5HG7A 5FWKK 2XNPA 3R63A 5BMMA 2IW9A 4E8AA 3DKCA 1NT2A 3BEGA 2XH5A 3VC4A 1H07A 2VD5A 2ZJWA 3K3IA 3E8CA 3ENMA 5BYLA 1BL6A 2WHBA 4NSTA 4A4XA 4C38A 3C4WA 3EN7A 2JFLA 2PMIA 1PMNA 1OMWA 2F4JA 1V1KA 2GNJA 1FPUA 1ZOHA 2QNJA 3G2FA 3KGAA 4LI5A 5M4UA 4QTAA 3TACA 3DKOA 4RIWB 5KO1A 4GG5A 4KRCA 4MBLA 3ENHA 2PMOX 4XLIA 4EOQA 5HQ0A 3QQFA 2ZMCA 5KMNA 1J1CA 1U59A 4R3PA 5IUGA 4CRLA 4EYMA 3LXLA 2YIYA 3DDPA 2WMTA 3CGFA 2WU6A 3I7BA 4F4PA 4O7WA 4PDYA 4RVKA 4AZWA 4EH7A 4B8MA 5JFXA 3FI3A 3H10A 4PDSA 3II5A 4R5YA 3ZCLA 4DA5A 4EOOA 5D9HA 2CSNA 3PSCA 3TL8A 4J97A 4FNXA 3FE3A 2BAJA 3LQ5A 3SXRA 5HIDA 4FTTA 3QRUA 1IR3A 4R1VA 4BR3A 4HZRA 5EYMA 4PUZA 3SV0A 2YLEA 4IDVA 4ZJJA 3BLRA 3MVLA 3UYSA 3I5ZA 2IZRA 4QMZA 4ACMA 5JGDA 1M7QA 2RKUA 3FUPA 4FIEA 3FI8A 3MY0A 5H8EA 4PQNA 1REJA 3ULIA 2FUMA 5K5XA 2WKMA 5J5SA 1WBTA 4LRKA 1OIYA 2WTVA 2XIXA 5M08A 4ZS0A 3HMPA 4A07A 2OJ9A 2YM6A 4RBLA 1BI8A 1PXOA 2QLUA 3ZLWA 4PPCA 3PG1A 3CY3A 1W0XC 1DI9A 1TVOA 4FG7A 3F5UA 4R6VA 4WNOA 4I6FA 4QMSA 5G6VA 5CXHA 2JDTA 1I09A 1Y8GA 3HNGA 4TWPA 4GKIA 3KMMA 3ZO4A 3R8UA 4ZY5A 3PZEA 3QFVA 3BQCA 4X2FA 4FTCA 5J1VA 4IB3A 2BILB 3R02A 5KMJA 3QHRA 3R6XA 3IOPA 4ONAA 3AD5A 3AC5A 3TXOA 5K4IA 4E93A 4YSMA 3HMOA 5A4TA 3O51A 3B2TA 4C3FA 4BKYA 3D4QA 2B7AA 2C3KA 3GVUA 4HNIA 4IX4A 4XEYA 4RMZA 2WGJA 1W83A 3FLQA 1OECA 1X8BA 3F2NA 3FPQA 2F49A 4C0TA 3NYXA 1WBSA 1ZZ2A 5TE0A 4FKRA 3TZMA 3QLFA 3GB2A 4CKIA 5GNKA 2OF4A 5DVRA 4BHNA 4M68A 1PXMA 3FLNC 3BWFA 4NWMA 3GCQA 5BVOA 4QPSA 4M3QA 5FEEA 3EKKA 3LKMA 1UWJA 3VUKA 3IDCA 3L8SA 4FTJA 2C6DA 4CFUA 4I1ZA 4FSWA 4UXQA 2OIDA 4H58A 3HRBA 3QAME 2UVXA 4LL5A 3OVVA 4FKQA 4L46A 3F5PA 3N9XA 4DTBA 1FBNA 5AP1A 1UV5A 4H3BA 2I1MA 3VJNA 3C4XA 5HTIA 2CNQA 4ZMFA 2Y8OA 2QONA 2RL5A 3EQHA 4UMPA 3FV8A 4MVFA 4M67A 4WG3A 4RIXA 4W8DA 4FZAB 3KVWA 4WOVA 2HELA 4EOSA 2HENA 2XM9A 4K9YA 4EHGA 2IVSA 1UKHA 3F5XA 3HMNA 3HP2A 4IFCA 4II5A 5CQUA 4E5WA 4AZVA 2GFCA 4IJPA 3HP5A 5H2UA 4D9TA 4PNKA 4AZFA 4M15A 3CQUA 2RF9A 3RINA 3SXFA 3C0IA 3ATSA 3P5KA 3CTQA 1ZRZA 3GC7A 3PXRA 2GTMA 2C3LA 3CJFA 4GVJA 3ORXA 5DRBA 2ONLA 4LUEA 3ZO2A 4XV3A 1OKVA 3FZRA 4RJ5A 2C5VA 2O5KA 3HYHA 4ZTHA 2PULA 3FYJX 2IJMA 4N6YA 5L8LA 2QVSE 4IACA 3FHIA 4OUCA 4V04A 4ZTSA 4ITIA 2BRNA 1Y6AA 3K54A 5I0BA 5CAPA 1GJOA 5AP7A 4QMYA 4R8QA 3KRRA 1NXKA 3MH3A 4HW7A 2J90A 2Y7JA 3GNIB 3HV3A 2UZDA 4E26A 3KY2A 4EH2A 2UZVA 4M8TA 5DE2A 2UW6A 5K0KA 4XV2A 3SKCA 4EKLA 4WO5A 2QHMA 2R2PA 5HVKA 3DFAA 4OTDA 3A7GA 4AU8A 3KRJA 3UPXA 3OCBA 2GCDA 4LQMA 2EXMA 4GT5A 4CKJA 2BHHA 3ALNA 1JKLA 1UU8A 3OTUA 2JDOA 3CKWA 1OBDA 4JBQA 1JWHA 2X81A 2VV9A 3PTGA 4YJVA 3F6XA 5DLSA 3WBLA 5JGAA 5JKGA 1Q97A 3MPMA 3ZRLA 4ENXA 2XCHA 3CJGA 3LM0A 4AW5A 1YWVA 2OIBA 4A7CA 5IU2A 3DB6A 4EWQA 5DT0A 4QP1A 2WQNA 2FO0A 4PPAA 5J5TA 3KL8A 4FKUA 3F2AA 1MRYA 1MRVA 3GUBA 4ZLOA 5AUUA 3L9PA 5LARA 4O21A 3EFWA 3VRYA 4O7SA 2ZM4A 4BYJA 2PU8A 4FBXA 5FTQA 5D10A 5FXQA 3ATTA 3FC2A 1OM1A 4NT4A 4ZP5A 3OEZA 3IW5A 4FSUA 2R7IA 1JSTA 3MSSA 2YM7A 4A9TA 3A7FA 3FHRA 3PXYA 4UWYA 3H9FA 4GT4A 4FI1A 4FVRA 3HUCA 5EHLA 3DTCA 3KMUA 4FTLA 4NJ3A 3VULA 2X7OA 2UZEA 3P7BA 4EK4A 4PL4A 4E5BA 4KIOA 2QOLA 1LPUA 4FYOA 3VN9A 4BDJA 3UQFA 2RFSA 1JSVA 4FV6A 4N4SA 3U55A 2XEYA 4O1OA 1IAHA 3UP2A 2QC6A 3FQHA 1H08A 3QD2B 4D0WA 4FUXA 4IWQA 4O1PA 4RLLA 3TUCA 3ZO3A 5HG9A 3A60A 2BDJA 4BCPA 2OJFE 4FNWA 3Q5ZA 3KXXA 3P4KA 3NNUA 3BBTB 5K9IA 2R3IA 3ACKA 3E93A 2BCJA 3C51A 4LOQA 4O0SA 5A6NA 5JQ5A 4CNHA 2WMVA 1LEZA 4WRGA 3NZ0A 1SM2A 1FVRA 3PJCA 3OP5A 4M14A 1Q8TA 4U40A 4Q2AA 3A4OX 1MQ4A 5EOLA 2FH9A 2JFMA 4C2VA 4BRXA 4RVTA 1PY5A 4P2KA 4FICA 2W4OA 5EM8A 2VWXA 1H28A 3KREA 3A8WA 5DPVA 1JQHA 3RNYA 2WMBA 3PVGA 2QOOA 3GU7A 1XH4A 3ZM4A 5CU6A 4ZSAA 3GEQA 2XIKA 3PXFA 5HBEA 2CPKE 2ERKA 4L53A 2X8EA 3KU2A 5A4EA 2XRWA 3BE2A 3VQUA 2OXYA 4EK5A 1YDSE 3BU6A 1OZ1A 4D4RA 3D5VA 1YWNA 4RX9A 2IG7A 2F2UA 4MNFA 5AV4A 1XJDA 2BZIB 4NU1A 3UG1A 2CDZA 2W05A 3OWPA 4PF4A 3QD3A 5CLPA 2IO6A 3UO6A 4XS2A 3N4UA 4DGGA 2GS7A 3E3PA 1H27A 4U43A 3SW7A 2B9IA 2YZAA 4W4XA 4B99A 2RGPA 1Q62A 2C3JA 3BKBA 4MBIA 2I0VA 4KSQA 1WBPA 1APME 3F88A 2ZB1A 3HVCA 4FSYA 5AP4A 3TV7A 4GK3A 4LRMA 4RWKA 1CM8A 4LG4A 4ZSEA 5I9VA 4UEUA 2PZPA 2J0IA 5IDPA 1WBOA 4J71A 3AMAA 4IM2A 3R9HA 3RZBA 2OZAB 1TKIA 3HA6A 1YXTA 2QOHA 3BPRA 4L7FA 4C58A 3Q96A 5AR8A 3TEIA 1PXKA 1S9IA 5KBQA 5LVMA 5EQYA 2FVDA 3LFBA 3UO4A 5EQEA 1HOWA 4FTMA 2C6OA 1FGIA 3D15A 3ZMMA 3IDPA 2V7AA 4ALUA 3SXSA 5LMKC 4L43A 3BYMA 3DU8A 4RX8A 4AGWA 4BBMA 4J98A 3ROYA 1LP4A 5LVLA 4FT3A 4TZRA 4HCVA 2H34A 3TG1A 1Q8ZA 4ALVA 4XNEA 3K5UA 3Q9WA 3MJ1A 3QA8A 5J87A 3TZ8A 4AA4A 4JOAA 1K2PA 2OGVA 3OY3A 2YCFA 3LFFA 4FKOA 3DFCB 4BIBA 2ZV9A 1SYKA 4JR7A 2OI4X 3AD6A 4UYNA 