4E6CA

P38a-perifosine complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
330
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Lipid Molecules Induce p38 alpha Activation via a Novel Molecular Switch.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e6cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e6cA01
2WTIA 2ITVA 3DAEA 3UIBA 2WIPA 2GSFA 2YJRA 3OT3A 3LOKA 3R02A 3QUPA 4ZLYA 1R0PA 5LMAA 5KHXA 3EZVA 2QOCA 4TRLA 1RJBA 3H4JA 3EH9A 5HE0A 4RMZA 5HOAA 2A27A 1JLUE 3KRLA 3PPKA 3QXPA 2XKCA 5D11A 4JBVA 2ONLA 2JITA 4AG8A 4GH2A 4F9YA 1ZMUA 1CTPE 2R3MA 1WZYA 4N6YA 3ELJA 2WOTA 1BI8A 2BR1A 3DKGA 4KBAA 4YBKA 4RX5A 4ZS4A 3C4ZA 3MPAA 4J7BA 4U44A 1V1KA 2HZIA 4OTHA 5DE2A 5DN3A 5M44A 2BUJA 3ZRLA 5DT0A 5HORA 4BWXA 1GOLA 2F4JA 3GOPA 4U3ZA 5EW8A 5FD2A 1YHWA 5AV0A 2PSQA 4EK5A 2ZM3A 3H9RA 2HOGA 5HE3A 4UX9A 4QPMA 3W55A 3N4TA 3WE8A 3D2KA 1OECA 3NX8A 4U97A 3A8XA 4O86A 3CY2A 3O23A 4MAOA 5F20A 3R1NA 2UZVA 4FK6A 3PYYA 3MVJA 2G1TA 2Z7RA 3ZO2A 2GFCA 3FLSA 4TXCA 2XK6A 4AE6A 1KSWA 3PJ1A 3I1AA 5D1JA 1Y8YA 3KXZA 1R1WA 5DRDA 2KTYA 1H4LA 3GC8A 3KXXA 1JAMA 3EQRA 3NNUA 2EXCX 4C4IA 3OEFX 3LQ3A 2O2UA 2XK8A 4FNXA 2PVHA 1P4FA 3V51A 1KUTA 3SG8A 3ZZEA 3S00A 5CI6A 4BFMA 3DNDA 3BHTA 3ERKA 1FVRA 4RGJA 2VN9A 4HPTE 4XP2A 1VJYA 4EI4A 3CKXA 4ZIMA 4C36A 3ZFMA 1UNLA 2PVKA 1MQ4A 3GEQA 2SRCA 4IDVA 2GQSA 4NJ3A 3ZM9A 5CQWA 1BX6A 4XYFA 4NIFB 3BE2A 3IS5A 4AZEA 3PG1A 4JBQA 4DGLC 2XS0A 3KU2A 4MX9A 3VUGA 4ERKA 2QCSA 5EHYA 5KMIA 2GQGA 4UBAA 4E5BA 4DH5A 1PXPA 1H28A 4KS7A 4LL5A 1PXJA 4BI2A 3G33A 4KNBA 4O91A 1CDKA 2GFSA 2QOHA 3COMA 4B8LA 2J5FA 2ZYBA 3IPHA 4ZTRA 3E8EA 4AGCA 3TNIA 5DMZA 2WKMA 1FBNA 4C35A 3QGWA 2P2IA 3BHVA 3WF6A 4NW6A 3NEWA 5AMNA 1GY3A 2R7BA 3DFAA 4EQMA 5IPJA 2W1GA 4G31A 3IO7A 4R3RA 3E8NA 4XV1A 2WTDA 5FEDA 