4D2RA

Human igf in complex with a dyrk1b inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
300
Chain Sequence
DVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
publication title Discovery and Optimization of a Novel Series of Dyrk1B Kinase Inhibitors to Explore a Mek Resistance Hypothesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 300
sequence length 302
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d2rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d2rA01
4TYGA 4HNFA 5CU3A 1ZYCA 3KL8A 1Q4LA 3R8ZA 2HZIA 3CD8A 4K33A 4DEGA 4Q9ZA 4D2SA 5HNIX 3KMWA 3IKAA 1XBCA 5J5SA 4JJRA 4RX9A 1JKSA 2XH5A 3Q2MA 4ZMFA 3UMWA 3VF8A 2C6OA 4BCFA 2HXQA 3BLRA 4U79A 4LV5A 4X6RA 2ZMCA 4KBAA 3IGOA 3GU7A 2OI4X 5AWMA 4DG2E 4YZCA 3DAEA 3BE9A 3ZZWA 3R9RA 3DOGA 2A0CX 2XNPA 1ZXEA 4ZEGA 4BGQA 1YXSA 5E8WA 3PVUA 1KWPA 2ACXA 4UBAA 4BC6A 2P0CA 2J0MB 5AM6A 4ZTLA 3ZRMA 4ZLYA 3LPBA 4J1RA 1FINA 3V5TA 1BLXA 2IZUA 3GENA 4EI4A 4EOPA 4L3JA 5K4IA 2C1AA 1Q8YA 4AAAA 3IDBA 3DT1A 3DJ6A 4L44A 4E5BA 4WUNA 2XK6A 3FI8A 3LFEA 4KIQA 5HIBA 5LMAA 3QCSA 3S95A 4GCJA 4HW7A 5DBXA 2H6DA 2PVNA 2VO3A 3E8DA 3LJ2A 3PPJA 4WNKA 1MRYA 4IX5A 4FOBA 5CNNA 3R9NA 3U8WA 3WYXA 4YO4A 1H24A 3NIEA 3PG1A 2WOTA 4AE9A 3VJOA 4FSYA 3RPVA 2V0DA 3PSCA 4FYNA 1JVPP 2ZB1A 2UW4A 1GIHA 5AR8A 2CSNA 4OTQA 4KIOA 3W32A 2A27A 2RKUA 4RA4A 5HX6A 3FMHA 4AWIA 3RK5A 4B8LA 5AADA 5ANDA 4BVUA 4J52A 4MX9A 4C35A 3NW7A 3NWWA 4UWCA 2I0HA 5AR4A 2RGPA 2B7AA 3FMLA 5JZNA 4DGOA 3K54A 4O0TA 1PRYA 5JFVA 4H58A 2BDWA 3G0FA 3H10A 3DCVA 3DNEA 4J98A 3PXKA 1OBGA 4UN0C 3A61A 4B99A 2R3MA 3MY0A 3U6IA 5AP7A 4V0GA 4TXCA 4JIAA 3VUMA 3M11A 3HUCA 1Z5MA 1H4LA 2VTRA 3KA0A 3HV3A 3QA8A 4GIIA 5KHXA 2YERA 3HDNA 4ANOA 4QMQA 5IZFA 4LQMA 4FKWA 2WO6A 3BYMA 3L9MA 4MKCA 2YLEA 5HO7A 3NYOA 3OP5A 2PWLA 4KWPA 2X8EA 2YITA 3P9JA 2XNMA 5JFXA 2HWOA 4GYGA 4DITA 3A8WA 3ODZX 3UGCA 5IUGA 2R3IA 4GIHA 3NR9A 4EOLA 1NVSA 5JGBA 4WSYA 4BYJA 4FV4A 2I0VA 4RG0A 4L01A 4XBUA 4YZ9A 2C3JA 2VNYA 2UZUE 4YZDA 5EM8A 4HVHA 4OAVB 4DFBA 1APME 2BZHB 4C33A 4M97A 3GP0A 3FXWA 4XUFA 5F4NA 4HVDA 4L53A 3LM0A 1ZY5A 3A8XA 3LCSA 4MD9E 4S32A 4G6OA 3NEWA 2QOCA 3FLNC 3OTUA 5HLPA 1OM1A 3DBDA 1LEWA 2XK4A 1PF8A 2CLXA 3KULB 2VUWA 2YM5A 4FT9A 4FV0A 4IVCA 5HE3A 5IA3A 4IZAA 4W4XA 3AGLA 4XRLA 4BWXA 5CEKA 4BY9E 3COKA 3GUBA 5DFPA 5EDQA 3B8QA 4EK8A 1H1PA 5AV0A 5G1XA 2QOOA 3KXGA 3LFQA 1CKIA 4ZSGA 3BX5A 3LLTA 3PWYA 3D7ZA 3NW6A 3K3IA 2Z8CA 4ACCA 4AS0A 1ZY4A 5TT7A 3TUCA 4LUDA 2BZJA 4EOMA 2J0JA 2HELA 2XIRA 4KKEA 3SOAA 3MS9A 1PY5A 5EM5A 3KRJA 3ODYX 3IW5A 3A4OX 4FZ6A 5IQIA 5FWKK 4YJVA 1PKGA 4IC8A 1YDRE 4XV9A 3UNKA 1ZMWA 5L3AA 2VAGA 3E87A 5ANJA 1SNUA 2G15A 5IPJA 4WSQA 5EOLA 5FTOA 2Y0AA 2IVVA 1OGUA 4NIFA 4LGGA 4FG7A 2BTSA 4W9XA 5AX3A 4K18A 3EQGA 1ZOGA 4XLIA 1WBNA 3FKOA 4RRVA 4R3RA 3RTPA 4ANBA 1BYGA 2B9IA 3HUBA 3EN9A 4G3DA 5DRBA 4FTCA 2WMVA 3BPRA 1FMOE 3D9VA 3HRBA 4EJNA 4X2NA 4FV8A 2HZ4A 4QYYA 4Y73A 2UW6A 2W1HA 2YZAA 2W5HA 2W9ZB 2WOUA 3LIJA 4BCIA 3GB2A 3ZH8A 2W5BA 4NFMA 3SOCA 4GJ3A 3RKBA 2I0EA 3O17A 4DEDA 4RIOA 3MIYA 5KMJA 3DAJA 1V0OA 3RM6A 4IMYA 2QC6A 3ET7A 4I93A 4BCGA 3ZFYA 4ALUA 3ATTA 3LCTA 4XG9A 3TCPA 5M08A 3FC1X 5FG8A 3KRWA 3V6SA 3RAHA 2ITOA 1IRKA 2XJ0A 3WIKA 4DGGA 4IVBA 3EN5A 4M12A 3VUHA 3K3JA 4XV3A 5ANEA 4I6QA 4XS2A 3EZRA 2HZNA 5CZIA 4EBWA 2PE0A 3L9PA 5E92A 3DKCA 4TY1A 1W0XC 3CTJA 2IW6A 4I41A 4QYHA 3HEGA 4YTFA 1WBSA 3PFQA 4FMQA 4H05A 1TVOA 2BKZA 3SC1A 3C9WA 3R00A 2CCHA 4QTBA 3FE3A 3HGKA 4I23A 5IISA 3S0OA 4WG5A 1MQ4A 1CKPA 4L68A 4V01A 4RVTA 4BZNA 3HP5A 4MTAA 2WMWA 3UYSA 3VS1A 4FIJA 3PJ1A 5J7BA 4GJ2A 1ZZ2A 1JKLA 5B0XA 3RAKA 1QL6A 2WB8A 4MBJA 3D5XA 1OIUA 3UC3A 5M53A 5I9WA 4KBCA 2BAKA 2RFSA 4YZBA 3MWUA 5AX9A 4CV8A 4AA0A 2R3RA 2X7FA 3FLWA 1VJYA 1REJA 5HORA 4TRLA 4R5SA 5F1ZA 2XK7A 2CN5A 3BIZA 4M67A 4FKLA 4HZSA 2WQMA 4YNOA 4FTRA 5AEPA 1PMNA 2X2KA 2V7OA 4FF8A 5AR5A 2HZ0A 4J71A 1H07A 2WEVA 3MPMA 3TV7A 4F0GA 3H0ZA 5IUIA 2H8HA 2QVSE 4ALWA 1FMKA 2G2IA 3MH0A 3MGYA 2PE2A 3FJQE 4JQ7A 4RFZA 4GK3A 4IAZA 3SGCA 2ITZA 4IFGA 3L9LA 5G6VA 3C4ZA 1H27A 1OL5A 4CRLA 3ACKA 4Y5QA 4BDIA 4EZ7A 2O8YA 3TDVA 4RIXB 3AOXA 3UVQA 2RSVA 3EQPA 1HOWA 1Y6BA 3Q9XA 1YWRA 5GIOE 3IO7A 4GFGA 3FY2A 2V62A 3I6UA 4JLCA 4FODA 4F1TA 5IDNA 3D14A 2XIYA 4N70A 2X39A 5FBOA 4V05A 5AUZA 5B2MA 3MFSA 5L2WA 4J99A 1KE5A 4EH8A 3FLYA 3LMHA 2VTNA 3KF4A 2XVDA 3GU8A 3VHEA 2B1PA 3PZHA 3KULA 2OSCA 5BQ0A 4LOOA 2J51A 4CKJA 4YJRA 4FSUA 1K2PA 5DGZA 1OIYA 2PL0A 3RJCA 3ZU7A 1IA8A 3GT8A 2GS6A 5A4EA 4TZRA 5DR6A 4U3ZA 1I44A 1KV1A 4EYJA 4M0ZA 3BQCA 3C13A 3GFWA 1BI7A 3VS2A 4BIDA 2CN8A 4RJ3A 3I1AA 2O3PA 3C4XA 3FXXA 2BKKA 5LMBA 4O6LA 2OXDA 4R5YA 2B4SB 4M0YA 4QTCA 5LMKC 2X7OA 2XA4A 4EHEA 4B9DA 4UEUA 3EYGA 2QU5A 4CG8A 1GZOA 3LHJA 3ANQA 3MH2A 2C4GA 5A4QA 5M4IA 4NM0A 3BWJA 2BCJA 4O6EA 2CPKE 4TNDA 3R1NA 4F70A 1Q3WA 3EQHA 3GQLA 3QBNA 4IJ9A 2C6KA 3QRKA 5D7VA 4BBEA 3LLAA 3FQSA 3VS7A 4IX3A 3HAMA 5EQPA 3OY3A 2JDTA 4HGTA 3R8VA 3R9OA 4GVAA 2YCQA 5H8BA 5CU0A 5A9UA 4RBLA 5J7HA 2QODA 2X6DA 4R3CA 4DT8A 2C3IB 3ORZA 2OIQA 2Z60A 4IAIA 4L46A 4YJPA 2I0YA 1R0PA 5FD2A 3V5JA 3MFTA 3WIGA 4YMJA 3U4UA 3UOLA 