2AYPA 4FL1A 3WIKA 4BDHA 1R3CA 3FLWA 2QURA 3EQCA 4D1SA 3H0YA 5ANOA 3UGCA 4UB7A 5HNBA 3LZBA 5AAFA 4PDPA 2DQ7X 3EN5A 3R8VA 5J1WA 3WF9A 2XEZA 4RC4A 4QMVA 3RAHA 4GFMA 4GIHA 1U4DA 1M17A 3P9JA 3OG7A 4MD9E 2VO7A 4RIYA 3U51A 3TKUA 5EM7A 4AXAA 4F9WA 5HLPA 3T3VA 3UZPA 2QI8A 4HNFA 3G9NA 4YHJA 4FIGA 2GTNA 3HV4A 2DUVA 4P5ZA 4U7ZA 3ORKA 3KK8A 2IW6A 2X1NA 3RPSA 4ZSGA 3FZOA 3QTXA 5EW3A 1YWRA 4EOJA 1PRYA 3MIYA 4FVQA 4AOJA 4J8MA 3NNWA 4ZY6A 4FK3A 3WZKA 4M97A 1H1WA 3I0OA 5M53A 4HPUE 5CSPA 3F3TA 4F09A 4M69B 4YUQA 5BYZA 4O22A 4FTAA 4RJ7A 3MVJA 3S1HA 1JNKA 5I3OA 2XNEA 3PA4A 4NJDA 2X7FA 5HLWA 3EHAA 4RLKA 1YVJA 2YDKA 3DAEA 4Z55A 4GS6A 2I6LA 3ZHPC 3SX9A 4I4EA 3IW8A 5J9YA 5J9LA 4R5SA 3QD4A 1U5QA 4OTIA 3UYTA 3DK3A 4YTHA 1E1XA 2HYYA 4BDCA 3UQCA 3VS0A 5HLNA 4BI1A 4Y73A 2I40A 4YBJA 2VWUA 5E8UA 1ZYLA 5TOZA 1O6LA 4K33A 3QRKA 5EK7A 1FGKA 3NUYA 4NFNA 3LFNA 3NAYA 4EZ5A 3GU8A 3VF9A 2A4LA 3Q9XA 1XR1A 3UO5A 2XK4A 2EXCX 3R9OA 2PYWA 2NPQA 4Z7GA 1GY3A 2HWOA 5AP0A 3HUBA 4CZYB 4QTEA 5IKWA 4D55A 5HU9A 3DQXA 3DZQA 4E6DA 5D41A 4E6QA 5FG8A 3TN8A 2HCKA 3R7YA 1SVHA 2J5FA 5BUIA 1M2RA 3PP1A 3HMIA 4FZFB 3UP7A 2RFNA 4FTIA 3C0GA 5AA9A 5C26A 3ZRKA 2YDJA 4RX7A 2C0OA 3RWPA 3ZYAA 1Y57A 4UMRA 3GQLA 2QOQA 3ID6C 4C37A 4R7HA 2H8HA 4Q9ZA 2Y4IC 4IBMA 4YBKA 4IZ7A 4DGMA 4A9YA 1ZXEA 2UZLA 3UQGA 3MY1A 4JX3A 4QYFA 1U54A 2PUIA 4FG8A 3C0HA 5EW9A 2WIHA 2O63A 2C5XA 3Q60A 3RPVA 2O3PA 3Q5IA 4MKCA 3OROA 2V0DA 4FOBA 5HCYA 4MEDA 4BZDA 4NW5A 3U6HA 4BWKA 4X2GA 2O65A 5KZ0A 2J4ZA 4BCQA 3H30A 1JKTA 5EI8A 5BVWA 5BUJA 3AGMA 3R7OA 3W2QA 3TCPA 4MWHA 3ZEWA 2UZUE 4I5PA 1IA9A 3CY2A 3QQKA 3LJ2A 5I9XA 2ACXA 2W96B 4YMJA 4ZZMA 3FMEA 4I41A 3EFKA 4EOIA 4F08A 4KS8A 3SRVB 4QP2A 4DEHA 4IM3A 4XG4A 1PMUA 3W10A 1LR4A 2F7ZE 3TNQB 3DT1A 3Q4UA 3LQ8A 5A3XA 3D7TB 5IQDA 3E8DA 3PLAE 5DR6A 1XH5A 2VWWA 5HD4A 4H39A 4IAKA 3C5IA 3BHTA 5DEYA 4EZ3A 3I6UA 3JS2A 5FUTA 3ZC6A 4EOKA 2Z7RA 5CEQA 2XNBA 1M14A 1OL7A 4TYHA 2BRBA 4NKSA 3RNIA 4QMUA 2ONLC 4IC8A 5KKRB 4U44A 1R1WA 2OBJA 2QHNA 3C4CA 4YPDA 4USEA 4O0TA 3EQFA 3IO7A 3U9CA 2HXLA 4FV7A 3F2RA 3LFSA 4L3JA 4E7WA 4FV2A 4LOOA 4F9YA 2OLCA 1DAYA 4FIHA 4AN3A 1BL7A 4FTKA 4UV0A 1PXNA 3QU0A 5IA0A 3PWYA 2BFXA 3RJCA 1DM2A 4D1ZA 3MWUA 1YXUA 3BYVA 4QMTA 3WZEA 1L3RE 4L68A 4U80A 1KE9A 5CSXA 4O81A 2Y9QA 3RM6A 3GOPA 3BQRA 5L8KA 1AD5A 3DXNA 4MXCA 4AACA 3ORMA 4AP7A 2WEVA 3CR0A 4DCEA 1KE8A 4AS0A 1ZAOA 3BCEA 4X3FB 5ANDA 1H1RA 2JLDA 2PVFA 3C1XA 3QQJA 1UNLA 4OBOA 4Y5QA 5H8BA 5IEVA 5HU3A 1PW2A 4F6UA 4FIIA 5GJDA 1KV2A 2EVAA 2YIXA 5HVYA 5IQIA 2IWIA 4JG8A 3UOKA 2CNVA 4AGDA 2W06A 4MF1A 2PVKA 3R0TA 2ITUA 3LJ1A 1SZMA 3HX4A 4JJRA 4BGGA 5L6PA 3QGYA 4PY1A 2VTLA 5B2MA 2GQGA 4O83A 2UZWE 3V5JA 3LM5A 4RJ3A 4IZ5A 2R3GA 4DN5A 4EI4A 4FEQA 4RZVA 5DNRA 5TR6A 3KF7A 2CCHA 4DITA 4CVAA 2XIRA 4TNBA 1MRUA 5AV2A 4DGOA 1R0PA 3LXKA 4RGJA 1ZARA 3BLHA 4RQKA 4YSJA 3WF8A 1Z9XA 3NIEA 2JAMA 3EZRA 4KIKB 4EYJA 2ZM3A 2WQOA 3PWDA 3DXPA 2RFDA 4YZDA 4D2PA 4AOTA 4O7ZA 2OFVA 4GRBA 3O7LB 4AN9A 4F0FA 3Q4TA 2C5NA 1W8CA 3TV6A 3FMHA 4L45A 3JY0A 3LW0A 2VN9A 4W4WA 3LFEA 3WILA 4E20A 2J6MA 2WXVA 4JNWA 4AZTA 2C6MA 2YJSA 3WI6A 3NDMA 3FKNA 4HVDA 3GCSA 3LFAA 4FTQA 4QP7A 3PPKA 3S0OA 3OS3A 1OUKA 4DINA 3KXZA 3PVBA 4ZTQA 5EI6A 1FVVA 3UOJA 2XKCA 2G2FA 2E2BA 4M7IA 2HZIA 4ACDA 2E9UA 4MHAA 5M55A 3ANQA 5AP6A 1K9AA 4CG9A 1M2PA 3W2CA 2BRMA 1XWSA 3R83A 4KA3A 2OXXA 3AC3A 2NO3A 4FMQA 4Y5HA 1J7LA 1JSUA 4CTBA 2PUNA 2X6DA 1YRPA 4IANA 1LUFA 2LGCA 3CD3A 5B2KA 4CQGA 4RSSA 2WQBA 5B0XA 3RPYA 4O2PA 4O27B 2JC6A 1M7NA 3POOA 2XYUA 4ANSA 4V0GA 3HV6A 3OT3A 4NIFB 4UN0C 1REKA 4G17A 1XH8A 5H3QA 4FL3A 4Z9LA 2AC5A 3LVPA 4GK4A 4HZSA 3VAPA 5JH6A 2BTSA 1T46A 3PSDA 5C1QB 3C4FA 3F7WA 5E8VA 4YJPA 3UIMA 4KIPA 4GU6A 2OF2A 4L9IA 4APCA 2BZJA 2UW3A 2CN5A 3O23A 5F95A 5K4JA 3ZC5A 4FT0A 5LQFA 3CKXA 5K3YA 3KMWA 4HCUA 4XV1A 2IN6A 1WBNA 3I4BA 4IAFA 2UZBA 4JRVA 3PE2A 2XKEA 4DCAA 5ANJA 3WZUA 3NUNA 5HIEA 3VUHA 4KB8A 4BZOA 3DBDA 5AUXA 2B55A 3E62A 3RALA 4BGQA 1JAMA 2X9EA 3KULB 2BTRA 3BELA 3MFRA 3OTVA 1J1BA 4YHFA 4ZK5A 5TKDA 3BV3A 3Q4ZA 4QYEA 4PL5A 5HHWA 4N70A 3QYZA 5GJGA 3WF7A 4F6WA 5IQHA 4XRLA 5DYJA 1BKXA 5IDNA 2OKRA 1U46A 2V22A 4IH8A 3FY2A 3LXNA 4I6HA 4NEUA 4Z7HA 3R8PA 3O8UA 4MX9A 4XX9A 3A7HA 3I79A 3T9IA 2C0TA 4H1MA 5GHVA 4BCOA 5JZJA 2C1AA 4K77A 4FC0A 4KBKA 2ITYA 4S30A 4FSTA 2IVUA 2RG5A 4LV5A 3OOGA 4FKIA 1R0EA 4DEBA 2WMQA 2C1BA 3BWJA 4XG9A 3ZBXA 2XK7A 3MFSA 1ZMWA 3R71A 3QRJA 4KBCA 3M2WA 2HZ4A 2UW4A 2BR1A 1WAKA 2YDIA 2X7GA 2VAGA 3D2KA 4M66A 2ZV8A 2OO8X 4PTCA 4BDKA 1FMOE 3F5GA 4JS8A 4DEAA 4FKPA 4EC8A 4XG7A 3VS7A 2BIYA 3AC8A 3MTLA 3O71A 3A99A 4HYSA 4OTPA 4WA9A 1KOBA 3TT0A 4DT9A 3FMLA 4LGGA 3R7IA 