2CNUA 1GIJA 2QO9A 4BDBA 3VS7A 4FKQA 3AD4A 4MCVA 4HVDA 2WXVA 4YTFA 1PMUA 3ZBFA 3MB6A 2AUHA 3CGFA 3IONA 4L45A 2XK9A 4IQ6A 3VUKA 2XKFA 2CMWA 2WB8A 3OOMA 4KKEA 4RSSA 3TWJA 2OG8A 4M8TA 3VS4A 4BDCA 1ND4A 3EQFA 2I0HA 4CFXA 3AMBA 2VO0A 2H8HA 1YWVA 3A99A 2HIWA 2Y4PA 3LKMA 4W8DA 4CKIA 5EK7A 2Z02A 4WNMA 3TIYA 4TWOA 4AZWA 2BDFA 4KRCA 4M13A 5F95A 3UQCA 1H25A 5JGBA 3ZZWA 4AW0A 3QKMA 5KZ0A 5DR2A 5AR2A 2J51A 3RK7A 2A19B 4X6RA 4OTFA 5AP4A 5FP6A 4YSJA 5KHWA 4APCA 3OEZA 3MBLA 3HX4A 2UVYA 3I5NA 3L8PA 4HYUA 4RA4A 5E8TA 4BYIA 4ZZNA 2Q0BA 4OBOA 4K18A 4IJ9A 3PSCA 5CI7A 4FSUA 3MWUA 4QP8A 5CLPA 2YWVA 3CEKA 1ZWSA 3QZIA 2B9IA 4LYNA 1STCE 4P5QA 4PDOA 4EJ7A 4NKAA 3PFQA 3PIYA 4QMMA 4WA9A 3EL7A 1H07A 2HAKA 5E90A 4LG4A 4I0SA 2J9MA 3EHAA 3R7VA 2BROA 2HZNA 4G3GA 4I6FA 1I44A 5HEZA 2BKKA 5IQBA 3RMFA 4OLIA 4C02A 2B54A 4AP7A 4KAOA 5L6WL 1FINA 5M4CA 2JKKA 4XG2A 3MIAA 4K0YA 1YXXA 3TZMA 3F88A 4ZSJA 2JDOA 2JDVA 4V05A 5E1EA 4YC6A 3NAXA 2QODA 3WI6A 4IHPA 2VTJA 2B1PA 4A9UA 3QZHA 4FKJA 2YDIA 3L8VA 3BYMA 3MJ1A 4QYYA 4RX9A 3I4BA 4DGNA 4USEA 4CXAA 2OJ9A 4C3PA 3NS9A 2QOKA 2X7OA 4DFZE 5T3QA 1M7QA 4L46A 4IM3A 3QWKA 4EQCA 4J8MA 4QMYA 4BCQA 4EUUA 4JG6A 3G6HA 1IEPA 1QPDA 3HRCA 1OZ1A 2VU3A 4GVJA 2FGIA 4EHVA 2YM6A 3HA8A 3P7BA 4IVBA 5IUHA 5BMMA 5AR8A 3P86A 3KMUA 4JG7A 3E5AA 1PMNA 2R64A 1V0PA 4FTTA 1H8FA 4G3EA 3RPSA 4BTFA 4E6CA 4I92A 3R7UA 5CYIA 2OFVA 1M2PA 4KINA 1PY5A 1F5QA 1NXKA 5LVLA 5CEKA 3AOXA 4NH1A 3BEGA 4MWHA 4PQNA 3U4UA 2QG7A 1AQ1A 5K9IA 3A7HA 5ANJA 4C7TA 2WU7A 5JZNA 5LMKA 1LEZA 5AUZA 2UV2A 2VTSA 4OTPA 5CVGA 4FV2A 4DH1A 4A9TA 1GZKA 4PDPA 2YIWA 2GTNA 1YHVA 2QURA 4QTDA 4XOYA 2HY81 4BCHA 4EKKA 2GCDA 3WZUA 2PE2A 4MBJA 4UZHA 3H9FA 1UU7A 3CP9A 1XH6A 2DQ7X 4NM5A 5CT7A 4R1VA 4KBKA 1G3NA 4EOMA 4MNEB 3G15A 2PL0A 3A7JA 4M67A 3UYSA 3DXPA 