2IZTA 2WXVA 4JR7A 4WD5A 2WTJA 4C37A 4LOPA 4CKRA 5C27A 3LCDA 1JWHA 4HYIA 5DWRA 2EUFB 1M17A 3FMEA 2OLCA 3LVPA 4O82A 3AC3A 4BTMA 3G2FA 1UNHA 3PA4A 4C02A 5CAPA 3SLSA 4AW1A 5BVKA 4RPVA 2UZOA 3RK7A 3WZDA 3EQBA 3UNZA 5EDRA 3OS3A 5FLFA 3WE8A 2CGVA 4A9RA 1PXMA 5I9ZA 4MXAA 5IH4A 4DTAA 5JMSA 1P5EA 4U80A 2EXMA 5E8UA 4K11A 3QZIA 4HNIA 5AA9A 2PUPA 3OOGA 4D4RA 3KCKA 3BKBA 4NYEA 1UWJA 3D5VA 5GJDA 1GJOA 4RJ6A 4WBBB 2C0TA 2PSQA 4S30A 2C6EA 3BLHA 3ZLYA 2QI8A 1RW8A 4FZ7A 3SAYA 3W2RA 3PIXA 4J8MA 1A06A 4JBQA 4W8EA 2GU8A 4PMTA 2XS0A 5D10A 1Q99A 4M69B 4Q5EA 2CNQA 4K8AA 3VBQA 3OXZA 3GXLA 2JGZA 3C4WA 3FQEA 1PXKA 4RX8A 3PVGA 3QKMA 3CP9A 3QTRA 5HGIA 4ZJVA 5CASA 1PXNA 5HLNA 3NNUA 4EH4A 4U8ZA 1CKJA 2BZIB 2R4BA 3ZRKA 4QNAA 4EK3A 2QOFA 5M56A 3P23A 4XG4A 4N6ZA 1KE6A 5DT4A 2HIWA 3P7AA 3JY0A 3NSZA 4R1VA 4D28A 4FVQA 2JKKA 5CZHA 3HRFA 5EI8A 3QQHA 4AE6A 5AIRA 4CTCA 1PKDA 3ZS5A 3PXQA 3FLQA 5L8LA 3PJ2A 2XNGA 2OJFE 3NUNA 4RJ4A 4CZYB 2RF9A 3T3VA 4PDSA 3RINA 1SVGA 4RFMA 3UE4A 2X4ZA 4LG4A 3FDNA 4E4XA 1YKRA 5ANKA 5J8IA 2UW9A 3BGZA 3R63A 4E5WA 5AP2A 1J91A 3PSDA 3N4TA 3HZTA 4YGAA 1XKKA 3I4BA 3KRLA 4V04A 4CMOA 1FGKA 1O9UA 4CLJA 3PTGA 2PVRA 3I5NA 5M4CA 3QUPA 2R7IA 1MRUA 1F5QA 4JL9A 5CVGA 5HO6A 4IC7A 4C2VA 4DC2A 3W2SA 3PJ8A 1G5SA 4C2WA 3DDPA 4I4FA 4PMPA 3ITZA 3QQLA 3KC3A 3T8OA 5A6OA 3L8XA 4UZDA 2E2BA 3V01A 2Q0BA 5D41A 3KB7A 3OWLA 4MXCA 2ZV8A 4FSNA 2W4OA 3PWDA 4AN2A 4FTMA 3TUBA 3DB8A 4PNKA 4O7LA 3L8SA 3I5ZA 4O86A 1H00A 3ROCA 2PZIA 5HLWA 5BVOA 3E62A 3GFEA 2R3NA 3P7BA 3OHTA 2JKQA 1DI8A 5J9ZA 4ZZOA 2FGIA 1VYWA 3AD5A 1M52A 4MK0A 1OB3A 5E8ZA 2OZAB 4CD0A 4E73A 3QKLA 1OUKA 3A62A 4PQNA 4BI1A 4FI1A 5L8JA 5GZAA 4LL0A 5L8KA 2YFXA 3VUDA 3TZMA 3IW8A 4GT5A 3ZEPA 4F7NA 5C9CA 2W1DA 1R3CA 1BX6A 2A1AB 4FT7A 3BCEA 1FPUA 3AD4A 5LARA 3R83A 5A14A 1Q8WA 5AUUA 4CZUA 2PMOX 2R3JA 3SRVA 2IO6A 2QLQA 2JIIA 2VV9A 3Q5IA 4OTGA 3OMVA 4DEBA 2QKRA 4RC4A 1M7QA 4OT6A 4A4XA 5L2TA 4KIKB 3JXWA 3QTUA 2EB2A 2B53A 2OH4A 4OBQA 4F7LA 1DAWA 3KU2A 4X7QA 3AT3A 3FMNA 1YWVA 3QLFA 1B38A 3RCJA 5CU4A 1CSNA 3ZLWA 3BEAA 4E6CA 4FX3A 2PU8A 1H28A 5BYLA 2GNGA 1PXPA 1W82A 4AOTA 5KUPA 4KB8A 3ZO2A 3ZYAA 4C4HA 3OWKA 4CLIA 3DKOA 2BRBA 2VNWA 4JG7A 4LGDA 4E3CA 4I5HA 2ZAZA 4EOJA 3VQHA 4U44A 4XG2A 3OFMA 3QTXA 2HW7A 3LQ5A 5HE0A 2HCKA 3TIZA 4YZNA 2HY0A 4AGUA 4BL1A 1SYKA 2UW0A 5DR2A 2ZMDA 4YHTA 4DEAA 4FIFA 2UV2A 2PVHA 1TQPA 3EQRA 4MXOA 5BUIA 1FVTA 3ZM4A 3DBFA 3OBJA 4EQMA 1I09A 4JXFA 5C8NA 3R7OA 5KCVA 4OBOA 2JDVA 2X9EA 2YABA 4XHKB 4ACDA 4LYNA 3VAPA 2ZM3A 5K5XA 4B4LA 4S31A 5ETIA 5EKNA 3H0YA 3F61A 4X21A 4FV6A 3VS3A 2W5AA 3RALA 4RZWA 3QRTA 4CZTA 2C5OA 1YOLA 4A9YA 4AZTA 4NCTA 4DH1A 3BI6A 3OROA 4OTWA 3E92A 4FTIA 4RWIA 2Q83A 4UMUA 2UZNA 3R30A 4M69A 3HA8A 3IDCA 4AFJA 4OAUC 2VO0A 4R78A 3FLSA 3DTCA 3R1YA 1PMVA 3F88A 3NCZA 4RWLA 4XG3A 2QO7A 1A9UA 3WZKA 5DI1A 3R71A 4QOXA 3MH3A 3WZUA 4UXLA 2C5XA 1YDSE 2FSTX 2UZDA 3CQUA 5CF5A 3F3VA 3CSVA 2AUHA 2CHLA 5TF9A 3FBVA 2GNLA 1H0WA 3TG1A 1OITA 5EYKA 3AQVA 4K0YA 3TXOA 3FUPA 4U3YA 2C3KA 2VGPA 3KFAA 1S9IA 3Q6WA 1YQJA 5IEYA 5JSMA 1BI8A 4PTEA 3C4EA 5JZJA 5KKRB 4YO6A 4UY9A 4GT3A 3H9OA 3NPCA 4QRCA 2VGOA 4OTFA 3FZ1A 3E8EA 4O0RA 3E8NA 2QD9A 4RIWA 4EHZA 5JEBA 1EH4A 2VTSA 4V0GB 4C61A 3ZXZA 2UW7A 3G0EA 4CV9A 4JAIA 1GIIA 3QTZA 4Q5HA 4XYFA 1U5RA 3O8UA 3FMJA 4YURA 3DZOA 4PY1A 3COIA 5DNRA 1YWNA 4IAYA 5IF1A 4FKQA 5M4FA 3ZLSA 3N51A 4BCMA 1KUTA 4QMMA 1JSVA 3HL7A 4TYEA 4I92A 5EHLA 5ETFA 4ZY6A 1L3RE 4PP7A 5CEQA 3U9CA 3A7GA 4ZSJA 1ZARA 4A4OA 4FGRA 4PWNA 2OG8A 3F3WA 2WAJA 3DDQA 2BZKB 4FL2A 4KINA 4X3JA 5CXHA 5BVDA 4RX7A 5DRDA 2JEDA 4QT1A 3PUPA 3AC5A 4MHAA 3W2PA 5LVMA 1ZYJA 3QRJA 1YVJA 3VQUA 5HHWA 4BIEA 2YAAA 4FKUA 4DFLA 5DH3A 3NNXA 4AOIA 4YU2A 4H3BA 5FTQA 2QKWB 4FSZA 1UU7A 1YXXA 4EKKA 3BQRA 1IASA 2C6IA 2XF0A 4YHFA 5FM2A 3VC4A 3C0GA 2R7BA 3FZSA 4WNMA 4EZ3A 4FTLA 4FYOA 4B8MA 2R64A 3D2KA 4UB7A 1OKZA 3TTJA 4C58A 2YDJA 5HD7A 1XR1A 2P2IA 4O22A 4IM0A 4GS6A 4QYGA 1V1KA 1PXJA 2BAQA 2W4JA 5HX8A 4IANA 3MFRA 4S2ZA 4AFEA 3BHVA 2X2LA 3OVVA 4NTSA 3I7CA 3ZEWA 4DCEA 5K3YA 2PZ5A 3AC1A 4CTBA 4QPSA 3LW0A 3WF6A 4UXQA 3OW3A 5ANIA 1BKXA 1Q8UA 4D9TA 5EQYA 1AD5A 3KK8A 3U9NA 4D4SA 4QQTA 1M2RA 3HRCA 3CIKA 4E4MA 1OKYA 2ITYA 3CEKA 3V5LA 2BHHA 2GPHA 5LVOA 5E8YA 1E1VA 2KULA 2V7AA 4YC3A 1PMEA 2C0IA 2ITQA 3I0OA 4HGLA 4NIFB 5H3QA 3V04A 1Y8GA 4FSWA 4QP8A 4TN6A 1REKA 2YM7A 5M51A 4DYMA 4DEEA 3AMYA 3EB0A 5HKMA 5CWZA 3R04A 5TO8A 4GL9A 4Y8DA 4DH7A 2ZVAA 4EOQA 3SG9A 4C4FA 3BU3A 2QQ7A 4U7ZA 3ZFMA 4IB0A 2ESMA 4AA5A 5A6NA 4MQ1A 4R7BA 1JNKA 2LAVA 4BF2A 1U4DA 3BHTA 4R3PA 2QOHA 3NUYA 4QP1A 4U0IA 3BHUA 3ZSHA 5E9EA 3RAIA 1OMWA 4IWOA 1SVEA 3C1XA 1OI9A 1URCA 2GS7A 2IVTA 3F82A 5JQ5A 3COMA 2WNTA 4HVGA 1P14A 3PYYA 3CTHA 5BVNA 2XYNA 3WZJA 4ZLOA 5ANGA 4BCNA 4PP9A 3DKFA 4CFVA 4O2PA 3HLLA 4D1SA 4UWBA 5KKRC 3W2CA 4EH6A 4QMSA 4MXZA 1DS5A 4F6SA 1PJKA 5A4LA 1Q3DA 3MH1A 4ZSLA 1UNLA 3V8WA 3VULA 4AN3A 4KSQA 5H9BA 4AW2A 4EH2A 4ZZNA 4EL9A 5A46A 4G3FA 4FZFB 1PW2A 4L3LA 4AN9A 4WKQA 5J79A 3JS2A 3IQ7A 4UYNA 1H01A 2JBPA 2REIA 1IG1A 4K2RA 4WG3A 3ORXA 4CT1A 3A7HA 4FV1A 3UTOA 4ALVA 3VNTA 5LVNA 2YDKA 2HW6A 1BMKA 3EMGA 