4AFEA 1A9UA 3DQWA 4TYJA 2OJIA 4N0SA 3LQ3A 4XCUA 4FEWA 3TIZA 3TJDA 3UNKA 3QLGA 5FBOA 5HG8A 5JN2A 2VTOA 3SQQA 2VTMA 2W4JA 2X39A 4RIWA 3Q9YA 4OLIA 4PMPA 2RSVA 3WIGA 4FZDB 5JFWA 4BKJA 4XG6A 5AAGA 1QMZA 4WKQA 3R1QA 4ZJVA 4WNMA 4ZLZA 4FKLA 2YN8A 3FLSA 2H6DA 4KWPA 4EQCA 5CEOA 3FZSA 2JKQA 3Q9ZA 2I7QA 3BE9A 5LWNA 4CCUA 4J8NA 2YHVA 3DAJA 3EYGA 2QU6A 4W9XA 5B2LA 2QLQA 4YZ9A 4YNEA 3LMIA 4W8EA 2HW6A 4CT2A 1VJYA 4IX3A 1Y6BA 4EUTA 2C6LA 4DF3A 2WO6A 1CTPE 4H1JA 3MGYA 3V6SA 4DTKA 1YOMA 3DLSA 2WMXA 4IADA 3BGPA 3E5AA 2W1EA 1A06A 4RFMA 5IH4A 2XM8A 2HAKA 3OT8A 3R8ZA 5L2SA 4KD1A 2W1DA 4XMOA 3C13A 4DEIA 5HTCA 1CSNA 3R9NA 2J9MA 3QC4A 1PXPA 5CI7A 4EORA 1JPAA 1KV1A 3VO3A 5BUEA 4O96A 2WEIA 4JT3A 3D7ZA 3D5UA 3MH2A 4W4VA 4ZZOA 1NW1A 4W4YA 4O0WA 4OTRA 2HWPA 2EB2A 2PVNA 1H1SA 5T68A 2ZM1A 4XP2A 3SOCA 5DA3A 5ITAA 4FV8A 1K3AA 4U0IA 4J95A 3WZDA 3MA3A 3U87A 3LJ0A 4AUAA 2BFYA 5FEQA 2UZTA 5HE3A 3F3VA 3R73A 4O6LA 5JK3A 2C47A 4D5HA 5M51A 3PJ8A 3W2SA 1PJKA 2YCSA 2OSCA 5F1ZA 4BCIA 3QL8A 3PPZA 2OICA 4C7TA 2BAKA 4L52A 3W8QA 3KXNA 4LGHA 3R1SA 3R2YA 3RPOA 5ETCA 3VVHA 4DGNA 5IQAA 2PVJA 3G9LX 4AOIA 5EG3A 2BDWA 3L9LA 2PE0A 3KRXA 1ZMVA 2NNWB 2OH0E 4YLLA 4LOPA 3ORZA 4IVDA 1WFCA 2B9HA 5CI6A 3C4ZA 3W2PA 4M0YA 2CLQA 5A46A 5J79A 4Y46A 3MDYA 1H4LA 3IGOA 4AW0A 3FAAA 2F7XE 4G34A 2X4FA 5EDQA 5L3AA 2IPXA 3DJ5A 4AA5A 4CLIA 4EK3A 5EHYA 4IVAA 3VUTA 4TWOA 5C27A 1G3NA 4QQ5A 1YHWA 4FEUA 2XCKA 5L8JA 3NGAA 4P4CA 5HO8A 5AWMA 5C4LA 3KF4A 3I1AA 5CY3A 4G6LA 1FQ1B 4I93A 4U45A 3MESA 5B7VA 5AR2A 4DEGA 2ESMA 4L44A 2YZLA 4BDBA 3GENA 1PF8A 1XKKA 4OT6A 5IG1A 3QRIA 4KRDA 2XK6A 2B0QA 4PNIA 3IOKA 4EH5A 4JR3A 3UZRA 4ZIMA 3E64A 4RC2A 5HE1A 5JT2A 3GQIA 2WMAA 1RE8A 2C30A 3D5WA 4FA2A 3W8LA 3KEXA 4F70A 1AGWA 4GFGA 4AX8A 4S32A 4UMQA 2VRXA 1ND4A 1G8SA 5CU3A 4GJ3A 3H4JA 3FKLA 3I0QA 4YNOA 3TKHA 4AGUA 4EH9A 4ZSLA 4UMUA 3U6IA 2R3HA 4YJSA 4OTWA 1HCKA 5DR2A 2Z02A 4YP8A 4F0IA 1BMKA 5HIBA 5I9WA 4F63A 3QGWA 1VEBA 1NVQA 3BYUA 3EQRA 5BYYA 3L8XA 4ZY4A 2RFEA 2ITTA 3AC4A 2ITOA 3CPCA 4EHEA 2YITA 2ZYBA 3A61A 3DKGA 2G1TA 4QNYA 4L6QA 4OTQA 3ZRMA 1GZOA 5I9UA 4CFMA 4HGTA 2W7XA 3MFUA 1ZLTA 5KKRC 1GAGA 4CYIA 2YWVA 2R3KA 2YAAA 3NUUA 2VU3A 3ZUVA 1KUTA 3SLSA 4PWNA 2B9JA 2X6EA 4ITJA 3IDBA 4EQMA 4LMUA 4W9WA 2VTPA 4C34A 2J50A 2J0KA 2Z7LA 2R3LA 4FSQA 2A27A 4QT1A 2WTDA 3OY1A 3OZ6A 3ZBFA 3E7OA 3ORPA 4B0GA 2VX0A 2XZSA 2P55A 3IKAA 3QC9A 5AP5A 4C02A 4CFFA 3CE3A 3FMKA 3UMWA 3G33A 5GZ8A 2WZJA 5DT3A 1YXXA 3FMMA 5DN3A 4D2VA 5KMIA 5CZIA 2PL0A 3F69A 4EHZA 3HGKA 1XH6A 1R78A 4X3FC 1PHKA 4CD0A 3EN9A 4F1TA 2BRHA 2UW8A 2AUHA 3VBTA 4S2ZA 3KXGA 5CAVA 5ICPA 2QO2A 5LMBA 2H96A 3ZONA 3ZXTA 4R1YA 2J0JA 4BZNA 4EC9A 3NUPA 5IEYA 5CVHA 3WE4A 5HX6A 2R0IA 4CV8A 3SA0A 3TDWA 4BGHA 3R21A 5ACBC 2R3MA 2YACA 4BI0A 4CSVA 2JDSA 5FTGA 3MPAA 5LVNA 4MXAA 4RJ4A 5BVKA 4C61A 3TM0A 4ANMA 3O17A 3QCXA 4JAIA 4RRVA 4MXZA 4PMTA 4DTAA 1OL2A 2XS0A 3R01A 4DGLC 3E8NA 1VYWA 3BIZA 4NM3A 4Q5HA 2B54A 3VUIA 2PMNX 4KKHA 4NCTA 2CKPA 3P7CA 3VS4A 3RM7A 4QP9A 4IX5A 1GZNA 3OWKA 1BLXA 4A06A 4I6QA 4JBPA 4AZEA 5HOAA 2CNUA 3C4EA 3GXLA 4QMPA 3TNWA 4QQTA 3G51A 4E6CA 4EH8A 1M2QA 2W5AA 4OTGA 1W98A 2IZSA 1E1VA 2C6EA 3JVRA 3KN6A 4K18A 4MF0A 4PTEA 4JDJA 5HO6A 3R9RA 4LYNA 4K11A 1P4OA 3TIYA 3VBVA 4C4FA 1ZZLA 5EQPA 4BYIA 4AA0A 1O6YA 4CMOA 3MVHA 3EQDA 3D0EA 4QYGA 2JKKA 3ZH8A 3UVPA 4IE9A 4JBVA 4HVSA 5E9EA 3BLQA 4N6ZA 3ZTXA 3UC3A 4BDGA 2GNGA 3B2WA 4QMNA 4EOPA 5CVFA 3OUKA 1Q8UA 3MPTA 1OI9A 2ITWA 1H25A 2QKRA 3RAIA 5BVFA 2ITPA 3FMNA 3AC2A 5EOBA 4CG8A 5CU4A 4BCJA 3KRLA 4EK6A 1URWA 2JBPA 3MV5A 5AR7A 5IUIA 3VIDA 2G15A 4QP4A 1ZWSA 3GOKA 4GL9A 1XHAA 2PY3A 2XKDA 4BBFA 1KWPA 2GNHA 4Z3VA 1WVXA 3AC1A 5DMZA 4O84A 3PJ1A 1YQJA 1YXSA 3ETAA 4IC7A 3ZU7A 4IXPA 3DCVA 3ZM9A 4ZTLA 2PZYA 3JUHA 3ZDIA 1P2AA 2GS6A 2EUFB 5K0XA 3VS5A 5E8ZA 5FDXA 3U9NA 2EXEA 3UG2A 3S00A 4XH6A 3D83A 5EYDA 2OZAA 4FV0A 4I6BA 4X7QA 4RIOA 4YC8A 4YJUA 4DYMA 4QQJA 4CLJA 2W1IA 3Q6UA 5FLFA 3BBWA 4C3PA 4YTCA 1IRKA 3FLYA 5E7RA 4TKSA 5CEMA 3PXZA 4L00A 3LE6A 3QXPA 4FODA 3RMFA 3UIXA 5EFQA 5J7HA 4G3EA 3R28A 5M57A 5EYKA 4NYEA 1NA7A 4XG2A 1H26A 3RPRA 3DLZA 4IAYA 1OL1A 5FXRA 3HAMA 1OL6A 4FYNA 2UW7A 2JGZA 3QWKA 2R3NA 2IVTA 4FNYA 4GMYA 4WRSA 1AQ1A 1O6KA 2QKWB 3L8PA 2BZKB 3W33A 3BYOA 3DNEA 1GNGA 2ITNA 3CXWA 4HJOA 3V5TA 4BL1A 3QQHA 4QPAA 4A9SA 1ZYCA 4YJNA 3NMUF 1UU3A 4RJ8A 4I94A 2GS2A 3PLSA 5AM7A 3W1FA 4PMMA 3UNZA 2J0LA 4JVGA 4JQ7A 1RQQA 4RFYA 1YHVA 5EDPA 5J8IA 4K2RA 5C01A 2WPAA 3QTQA 4Y85A 4K0YA 4AF3A 4QYYA 3I5NA 5EKOA 4AN2A 3BU3A 4MNEB 3GI3A 4U41A 4NM5A 2JITA 3CC6A 3FJQE 4D58A 1TQMA 1F5QA 2QR8A 2OU7A 4E73A 4QMOA 4G16A 2PVMA 3QTUA 3FLZA 1WCCA 2XP2A 3LLTA 