4O82A 5AP3A 4C58A 5LVPA 3F3WA 2C6KA 4F1OA 2F7XE 3W2QA 3M1SA 4NM3A 2VWXA 4E26A 2UW8A 3CE3A 4QMTA 3UIUA 4TN6A 4PTEA 5E8XA 2W5BA 4KWPA 3QD2B 5ACKA 3IW8A 3ZFXA 3LJ0A 2C5VA 1UNGA 3QD0A 5HCYA 4R3CA 1V0BA 3BV3A 5CX9A 2XIXA 2QD9A 3GXLA 4IIRA 2B9HA 4FTCA 4D0XA 4JDKA 5BMSA 4YJTA 4IMYA 2OJGA 3FHIA 4ASDA 4OAUC 2ITZA 3GU7A 4ACDA 3IQ7A 1BL7A 4IADA 1J3HA 4GVAA 3QALE 4TT7A 3JYAA 4QQJA 4NFMA 2GHMA 1KE5A 2XM9A 3A4OX 4QQCA 4QP4A 1ZLTA 5I9VA 2YM7A 2GQRA 4DFYA 2XIKA 3KRRA 1UNHA 4U43A 5TT7A 4AAAA 3BU3A 1W82A 3SGCA 4IVCA 4RBLA 3WOWA 3EMGA 4DHFA 4C0TA 4RX7A 5FLFA 2R3RA 5IEXA 2XBAA 3I0QA 3ODZX 4ACGA 4HNFA 2PE0A 5DG5A 3MGYA 2I40A 4WG3A 2FVDA 4WD5A 4XLVA 3HMNA 2F7EE 3MIYA 1KE9A 1YDSE 2WQNA 3N51A 4EOSA 2GS2A 2WMUA 5CZHA 3LLTA 4YJPA 4EONA 2QC6A 4O0RA 1K9AA 5FTQA 3QWJA 4S30A 1H1PA 4Y73A 2UZUE 2ZDTA 3NYNA 1XKKA 4G1WA 4JNWA 3UVQA 4BDJA 5IA3A 2C6LA 3GQIA 3L8XA 5IISA 2WFYA 4TWCA 3NUXA 4FX3A 4WSQA 3NLBA 5HG5A 1APME 3VF8A 3BQRA 3R0TA 4GV1A 3NVMB 5CAOA 3P08A 5AIRA 4CRLA 3P9JA 4CZYB 3TT0A 2G01A 3NSZA 2JBOA 3QRIA 5LXMA 1JBPE 2JFLA 4GUBA 3D2IA 5AV2A 1O6YA 2C1BA 2HENA 2Z2WA 4PNKA 2W9ZB 5JSMA 4FV6A 2BRHA 2YIRA 3D94A 4EKLA 1FGIA 2BVAA 2F57A 3LFFA 3NIEA 3R8PA 5FTOA 4IWPA 1OBDA 4FGBA 3BIZA 2JFMA 2EUFB 4S31A 4JQ8A 4C61A 4IX3A 4PP7A 3NIZA 3ZUVA 3CJFA 3BHUA 2J2IB 5FWKK 2EXMA 2IZUA 2X2LA 4ZSGA 3R1SA 5FDPA 2HWPA 3RNIA 4DFUA 3FUPA 4FC0A 4NT4A 4W9WA 1HCLA 2GNLA 2AC3A 3I6UA 4P90A 2XF0A 5HCXA 5HE1A 4AA0A 5HICA 4Y5QA 5M51A 3UOJA 3ATSA 3KXNA 4FEXA 1PF8A 2B7AA 3F9NA 2ZV8A 5IQHA 3VS5A 3PTGA 2OH0E 2PK9A 5FEQA 4WUAA 5AR7A 2XNGA 5E4HA 1U5QA 3R73A 2YCQA 3SXFA 2W1IA 3QA0A 4ITIA 4I5MA 1DAWA 3DQWA 3BRBA 4U81A 4XG3A 2XJ2A 3ZTXA 5FRIA 5CF4A 5HX6A 2X7GA 4RG0A 4OTRA 5AP5A 3E3BX 5CEMA 3FMEA 5IUIA 4BZOA 3LMIA 4J8NA 2BZKB 4I5PA 4Y72A 2QNJA 2PUIA 