3L8PA 5EHOA 2OGVA 5I4NA 2PZRA 4AZWA 5CYIA 2CJMA 2Y6MA 5DLSA 2W1FA 4HPTE 2QO9A 4NJ3A 4BTJA 4I6HA 4NKAA 4WUAA 4APPA 4QTAA 1P2AA 2YIQA 4GMYA 2C6LA 4GKIA 3NVKI 4HYSA 4JOAA 5I9UA 5IA2A 3ZSIA 4OBPA 3HX4A 4KS7A 2OK1A 4ZTSA 5IA0A 3VS5A 2C0OA 3CTQA 1JAMA 4GYIA 4TT7A 4DFUA 3ZHPC 4O7RA 2OF4A 3PSBA 4ENYA 5IMEA 2UZVA 3AG9A 4QMWA 5DOSA 3DQWA 5M55A 3RP9A 4DT9A 3THBA 2ETRA 4GG7A 4RX5A 5J1VA 1U5QA 3UYTA 5I9YA 4LRJA 3R7EA 2PK9A 3Q96A 1OUYA 2XYUA 3QXOA 4W4VA 4AACA 4EEVA 1RE8A 3QD4A 5KHWA 3EKNA 1R0EA 4C3PA 4C59A 3II5A 3W1FA 5CEMA 2Y4PA 1Q8TA 3TUDA 4XV1A 4AGWA 2ITWA 2XP2A 2VTQA 4BCJA 4AOJA 3FYKX 3LE6A 3QQKA 2WIHA 3R7VA 3ORNA 2VWVA 4NEUA 2ITUA 5HVKA 4CSVA 3SDJA 3FWQA 2CKQA 4JAJA 3VS0A 3QA0A 1UV5A 3DZQA 4I0TA 3U87A 4FKSA 2A19B 2FA2A 5HCZA 4AZFA 1XH4A 1YI3A 3Q04A 4FIGA 4D1XA 4WT6A 4D2RA 4LFIA 1WFCA 4FKRA 3DA6A 2P3GX 4ZZMA 3CY3A 2ETMA 4X2FA 3UBDA 5LVPA 4CFFA 4C3FA 4YJTA 3P78A 2Z02A 3TDWA 4MH7A 3JVSA 2BVAA 2QHNA 1ZOEA 3LFSA 4F63A 1XBBA 1G8AA 3PPZA 4QP2A 2JDRA 3JVRA 3QUEA 4P7EA 1GIJA 5DEYA 3WYYA 4PL5A 5AUTA 2ONLA 3R7YA 4QMLA 2CKPA 1XH6A 4FV5A 2UZTA 4LGHA 2BHEA 2B9FA 3MV5A 4NKSA 3ENHA 5CALA 1J7UA 2ZOQA 1W83A 1ZZLA 3MVHA 5EKOA 1KE9A 4DGLC 3TNPC 3QRIA 1J3HA 2Z2WA 2YA9A 3DNDA 5BNJA 3QQGA 4MAOA 4OTPA 2BAJA 2HXLA 3MY1A 1CM8A 3F5UA 4YPDA 3VS6A 3FI2A 4W4YA 3VS4A 2ITPA 1GZKA 1CMKE 2WTDA 2QOBA 5EG3A 3ZBXA 2W05A 2B9HA 2F7ZE 2VU3A 1NVQA 1Q5KA 3BZ3A 1H1QA 3SVVA 2WTWA 4J95A 4RGJA 2WQEA 5EHYA 5I3OA 4FG9A 1ZRZA 3HMOA 4UWYA 3UMXA 5C8MA 2GNIA 4XRJA 2R0UA 3KXMA 4U43A 2BDFA 2VTLA 4ZXTA 4AX8A 1ZYLA 3KRXA 3DV3A 1UU9A 1KOAA 4E4NA 3E3BX 4M66A 3I6WA 3EQIA 1SZMA 3VBYA 3ATSA 3OT8A 4ZMEA 2J6MA 4KAOA 3KMUA 4DH3A 1LEZA 2YM8A 4FTQA 3FMMA 1H1SA 5IQHA 2J9MA 4QQ5A 3E5AA 3RAWA 3B8RA 3ALNA 5E90A 3KXXA 4PDOA 4ZSEA 3VJNA 4GV1A 2XIZA 2B52A 3H9FA 2E9VA 3DBEA 3ZUVA 2B0QA 4QMXA 3Q53A 3WILA 2C5YA 4MD8E 3DFAA 4I6FA 3M42A 4BCPA 2J90A 4G17A 2NNWB 4AUAA 3EJ1A 4G6NA 5L2QA 3S4QA 4L43A 4HPUE 3OY1A 4CVAA 1CDKA 4AU8A 5IKWA 3UZRA 5EI2A 3R8UA 4JQ8A 2B55A 3NUXA 3KN6A 3KKVA 5KMMA 2YZLA 2F2UA 5M4UA 3OT3A 3JPVA 3LJ1A 4LOQA 1UVRA 3FC2A 3AC8A 3GGFA 3A7JA 3VO3A 5FGKA 4DH5A 3PE1A 4RA5A 3P1AA 3VBTA 4D2TA 4D5HA 1FBNA 2IW9A 3R9DA 4I22A 4KRDA 4GU9A 3AMBA 4QMYA 3R7IA 3OEFX 3TKIA 4BTFA 4P5ZA 1PXLA 4EQUA 4JG6A 5IQFA 4CFNA 2XCKA 2YLFA 3FHIA 3FYJX 2R5TA 3NUPA 2BRGA 5EH0A 3UIMA 4CMUA 5AFVA 2EVAA 4FE2A 2I40A 3RPOA 5HBJA 2C6TA 4L7SA 4EH7A 3G9NA 5JK3A 4QMZA 1L8TA 5E91A 4DE4A 4CFWA 1Q62A 1XH5A 5GJGA 5HG5A 5L6OA 5AV2A 4QMUA 4D9UA 2KTYA 3EN7A 5ANOA 4FEXA 5FDXA 4ENXA 2WKMA 4YPSA 5A4CA 5GIPE 2GMXA 2ZDUA 4H39A 1B6CB 2P55A 3FV8A 3G6HA 4NSTA 4N4SA 3ANRA 3OW4A 3K2LA 4JRNA 5J9YA 2C30A 3NW5A 3NAXA 2YIRA 5IQCA 4JBVA 3FMKA 3Q2JA 2VTTA 4KSPA 3BV2A 3ORPA 4YSMA 1AGWA 2WD1A 2YISA 4UYAA 5LVLA 2QNJA 1LR4A 3C5UA 5M57A 2G9XA 3TZ8A 2ITVA 5CEPA 3SXRA 2Y9QA 3EOCA 1OBDA 4TWCA 5A3XA 5CAOA 5AP0A 3WOWA 5JH6A 1KOBA 2XNEA 4G3GA 5CENA 2W7XA 3VRYA 3KF7A 3QHRA 4O0XA 4ONAA 3FSKA 5HNGA 5I9XA 4J7BA 4ACHA 3EH9A 5B2LA 3O51A 3GCSA 2R3LA 3BGPA 3PLAE 4ASZA 5LWMA 3TNIA 3ZO3A 2X4FA 4QQCA 2GNFA 4EHGA 4FV3A 3V5PA 4FEVA 3P0MA 4GUEA 5E8VA 4PX6A 1WMKA 4DH8A 5IA1A 5CSVA 4WRSA 3GOKA 2QR8A 4GT4A 4BRXA 4MNFA 3KXZA 4BKYA 1QMZA 4EWQA 1IR3A 2OJ9A 4F08A 4XOZA 5KNJA 3RK9A 4G9CA 4RT7A 3A4PA 1KV2A 4EHVA 3I0QA 4R8QA 2VWXA 4ZTQA 3LFAA 1XO2B 2BDJA 5IQDA 1PXOA 2QOIA 3WF8A 4XBRA 4Z3VA 3AD6A 3F66A 4QMPA 4ZTNA 4O7ZA 5CU6A 3MFUA 3G9LX 3R73A 3ZONA 3FL5A 4EH5A 1OIRA 5AAEA 1W84A 2PULA 4U40A 4KRCA 3SRVB 5FXSA 3P5KA 4E4LA 1YHVA 3Q9ZA 2RFDA 3LXLA 3IPHA 3SXFA 3PJ3A 4BI2A 4HGEA 4A9TA 4HVSA 3BBWA 3KN5A 3LFBA 4H3PA 4C4JA 5BUEA 2X1NA 3L9NA 2GFCA 2OJGA 1PXIA 3K5UA 4FC0A 2WU6A 4NZWB 2XNOA 5CX9A 2X9FA 3W55A 3R8PA 4L7FA 4EYMA 1TQMA 4KA3A 4BDFA 1J7LA 3GBZA 5F20A 4IH8A 1VEBA 1ZMUA 3SA0A 2C5VA 4Q2AA 3ZXTA 4FOCA 3H30A 4DG0E 4AW5A 4X6QC 2J0IA 3FKLA 3CR0A 1YRPA 2CCIA 4ZP5A 3W33A 5FXRA 3UP7A 1WZYA 1Q61A 3EFLA 5HG8A 4CFUA 3NUAA 1H08A 2C1BA 3F9NA 4FEQA 2GS2A 3TJCA 4PL3A 4BI0A 3GU4A 2C6MA 3UPXA 4FBXA 4A9SA 5CS6A 4F9BA 3BELA 2PYWA 2YM6A 4HOKA 1Q24A 2VTIA 5I0BA 4P2KA 4P90A 4ITHA 1ZOHA 4D2VA 3FQHA 4EONA 4D5KA 5BVFA 3M2WA 2DUVA 2FO0A 3SQQA 4ID7A 4O1PA 2JDOA 3QL8A 4MXXA 2CGWA 5AP6A 5AP1A 2PVKA 3ZTXA 2PVFA 3GCPA 5JFSA 3B2TA 1M7NA 4FTAA 3HVCA 3MPAA 1FVVA 1PYEA 2OFVA 4OTHA 3F69A 1FGIA 5HG7A 3AT2A 4TWOA 3W18A 4C8BA 1OPLA 5EW9A 4C34A 5CF8A 1G3NA 3PLSA 1UU8A 3LOKA 4J97A 5EW3A 2HOGA 3UNJA 4CT2A 1Z9XA 3PJCA 4IVDA 3HDMA 4HJOA 2QR7A 4LMNA 5HESA 5FEEA 5LOHA 3Q4UA 5GZ9A 4WHZA 2WHBA 3ORTA 5HTIA 1NXKA 4X3FB 1R39A 2JAVA 3DU8A 5KMIA 3NCGA 1YI6A 2XNNA 3ORMA 4IAAA 4P4CA 4AT5A 3DJ7A 2QG7A 2VWUA 3HNGA 3L1SA 4O0VA 2WFYA 4RIWB 1BL7A 3CKXA 1VR2A 3OCSA 4PUZA 3LXNA 3NDMA 3ZDIA 2WMRA 4O0YA 4KABA 3C4CA 4W9WA 5F95A 2EXEA 4E8AA 3LFNA 4GUBA 4QP3A 4LRKA 1H1WA 2XJ1A 3QQJA 4YJUA 3VRZA 4BDDA 2YHVA 3CBLA 4I5MA 3OEZA 4G16A 5EW8A 1P4FA 4I4EA 4O7VA 3F2RA 4AZSA 5C03A 4F6WA 3UC4A 2X7GA 1ZWSA 5B2KA 4ASXA 2XJ2A 4EORA 2OXXA 3UVPA 4CNHA 5FXQA 2VTAA 3GOPA 3QZGA 3RZFA 2F49A 2IZRA 5FQDC 5J87A 5K5NA 2IPXA 5D12A 5JGDA 3O8TA 4I21A 4KUJA 1KSWA 2CGUA 3A7IA 5HI2A 1A48A 1J1CA 