4ACCA 5T3QA 1H8FA 2WAJA 3GU6A 4C4IA 3KC3A 4C4GA 4FEXA 1UU7A 3EL7A 4ZJIA 5LJJA 3V04A 5DHJA 4IHPA 4DFXE 5KMMA 4TYEA 5JMSA 3O8TA 4B9DA 4K6ZA 4YLKA 2UV2A 2XBJA 3GT8A 3VUMA 1JLUE 4G2FA 3RWQA 2O64A 4FZ7A 2J7TA 2CGVA 5E91A 4EOMA 2XK9A 4M69A 4MCVA 3W55A 2C6IA 2HXQA 3JPVA 3R2BA 4U8ZA 5IA3A 3LOKA 2Z60A 4MH7A 3DBCA 4GFOA 4Y8DA 5IZFA 4BTFA 1Z5MA 4RWIA 2DS1A 3BHUA 3RKBA 5M4FA 4RC3A 4H36A 3ALOA 2CKOA 3P08A 2VTHA 3EFLA 5FP5A 3OXTA 4MD8E 4AZSA 4PX6A 5CNNA 3EZVA 2BRGA 1YHSA 2UZOA 1J91A 1Q8WA 3GC0A 3UNJA 2QG7A 1BX6A 1WZYA 2I0HA 5JRQA 3NVMB 4D1XA 2HK5A 2WU7A 3CEKA 3KQ7A 1OL5A 5E1EA 5A4LA 1YW2A 5I9YA 4CT1A 3LCDA 4UZHA 4F1OA 5I3RA 3N51A 4O2ZA 3ZFYA 4BCNA 5IISA 4GW8A 3PPJA 3BGQA 4IAAA 4FNZA 2JBOA 2GU8A 4I4FA 2R4BA 2BROA 4KKGA 2QODA 2FSTX 3C9WA 3RCJA 5LXMA 4FX3A 4JIKA 3E3BX 5DH3A 4DH3A 3OCSA 4L01A 5CAUA 1YOJA 2QQ7A 4NKAA 1LEWA 3FZ1A 2GNLA 4FVPA 4DHFA 4F65A 4QMQA 4YR8A 3OCGA 4ZAUA 5IH6A 4CFWA 3P7AA 3ZLSA 4I0TA 4XG8A 3RGFA 5KUPA 2UW9A 2VZ6A 1JBPE 4FV3A 4QTCA 4G3GA 2W4KA 4D4YA 4DEEA 1J7IA 1HCLA 1YDTE 3COMA 4G5JA 4P90A 3ZEPA 1PYEA 4QMLA 2JEDA 1YI6A 3CPBA 3AG9A 3QQGA 1OIQA 1XH9A 2CLXA 2EU9A 4RVLA 4A9UA 1VZOA 1RW8A 2ZAZA 2W5BA 4FTOA 4FIJA 4G3CA 3VW6A 3ZUTA 4ACHA 3O2MA 2VO6A 5FXSA 4F99A 3MBLA 4PP9A 3WE8A 2VTTA 3P86A 1WBWA 4G3DA 4YTFA 1CKPA 3MA6A 5JZNA 1F0QA 3BI6A 5HORA 3EB0A 4MQ2A 4LV8A 4WT6A 3NW5A 1NY3A 3AMBA 5DEWA 4FF8A 1IASA 3IW7A 3O50A 3ERKA 3FWQA 5ETAA 5C8KA 1OUYA 3C50A 4Y72A 5CX9A 3HDNA 4B7TA 3AQVA 3KXHA 3SW4A 2V7OA 4BCFA 3SRVA 4XP3A 4EUUA 3QRTA 1V0BA 1OKZA 5EKNA 3D14A 4LL0A 4C3RA 5E8WA 2CHLA 1B39A 3D7TA 4HPTE 5ACKA 3RK9A 3VW8A 3DXQA 1OGUA 3JR1A 3NS9A 3Q32A 5E8SA 4F9CA 4IB5A 1ATPE 1GIIA 2VWZA 3G6HA 4HGEA 5IQBA 2W1GA 3C5UA 2HZNA 2VWBA 1GIJA 1ZYJA 5D7AA 1W84A 4FKTA 4A9RA 4G9CA 1ZYDA 4AGCA 4KINA 5H8GA 5E92A 5KZIA 1YI3A 3LFCA 5JEBA 4EQUA 3HMMA 2WOTA 3NUSA 4XP0A 2QO7A 4USFA 1JVPP 3PFQA 3H0ZA 4O91A 2ETKA 5FGKA 3D5XA 4MXYA 3EQPA 3QWJA 1XBCA 3OW3A 2FA2A 1MQBA 5IMXA 4D4VA 5BNJA 1PYXA 4CKRA 1I44A 4EONA 3LAUA 3PA5A 4U9AA 4DEDA 4DH7A 3PJ2A 5D7VA 2P4IA 2RIOA 2IVVA 4DH1A 4DH5A 4BN1A 4EBWA 1SNUA 1YI4A 3IG7A 5HE0A 4FR4A 5BVDA 1KE6A 4CMUA 2BKZA 4FKVA 2R3JA 3NW6A 3F3WA 4X3FA 1Q61A 3RI1A 2C0IA 5HCXA 2Q83A 5KMOA 1VYZA 3HA8A 5CZHA 4EH6A 4X2KA 3ZXZA 3DGKA 4X2JA 4KABA 5ANIA 5GZ9A 4AWIA 4F7SA 2OH4A 3L9NA 5CXZA 3DJ6A 3AT4A 4XJ0A 3LMGA 3MFTA 4LUDA 5AV1A 3BHVA 4OTHA 4PRJA 4ALWA 4ZSJA 5BVNA 2PUUA 3NRMA 3OEFX 1RDQE 5HZNA 4HYHA 5DR9A 3D94A 3HEGA 4YO4A 5BX0A 3COHA 5AMNA 4I3ZA 5LCJA 3P79A 1J3HA 1UA2A 4WSYA 1CKIA 4D2SA 3GFEA 1W7HA 1Z57A 3QUPA 4WHZA 3DBEA 5EH0A 4KSPA 1UVRA 2YM3A 4JX7A 4YGAA 3CBLA 5E8YA 5JRSA 3U8WA 4KIKA 3CSVA 2FB8A 5AJQA 5HGIA 1Q3DA 3TTIA 3QQLA 1TQPA 2EB3A 5FM3A 3TTJA 1STCE 3EIDA 4EWHA 3FL4A 4TPTA 4WG5A 2R5TA 1PMVA 3EH9A 3OFMA 4D9UA 2A1AB 4FKJA 4RG0A 3VUGA 3GU4A 5AIRA 5AR3A 4DT8A 5CT7A 3NCZA 3O0GA 5AUWA 4DFNA 5A14A 3KFAA 1YXVA 2V55A 3ZZWA 4U3YA 1YKRA 5CSHA 4ASZA 3PXQA 2B52A 4CZUA 4NCTC 4BTJA 1DI8A 1VR2A 4C4JA 2PUPA 1B6CB 2R7BA 2W1FA 4BF2A 3NWWA 3G6GA 4ANNA 2E9OA 4I0SA 4BDAA 2OJGA 4BDFA 3W2OA 4S34A 2J2IB 3H3CA 2UW0A 2WQMA 3OOMA 4XG3A 2ETMA 4JG6A 2F7EE 3UDBA 4DC2A 3COIA 5HO7A 1PXJA 2BKKA 4TWNA 3V8SA 2ITQA 3ZZEA 4BKZA 4G31A 4L7SA 2OW3A 4DE4A 2GNFA 2XJ1A 3G0EA 3IW6A 4BCGA 4NIFA 2XNMA 4I20A 3MJ2A 2BALA 4I5MA 4YJOA 1FMKA 2BHEA 3FSFA 4BTMA 4OBQA 3LMHA 3S3IA 2C68A 2IZTA 4C59A 2HOGA 1B38A 3VUDA 2JIVA 5T6KA 4IDTA 4C36A 4CV9A 4YZBA 3BZ3A 2YFXA 3K5VA 5HVJA 5LVPA 1UNGA 2NP8A 2W1HA 3WOWA 3AXWA 3MN3A 2XMYA 4MK0A 4FV1A 5CEIA 4B8LA 4O7LA 5AADA 2R3PA 4FSRA 3ZFXA 3PVWA 4QPMA 3DA6A 3DBFA 2GQSA 4O7TA 4CGAA 4RA4A 4XV9A 3FYKX 3F7ZA 2BUJA 4AT4A 5DFPA 4JXFA 5EM6A 4QMXA 3NYOA 4I22A 2ZB0A 5JFVA 4FV5A 2C5OA 2WNTA 2J5EA 4HVGA 2PZRA 5BQ0A 3QXOA 2WTCA 3KULA 5D1JA 4BI2A 5IQGA 3PVUA 4QP8A 4C35A 2YISA 3S2PA 4GKHA 3E63A 2R3OA 4DG3E 3PDTA 1Q8YA 3BYSA 4CFVA 4D28A 4ENYA 4RJ6A 4V01A 5KX8A 4Z16A 2WMSA 5JQ8A 4IVBA 2UW5A 3QTWA 2NRYA 3RTPA 3RBWA 4R77A 4JG7A 4AE6A 4QRCA 4C62A 3GU5A 2P3GX 3EWHA 3PRIA 4ID7A 1RJBA 4BDDA 3N4TA 4LGDA 3TJCA 1OIRA 3E7VA 4O6EA 5AP3A 1PKDA 3LCOA 2C3IB 2XIZA 3LFQA 5CU2A 3ZSGA 4D2TA 4EOLA 3UZTA 3M42A 4IWOA 4UY9A 2YM4A 4D0XA 3IQ7A 3ZSIA 1WMKA 5EHOA 4XOYA 4EBVA 5CVGA 4GYIA 3KN5A 4O0YA 5CASA 3ITZA 2R64A 4WBOA 4F9AA 5LOHA 3R30A 4H05A 5CANA 1WVYA 2P0CA 2WTKB 4LFIA 1FOTA 2C5YA 3DK7A 4F6SA 4OW8A 3V51A 4CEGA 2KULA 3MVMA 3OBJA 4JQ8A 4O0UA 3FI4A 2VX1A 3S95A 4IWDA 2JDVA 3DTWA 3L1SA 3RAKA 4R78A 4PMSA 4FEVA 2WELA 3P1AA 3UOLA 3WARA 2QU5A 2UZNA 2O2UA 4KBAA 4D4SA 4ASDA 3DK6A 4FT7A 2ZDTA 4MBJA 2B4SB 3Q04A 5IA5A 1OIUA 1QPJA 4ITHA 2VGPA 2PVLA 4EK8A 3ULZA 5JGBA 4GJ2A 3A4PA 4IIRA 