2Z7QA 4J71A 5AR4A 1JVPP 3S3IA 3RAHA 4K2RA 2ETMA 4QQ5A 3RWQA 4Y46A 3CLYA 4MQ1A 4C4JA 3LCDA 2FUMA 4O27B 2WTJA 4YC3A 4YO6A 4E4LA 3QC9A 4YTIA 2JEDA 3FMMA 4EK6A 4GYGA 4PL4A 1XO2B 5GHVA 3R9OA 4CQGA 3KVXA 3V01A 4IAKA 3Q2MA 3ACJA 2OGVA 4MVFA 4DT9A 1WMKA 2GTMA 3D0EA 4LGHA 2XIYA 2WTCA 5M53A 4HVIA 3OUKA 2ITQA 3R83A 5IUGA 3S4QA 3AMYA 1DI9A 2CGVA 4FTRA 2YM5A 4FZ7A 5GZ8A 2WTVA 2XYUA 3CTHA 4NSTA 1UU9A 2C3JA 3LJ2A 4G9CA 5DRBA 3THBA 2IVSA 4O2ZA 4ANMA 4GEOA 4C3FA 3KA0A 5GIOE 3A60A 3KF4A 4HZRA 4X0MA 4I23A 2J4ZA 4BTJA 3HZTA 3NUSA 2B55A 4R7BA 1F3MC 1Z9XA 3LXLA 4NTSA 1H1RA 1M7NA 4YLKA 2CLQA 5IKWA 1SVEA 2VTQA 2DYLA 1OPKA 4GS6A 3V5WA 3TJDA 5HQ0A 4C8BA 4R1YA 4O0YA 3HGKA 3MYGA 5BVKA 4DBNA 1ZOEA 4IFCA 4WHZA 5JMSA 4FEVA 3IW4A 5FM2A 4FE2A 2O0UA 2VWUA 2J0JA 5A9UA 3Q2JA 5KMLA 2BHHA 5IA1A 1FMOE 1ZARA 2NP8A 2ZV7A 3AT2A 5DT3A 3ZRMA 3NMUF 3TNPC 2CHLA 4IX6A 1M14A 3O71A 4EOKA 3B8QA 3R7EA 3PRIA 1H1WA 2WMVA 3MW1A 4FKLA 4ZOGA 4G3FA 2XP2A 1YOMA 4IAIA 5DWRA 2VO6A 2QO2A 3MY0A 3A7FA 2QHMA 4FEWA 3TDVA 4UY9A 5FQDC 5CNOA 4BI1A 1VYWA 2QR7A 4HCVA 4YBJA 1RDQE 4ANNA 3QHRA 3EQGA 3TG1A 4C38A 1JKTA 4EC9A 2C0TA 3PLSA 5HX8A 2C6IA 4CTBA 2PVJA 4F7SA 2P55A 2GS7A 3E88A 3I0OA 4ANLA 3KRJA 4WG4A 3OTVA 4XOZA 3RINA 4Q9ZA 1KE8A 2BRNA 4QTAA 3VBXA 4PDYA 3SHEA 2GMXA 3LVPA 3QX2A 4FK3A 4QPAA 5IMEA 4FV3A 3VUIA 3HAMA 3FPQA 3ZBXA 4FKTA 4XP0A 3AD6A 2CGWA 3PRFA 4J1RA 3T3VA 1MRYA 4BDIA 5HNIX 4BKYA 4X21A 3V5JA 2FH9A 5T68A 1YOLA 2O64A 2BMCA 3GBZA 1WBPA 4NWMA 4J98A 4RJ5A 2IW6A 3PA5A 4IZ7A 1MP8A 4I3ZA 4JS8A 2ITWA 3HNGA 3L9PA 3EZRA 4I20A 5EHOA 4F9BA 3GCVA 4G6NA 2WTKB 5BVEA 2BFXA 4HCUA 4C34A 4E8AA 4Z7GA 3LFQA 4FL2A 4ALUA 4EHGA 5KE0A 2OZOA 1S9JA 3Q04A 2Y9QA 4ZTSA 5AUWA 3FYKX 5A4TA 4FSMA 4YLLA 4K77A 4C4FA 4CV9A 2QU6A 2VGOA 5EW3A 4Y83A 3KREA 4FIJA 4BVUA 3L1SA 