3E88A 4YNEA 5JGAA 3FZTA 2PMNX 4MD7E 3IK3A 3KY2A 3F3UA 1STCE 2PPQA 4C36A 4D1ZA 4A7CA 3EZVA 3R2BA 4XV2A 4OR5A 3D2IA 4ITJA 3H3CA 2P2HA 3FXZA 3RZBA 1OPJA 3PXFA 5CNOA 3OOMA 5DR9A 1X8BA 2BRNA 5DHJA 4NU1A 1NA7A 4M7IA 4XP2A 5M07A 2P33A 3BYOA 4YJQA 5EYMA 5AP4A 3UOHA 5KMNA 2GCDA 2R3HA 2RFEA 2O0UA 5HE2A 2PTKA 2OW3A 3FY0A 4O38A 4B6LA 4DLIA 4PTGA 5FEDA 3O7LB 4EC9A 4O21A 4FA2A 2UZWE 4BYIA 4DFXE 3IW6A 2W96B 2X0GA 4RSSA 2QG5A 4GH2A 4KIPA 2J50A 2OZOA 4OGRA 4ZJJA 1OZ1A 3SW4A 4AZVA 2J0KA 1S9JA 3O7LD 5CEIA 1DI9A 3EWHA 4IADA 5ICPA 4WOVA 1MUOA 1YHWA 4LRMA 3DFCB 4RZVA 4Y72A 5CT0A 2XM8A 2VTJA 3DXQA 4DTBA 1W98A 3FI3A 3MTLA 3UDBA 3TTIA 4ZOGA 1QPCA 5H8EA 5C01A 2J7TA 4EZ5A 5CAQA 2YIYA 5DT3A 5DN3A 3UOKA 4AT3A 2VWBA 2UW3A 1WAKA 4D55A 4NCTC 3SKCA 4CFXA 3FKNA 3E63A 4H1MA 3B2WA 4L67A 2ZM1A 4HYHA 4JDIA 5T68A 2XK9A 3BEGA 4G3EA 1NW1A 1NY3A 4OW8A 3EL7A 4EBVA 4QQJA 2ITXA 2WMXA 1O6LA 1E9HA 3GQIA 5CSWA 2F2CB 5DG5A 3ROYA 4LUEA 2YWVA 4UALA 2XNBA 5L4QA 4XP0A 3OXIA 4ACMA 5FEQA 1XJDA 2BIKB 4YUQA 3RM7A 1Q97A 1LP4A 1Y6AA 2XRUA 1RQQA 4IWDA 3BE2A 3DPKA 4GK4A 4ZS0A 3WF5A 4F64A 1BUHA 2C47A 3CS9A 4UZHA 3OC1A 4AT4A 2CKEA 3D94A 5HO8A 2ZV7A 4TL0A 4F9AA 4I5CA 4K77A 4C4EA 3CY2A 4X3FC 5D1JA 4DEHA 3HMNA 2AC3A 4IQ6A 4PF4A 5HU9A 4I0SA 1OL6A 5AIKA 3G6GA 5HCXA 2R3PA 3LCOA 2OJIA 1WCCA 3OBGA 3DS6A 4MF1A 1VZOA 5AV3A 5HVJA 3AC4A 2F57A 5I9VA 1UU3A 5AR7A 2HYYA 2G1TA 1GZNA 4ZY4A 2ZJWA 1FQ1B 5CSPA 4GRBA 4YR8A 4Z9LA 4YC6A 1FVRA 4NJDA 4BCHA 1JKTA 4L8MA 4BZOA 5FRIA 3H9RA 1JLUE 2E9OA 3RHKA 3QAME 4FIEA 2YAKA 5E1EA 5HIEA 3Q4CA 5EM6A 2XKFA 3PXRA 4C62A 1SM2A 1TQIA 1V0PA 4FGBA 4J96A 4IW0A 3UODA 4F4PA 4FTUA 3S2PA 1OL2A 3VBWA 5AUXA 5L2SA 1NT2A 1V0BA 2ZV9A 4FEWA 4X3FA 4ASDA 2Q0NA 5HE1A 2EWAA 2YJSA 2C68A 3UO6A 3ETAA 3WI6A 4XG8A 3LJ0A 4I20A 3IDPA 5A54A 4FVRA 3D5WA 2UZEA 4IZ5A 4PV0A 5AUYA 3MW1A 3EQCA 3LXPA 3IOPA 3QU0A 4TYHA 3CE3A 4EUUA 4E6QA 2YEXA 2FVDA 2IJMA 4PPAA 2XKDA 2OO8X 2RFNA 3MYGA 4QPAA 3V8TA 1ZAOA 3W8QA 4G34A 3MESA 4F1OA 4FT5A 4QYFA 1B39A 1YDTE 4M15A 4CQEA 3TEIA 4IBMA 4IZYA 4YP8A 3TM0A 3F3ZA 2JKOA 2OU7A 2WZJA 5EYDA 3A7FA 4BHNA 2OICA 3R7UA 2XKCA 4MVFA 4E6DA 4E7WA 3MDYA 1YXVA 1OL7A 3EYHA 2UVYA 4IIRA 3PPKA 2QOKA 2YN8A 4FK6A 2OH0E 5CI7A 3FZPA 3QGYA 2PMLX 5CQUA 3DGKA 1FOTA 2JITA 4HCUA 3EN4A 4M8TA 4D2WA 4EUTA 4D58A 3P79A 4MNEA 1PHKA 1YHSA 3DBQA 1YOJA 3SHEA 3VWAA 1DAYA 5B7VA 4QMNA 3UPZA 2W0JA 4NK9A 4S33A 4ORKA 4DBXA 3QTSA 3DBCA 4EK4A 4LM5A 2R9SA 4QMOA 2CDZA 4ITIA 4DFZE 5LJJA 5ACBC 1J7IA 1P4OA 3QTIA 3RGFA 4RLKA 4O81A 2JDSA 2X6EA 2JFLA 4NW5A 2RL5A 4WRGA 3E7VA 5GHVA 1ZLTA 2I6LA 4FSRA 4IB5A 3UJGA 3DLZA 2GHLA 4TW9A 2C5NA 4ARKA 2UZLA 4IB3A 5IQEA 2QOLA 1R78A 4FIIA 1W7HA 5DEWA 5DT0A 3VVHA 3P7CA 3R6XA 3GC8A 2ZYBA 3JR1A 4OUCA 3TNQB 3LFFA 4JI9A 4YBJA 4BTKA 2IG7A 5IEVA 4JRVA 5DMZA 5CVFA 3REPA 4TKSA 3CCNA 4PNIA 5M06A 2QURA 2XZSA 5ETCA 3HV7A 4F9CA 4QO9A 4FR4A 4WIHA 4PL4A 3G33A 4C3RA 2DQ7X 4TWPA 4BFMA 3EN6A 1U54A 2V55A 3ENMA 4RJ5A 3TZ7A 4GKHA 3SV0A 2VWYA 3CLYA 3MVJA 2GNJA 4GFMA 3QC4A 2F7XE 3OWPA 4BDBA 5J9LA 4DCAA 1K9AA 5CEOA 4NL0A 4IB1A 3PG3A 4BIBA 2GSFA 3OF0A 4EH3A 3I79A 4OTRA 4F0FA 1XBAA 3ORKA 2YM3A 4C7TA 5CSHA 4FL1A 3LFDA 4L52A 3C51A 4OTDA 2WEIA 2CLQA 4IDVA 2RG5A 3U55A 4I1ZA 5J5TA 2VN9A 2WQNA 1CTPE 4JVGA 3O23A 3CJGA 4U9AA 4HGSA 3S00A 3G15A 1O6YA 3ZCLA 3KCFA 1PMUA 4H1JA 5KZIA 3ZZEA 4C4GA 2GQSA 4MEDA 4OT5A 4L6QA 4FG8A 3PY3A 3FEGA 2J0LA 5AA8A 2VX3A 3R21A 4F0IA 4M14A 4FKJA 2R2PA 4YLJA 3F5GA 4Y46A 3RNIA 2VWIA 2R3KA 4D0XA 4BKZA 4FSQA 5CF6A 1YI4A 2BALA 4OLIA 5BVEA 3KRRA 1ND4A 2BPMA 3QUDA 2YACA 4E1ZA 2Y6OA 4YJNA 3TT0A 3BU6A 2W9FB 3CQEA 4BKJA 1T45A 1WVYA 3TL8A 4U41A 5HD4A 5IH6A 2XBAA 3QQUA 5IA5A 3QX2A 2WQOA 4HYUA 3G5DA 5CI6A 3PY0A 2PZYA 3DK3A 1JSUA 2JLDA 2VTHA 3WBLA 3GCQA 2XK8A 5AAFA 4MBLA 2O63A 2OWBA 4JQEA 3VW8A 1URWA 3U51A 4YZMA 3GC9A 4JX7A 5ETAA 2QHMA 3W2QA 4TYJA 3TKHA 3QD0A 3MIAA 2BUJA 5KMKA 4MYGA 3OXTA 5FP5A 3QRUA 1YW2A 2CKOA 3QCXA 3PIYA 3HECA 2E9NA 2IWIA 1LPUA 3OWJA 2UVXA 4NWMA 4ACGA 3HV4A 3LCKA 2CNUA 2WIPA 4UMTA 3A60A 1XH8A 2HK5A 3UO5A 3UIBA 2NRYA 5EOBA 3C5IA 3LQ8A 1QPJA 2ONLC 3PIZA 3QTQA 1WBWA 2BIYA 2XBJA 3NYNA 2B54A 4N6YA 5AR2A 1RJBA 3RI1A 3R1QA 4XNEA 3TIYA 2NP8A 2Y7JA 2YCSA 4EH9A 4DHFA 4DFYA 1H8FA 3IG7A 3BWFA 1GOLA 3EQDA 5CAVA 3HMPA 3EIDA 2HWPA 2H34A 1SVHA 1QPDA 4RVKA 1IA9A 4AGDA 2HAKA 3EL8A 2QCSA 2E9UA 4RMZA 4FV9A 4CFMA 1JBPE 4R7HA 4BDJA 3S1HA 4U45A 3D4QA 2G2FA 3NRMA 2BROA 4JDHA 2VTPA 3E8CA 5HVYA 4UMRA 4K1BA 5DYJA 4W4WA 4DINA 3N4VA 2WU7A 4M84A 2FSMX 2PUIA 4DF3A 2OJJA 4BGHA 2X2MA 3JUHA 4L00A 2YCFA 4FTTA 5D9HA 4ZJIA 2BRHA 5HTCA 4WA9A 4M3QA 4BDAA 2SRCA 3N4UA 4FIHA 1PYXA 3C0HA 2BRMA 3H4JA 3VHKA 3DJ5A 5BMMA 4ZAUA 3LQ3A 3W2OA 3IGGA 3MI9A 1DM2A 1LUFA 2FSLX 4GG5A 4IM2A 3TNHA 1OECA 2WELA 4YTHA 3D7TA 2QLUA 1U59A 3ZFXA 1K3AA 4BR3A 2A4LA 3DKGA 5IQAA 3MVMA 3BU5A 4W8DA 3ZO4A 3P08A 3RNYA 2GDOA 5K0XA 1M2PA 2GHMA 2WMBA 1J1BA 2WMSA 4U6RA 4IVAA 4NM5A 5EK7A 2GTNA 4D4YA 3LM5A 3RMFA 2W1EA 3V8SA 4NM3A 4CEGA 2JBOA 2GNHA 4PRJA 3D15A 4IEBA 3FPQA 4KD1A 2I7QA 4GU6A 5GJFA 4HVIA 4JIKA 3AXWA 3AC2A 2JIVA 3RBWA 4JDJA 5IU2A 3OD6X 4EK5A 2QONA 2G01A 4B7TA 