3JYAA 5FQDC 2X8IA 1IEPA 4DBXA 2HIWA 3DOGA 3LCKA 4ZS4A 1OBGA 4YLJA 2G2IA 4BIEA 3NCGA 4XBRA 5CF8A 3GP0A 1OKYA 4KS7A 2HY0A 3PUPA 3QQUA 5C8MA 4O82A 4RQVA 5ETFA 3F66A 3VS3A 3F61A 4X21A 5CAQA 4ZXTA 1XBBA 1ZY5A 3WZJA 5HBHA 4FTUA 3PIXA 5G1XA 3LCTA 4NTTA 5AUZA 4R7BA 2PZIA 4JBOA 3T8OA 3LLAA 2PMLX 1NVSA 3DDQA 2YCRA 4E4XA 2YERA 2Y4IB 3HL7A 1OPLA 3SOAA 4LMNA 2PSQA 3TI1A 1GIHA 5AUVA 3OMVA 4YC6A 4HGSA 4EH4A 2B9FA 2ITXA 3PE1A 4TN6A 5IA2A 4FK6A 4JRNA 5IPJA 2XF0A 3VBWA 3G0FA 4AE9A 4ACGA 3ORIA 3HRFA 3UMXA 4I92A 5L2QA 3R7GA 3O7LD 5KCVA 5C03A 1GZ8A 5D12A 5LVOA 3HRCA 3BV2A 3MTFA 3SAYA 3G15A 4JI9A 4WSQA 2XNGA 4BFMA 4QO9A 3A7IA 3BEAA 1P4FA 4QQCA 3TKIA 2X0GA 3GGFA 4F0GA 5A4CA 2GFSA 2PPQA 4CFNA 4RX5A 2BVAA 3QZIA 5AV3A 3P78A 3PYYA 4DG0E 5IH5A 5KHXA 4QMWA 4AT3A 4GUEA 4EL9A 1MP8A 4ASEA 1O9UA 4M0ZA 3W16A 4C2WA 3OWJA 3HDMA 5HBJA 2YM8A 4RIXB 1H00A 4FGRA 3FSKA 3FBVA 3DNDA 4GH2A 2KTYA 4ASXA 3VF8A 4IVCA 5HESA 3V01A 3W18A 3HECA 4RFZA 5FRIA 4CCBA 3PY1A 4A4LA 5J95A 4GG7A 2VO3A 5C8NA 4CQEA 5K5NA 3FMJA 4QP3A 3QCSA 5KMKA 2P2HA 3Q6WA 4O0XA 4H3PA 4MTAA 4U81A 1G5SA 5L2WA 2IZUA 2CMWA 2PHKA 2WMRA 2BMCA 5HX8A 3REPA 3V8WA 5AX9A 4D5KA 4DAWA 4F64A 3ZFMA 4O38A 4WUAA 1JOWB 2GHMA 2A2AA 4YURA 3EJ1A 3ELJA 3MH1A 5AUTA 4GV1A 4TY1A 2JAVA 3PG3A 4EHVA 1EH4A 3QZHA 5H9BA 3A2CA 2G01A 5LCKA 2ZDUA 3HAVA 4DFZE 5HI2A 4JQEA 5EI2A 1R39A 2QOIA 4IEBA 4F7LA 4EZ7A 4FL2A 1ZOEA 3O96A 4DH8A 4WD5A 4TW9A 3FQEA 3FY0A 1OPKA 2QR7A 3EN6A 3TUDA 1KSWA 4FIFA 5GJFA 4X6QC 5FD2A 4G6NA 4BTKA 1BI7A 2WIPA 3PP0A 3QCYA 4E6AA 5GIOE 2ETRA 2R3FA 2W1CA 2YIQA 4O7NA 2YA9A 4CRSA 2CKEA 4QP6A 2YCQA 3VS6A 1ZY4A 5A6OA 4JAJA 5FP6A 4GIIA 4X3JA 2PZ5A 3Q2MA 4AG8A 3R7UA 4GYGA 2C69A 4AT5A 4X0MA 1PKGA 3SD0A 4IW0A 2R3QA 3FQSA 2W0JA 2VX3A 3MIAA 4YPSA 2EWAA 4C57A 4RWLA 4HYIA 3S4QA 2VNYA 4NL0A 4EJ7A 4IJ9A 4BC6A 3QUDA 4GSBA 4NM0A 3UIBA 3LCSA 2QOBA 1H1QA 4C4EA 4TYIA 2RG6A 3VBXA 1OVEA 3EFJA 3OC1A 3PJ3A 4ZTMA 3THBA 1GOLA 4E3CA 4F1MA 2OXDA 4MXXA 4B6LA 2WB8A 2OIQA 1A48A 2X9FA 3SHEA 2R0UA 2F57A 1J7UA 3TV4A 5CQWA 2XBAA 4WUNA 5E90A 4U79A 3P23A 5I5ZA 2VGOA 5AV0A 2FSOX 4YO6A 1OITA 2A19B 3MB6A 4UWBA 2CJMA 3C7QA 3GC8A 5DOSA 3DJ7A 2XB7A 5DBXA 3IGGA 3UODA 4D2WA 3PZHA 4JDIA 3L9MA 1ERKA 3ORLA 4S31A 4FUYA 4FV9A 4QTBA 3VHKA 3JVSA 4R7IA 4J52A 3HZTA 4QTDA 3EQGA 3FXXA 4FKGA 3ACJA 3PSBA 3F3ZA 2QD9A 3F9NA 1Q4LA 1XQZA 2HY81 4ZLYA 1QPCA 5CF5A 3QX4A 1CMKE 2C6KA 4YJQA 1KOAA 4WBBB 4ZTNA 2PK9A 3UJGA 4F7NA 5CSWA 2E9PA 3QKMA 2J51A 2GDOA 3JY9A 4G1WA 4UYAA 3V6RA 3A8XA 3PY3A 4NH1A 3TNIA 2VWVA 3E8EA 5FBNC 4BY9E 2Y0AA 3G90X 4DFYA 4NM7A 3K3JA 3ZUUA 5EM5A 3WF5A 4C8BA 1IA8A 3BU5A 1WBVA 2XK8A 4FT9A 4ZEGA 3RAWA 4J99A 3RP9A 4XYFA 1V0OA 2FSLX 1Y91A 4WNKA 2OJJA 2ZV2A 3I60A 3BRBA 5L6WL 4TWCA 4ARKA 1T45A 3RVGA 5CTPA 5C4KA 4YZNA 4AAAA 2XIYA 2ZOQA 3E92A 5IEXA 4DFBA 2GHGA 4PP7A 5LWMA 1Q24A 1UU9A 3POZA 3UBDA 5IUHA 4I23A 2QOFA 2DYLA 2OZOA 4GK2A 4JDHA 5CF4A 3R22A 1TQIA 4CZTA 1UKIA 5M09A 4HVHA 1XBAA 4TNDA 3G5DA 5A4QA 4L3LA 5DGZA 5M06A 3WF6A 2XJ0A 3R1NA 5E1SA 3ORTA 3QKLA 3R9DA 3QALE 3LXPA 4C4HA 3WYXA 2V5QA 5E4HA 3QD0A 5GIPE 4UWCA 2SRCA 3QZFA 3QF9A 2X2MA 4J96A 5HEZA 3VNTA 3NUXA 4E1ZA 3N4VA 2VNWA 4EEVA 3AGLA 1ZYSA 2YWPA 2VTNA 3R8LA 3ZSHA 3A62A 1U5RA 5AR4A 4KNBA 2CN8A 4FG9A 3CD8A 3F82A 3TDVA 4TL0A 3PY0A 1URCA 3QX2A 2PVRA 4Q5EA 1MUOA 2P33A 5KHWA 3F3UA 3ZS5A 2XVDA 5I9ZA 3UE4A 3CP9A 1SMHA 4AW1A 3FZTA 2VTQA 5AM6A 3ZLYA 3W2RA 5IF1A 3RHXA 2GPHA 3QZGA 5JSMA 3EL8A 1OKWA 2YJRA 2WFYA 3AT3A 4QNAA 4N57A 3SG8A 3SC1A 2WQEA 5IQEA 2GNIA 3PIYA 1CDKA 4L67A 3VJOA 4FKWA 4O0VA 3I7CA 2FSMX 3ANRA 3DZOA 3P0MA 2CGWA 2WOUA 3KXMA 5M07A 3MY5A 5DWRA 3MW1A 4RIYB 4EKKA 5AIKA 1SVGA 4GVAA 4YZCA 3HKOA 3OW4A 4KKEA 4FV4A 3ODZX 4FT5A 3UVRA 4AW2A 5M4IA 2YIRA 2E9NA 2QO9A 2UUEA 4PL3A 1QPDA 2I0EA 2PE1A 2W99B 5CSVA 5HNGA 4ZTRA 4ANBA 4P5QA 2XA4A 4G9RA 5L4QA 1CKJA 2BAQA 2LAVA 4NFMA 4JLCA 2R9SA 4GEOA 5AUYA 2YM5A 1PXLA 3AMYA 4GCJA 4GUBA 3PXKA 4WG4A 4YC3A 5HCZA 3CGOA 5CAOA 4J1RA 4YJTA 3CIKA 5EDRA 2X8DA 3B8QA 5CS6A 1ZOGA 3GBZA 3CCNA 4MNEA 4U6RA 4XRJA 1V0PA 4LRJA 5M44A 1GZKA 3BX5A 4XOZA 4USDA 2P2IA 3V5LA 5AEPA 2C6TA 5EW8A 4G6OA 1OPJA 5L6OA 4C33A 5AP2A 4I0RA 3QKKA 1KE7A 2VWIA 2GHLA 3DBQA 1P5EA 3NPCA 5D11A 1NVRA 2YABA 2NRUA 3SVVA 2WTKC 3FXWA 3AT2A 3FZPA 3FEGA 4BCKA 4UMTA 5IQFA 5IA4A 4ZZNA 4TXCA 4YJRA 5AFVA 1BUHA 4F9BA 3U6JA 4NUSA 1DAWA 4DFUA 3MS9A 3FPMA 3BHHA 5FM2A 2E9VA 2OFUA 3KB7A 4FKSA 4K8AA 4YHTA 3V5WA 2R3RA 4E4MA 3DB8A 1F3MC 4I21A 4X6RA 3NAXA 4BCMA 3EYHA 2F2CB 3KKVA 4I5CA 3TNPC 1Q99A 2QCSA 1IAJA 2JKMA 3E88A 4BB4A 3BHYA 4MYGA 5DIAA 2B53A 4BBEA 3IECA 4H3QA 3U54A 2Z7SA 4I5HA 3GFWA 2OWBA 3VWAA 4M13A 3EQIA 2O8YA 3GCVA 1L8TA 3GCUA 3M11A 5CNOA