2VX0A 3PXQA 3AC4A 3H0ZA 4MXAA 4YJUA 3LQ5A 4HVGA 3Q4ZA 2RF9A 4FSWA 2WOUA 4FMQA 3S0OA 3HUBA 2WTWA 5C4LA 3L9NA 3F6XA 4ACMA 2KULA 2HYYA 1NY3A 2UZBA 4IB0A 4RRVA 4QMWA 3DPKA 1RQQA 5EQYA 5EG3A 5JFWA 3SW4A 1OL6A 3RKBA 2W9FB 3HUCA 3B8RA 4PPBA 2CPKE 1KE7A 1NVSA 4L52A 1Q3WA 2GNFA 2PUUA 2GHGA 3KN5A 4HGTA 5HO7A 4YTCA 4G3CA 4BHNA 4FYOA 2YCFA 3ZEWA 4BBEA 4EH6A 2PMLX 3MVMA 3QQLA 3GP0A 4P4CA 3TNHA 1OL7A 4ALWA 5EDPA 3KK8A 3HV3A 4FT7A 4YJNA 1JPAA 5JZJA 2X8DA 3DLSA 3CKWA 3PY1A 3P0MA 5ETCA 1GZ8A 2CNVA 2PY3A 2OU7A 2B9JA 3R2YA 4CFUA 2QOBA 4FKIA 3DKFA 4D4VA 1E1XA 3PJ8A 3UZPA 3TEIA 3OVVA 3QTZA 2E9UA 2P4IA 5KBQA 1XH9A 5CSXA 4XG9A 2J0KA 4BYJA 2JDRA 4E6DA 4UMTA 4I93A 4L9IA 1IR3A 4BZNA 5IDPA 2UVXA 1NVRA 2ZV9A 3ORPA 3KULA 5LCKA 5LWNA 3IW5A 4D0WA 5AIKA 3RCDA 5KMMA 2CCIA 2CNQA 4O83A 2WEVA 4YJSA 1OMWA 3IDCA 5DH3A 4CYIA 5AUUA 1ZOHA 3C0GA 5LARA 1OVEA 2IVUA 3GC9A 4R6VA 3KULB 4QYGA 4RQVA 1H01A 3DB6A 3LQ8A 4M14A 5CAPA 4RWKA 4AA5A 2BTRA 2PULA 5AA8A 5CWZA 3RAWA 4FKOA 1B39A 1TKIA 4O1OA 3FLQA 1QPCA 3NW7A 4YP8A 4DG2E 4XUFA 3MY5A 4PL3A 3DT1A 4PF4A 3UP7A 3TTJA 4EH2A 2VTMA 4PMMA 4TTHB 5EDRA 5BQ0A 3I7BA 4QO9A 3KCKA 3BU6A 1PXMA 4GW8A 1OIRA 3OZ6A 5ETFA 5GZAA 5KMNA 4J52A 5LOHA 1GNGA 2X1NA 1SM2A 4WBBB 4F9WA 2PZPA 3C4FA 1F0QA 4XG7A 3BHHA 4IZ5A 1WBSA 4Z3VA 1H24A 4FTNA 4AT5A 1T45A 2X4FA 4XG4A 1IA9A 3TXOA 3UVPA 3EFLA 3RJCA 4BGQA 2X9FA 3DFCB 4ZY4A 3RAIA 5J5TA 3UP2A 4QMNA 3MESA 3TI1A 4DEDA 3BU5A 5M56A 3UNZA 3DQXA 3O17A 2JD5A 4BDAA 4AN2A 3GCQA 1H1SA 3V5QA 5J7BA 4NUSA 3P5KA 5ANDA 4FT5A 1DM2A 2OIQA 4LOQA 3VJOA 3U55A 2PE1A 3LFBA 3ZM4A 5EYCA 5BX0A 4YZ9A 4PNIA 5HHWA 3EQBA 4HCTA 2CDZA 3ENMA 4LV5A 1WBNA 1ZYLA 3OP5A 3UG1A 3C4XA 3S2PA 1U5RA 3DDQA 5AUXA 5C8NA 3CGOA 4CV8A 3GC0A 4FUYA 4MK0A 4ZZMA 5FEEA 2IW8A 3NVKI 5H8EA 4ACHA 3ZHPC 4RPVA 5AUVA 