2UVZA 4NW6A 3DQXA 5I3RA 2ETKA 4HCVA 3ORLA 1GAGA 4G6LA 4RQVA 5HOAA 2X8DA 3EFWA 4MXYA 5HNBA 2NRUA 2VRXA 3IECA 1WVXA 2WPAA 5T3QA 4JR3A 4O91A 3IW4A 2ITTA 2J5EA 3SW7A 3Q5ZA 5K0KA 4CG9A 2WTVA 4RVMA 1MQBA 2A2AA 3BGQA 4CMTA 3HAVA 4FEUA 1XH7A 3MN3A 3MA3A 1F3MC 4Y95A 3RHXA 2R3FA 5HBEA 2PVLA 3QZHA 3LZBA 4O7NA 2YIXA 3R8LA 2VX0A 3BYUA 5GINE 1XWSA 4B0GA 4BICA 2UZBA 2EU9A 1O6KA 3CJFA 3PA3A 5FBNC 3Q9WA 3LKMA 3FL4A 1BL6A 2F4JA 4FSMA 3W10A 3RCDA 2RIOA 3OUNB 2JKMA 2XM9A 2C3LA 3D83A 4BN1A 3C7QA 4KBKA 1WBTA 2GQRA 1Q8ZA 1Y8YA 3P4KA 4FTJA 5CLPA 3QF9A 5LQFA 2FH9A 3Q4TA 3QCYA 3KEXA 3P86A 3QZFA 2VTMA 5CSXA 3FMDA 2PMIA 3OCTA 5CF4A 4XJ0A 5GZ8A 5E4HA 4DBNA 2VD5A 5JFWA 5C1QB 3VBVA 1ERKA 2Y4IB 4BGGA 3D5UA 3PVBA 2R0IA 4BDKA 4FV7A 4O0SA 5L6WL 4G31A 5I5ZA 4A4LA 3MJ2A 4JT3A 5GNKA 3VF9A 4LL5A 4A07A 3VUGA 5CY3A 2PVJA 2PVYA 2V22A 4QP6A 3UO4A 3HV6A 2WQBA 4JBOA 4IM3A 4BCKA 4KS8A 4X2GA 3RVGA 2W1IA 4JG8A 4BDEA 5JKGA 4AP7A 4XEYA 3FLZA 4RIYB 5M44A 5H8GA 2HENA 4ANQA 5FP6A 4X2JA 4O7SA 4E20A 4G9RA 3KXNA 1IEPA 4F9WA 3QWJA 4IWPA 2VO6A 3C50A 3MTFA 5E8XA 4FNZA 5AUWA 3ERKA 4Q9SA 5HU3A 5TR6A 3Q4ZA 3K5VA 3N9XA 1H26A 5KBRA 3BBTB 4WNPA 2GHGA 3G90X 1Y91A 3OG7A 4IX6A 5BYZA 5JT2A 5LXMA 1RDQE 2FSOX 4QP7A 3CGFA 4AXAA 3TJDA 3HYHA 3S3IA 3TKUA 2OIDA 3CPBA 4ZS4A 4UMQA 4IJPA 1WBVA 3WF9A 2DS1A 4HCTA 1OVEA 1JQHA 4G5JA 4PDPA 3HMMA 5K9IA 3GCVA 4KKGA 4P5QA 2GFSA 3KMMA 5HTBA 3I7BA 2CGXA 5BYYA 4PDYA 2OKRA 2NPQA 3FZRA 3LMGA 3NNVA 3D0EA 3U4WA 3OZ6A 4EK6A 4QTEA 4K9YA 3O71A 5IA4A 2IVSA 5CXZA 4GK2A 1Z57A 1MP8A 3O8PA 3UG2A 5CANA 2WTKB 3NIZA 3Q3BA 2VWWA 4RWKA 1QPEA 4A06A 3EFKA 2H96A 2C6DA 4KNBA 4DEIA 5EI6A 1UKHA 5DIAA 4ZTRA 3BYVA 3PP1A 2RG6A 3R7GA 2O65A 5DPVA 4FNWA 5FM3A 2IW8A 5IEXA 3KGAA 3R02A 4WG4A 3QXPA 4APCA 2WMUA 4RLLA 3UQCA 3UIXA 4EOSA 3PP0A 3ZC5A 2BFYA 4FUXA 1R1WA 3ULZA 3C4FA 3G51A 2Y8OA 3NUUA 4PMSA 2GTMA 2EXCX 2UUEA 2FYSA 4O96A 3QALE 2CNVA 3VIDA 5EYCA 3LXKA 4KKHA 2VX1A 4NTTA 4EKLA 2NO3A 2OFUA 5HICA 4E5AX 4N0SA 3WZEA 3GU5A 3QQFA 5DVRA 3W8LA 5FDPA 3E7OA 3V3VA 2ERKA 3SXSA 4E6AA 3ORIA 3FSFA 3I81A 3QTWA 2XIXA 5E8SA 4N57A 3NYXA 3WARA 4ZY5A 4RWJA 3RWPA 4WO5A 4F99A 3ALOA 4JNWA 3A99A 4ZSAA 3O2MA 3O0GA 4TTHB 4YJOA 3E3PA 4JDKA 2BILB 2OIBA 2W1CA 4H3QA 1T46A 3FZOA 4NT4A 4MWIA 4U97A 4YLLA 4O27B 4O2ZA 3ZDUA 4NM7A 3GI3A 4GW8A 4DFNA 3E93A 3FHRA 3V5QA 4AZEA 2WGJA 4QMTA 4Z55A 1IAHA 2GQGA 2Y4IC 3V6RA 5BUJA 3R0TA 4AA4A 2Z7RA 2WMAA 4IXPA 1U46A 4FKIA 3M1SA 2QOQA 5AM7A 3V51A 3WF7A 4J53A 4BHZA 4ZLZA 4O84A 3NZ0A 5TKDA 4R77A 4A9UA 3UVRA 4K6ZA 2IZSA 4E93A 4LV8A 2JD5A 4FTNA 4D4VA 2XCHA 4BBMA 3F7WA 3IONA 4CQGA 4M13A 2ITNA 5HIDA 3T9IA 4IFCA 1YOMA 1QCFA 2WMQA 5C4KA 3QC9A 4IZ7A 5LMKA 3MB7A 1OKWA 3U54A 2G2HA 4IDTA 5IUHA 5AP3A 5JRQA 1W8CA 3QWKA 3Q32A 2WTIA 1H0VA 4MWHA 4L42A 4H36A 5AAGA 3GCUA 3POZA 3KQ7A 4DG3E 2PUNA 4ERWA 4F1MA 4F09A 3ZBFA 3KXHA 3ZC6A 5JN2A 1MRVA 5F9EA 4EOOA 1YXTA 1ATPE 3PZEA 4FSTA 4GFOA 2XMYA 3LFCA 4X2KA 4YHJA 4ZTHA 5L6PA 5C4LA 5JRSA 3MA6A 4WBOA 3PXYA 3ZO1A 2I1MA 3QD3A 3R8MA 2ERZE 5KZ0A 2YCRA 1ZYSA 3C0IA 2UW8A 1OIQA 1WVWA 3QHWA 4MF0A 5F94A 3VUTA 2P4IA 2W06A 4RIYA 3PXZA 2PHKA 4F7JA 2PVMA 3QCQA 4G1WA 5D7AA 4DGNA 3DXPA 3CPCA 5HCYA 4BDGA 4EC8A 5KMOA 5IQGA 2WTCA 4O0WA 3O50A 2WTKC 4XOYA 3UP2A 3IOKA 1F0QA 4CGAA 4JBPA 1H1RA 4AF3A 4EWHA 2OBJA 4TYHB 3IW7A 5AUVA 4DN5A 2HY81 3F7ZA 3CGOA 3CKWA 3MBLA 3R28A 4MCVA 3ULIA 4AQCA 5KO1A 4BB4A 3R22A 1VYZA 4XCUA 3TN8A 1OKVA 4QNYA 3MSSA 3NX8A 5AJQA 3KREA 1UA2A 2YIWA 4NFNA 3DAKA 5J1WA 3U6HA 3TACA 2W17A 3ZUTA 4XG6A 2W1ZA 4I0RA 5EDPA 3RPYA 2F7EE 4CRSA 3DK7A 4DAWA 3AMAA 2FB8A 2X8IA 3OCBA 3GNIB 2JFMA 4FT0A 4IAKA 2YJRA 2R3OA 4EOKA 3JY9A 4XX9A 2VTOA 5AMNA 1WBPA 4ANNA 3KK9A 2ZV2A 1GY3A 5EFQA 2IVUA 4RIXA 4Y83A 3Q9YA 4C4IA 4CXAA 5FUTA 2PE1A 2XEYA 3QYWA 3QGWA 4YC8A 4Z7HA 5E7RA 4IX4A 3ZLXA 4FNYA 2AYPA 2JAMA 4M68A 3OUKA 1M14A 4MNEB 3SX9A 3LAUA 3R1SA 4QP9A 5TE0A 3VUKA 4BWPA 5KBQA 4FZAB 3GC0A 5A4TA 5C26A 2J2IB 4FUYA 3RPRA 5CTPA 3NMUF 2F9GA 4FTKA 3PRIA 4TWNA 4O7TA 4DLJA 4NUSA 4ANLA 5BPYA 1Y57A 2B9JA 4MBIA 3ID6C 3UZTA 5M09A 3W16A 2DYLA 2ZDTA 2BR1A 3HP2A 4FTOA 4QPMA 3AT4A 5L2IA 3WE4A 1KE8A 2UW5A 3PY1A 4RJ8A 4XLVA 4IE9A 3TV6A 3ZM9A 5K4JA 1KE7A 4II5A 4RVLA 4PTCA 3NVMB 3PA5A 3UQFA 2YDIA 4YBKA 3O96A 3Q52A 1UNGA 3GEQA 4FVPA 4I6BA 3DK6A 3FPMA 1XQZA 1H25A 1JOWB 2VWZA 4TPTA 3QX4A 4Z7GA 1U54B 4U5JA 3T9TA 3PDTA 4AG8A 4Y85A 4RJ7A 3PRFA 3TZ9A 5J95A 4CYJA 1UKIA 4F7SA 5HBHA 3FI4A 5DE2A 2BFXA 3MJ1A 5HG9A 3BHYA 3Q60A 1SMHA 4UX9A 4AGCA 3HV5A 4XP3A 5DA3A 3AGMA 3QFVA 4O83A 4C57A 4GEOA 4YTCA 4GVJA 3QD2B 3Q6UA 4XH6A 5EM7A 4E26A 2Z7QA 2BTRA 3EKKA 2VO7A 4FV2A 3T3UA 3F2AA 3EQFA 4PPBA 2YM4A 4JX3A 4DGMA 1OL1A 2W1GA 4R7IA 3LMIA 2OXYA 4YTIA 2QU6A 3VUIA 4RC3A 4O7YA 1IAJA 3QKKA 4G3CA 4I94A 5T6KA 3QLGA 4IWQA 3GC7A 4MQ2A 3U6JA 4FKPA 5ITAA 3GU6A 4O1OA 5IDPA 3BRBA 4XG7A 4YLKA 4I24A 3RPSA 3DLSA 5CQWA 3MB6A 4WNOA 3NAYA 5C8KA 4RFYA 3MVLA 2ZB0A 2O2UA 4RC2A 5BVWA 3ACJA 4ZIMA 4F65A 3POOA 5CAUA 2ZM4A 3V5WA 3GVUA 1OPKA 3EHAA 3ELJA 3MPTA 4BCOA 5AV1A 5IMXA 4JS8A 5KX8A 2XRWA 5HQ0A 4DA5A 5CU2A 3HKOA 3JYAA 4EQCA 4YJSA 1JPAA 2EB3A 2R3GA 4U42A 2XK3A 1XHAA 4XMOA 