chains in the Genus database with same CATH superfamily
3FI2A 3TZ7A 4I24A 3DY7A 4IFGA 4M12A 1XO2B 3ZOSA 4BDIA 2CCIA 5AR5A 1U54B 4CXAA 5CALA 4ZOGA 4RZWA 1H0WA 4TYGA 3FKOA 1OB3A 5CU0A 3MB7A 5HE2A 4CMTA 4IMYA 2XALA 3KK9A 2QG5A 5F20A 4MD7E 4GU9A 1JKKA 1Y8YA 4FSNA 5ANEA 4WIHA 3UTOA 4IB1A 5F4NA 4BWXA 5HG5A 3CTJA 1P14A 5L2IA 4DLJA 2GQRA 2J0MB 3PIZA 4UBAA 4OGRA 1XMMA 2JD5A 5L2TA 4ANLA 3Q52A 2H9VA 3D9VA 5IA1A 3DKFA 3EN4A 5M56A 4FGBA 3U4WA 3PRFA 3QUEA 2WD1A 4U5JA 3VBYA 2Z8CA 1Q41A 2FGIA 3CQWA 4FSZA 1UWHA 3CQEA 3IPHA 3OUNB 2VTIA 4RT7A 5J7BA 1QL6A 4U42A 4BDEA 3ZO1A 2XNNA 1G8AA 4L42A 3KCFA 4OT5A 5JFSA 3CLYA 4MQ1A 2ITZA 3PA3A 2PE2A 3R7EA 5CEKA 5DT4A 4PDOA 4Y95A 4D2RA 4X2NA 3LIJA 2OK1A 4HVIA 3MH0A 4IB0A 5TO8A 3V3VA 4BVUA 2BDFA 2VTJA 4RA5A 3H9OA 1YOLA 2UVYA 3IS5A 4DHZA 2VTRA 5EYCA 4PPBA 3KRWA 3EKNA 4MAOA 4TYHB 3UC4A 5I4NA 3TUBA 3M1SA 1Q5KA 2XUUA 3LPBA 4J53A 4MXOA 4FE2A 3CS9A 2XJ2A 5HICA 1QPEA 1BYGA 4R3CA 2Q0BA 5F9EA 4JIAA 1FINA 5DG5A 2YLFA 3NNVA 2WTWA 3AD4A 4O7YA 2W9ZB 4TRLA 4XLVA 2Z7QA 3B8RA 2YEXA 3H9RA 4K1BA 4DFLA 4NTSA 2V62A 3O8PA 3IW4A 4IM0A 5FTOA 1ST0A 2VTSA 3BGZA 4PTGA 4ZMEA 1H24A 3MI9A 3R00A 4Y83A 3FMDA 1PMEA 4CTCA 2W1ZA 3OHTA 1W2DA 3T9TA 3R04A 2GSFA 1DS5A 4BICA 3W0MA 3W0RA 5LMAA 3OCTA 3ZDUA 3GC9A 3EMGA 4G3FA 4YTIA 4M84A 5A9UA 4J7BA 3RK5A 3OBGA 5BPYA 2CGXA 5E8XA 3TWJA 4Q9SA 4KUJA 3DPKA 4KIQA 1W82A 2A0CX 1TZDA 2VO0A 3WYYA 2BZHB 4RVMA 2Y4PA 1KE5A 4WNPA 3UDSA 2BPMA 4IAZA 5HKMA 1FVTA 3BL9A 3ODYX 3VS2A 5CYIA 1M52A 4O7RA 4HOKA 2IW8A 4E5AX 2IEWA 2BIKB 5IQCA 4XUFA 2AC3A 2JIUA 3ROCA 4PV0A 2JKOA 4DLIA 5HTBA 3NUAA 4NZWB 3RHKA 2CKQA 5CENA 3Q3BA 4E4NA 4L8MA 4O4CA 3SGCA 1PXIA 2YAKA 4DBNA 4HYUA 4DG2E 3NYNA 5ANKA 5E8TA 4RWJA 5DRDA 5GINE 4O0RA 4G5PA 4BWPA 5ETIA 5HNIX 4IZYA 2WTIA 2VTAA 1UNHA 3FDNA 5DI1A 3U4UA 5TF9A 2XK3A 3SG9A 2OG8A 5FEDA 2WMWA 3Q4CA 3ORNA 3KA0A 3EQBA 5HD7A 2Y6OA 4JL9A 4O7VA 3I81A 4B4LA 3NVKI 3ET7A 5AX3A 1YDRE 2X4ZA 4U3ZA 3E87A 3V5PA 4ANOA 3OXIA 2C4GA 5M4CA 3VBQA 5A54A 3D2IA 1WVWA 4CYJA 3NEWA 3HV5A 4QYHA 2W9FB 4BIDA 3CTHA 3I6WA 3V5QA 4TTHB 3ZLXA 4UXLA 3V8TA 3NW7A 2WTJA 5C9CA 2Q0NA 4KAOA 4APPA 2I0YA 2W17A 4FSMA 3SDJA 3EOCA 5FDPA 4LM5A 3VRZA 2B1PA 1QCFA 3NNXA 3TZ9A 5AA8A 2G9XA 5CF6A 3KVXA 4A4OA 2XKFA 2Y6MA 4OAUC 2Z2WA 4ERWA 2ERZE 2X2LA 4OR5A 3OD6X 4F7JA 5KE0A 3IK3A 4JDKA 2ZMDA 4IQ6A 3QTRA 2GMXA 3DAKA 3VHEA 4V0GB 3OWLA 4UALA 4UX9A 3DS6A 3NSZA 4AFJA 1IG1A 3Q2JA 4HCTA 2QOCA 3R7VA 5GZAA 4OBPA 3UPZA 3NR9A 3NX8A 4ANQA 3RCDA 5J9ZA 4FRFA 4YZMA 3W32A 5BVEA 2FYSA 1ZMUA 2XYNA 5TT7A 2ZVAA 3GCPA 2JIIA 4BCHA 2X2KA 5KNJA 2HZ0A 3QA0A 4BHZA 2ZV7A 2G2HA 4UZDA 2CGUA 5IMEA 4DHJA 3RZFA 3UVQA 4E4LA 4GT3A 5CT0A 4QOXA 3K2LA 3KCKA 4XHKB 4FTRA 3LHJA 2PVHA 3Q53A 4FTNA 2XNOA 3HV7A 3DV3A 3QTZA 4CFXA 3HLLA 2VWYA 4HGLA 3NYVA 3UOHA 3QYWA 4IZAA 3OF0A 3AOXA 2JDRA 3NLBA 3QCQA 3QTSA 4ERKA 3COKA 2PTKA 5KMLA 5CWZA 2QOKA 3R1YA 4IX6A 4QD6A 2REIA 3AKLA 1E9HA 1H1PA 4L3PA 2F9GA 4U97A 5BMSA 2O0UA 4R3RA 3IONA 4EH3A 5CEPA 5F94A 4S33A 4FZ6A 2XRUA 3T3UA 3FL5A 1XH7A 3OXZA 3TNHA 4AQCA 2UVZA 3NIZA 5AAEA 2WMUA 4IAIA 4IWPA 3LFDA 1S9JA 2HW7A 4FOCA 2PWLA 3VQHA 3FXZA 4QMMA 1SNXA 3FC1X 1SVEA 4O86A 2PVYA 5LMKA 4P7EA 4NK9A 4TT7A 2YIWA 3A7JA 4OAVB 2W5HA 2VUWA 4RPVA 3QHWA 5KBRA 4XBUA 3L8VA 3R8MA 1JKSA 1H01A 4MWIA 2DWBA 3UIUA 2ITVA 4NW6A 4EJNA 3VONA 1H0VA 3VS1A 3RK7A 4ORKA 3JXWA 5ANGA 4V05A 3MYGA 3QBNA 1Q3WA 4YU2A 3QTIA 4OTFA 5HG7A 5FWKK 2XNPA 3R63A 5BMMA 2IW9A 4E8AA 3DKCA 4O4DA 3BEGA 2XH5A 1NT2A 3VC4A 1H07A 2VD5A 2ZJWA 3K3IA 3E8CA 3ENMA 5BYLA 1BL6A 2WHBA 4NSTA 4A4XA 4C38A 3C4WA 3EN7A 2JFLA 2PMIA 1PMNA 1OMWA 2F4JA 1V1KA 2GNJA 1FPUA 1ZOHA 2QNJA 3G2FA 3KGAA 4LI5A 5M4UA 4QTAA 3TACA 3DKOA 4RIWB 5KO1A 4GG5A 4KRCA 4MBLA 3ENHA 2PMOX 4XLIA 4EOQA 5HQ0A 3QQFA 2ZMCA 5KMNA 1J1CA 1U59A 4R3PA 5IUGA 4CRLA 4EYMA 3LXLA 2YIYA 3DDPA 2WMTA 3CGFA 2WU6A 3I7BA 4F4PA 4O7WA 4PDYA 4RVKA 4AZWA 4EH7A 4B8MA 5JFXA 3FI3A 3H10A 4PDSA 3II5A 1VLRA 4R5YA 3ZCLA 4DA5A 4EOOA 5D9HA 3TYKA 2CSNA 3PSCA 3TL8A 4J97A 4FNXA 3FE3A 2BAJA 3LQ5A 3SXRA 5HIDA 4FTTA 3QRUA 1IR3A 4R1VA 4BR3A 4HZRA 5EYMA 4PUZA 3SV0A 2YLEA 4IDVA 4ZJJA 2A98A 3BLRA 3MVLA 3I5ZA 2IZRA 4QMZA 3UYSA 4ACMA 5JGDA 1M7QA 2RKUA 3FUPA 4FIEA 1XMLA 3FI8A 3W0OA 3MY0A 5H8EA 4PQNA 1REJA 3ULIA 2FUMA 5K5XA 3NFFB 2WKMA 5J5SA 1WBTA 4LRKA 1OIYA 2WTVA 2XIXA 5M08A 4ZS0A 3HMPA 4A07A 2OJ9A 2YM6A 4RBLA 1BI8A 1PXOA 2QLUA 3ZLWA 4PPCA 3PG1A 3CY3A 1W0XC 1DI9A 1TVOA 4FG7A 3F5UA 4R6VA 4WNOA 4I6FA 4QMSA 5G6VA 5CXHA 2JDTA 1I09A 1Y8GA 3HNGA 4TWPA 4GKIA 3KMMA 3ZO4A 3R8UA 4ZY5A 3PZEA 3QFVA 3BQCA 4X2FA 4FTCA 5J1VA 4IB3A 2BILB 3R02A 5KMJA 3QHRA 3R6XA 