4OAVB 3EKNA 4G6OA 3O0GA 4IC7A 4NTTA 4QP3A 4ITJA 3Q9ZA 4FNZA 3KMMA 2BAKA 3OY1A 4FOCA 2PVMA 4JL9A 2W17A 4RZVA 5HG8A 1JKLA 2YACA 3VRYA 4LUDA 4Q5HA 3HMMA 5K4IA 2G15A 3BLHA 3PSBA 2EU9A 2F2CB 1YI4A 4X2FA 5IQDA 2I1MA 4FTUA 4E5WA 3Q60A 1QPEA 1A9UA 5FTGA 1OBGA 3FDNA 4N6ZA 1DS5A 4IB5A 3W2SA 5I9XA 4FT3A 3UJGA 5IDNA 5HU3A 2OXDA 3ORKA 4H1JA 3SLSA 2QKRA 3D7TA 3FJQE 1FGKA 1JKSA 3BYSA 2RSVA 3OWJA 4V04A 3VBTA 4AS0A 2UW4A 4C57A 4RA5A 4MH7A 2QI8A 5JN2A 1JSTA 3D7TB 4KKHA 5AAGA 1NA7A 2GHLA 3FZPA 3OWKA 4AX8A 3CBLA 4FIGA 2PVLA 3R8UA 2VGPA 3KN6A 3CPCA 3EOCA 2H96A 3NDMA 4HYSA 3UO4A 3T9TA 4J99A 1Q3DA 4UZDA 2WEIA 3OF0A 4KIPA 4QT1A 3BWFA 2X2KA 3QF9A 1CKIA 2BZHB 5AM6A 5HBHA 2OF2A 5CAUA 4GIHA 3MH3A 1PKDA 3TIZA 3H0YA 5LCJA 1MRUA 3ALNA 5L8JA 1Q8TA 1MRVA 2WQBA 3MH0A 4RJ3A 3WF5A 5IA0A 3WYYA 1LEWA 3DTWA 3NYOA 5DA3A 3RVGA 3VQHA 4FICA 5L2WA 4IXPA 3GT8A 4RIOA 1YKRA 3FI4A 4TY1A 5IEVA 5EQPA 3OWLA 3C5UA 3PXFA 2J50A 4QYFA 4GT3A 4KUJA 2PPQA 5E92A 4BIEA 3JVRA 1ERKA 2C5YA 4B6LA 5JT2A 1FPUA 4H05A 3BELA 2UZOA 4E6QA 1PXNA 5DEWA 2YM4A 4S34A 4D1ZA 4XV3A 4RIXB 5ETAA 2HW7A 1CM8A 1PJKA 1YXUA 3DB8A 3OFMA 3BGQA 1J91A 3A62A 2BRBA 1OUKA 4CSVA 3CD3A 4RT7A 4UMRA 4FVQA 2B53A 5DVRA 1JSVA 4AGWA 2BIKB 3EN5A 3W18A 3CS9A 4NIFA 4P7EA 4AACA 5IG1A 4IWOA 1QMZA 5CSHA 4JBPA 2C4GA 1G8SA 4FTKA 4FG9A 2WQOA 4O0XA 4OT6A 3OT8A 5IH5A 2QOLA 3ZMMA 4DC2A 4Z55A 2XUUA 2JDTA 5H9BA 4W8EA 2X2MA 4DFXE 4EH3A 3ZLSA 4DA5A 2X0GA 4UWYA 4ZY6A 2CN8A 2XK4A 4IAAA 3R04A 5TF9A 3MFSA 5I9ZA 4QMQA 2BALA 5AM7A 3VC4A 1OKZA 4YJRA 2BDJA 3AT4A 4LMUA 5ANOA 5D41A 2VD5A 5KMKA 4M68A 4FIEA 4DH3A 3HYHA 4MF1A 3MV5A 4HYIA 4Z16A 2HW6A 4O0SA 2PZIA 4L67A 2B0QA 3GU8A 3BI6A 5D10A 1UKIA 4RFYA 4C62A 1PYXA 4NCTC 1BKXA 2PVYA 4F6WA 4EH7A 4M7IA 3RZFA 1YXSA 4M3QA 3PDTA 3R9RA 4O7TA 4JIKA 1WBVA 2QQ7A 