3PE2A 2H9VA 3NLBA 1E1XA 3UZPA 4D2PA 4ZK5A 4ERKA 4USEA 3KVXA 5ACKA 1GNGA 3ZMMA 4BDCA 4QYEA 2XUUA 3BYSA 5LCKA 2C69A 3MY5A 3NYVA 2V5QA 4OTIA 4R6VA 1TKIA 2X81A 4CKIA 2JC6A 4FL3A 4FKTA 3NGAA 4YSJA 2W99B 2XEZA 4USFA 4U81A 2O64A 4IACA 4QMVA 4L45A 2QO2A 5IH5A 4FKOA 2VZ6A 3R2YA 4Z16A 1AQ1A 4ANSA 4FNXA 3VBXA 4PPCA 2OF2A 4USDA 4G2FA 1JSTA 3NNWA 2Z7LA 4C38A 5H2UA 3TNWA 5AR3A 1SNXA 3CQWA 4HZRA 5LWNA 2IN6A 3E64A 5IG1A 3UOJA 4PMMA 4QD6A 5D11A 2PUUA 2XKEA 4FICA 3NS9A 4F9YA 3R9HA 3VN9A 1UWHA 4IAFA 3F5PA 4UV0A 2Z7SA 3CD3A 5FTGA 5BX0A 4DTKA 4D0WA 5KE0A 4X0MA 1Q41A 3BV3A 2PY3A 5HEZA 4FKGA 3HA6A 5E8TA 3A2CA 3EFJA 3F2NA 5CT7A 4BDHA 4CCUA 4QTDA 4QP4A 3ZOSA 3OCGA 3F6XA 3IS5A 3VW6A 4EJ7A 1YXUA 3KVWA 4AW0A 3FAAA 1NVRA 4CCBA 3NUSA 4I3ZA 2XB7A 3ZUUA 4FKVA 2PZPA 3OTVA 5EQEA 4GSBA 3TWJA 3UQGA 4BWKA 4NH1A 4J8NA 5KMLA 1XH9A 5JQ8A 2YWPA 2R3QA 1HCLA 3D7TB 3CC6A 1GZ8A 2J4ZA 4G5PA 3PVWA 4TNBA 4ANMA 2LGCA 2WMTA 5TOZA 4BBFA 2JIUA 2XIKA 3TI1A 4TYIA 4R1YA 2OZAA 3RWQA 3ZRLA 5E1SA 3UG1A 3DTWA 1WBOA 2BMCA 3DXNA 4FK3A 4IHPA 4L3PA 3SD0A 3SG8A 3BLQA 2E9PA 2DWBA 4F6UA 5BMSA 2CMWA 4RQKA 3ZSGA 4O7WA 4LI5A 4Y5HA 4L9IA 4C0TA 5AV4A 1JKKA 3F5XA 2FUMA 3HMIA 1ZMVA 4I5PA 5IQBA 3QYZA 3DB6A 4BZDA 3F3TA 3BHHA 1HCKA 4CYIA 1ZYDA 2O5KA 4UMPA 5CVHA 3CXWA 4ZTMA 3R01A 1G8SA 2W4KA 5AP5A 3I60A 3TV4A 4EOIA 1M2QA 4O0UA 3COHA 3UIUA 4FT3A 5HZNA 2AC5A 3DY7A 4FZDB 4KIKA 3L8VA 4LMUA 4ASEA 2J5FA 4BCQA 5LCJA 4S34A
chains in the Genus database with same CATH superfamily
4TYGA 4HNFA 5CU3A 2ZFYA 1ZYCA 3KL8A 1Q4LA 3R8ZA 2HZIA 3CD8A 4K33A 4DEGA 4Q9ZA 4D2SA 5HNIX 3KMWA 3IKAA 1XBCA 5J5SA 4JJRA 4RX9A 1JKSA 2XH5A 3Q2MA 4ZMFA 3UMWA 3VF8A 2C6OA 4BCFA 2HXQA 3BLRA 4U79A 4LV5A 4X6RA 2ZMCA 4KBAA 3IGOA 3GU7A 2OI4X 5AWMA 4DG2E 4YZCA 3DAEA 3BE9A 3ZZWA 3R9RA 3DOGA 2A0CX 2XNPA 1ZXEA 4ZEGA 4BGQA 1YXSA 5E8WA 3PVUA 2XALA 1KWPA 2ACXA 4UBAA 4BC6A 2P0CA 2J0MB 5AM6A 4ZTLA 3ZRMA 4ZLYA 3LPBA 4J1RA 1FINA 3V5TA 1BLXA 2IZUA 3GENA 4EI4A 4EOPA 4L3JA 5K4IA 2C1AA 1Q8YA 4AAAA 3IDBA 3DT1A 3DJ6A 4L44A 4E5BA 4WUNA 2XK6A 3FI8A 3LFEA 4KIQA 5HIBA 5LMAA 3QCSA 3S95A 4GCJA 4HW7A 5DBXA 2H6DA 2PVNA 2VO3A 3E8DA 3LJ2A 3PPJA 4WNKA 1MRYA 4IX5A 4FOBA 5CNNA 3R9NA 3U8WA 3WYXA 4YO4A 1H24A 3NIEA 3PG1A 2WOTA 4AE9A 3VJOA 4FSYA 3RPVA 2V0DA 3PSCA 4FYNA 1JVPP 2ZB1A 2UW4A 1GIHA 5AR8A 2CSNA 4OTQA 4KIOA 3W32A 2A27A 2RKUA 4RA4A 5HX6A 3FMHA 4AWIA 3RK5A 4B8LA 5AADA 5ANDA 4BVUA 4J52A 4MX9A 4C35A 3NW7A 3NWWA 4UWCA 2I0HA 5AR4A 2RGPA 2B7AA 3FMLA 5JZNA 4DGOA 2X0OA 3K54A 4O0TA 1PRYA 5JFVA 4H58A 2BDWA 3G0FA 3H10A 3DCVA 3DNEA 4J98A 3PXKA 1OBGA 4UN0C 3A61A 4B99A 2R3MA 3MY0A 4BJJB 3U6IA 5AP7A 4V0GA 4TXCA 4JIAA 3VUMA 3M11A 3HUCA 1Z5MA 1H4LA 2VTRA 3KA0A 3HV3A 3QA8A 4GIIA 5KHXA 2YERA 3HDNA 4ANOA 4QMQA 5IZFA 4LQMA 4FKWA 2WO6A 3BYMA 3L9MA 4MKCA 2YLEA 5HO7A 3NYOA 3OP5A 2PWLA 4KWPA 2X8EA 1XMLA 2YITA 3P9JA 2XNMA 5JFXA 2HWOA 4GYGA 4DITA 3A8WA 3ODZX 3UGCA 5IUGA 2R3IA 4GIHA 3NR9A 4EOLA 1NVSA 5JGBA 4WSYA 4BYJA 4FV4A 2I0VA 4RG0A 4L01A 4XBUA 4YZ9A 2C3JA 2VNYA 2UZUE 4YZDA 5EM8A 4HVHA 4OAVB 4DFBA 1APME 2BZHB 4C33A 4M97A 3GP0A 3FXWA 4XUFA 5F4NA 4HVDA 4L53A 3LM0A 1ZY5A 3A8XA 3LCSA 4MD9E 4S32A 4G6OA 3NEWA 2QOCA 3FLNC 3OTUA 5HLPA 1OM1A 3DBDA 1LEWA 2XK4A 1PF8A 2CLXA 3KULB 2VUWA 2YM5A 4FT9A 4FV0A 4IVCA 5HE3A 5IA3A 4IZAA 4W4XA 3AGLA 4AXFA 4XRLA 3UDTA 4BWXA 5CEKA 4BY9E 3COKA 3GUBA 5DFPA 5EDQA 3B8QA 4EK8A 1H1PA 5AV0A 5G1XA 2QOOA 3KXGA 3LFQA 1CKIA 4ZSGA 3BX5A 3LLTA 3PWYA 3D7ZA 3NW6A 3K3IA 2Z8CA 4ACCA 4AS0A 1ZY4A 5TT7A 3TUCA 4LUDA 2BZJA 4EOMA 2J0JA 2HELA 2XIRA 4KKEA 3SOAA 3MS9A 1OGYA 1PY5A 5EM5A 3KRJA 3ODYX 3IW5A 3A4OX 4FZ6A 5IQIA 5FWKK 4YJVA 1PKGA 4IC8A 1YDRE 4XV9A 3UNKA 1ZMWA 5L3AA 2VAGA 3E87A 5ANJA 1SNUA 4AXDA 2G15A 5IPJA 4WSQA 5EOLA 5FTOA 2Y0AA 2IVVA 1OGUA 4NIFA 3AKLA 4LGGA 4FG7A 2BTSA 4W9XA 5AX3A 4K18A 3EQGA 1ZOGA 4XLIA 1WBNA 3FKOA 4RRVA 4R3RA 3RTPA 4ANBA 1BYGA 2B9IA 3HUBA 3EN9A 4G3DA 5DRBA 4FTCA 2WMVA 3BPRA 1FMOE 3D9VA 3HRBA 4EJNA 4X2NA 4FV8A 2HZ4A 4QYYA 4Y73A 2UW6A 2W1HA 2YZAA 2W5HA 2W9ZB 2WOUA 3LIJA 4BCIA 3GB2A 3ZH8A 2W5BA 4NFMA 3SOCA 4GJ3A 3RKBA 2I0EA 3O17A 4DEDA 4RIOA 3MIYA 5KMJA 3DAJA 1V0OA 3RM6A 4IMYA 2QC6A 3ET7A 4I93A 4BCGA 3ZFYA 4ALUA 3ATTA 3LCTA 4XG9A 3TCPA 5M08A 3FC1X 5FG8A 3KRWA 3V6SA 3RAHA 2ITOA 1IRKA 2XJ0A 3WIKA 4DGGA 4IVBA 3EN5A 4M12A 3VUHA 3K3JA 4XV3A 5ANEA 4I6QA 4XS2A 3EZRA 2HZNA 5CZIA 4EBWA 2PE0A 3L9PA 5E92A 3DKCA 4TY1A 1W0XC 3CTJA 2IW6A 4I41A 4O4DA 3HEGA 4QYHA 4YTFA 1WBSA 3PFQA 4FMQA 4H05A 1TVOA 2BKZA 3SC1A 3C9WA 3R00A 2CCHA 4QTBA 3FE3A 3HGKA 4I23A 5IISA 3S0OA 4WG5A 1MQ4A 1CKPA 4L68A 4V01A 4RVTA 4BZNA 3HP5A 4MTAA 2WMWA 3UYSA 3VS1A 4FIJA 3PJ1A 5J7BA 4GJ2A 1ZZ2A 1JKLA 5B0XA 3RAKA 1QL6A 2WB8A 4MBJA 3D5XA 1OIUA 3UC3A 5M53A 5I9WA 4KBCA 2BAKA 2RFSA 4YZBA 3MWUA 5AX9A 4CV8A 4AA0A 2R3RA 2X7FA 3FLWA 1VJYA 1REJA 5HORA 4TRLA 4R5SA 5F1ZA 2XK7A 2CN5A 3BIZA 4M67A 4FKLA 4HZSA 2WQMA 4YNOA 4FTRA 5AEPA 1PMNA 2X2KA 2V7OA 4FF8A 5AR5A 2HZ0A 4J71A 1H07A 2WEVA 3MPMA 3TV7A 4F0GA 3H0ZA 5IUIA 2H8HA 2QVSE 4BJJA 4ALWA 1FMKA 2G2IA 3MH0A 3MGYA 2PE2A 3FJQE 4JQ7A 4RFZA 4GK3A 4IAZA 3SGCA 2ITZA 4IFGA 3L9LA 5G6VA 