3IOPA 4ONAA 3AD5A 3AC5A 3TXOA 5K4IA 4E93A 4YSMA 3HMOA 5A4TA 2XANA 3O51A 3B2TA 4C3FA 4BKYA 3D4QA 2B7AA 2C3KA 3GVUA 4HNIA 4IX4A 4XEYA 4RMZA 2WGJA 1W83A 3FLQA 1OECA 1X8BA 3F2NA 3FPQA 2F49A 4C0TA 3NYXA 1WBSA 1ZZ2A 5TE0A 4FKRA 3TZMA 3QLFA 3GB2A 4CKIA 5GNKA 2OF4A 5DVRA 4BHNA 4M68A 1PXMA 3FLNC 3BWFA 4NWMA 3GCQA 5BVOA 4QPSA 4M3QA 5FEEA 3EKKA 3LKMA 1UWJA 3VUKA 3IDCA 3L8SA 4FTJA 2C6DA 4CFUA 4I1ZA 4FSWA 4UXQA 2OIDA 4H58A 3HRBA 3QAME 2UVXA 4LL5A 3OVVA 4FKQA 4L46A 3F5PA 3N9XA 4DTBA 1FBNA 5AP1A 1UV5A 4H3BA 2I1MA 3VJNA 3C4XA 5HTIA 2CNQA 4ZMFA 2Y8OA 2QONA 2RL5A 3EQHA 4UMPA 4O4FA 3FV8A 4MVFA 4M67A 4WG3A 4RIXA 4W8DA 4FZAB 3KVWA 4WOVA 2HELA 4EOSA 2HENA 2XM9A 4K9YA 4EHGA 2IVSA 1UKHA 3F5XA 3HMNA 3HP2A 4IFCA 4II5A 5CQUA 4E5WA 4AZVA 2GFCA 4IJPA 3HP5A 5H2UA 4D9TA 4PNKA 4AZFA 4M15A 3CQUA 2RF9A 3RINA 3SXFA 3C0IA 3ATSA 3P5KA 3CTQA 1ZRZA 3GC7A 3PXRA 2GTMA 2C3LA 3CJFA 4GVJA 3ORXA 5DRBA 3KIOC 2ONLA 4LUEA 3ZO2A 4XV3A 1OKVA 3FZRA 4RJ5A 2C5VA 2O5KA 3HYHA 4ZTHA 2PULA 3FYJX 2IJMA 4N6YA 5L8LA 2QVSE 4IACA 3FHIA 4OUCA 4V04A 4ZTSA 4ITIA 2BRNA 1Y6AA 3K54A 5I0BA 5CAPA 1GJOA 5AP7A 4QMYA 4R8QA 3KRRA 1NXKA 3MH3A 4HW7A 2J90A 2Y7JA 3GNIB 3HV3A 2UZDA 4E26A 3KY2A 4EH2A 2UZVA 4M8TA 5DE2A 2UW6A 5K0KA 4XV2A 3SKCA 4EKLA 4WO5A 2QHMA 2R2PA 5HVKA 3DFAA 4OTDA 3A7GA 4AU8A 3KRJA 3UPXA 3OCBA 2GCDA 4LQMA 2EXMA 4GT5A 4CKJA 2BHHA 3ALNA 1JKLA 1UU8A 3OTUA 2JDOA 3CKWA 1OBDA 4JBQA 1JWHA 2X81A 2VV9A 3PTGA 4YJVA 3F6XA 5DLSA 3WBLA 5JGAA 5JKGA 1Q97A 3MPMA 3ZRLA 4ENXA 2XCHA 3CJGA 3LM0A 4AW5A 1YWVA 2OIBA 4A7CA 5IU2A 3DB6A 4EWQA 5DT0A 4QP1A 2WQNA 2FO0A 4PPAA 5J5TA 3KL8A 4FKUA 3TMOA 3F2AA 1MRYA 1MRVA 3GUBA 4ZLOA 5AUUA 3L9PA 5LARA 4O21A 3EFWA 3VRYA 4O7SA 2ZM4A 4BYJA 2PU8A 4FBXA 5FTQA 5D10A 5FXQA 3ATTA 3FC2A 1OM1A 4NT4A 4ZP5A 3OEZA 3IW5A 4FSUA 2R7IA 1JSTA 3MSSA 2YM7A 4A9TA 3A7FA 3FHRA 3PXYA 4UWYA 3H9FA 4GT4A 4FJVA 4FI1A 4FVRA 3HUCA 5EHLA 3DTCA 3KMUA 4FTLA 4NJ3A 3VULA 2X7OA 2UZEA 3P7BA 4EK4A 4PL4A 4E5BA 4KIOA 2QOLA 1LPUA 4FYOA 3VN9A 4BDJA 3UQFA 2RFSA 1JSVA 4FV6A 4N4SA 3U55A 2XEYA 4O1OA 1IAHA 3UP2A 2QC6A 3FQHA 1H08A 3QD2B 4D0WA 4FUXA 4IWQA 4O1PA 4RLLA 3TUCA 3ZO3A 5HG9A 3A60A 2BDJA 4BCPA 2OJFE 4FNWA 3Q5ZA 3KXXA 3P4KA 3NNUA 3BBTB 5K9IA 2R3IA 3ACKA 3E93A 2BCJA 3C51A 4LOQA 4O0SA 5A6NA 5JQ5A 4CNHA 2WMVA 1LEZA 4WRGA 3NZ0A 1SM2A 1FVRA 3PJCA 3OP5A 4M14A 1Q8TA 4U40A 4Q2AA 3A4OX 1MQ4A 5EOLA 2FH9A 2JFMA 4C2VA 4BRXA 4RVTA 1PY5A 4P2KA 4FICA 2W4OA 5EM8A 2VWXA 1H28A 3KREA 3A8WA 5DPVA 1JQHA 3RNYA 2WMBA 3PVGA 2QOOA 3GU7A 1XH4A 3ZM4A 5CU6A 4ZSAA 3GEQA 2XIKA 3PXFA 5HBEA 2CPKE 2ERKA 4L53A 2X8EA 3KU2A 5A4EA 2XRWA 3BE2A 3VQUA 2OXYA 4EK5A 1YDSE 3BU6A 1OZ1A 4D4RA 3D5VA 1YWNA 4RX9A 2IG7A 2F2UA 4MNFA 5AV4A 3AKJA 1XJDA 2BZIB 4NU1A 3UG1A 2CDZA 2W05A 3OWPA 4PF4A 3QD3A 5CLPA 2IO6A 3UO6A 4XS2A 3N4UA 4DGGA 2GS7A 3E3PA 1H27A 4U43A 3SW7A 2B9IA 2YZAA 4W4XA 4B99A 2RGPA 1Q62A 2C3JA 3BKBA 4MBIA 2I0VA 4KSQA 1WBPA 1APME 3F88A 2ZB1A 3HVCA 4FSYA 5AP4A 3TV7A 4QDVA 4GK3A 4LRMA 4RWKA 1CM8A 4LG4A 4ZSEA 5I9VA 4UEUA 2PZPA 2J0IA 5IDPA 1WBOA 4J71A 3AMAA 4IM2A 3R9HA 2X0PA 3RZBA 2OZAB 1TKIA 3HA6A 1YXTA 2QOHA 3BPRA 4L7FA 4C58A 3Q96A 5AR8A 3TEIA 1PXKA 1S9IA 5KBQA 5LVMA 5EQYA 2FVDA 3LFBA 3UO4A 5EQEA 1HOWA 4FTMA 2C6OA 1FGIA 3D15A 3ZMMA 3IDPA 2V7AA 4ALUA 3SXSA 5LMKC 4L43A 3BYMA 3DU8A 4RX8A 4AGWA 4BBMA 4J98A 3ROYA 1LP4A 5LVLA 4FT3A 4TZRA 4HCVA 2H34A 3TG1A 1Q8ZA 4ALVA 4XNEA 3K5UA 3Q9WA 3MJ1A 3QA8A 5J87A 3TZ8A 4AA4A 4JOAA 1K2PA 2OGVA 3OY3A 2YCFA 3LFFA 4FKOA 3DFCB 4BIBA 2ZV9A 1SYKA 4JR7A 2OI4X 3AD6A 4UYNA 2AYPA 4FL1A 3WIKA 4BDHA 1R3CA 3FLWA 2QURA 3EQCA 4D1SA 3H0YA 5ANOA 3UGCA 4UB7A 5HNBA 3LZBA 5AAFA 4PDPA 2DQ7X 3EN5A 3R8VA 5J1WA 3WF9A 2XEZA 4RC4A 4QMVA 3RAHA 4GFMA 4GIHA 3UDTA 1U4DA 1M17A 3P9JA 3OG7A 4MD9E 2VO7A 4RIYA 3U51A 3TKUA 5EM7A 4AXAA 4F9WA 5HLPA 3T3VA 3UZPA 2QI8A 4HNFA 3G9NA 4YHJA 4FIGA 2GTNA 3HV4A 2DUVA 4P5ZA 4QDEA 4U7ZA 3ORKA 3KK8A 2IW6A 2X1NA 3RPSA 4ZSGA 3FZOA 3QTXA 5EW3A 1YWRA 4EOJA 1PRYA 3MIYA 4FVQA 4AOJA 4J8MA 3NNWA 4ZY6A 4FK3A 3WZKA 4M97A 1H1WA 3I0OA 5M53A 4HPUE 5CSPA 3F3TA 4F09A 4M69B 4YUQA 5BYZA 4O22A 4FTAA 4RJ7A 3MVJA 3S1HA 1JNKA 5I3OA 2XNEA 3PA4A 4NJDA 2X7FA 5HLWA 3EHAA 4RLKA 1YVJA 2YDKA 3DAEA 4Z55A 4GS6A 3O5AA 3BL7A 2I6LA 3ZHPC 3SX9A 4I4EA 3IW8A 5J9YA 5J9LA 4R5SA 3QD4A 1U5QA 4OTIA 3UYTA 3DK3A 4YTHA 1E1XA 2HYYA 4BDCA 3UQCA 3VS0A 5HLNA 4BI1A 4Y73A 2I40A 4YBJA 2VWUA 5E8UA 1ZYLA 5TOZA 1O6LA 4K33A 3QRKA 5EK7A 1FGKA 3NUYA 4NFNA 3LFNA 3NAYA 4EZ5A 3GU8A 3VF9A 2A4LA 3Q9XA 1XR1A 3UO5A 2XK4A 2AQXA 2EXCX 3R9OA 2PYWA 2NPQA 4Z7GA 1GY3A 2HWOA 1G8JA 5AP0A 3HUBA 4CZYB 4QTEA 5IKWA 4D55A 5HU9A 3DQXA 3DZQA 4E6DA 5D41A 4E6QA 5FG8A 