3C4ZA 1H27A 1OL5A 4CRLA 3ACKA 4Y5QA 4BDIA 4EZ7A 2O8YA 3TDVA 4RIXB 3AOXA 3UVQA 2RSVA 3EQPA 1HOWA 1Y6BA 3Q9XA 1YWRA 5GIOE 3IO7A 4GFGA 3FY2A 2V62A 3I6UA 4JLCA 4FODA 4F1TA 5IDNA 3D14A 2XIYA 4N70A 2X39A 5FBOA 4V05A 5AUZA 5B2MA 3MFSA 5L2WA 4J99A 1KE5A 4EH8A 3FLYA 3LMHA 2VTNA 3KF4A 2XVDA 3GU8A 3VHEA 2B1PA 3PZHA 3KULA 2OSCA 5BQ0A 4LOOA 2J51A 4CKJA 4YJRA 4FSUA 1K2PA 5DGZA 1OIYA 2PL0A 3RJCA 3ZU7A 1IA8A 3GT8A 2GS6A 5A4EA 4TZRA 5DR6A 4U3ZA 1I44A 1KV1A 4EYJA 4M0ZA 3BQCA 3C13A 3GFWA 1BI7A 3VS2A 4BIDA 2CN8A 3W0PA 4RJ3A 3I1AA 2O3PA 3C4XA 3FXXA 2BKKA 5LMBA 4O6LA 2OXDA 4R5YA 2B4SB 4M0YA 4QTCA 5LMKC 2X7OA 2XA4A 4EHEA 4B9DA 4UEUA 3EYGA 2QU5A 4CG8A 1GZOA 3LHJA 3ANQA 3MH2A 2C4GA 5A4QA 5M4IA 4NM0A 3BWJA 2BCJA 4O6EA 4O4FA 2CPKE 4TNDA 3R1NA 2X0PA 4F70A 1Q3WA 3EQHA 3GQLA 3QBNA 4IJ9A 2C6KA 3QRKA 5D7VA 4BBEA 3LLAA 3FQSA 3VS7A 4IX3A 3HAMA 5EQPA 3OY3A 2JDTA 4HGTA 3R8VA 3R9OA 4GVAA 2YCQA 5H8BA 5CU0A 5A9UA 4RBLA 5J7HA 2QODA 2X6DA 4R3CA 4DT8A 2C3IB 3ORZA 2OIQA 2Z60A 4IAIA 4L46A 4YJPA 2I0YA 1R0PA 5FD2A 3V5JA 3MFTA 3WIGA 4YMJA 3U4UA 3UOLA 2IZTA 2WXVA 3W0QA 4JR7A 4WD5A 2WTJA 4C37A 4LOPA 4CKRA 5C27A 3LCDA 2AQXA 1JWHA 4HYIA 5DWRA 2EUFB 3W0OA 1M17A 3FMEA 2OLCA 3LVPA 4O82A 3AC3A 4BTMA 3G2FA 1UNHA 3PA4A 4C02A 5CAPA 3SLSA 4AW1A 5BVKA 4RPVA 3O5AA 2UZOA 3RK7A 3WZDA 3EQBA 3UNZA 5EDRA 3OS3A 5FLFA 3WE8A 2CGVA 4A9RA 1PXMA 5I9ZA 4MXAA 5IH4A 4DTAA 5JMSA 1P5EA 4U80A 2EXMA 5E8UA 4K11A 3QZIA 4HNIA 5AA9A 2PUPA 3OOGA 4D4RA 3KCKA 3BKBA 4NYEA 1UWJA 3D5VA 5GJDA 1GJOA 4RJ6A 4WBBB 2C0TA 2PSQA 4S30A 2C6EA 3BLHA 3ZLYA 2NYAA 2QI8A 1RW8A 4FZ7A 3SAYA 3W2RA 3PIXA 4J8MA 1A06A 4JBQA 4W8EA 2GU8A 4PMTA 2XS0A 5D10A 1Q99A 4M69B 4Q5EA 4O4EA 2CNQA 4K8AA 3VBQA 3OXZA 3GXLA 2JGZA 3C4WA 3FQEA 1PXKA 3TMOA 4RX8A 3PVGA 3QKMA 3CP9A 3QTRA 5HGIA 4ZJVA 5CASA 1PXNA 5HLNA 3NNUA 4EH4A 4I6LA 4U8ZA 1CKJA 2BZIB 2R4BA 3ZRKA 4QNAA 4EK3A 2QOFA 5M56A 3P23A 4XG4A 4N6ZA 1KE6A 5DT4A 2HIWA 3P7AA 3JY0A 3NSZA 4R1VA 4D28A 4FVQA 2JKKA 5CZHA 3HRFA 5EI8A 3QQHA 4AE6A 5AIRA 4CTCA 1PKDA 3ZS5A 3PXQA 3FLQA 5L8LA 3PJ2A 2XNGA 2OJFE 3NUNA 4RJ4A 4CZYB 2RF9A 3T3VA 4PDSA 3RINA 1SVGA 4RFMA 3UE4A 2X4ZA 4LG4A 3FDNA 4E4XA 1YKRA 5ANKA 5J8IA 2UW9A 3BGZA 3R63A 4E5WA 5AP2A 1J91A 3PSDA 3N4TA 3HZTA 4YGAA 1XKKA 3I4BA 3KRLA 4V04A 4CMOA 1FGKA 1O9UA 4CLJA 3PTGA 2PVRA 3I5NA 5M4CA 3QUPA 2R7IA 1MRUA 2IEWA 1F5QA 4JL9A 5CVGA 5HO6A 4IC7A 4C2VA 4DC2A 3W2SA 3PJ8A 1G5SA 4C2WA 3DDPA 4I4FA 4PMPA 3ITZA 3QQLA 3KC3A 3T8OA 5A6OA 3L8XA 4UZDA 2E2BA 3V01A 2Q0BA 5D41A 3KB7A 3OWLA 4MXCA 2ZV8A 4FSNA 2W4OA 3PWDA 4AN2A 4MUQA 4FTMA 3TUBA 3DB8A 4PNKA 4O7LA 3L8SA 3I5ZA 4O86A 1H00A 3ROCA 2PZIA 5HLWA 5BVOA 3E62A 3GFEA 2R3NA 3P7BA 3OHTA 2JKQA 1DI8A 5J9ZA 4ZZOA 2FGIA 1VYWA 3AD5A 1M52A 4MK0A 1OB3A 5E8ZA 2OZAB 4CD0A 4E73A 3QKLA 1OUKA 3A62A 4PQNA 4BI1A 4FI1A 5L8JA 5GZAA 4LL0A 5L8KA 2YFXA 3VUDA 3TZMA 3IW8A 4GT5A 3ZEPA 4F7NA 5C9CA 2W1DA 1R3CA 1BX6A 2A1AB 4FT7A 3BCEA 1FPUA 3AD4A 5LARA 3R83A 5A14A 1Q8WA 5AUUA 4CZUA 2PMOX 2R3JA 3SRVA 2IO6A 4AXCA 2QLQA 2JIIA 2VV9A 3Q5IA 4OTGA 3OMVA 4DEBA 2QKRA 4RC4A 1M7QA 4OT6A 1W2DA 4A4XA 5L2TA 4KIKB 3JXWA 3QTUA 2EB2A 2B53A 2OH4A 4OBQA 4F7LA 1DAWA 3KU2A 4X7QA 3AT3A 3FMNA 1YWVA 3QLFA 1B38A 3RCJA 5CU4A 1CSNA 3ZLWA 3BEAA 4E6CA 4FX3A 2PU8A 1H28A 5BYLA 2GNGA 1PXPA 1W82A 4AOTA 5KUPA 4KB8A 3ZO2A 3ZYAA 4C4HA 3OWKA 4CLIA 3DKOA 2BRBA 2VNWA 4JG7A 4LGDA 4E3CA 4I5HA 2ZAZA 4EOJA 3VQHA 4U44A 4XG2A 3OFMA 3QTXA 2HW7A 3LQ5A 5HE0A 2HCKA 3TIZA 4YZNA 2HY0A 4AGUA 4BL1A 1SYKA 2UW0A 5DR2A 2ZMDA 4YHTA 4DEAA 4FIFA 2UV2A 2PVHA 1TQPA 3EQRA 4MXOA 5BUIA 4O4BB 1FVTA 3ZM4A 3DBFA 3OBJA 4EQMA 1I09A 4JXFA 5C8NA 3R7OA 5KCVA 4OBOA 2JDVA 2X9EA 2YABA 4XHKB 4ACDA 4LYNA 3VAPA 2ZM3A 5K5XA 4B4LA 4S31A 5ETIA 3PUFC 5EKNA 3H0YA 3F61A 4X21A 4FV6A 3VS3A 2W5AA 3RALA 4RZWA 3QRTA 4CZTA 2C5OA 1YOLA 4A9YA 4AZTA 4NCTA 4DH1A 3BI6A 3OROA 4OTWA 3E92A 4FTIA 4RWIA 2Q83A 4UMUA 2UZNA 3R30A 4M69A 3HA8A 3IDCA 4AFJA 4OAUC 2VO0A 4R78A 3FLSA 3DTCA 3R1YA 1PMVA 3F88A 3NCZA 4RWLA 4XG3A 2QO7A 1A9UA 3WZKA 5DI1A 3R71A 4QOXA 3MH3A 3WZUA 4UXLA 2C5XA 1YDSE 2FSTX 2UZDA 3CQUA 5CF5A 3F3VA 3CSVA 2AUHA 2CHLA 5TF9A 3FBVA 2GNLA 1H0WA 3TG1A 1OITA 5EYKA 3AQVA 4K0YA 3TXOA 3FUPA 4U3YA 2C3KA 2VGPA 3KFAA 1S9IA 3Q6WA 1YQJA 5IEYA 5JSMA 3KIOC 1BI8A 2AEGA 3VONA 4PTEA 3C4EA 5JZJA 5KKRB 4YO6A 4UY9A 4GT3A 3H9OA 3NPCA 4QRCA 2VGOA 4OTFA 3FZ1A 3E8EA 4O0RA 3E8NA 2QD9A 4RIWA 4EHZA 5JEBA 1EH4A 2VTSA 4V0GB 4C61A 3ZXZA 2UW7A 3G0EA 4CV9A 4JAIA 1GIIA 3QTZA 4Q5HA 4XYFA 1U5RA 3O8UA 3FMJA 4YURA 3DZOA 4PY1A 3COIA 5DNRA 1YWNA 4IAYA 5IF1A 4FKQA 5M4FA 3ZLSA 3N51A 4BCMA 1KUTA 4QMMA 1JSVA 3HL7A 4TYEA 4I92A 5EHLA 5ETFA 4ZY6A 1L3RE 4PP7A 5CEQA 3U9CA 3A7GA 4ZSJA 1ZARA 4A4OA 4FGRA 4PWNA 2OG8A 3F3WA 2WAJA 3DDQA 2BZKB 4FL2A 4KINA 4X3JA 5CXHA 5BVDA 4RX7A 5DRDA 2JEDA 4QT1A 3PUPA 3AC5A 4MHAA 3W2PA 5LVMA 1ZYJA 3QRJA 1YVJA 3VQUA 5HHWA 4AQKA 4BIEA 2YAAA 4FKUA 4DFLA 5DH3A 3NNXA 4AOIA 4YU2A 4H3BA 5FTQA 2QKWB 4FSZA 1UU7A 1YXXA 4EKKA 3BQRA 1IASA 2C6IA 2XF0A 4YHFA 5FM2A 3VC4A 3C0GA 2R7BA 3FZSA 4WNMA 4EZ3A 4FTLA 4FYOA 4B8MA 2R64A 3D2KA 4UB7A 1OKZA 3TTJA 4C58A 2YDJA 5HD7A 1XR1A 2P2IA 4O22A 4IM0A 