3TN8A 2HCKA 3R7YA 1SVHA 2J5FA 5BUIA 1M2RA 3PP1A 3HMIA 4FZFB 3UP7A 2RFNA 4FTIA 3C0GA 5AA9A 5C26A 3ZRKA 2YDJA 4RX7A 2C0OA 3RWPA 3ZYAA 1Y57A 4UMRA 3GQLA 2QOQA 3ID6C 4C37A 4R7HA 2H8HA 4Q9ZA 2Y4IC 4IBMA 4YBKA 4IZ7A 4DGMA 4A9YA 1ZXEA 2UZLA 3UQGA 3MY1A 4MUQA 4JX3A 4QYFA 1U54A 2PUIA 4FG8A 3C0HA 5EW9A 2WIHA 2O63A 2C5XA 3Q60A 3RPVA 2O3PA 3Q5IA 4MKCA 3OROA 2V0DA 4FOBA 5HCYA 4DDGA 4MEDA 4BZDA 4NW5A 3U6HA 4BWKA 4X2GA 3W0SA 2O65A 5KZ0A 2J4ZA 4BCQA 3H30A 1JKTA 5EI8A 5BVWA 5BUJA 4AQKA 3AGMA 3R7OA 3W2QA 3TCPA 4MWHA 3ZEWA 2UZUE 4I5PA 1IA9A 3CY2A 3QQKA 3LJ2A 5I9XA 2ACXA 2W96B 4YMJA 4ZZMA 3FMEA 4I41A 3EFKA 4EOIA 4AXEA 4F08A 4KS8A 3SRVB 4QP2A 4DEHA 4IM3A 4XG4A 4QEBA 1PMUA 3W10A 1LR4A 2F7ZE 3TNQB 3DT1A 3Q4UA 3LQ8A 5A3XA 3D7TB 5IQDA 3E8DA 3PLAE 5DR6A 1XH5A 2VWWA 5HD4A 4H39A 4IAKA 3C5IA 3BHTA 5DEYA 4EZ3A 3I6UA 3JS2A 5FUTA 3ZC6A 4EOKA 2Z7RA 5CEQA 2XNBA 1M14A 1OL7A 4TYHA 2BRBA 4NKSA 3RNIA 4QMUA 2ONLC 4IC8A 5KKRB 4U44A 1R1WA 2OBJA 2QHNA 3C4CA 4YPDA 4USEA 4O0TA 3EQFA 3IO7A 3U9CA 2HXLA 4FV7A 3F2RA 3LFSA 4L3JA 4E7WA 4FV2A 4LOOA 4F9YA 2OLCA 1DAYA 4FIHA 4AN3A 1BL7A 4FTKA 4UV0A 1PXNA 3QU0A 5IA0A 3PWYA 2BFXA 3RJCA 1DM2A 4D1ZA 3MWUA 1YXUA 3BYVA 4QMTA 3WZEA 1L3RE 4L68A 4U80A 1KE9A 5CSXA 4O81A 2Y9QA 3RM6A 3GOPA 3BQRA 5L8KA 1AD5A 3DXNA 4MXCA 4AACA 3ORMA 4AP7A 2WEVA 3CR0A 4DCEA 1KE8A 4AS0A 1ZAOA 3BCEA 4X3FB 5ANDA 1H1RA 2JLDA 2PVFA 3C1XA 3QQJA 1UNLA 4OBOA 4Y5QA 5H8BA 5IEVA 5HU3A 1PW2A 4F6UA 4FIIA 5GJDA 1KV2A 2EVAA 2YIXA 5HVYA 5IQIA 2IWIA 4JG8A 3UOKA 2CNVA 4AGDA 2W06A 4MF1A 2PVKA 3R0TA 2ITUA 3LJ1A 1SZMA 3HX4A 4JJRA 4BGGA 5L6PA 3QGYA 4PY1A 2VTLA 5B2MA 2GQGA 4O83A 2UZWE 3V5JA 3LM5A 4RJ3A 4IZ5A 2R3GA 4DN5A 4EI4A 4FEQA 4RZVA 5DNRA 5TR6A 3KF7A 2CCHA 4DITA 4CVAA 2XIRA 4TNBA 1MRUA 5AV2A 4DGOA 1R0PA 3LXKA 4RGJA 1ZARA 3BLHA 4RQKA 4YSJA 3WF8A 1Z9XA 3NIEA 2JAMA 3EZRA 4KIKB 4EYJA 2ZM3A 2WQOA 3PWDA 3DXPA 2RFDA 4YZDA 4D2PA 4AOTA 4O7ZA 2OFVA 4GRBA 3O7LB 4AN9A 4F0FA 3Q4TA 2C5NA 1W8CA 3TV6A 3FMHA 4L45A 3JY0A 3LW0A 2VN9A 4W4WA 3LFEA 3WILA 4E20A 2J6MA 2WXVA 4JNWA 4AZTA 2C6MA 2YJSA 3WI6A 3NDMA 3FKNA 4HVDA 3GCSA 3LFAA 4FTQA 4QP7A 3PPKA 3S0OA 3OS3A 1OUKA 4DINA 3KXZA 3PVBA 4ZTQA 5EI6A 1FVVA 3UOJA 2XKCA 2G2FA 2E2BA 4M7IA 2HZIA 4ACDA 2E9UA 4MHAA 5M55A 3ANQA 5AP6A 1K9AA 4CG9A 1M2PA 3W2CA 2BRMA 1XWSA 3R83A 4KA3A 2OXXA 3AC3A 2NO3A 4FMQA 4Y5HA 1J7LA 1JSUA 4CTBA 2PUNA 2X6DA 1YRPA 4IANA 1LUFA 2LGCA 3CD3A 5B2KA 4CQGA 4RSSA 2WQBA 5B0XA 3RPYA 4O2PA 4O27B 2JC6A 1M7NA 3POOA 2XYUA 4ANSA 4V0GA 3HV6A 3OT3A 4NIFB 4UN0C 1REKA 4G17A 1XH8A 5H3QA 4FL3A 4Z9LA 2AC5A 3LVPA 4GK4A 4HZSA 3VAPA 5JH6A 2BTSA 1T46A 3PSDA 5C1QB 3C4FA 3F7WA 5E8VA 4YJPA 3UIMA 4KIPA 4GU6A 2OF2A 4L9IA 4APCA 2BZJA 2UW3A 2CN5A 3O23A 5F95A 5K4JA 3ZC5A 4FT0A 5LQFA 3CKXA 5K3YA 3KMWA 4HCUA 4XV1A 2IN6A 1WBNA 3I4BA 4IAFA 2UZBA 4JRVA 3PE2A 2XKEA 4DCAA 5ANJA 3WZUA 3NUNA 5HIEA 3VUHA 4KB8A 4BZOA 3DBDA 5AUXA 2B55A 3E62A 3RALA 4BGQA 1JAMA 2X9EA 3KULB 2BTRA 3BELA 3MFRA 3OTVA 1J1BA 4YHFA 4ZK5A 5TKDA 3BV3A 3Q4ZA 4QYEA 4PL5A 5HHWA 4N70A 3QYZA 5GJGA 3WF7A 4F6WA 5IQHA 4XRLA 5DYJA 1BKXA 5IDNA 2OKRA 1U46A 2V22A 4IH8A 3FY2A 3LXNA 4I6HA 4NEUA 4Z7HA 3R8PA 3O8UA 4MX9A 4XX9A 3A7HA 3I79A 3T9IA 2C0TA 4H1MA 5GHVA 4BCOA 5JZJA 2C1AA 4K77A 4FC0A 4KBKA 2ITYA 4S30A 4FSTA 2IVUA 2RG5A 4LV5A 3OOGA 4FKIA 1R0EA 4DEBA 2WMQA 4AXCA 2C1BA 3BWJA 4XG9A 3ZBXA 2XK7A 3MFSA 1ZMWA 3R71A 3QRJA 4KBCA 3M2WA 2HZ4A 2UW4A 2BR1A 1WAKA 2YDIA 2X7GA 2VAGA 3D2KA 4M66A 2ZV8A 2OO8X 4PTCA 4BDKA 1FMOE 3F5GA 4JS8A 4DEAA 4FKPA 4EC8A 4XG7A 3VS7A 2BIYA 3AC8A 3MTLA 3O71A 3A99A 4HYSA 4OTPA 4WA9A 1KOBA 3TT0A 4DT9A 3FMLA 4LGGA 3R7IA 4AFEA 3PUFC 4AXDA 1A9UA 3DQWA 4TYJA 2OJIA 4N0SA 3LQ3A 4XCUA 4FEWA 3TIZA 3TJDA 2AEGA 3UNKA 3QLGA 5FBOA 5HG8A 5JN2A 2VTOA 3SQQA 2VTMA 2W4JA 2X39A 3W0NA 4RIWA 3Q9YA 4OLIA 4PMPA 2RSVA 3WIGA 4FZDB 5JFWA 4BKJA 4XG6A 5AAGA 1QMZA 4WKQA 3R1QA 4ZJVA 4WNMA 4ZLZA 4FKLA 2YN8A 3FLSA 2H6DA 4KWPA 4EQCA 5CEOA 3FZSA 2JKQA 3Q9ZA 2I7QA 3BE9A 5LWNA 4CCUA 4J8NA 2YHVA 3DAJA 3EYGA 2QU6A 4W9XA 5B2LA 2QLQA 4YZ9A 4YNEA 3LMIA 4W8EA 2HW6A 4CT2A 1VJYA 4IX3A 1Y6BA 4EUTA 2C6LA 4DF3A 2WO6A 1CTPE 4H1JA 1W2FA 4DHIB 3MGYA 3V6SA 4DTKA 1YOMA 3DLSA 2WMXA 4IADA 3BGPA 3E5AA 2W1EA 1A06A 4RFMA 5IH4A 2XM8A 2HAKA 3OT8A 3R8ZA 5L2SA 4KD1A 2W1DA 4XMOA 3C13A 4DEIA 5HTCA 1CSNA 3R9NA 2J9MA 3QC4A 1PXPA 5CI7A 4EORA 1JPAA 1KV1A 3VO3A 5BUEA 4O96A 2WEIA 4JT3A 3D7ZA 3D5UA 3MH2A 4W4VA 4ZZOA 1NW1A 4W4YA 4O0WA 4OTRA 2HWPA 2EB2A 2PVNA 1H1SA 5T68A 2ZM1A 4XP2A 3SOCA 5DA3A 5ITAA 4FV8A 1K3AA 4U0IA 4J95A 3WZDA 3MA3A 3U87A 3LJ0A 4AUAA 2BFYA 5FEQA 2UZTA 5HE3A 3F3VA 3R73A 4O6LA 5JK3A 2C47A 4D5HA 5M51A 3PJ8A 3W2SA 1PJKA