4GS6A 4QYGA 1V1KA 1PXJA 2BAQA 2W4JA 5HX8A 4IANA 3MFRA 4S2ZA 4AFEA 3BHVA 2X2LA 3OVVA 4NTSA 3I7CA 3ZEWA 4DCEA 5K3YA 2PZ5A 3AC1A 4CTBA 4QPSA 3LW0A 3WF6A 4UXQA 3OW3A 5ANIA 1BKXA 1Q8UA 4D9TA 5EQYA 1AD5A 3KK8A 3U9NA 4D4SA 4QQTA 1M2RA 3HRCA 3CIKA 4E4MA 1OKYA 2ITYA 3CEKA 3V5LA 2BHHA 2GPHA 5LVOA 5E8YA 1E1VA 2KULA 2V7AA 4YC3A 1PMEA 2C0IA 2ITQA 3I0OA 4HGLA 4NIFB 5H3QA 3AKKA 3V04A 1Y8GA 4FSWA 4QP8A 4TN6A 1REKA 2YM7A 5M51A 4DYMA 4DEEA 3AMYA 3EB0A 5HKMA 5CWZA 3R04A 3W0SA 5TO8A 4GL9A 4Y8DA 4DH7A 2ZVAA 4EOQA 3SG9A 4C4FA 3BU3A 2QQ7A 4U7ZA 3ZFMA 4IB0A 2ESMA 4AA5A 5A6NA 4MQ1A 4R7BA 1JNKA 2LAVA 4BF2A 1U4DA 3BHTA 4R3PA 2QOHA 3NUYA 4QP1A 4U0IA 3BHUA 3ZSHA 5E9EA 3RAIA 1OMWA 4IWOA 1SVEA 3C1XA 1OI9A 1URCA 2GS7A 2IVTA 3F82A 5JQ5A 3COMA 2WNTA 4HVGA 1P14A 4FRFA 3PYYA 3CTHA 5BVNA 2XYNA 3WZJA 4ZLOA 3W0NA 5ANGA 4BCNA 4PP9A 3DKFA 4CFVA 4O2PA 3HLLA 4D1SA 4UWBA 5KKRC 3W2CA 4EH6A 4QMSA 4MXZA 1DS5A 4F6SA 1PJKA 5A4LA 1Q3DA 3MH1A 4ZSLA 1UNLA 3V8WA 3VULA 4AN3A 4KSQA 5H9BA 4AW2A 4EH2A 4ZZNA 4EL9A 5A46A 4G3FA 4FZFB 1PW2A 4L3LA 4AN9A 4WKQA 5J79A 3JS2A 3IQ7A 4UYNA 1H01A 2JBPA 2REIA 1IG1A 4K2RA 4WG3A 3ORXA 4CT1A 3A7HA 4FV1A 3UTOA 4ALVA 3VNTA 5LVNA 2YDKA 2HW6A 1BMKA 3EMGA 3L8PA 5EHOA 2OGVA 5I4NA 2PZRA 4AZWA 5CYIA 2CJMA 2Y6MA 5DLSA 2W1FA 4HPTE 2QO9A 4NJ3A 4BTJA 4I6HA 4NKAA 4WUAA 4APPA 4QTAA 1P2AA 2YIQA 4GMYA 2C6LA 4GKIA 3NVKI 4HYSA 4JOAA 5I9UA 5IA2A 3ZSIA 4OBPA 3HX4A 4KS7A 2OK1A 4ZTSA 5IA0A 3VS5A 2C0OA 3CTQA 1JAMA 4GYIA 4TT7A 4DFUA 3ZHPC 4O7RA 2OF4A 3PSBA 4ENYA 5IMEA 2UZVA 3AG9A 4QMWA 5DOSA 3DQWA 5M55A 3RP9A 4DT9A 3THBA 2ETRA 4GG7A 4RX5A 5J1VA 1U5QA 3UYTA 5I9YA 4LRJA 3R7EA 2PK9A 3Q96A 1OUYA 2XYUA 3QXOA 4W4VA 4AACA 4EEVA 1RE8A 3QD4A 5KHWA 3EKNA 1R0EA 4C3PA 4C59A 3II5A 3W1FA 5CEMA 2Y4PA 1Q8TA 3TUDA 4XV1A 4AGWA 2ITWA 2XP2A 2VTQA 4BCJA 4AOJA 3FYKX 3LE6A 3QQKA 2WIHA 3R7VA 3ORNA 2VWVA 4NEUA 2ITUA 5HVKA 4CSVA 3SDJA 3FWQA 2CKQA 4JAJA 3VS0A 3QA0A 1UV5A 3DZQA 4I0TA 3U87A 3NFFB 4FKSA 2A19B 2FA2A 5HCZA 4AZFA 1XH4A 1YI3A 3Q04A 4FIGA 4D1XA 4WT6A 4D2RA 4LFIA 1WFCA 4FKRA 3DA6A 2P3GX 4ZZMA 3CY3A 2ETMA 4X2FA 3UBDA 5LVPA 4CFFA 4C3FA 4YJTA 3P78A 2Z02A 3TDWA 4MH7A 3JVSA 2BVAA 2QHNA 1ZOEA 3LFSA 4F63A 1XBBA 1G8AA 3PPZA 4QP2A 2JDRA 3JVRA 3QUEA 4P7EA 1GIJA 5DEYA 3WYYA 4PL5A 5AUTA 2ONLA 3R7YA 4QMLA 2CKPA 1XH6A 4FV5A 2UZTA 4LGHA 2BHEA 2B9FA 3MV5A 4NKSA 3ENHA 5CALA 1J7UA 2ZOQA 1W83A 1ZZLA 3MVHA 5EKOA 1TFFA 1KE9A 4DGLC 3TNPC 3QRIA 1J3HA 2Z2WA 2YA9A 3DNDA 5BNJA 3QQGA 4MAOA 4OTPA 2BAJA 2HXLA 3MY1A 1CM8A 3F5UA 4YPDA 3VS6A 3FI2A 4W4YA 3VS4A 2ITPA 1GZKA 1CMKE 2WTDA 2QOBA 5EG3A 3ZBXA 2W05A 2B9HA 2F7ZE 2VU3A 1NVQA 1Q5KA 3BZ3A 1H1QA 3SVVA 2WTWA 4J95A 4RGJA 2WQEA 5EHYA 5I3OA 4FG9A 1ZRZA 3HMOA 4UWYA 3UMXA 5C8MA 2GNIA 4XRJA 2R0UA 3KXMA 4U43A 2BDFA 2VTLA 4ZXTA 4AX8A 1ZYLA 3KRXA 3DV3A 1UU9A 1KOAA 4E4NA 3E3BX 4M66A 3I6WA 3EQIA 1SZMA 3VBYA 3ATSA 3OT8A 4ZMEA 2J6MA 4KAOA 3KMUA 4DH3A 1LEZA 2YM8A 4FTQA 3FMMA 1H1SA 5IQHA 2J9MA 4QQ5A 3E5AA 3RAWA 3B8RA 3ALNA 5E90A 3KXXA 4PDOA 4ZSEA 3VJNA 4GV1A 2XIZA 2B52A 3H9FA 2E9VA 3DBEA 3ZUVA 2B0QA 4QMXA 3Q53A 3WILA 2C5YA 4MD8E 3DFAA 4I6FA 3M42A 4BCPA 2J90A 4G17A 2NNWB 4AUAA 3EJ1A 4G6NA 5L2QA 3S4QA 3BL7A 4L43A 4HPUE 3OY1A 4CVAA 1CDKA 4AU8A 5IKWA 3UZRA 5EI2A 3R8UA 4JQ8A 2B55A 3NUXA 3KN6A 3KKVA 5KMMA 2YZLA 2F2UA 5M4UA 3OT3A 3JPVA 3LJ1A 4LOQA 1UVRA 3FC2A 3AC8A 3GGFA 3A7JA 3VO3A 5FGKA 4DH5A 3PE1A 4RA5A 3P1AA 3VBTA 4D2TA 4D5HA 1FBNA 2IW9A 3R9DA 4I22A 4KRDA 4GU9A 3AMBA 4QMYA 3R7IA 3OEFX 3TKIA 4BTFA 4P5ZA 1PXLA 4EQUA 4JG6A 5IQFA 4CFNA 2XCKA 2YLFA 3FHIA 3FYJX 2R5TA 3NUPA 2BRGA 5EH0A 3UIMA 4CMUA 5AFVA 2EVAA 4FE2A 2I40A 3RPOA 5HBJA 2C6TA 4L7SA 4EH7A 3G9NA 5JK3A 4QMZA 1L8TA 4QDEA 5E91A 4DE4A 4CFWA 1Q62A 1XH5A 5GJGA 5HG5A 5L6OA 5AV2A 4QMUA 4D9UA 2XAOA 2KTYA 3EN7A 5ANOA 4FEXA 5FDXA 4ENXA 2WKMA 4YPSA 5A4CA 5GIPE 2GMXA 2ZDUA 4H39A 1B6CB 2P55A 3FV8A 3G6HA 4NSTA 4N4SA 3ANRA 3OW4A 3K2LA 4JRNA 5J9YA 2C30A 3NW5A 3NAXA 2YIRA 5IQCA 4JBVA 3FMKA 3Q2JA 2VTTA 4KSPA 3BV2A 3ORPA 4YSMA 1AGWA 2WD1A 2YISA 4UYAA 5LVLA 2QNJA 1LR4A 3C5UA 5M57A 2G9XA 3TZ8A 2ITVA 5CEPA 3SXRA 2Y9QA 3EOCA 1OBDA 4TWCA 5A3XA 5CAOA 5AP0A 3WOWA 1TZDA 5JH6A 1KOBA 2XNEA 4G3GA 5CENA 2W7XA 3VRYA 3KF7A 3QHRA 4O0XA 4ONAA 3FSKA 5HNGA 5I9XA 4J7BA 4ACHA 3EH9A 5B2LA 3O51A 3GCSA 2A98A 2R3LA 3BGPA 3PLAE 4ASZA 5LWMA 3TNIA 3ZO3A 2X4FA 4QQCA 2GNFA 4EHGA 4FV3A 3V5PA 4FEVA 3P0MA 4GUEA 5E8VA 4PX6A 1WMKA 4DH8A 5IA1A 5CSVA 4WRSA 3GOKA 2QR8A 4GT4A 4BRXA 4MNFA 3KXZA 4BKYA 1QMZA 4EWQA 1IR3A 2OJ9A 4F08A 4XOZA 5KNJA 3RK9A 4G9CA 4RT7A 3A4PA 1KV2A 4EHVA 3I0QA 4R8QA 2VWXA 4ZTQA 3LFAA 1XO2B 2BDJA 5IQDA 1PXOA 2QOIA 3WF8A 4XBRA 4Z3VA 3AD6A 3F66A 4QMPA 4ZTNA 4O7ZA 5CU6A 3MFUA 3G9LX 3R73A 3ZONA 3FL5A 4EH5A 1OIRA 5AAEA 1W84A 2PULA 4U40A 4KRCA 3SRVB 5FXSA 1XMMA 3P5KA 4E4LA 1YHVA 3Q9ZA 2RFDA 3LXLA 3IPHA 3SXFA 3PJ3A 4BI2A 4HGEA 4A9TA 4HVSA 3BBWA 3KN5A 3LFBA 4H3PA 4C4JA 5BUEA 2X1NA 3L9NA 2GFCA 2OJGA 1PXIA 3K5UA 4FC0A 2WU6A 4NZWB 2XNOA 5CX9A 2X9FA 3W55A 3R8PA 4L7FA 4EYMA 1TQMA 4KA3A 4BDFA 1J7LA 3GBZA 5F20A 4IH8A 1VEBA 1ZMUA 3SA0A 2C5VA 4Q2AA 3ZXTA 4FOCA 3H30A 4DG0E 4AW5A 4X6QC 2J0IA