4FKPA 5FXSA 5M07A 2PZ5A 3AC8A 3KXHA 3M42A 1XR1A 5C27A 4DF3A 3QD4A 4R7HA 2NRYA 4O21A 3OG7A 4IM0A 3I81A 2YABA 3JXWA 2IWIA 3AC3A 4M15A 4WBOA 3C5IA 5LVNA 4DBXA 4MD7E 1IA8A 5J1WA 3UO6A 4ZSEA 4PY1A 3PPZA 2VWZA 5EFQA 3RZBA 3DS6A 3GFEA 3GVUA 5ACBC 3LFNA 2QLQA 4D2VA 4ANQA 1R0EA 1SNUA 4U0IA 4FEQA 1YWNA 3FI2A 4IH8A 4N4SA 4NM7A 4JDIA 3CR0A 5CZIA 4ZAUA 3DZOA 2RG5A 2GNGA 2VNWA 3QKKA 4GUEA 3IG7A 4JR3A 3ZLXA 4ORKA 3U8WA 4F65A 4LGGA 4Y5HA 4QPSA 3RTPA 5AJQA 5I0BA 3P7AA 3V04A 5IF1A 3EQHA 5IU2A 3C7QA 2VO7A 5EI2A 3MB7A 3Q9XA 2W1CA 4I41A 4RIWA 3DBEA 4HZSA 2YIYA 5AA9A 4HJOA 5CVHA 4O7YA 2REIA 4FA2A 4FVPA 4FV9A 1YW2A 4S32A 3ZC6A 3FL5A 3UZRA 1ZY5A 4DCAA 4BZDA 1P5EA 4IWQA 2YEXA 3UDBA 3V8TA 4GYIA 4RIWB 2WMQA 3TL8A 1WBWA 4H1MA 4F6UA 1RE8A 2LGCA 1JWHA 3Q53A 1S9IA 4EHEA 4GJ2A 2PZYA 3EFWA 3VHKA 3P4KA 3FQHA 3DKCA 5ITAA 3QYZA 5CVFA 3R22A 3R71A 4IJPA 4NM0A 4H36A 2OJJA 2W5HA 4RLKA 4ANOA 1TVOA 1XJDA 3F2AA 3U6HA 3QTUA 1E9HA 3MJ2A 4KA3A 5TE0A 4DN5A 3LM0A 3TNQB 4EHZA 3F3UA 1FVVA 2UW7A 4YZDA 4F63A 3DBCA 5LWMA 4X3FC 3EN7A 1XBBA 3UVRA 4D55A 3O50A 4R7IA 3DA6A 3D4QA 3BYVA 5E7RA 5CANA 3BLQA 4O81A 4H39A 4I24A 3F3ZA 2QOFA 3FLWA 3HA6A 3HVCA 2W1FA 1G5SA 3VULA 3EIDA 4RQKA 5FBOA 2ZM4A 3ORLA 3PP1A 2C3KA 2XRUA 2C3LA 2W96B 2E9VA 4ZJJA 5IQIA 2VTTA 3RM6A 3ALOA 4BI0A 3MY1A 3PJ3A 2XM8A 4I5CA 4ZY5A 3HKOA 1MQBA 1OGUA 3ORMA 3PPJA 5I9YA 1UV5A 4L42A 4MNEA 4NL0A 3KXGA 5E91A 1W83A 3OY3A 3UIXA 5E9EA 2R3FA 3FPMA 2OLCA 5L3AA 5EW9A 1U46A 3BQCA 4G16A 2G2IA 4BCIA 3DCVA 4CGAA 5D12A 3LXNA 2OIDA 3SQQA 3TKIA 4M0YA 4B7TA 2Z60A 4BN1A 4EOOA 4GK4A 1CKPA 2GS6A 5FDXA 4F9AA 4I0RA 4L7FA 2VZ6A 3FC2A 3UC3A 5AADA 2VTHA 3ENHA 3G5DA 3PP0A 2W06A 5EM7A 4ENXA 3JR1A 3PE1A 1IRKA 3QLGA 2BCJA 4CYJA 2UZWE 4FIFA 2VTAA 3ZONA 4FI1A 5AWMA 3GCPA 3R9NA 4IB1A 5CAQA 1PXLA 4HVSA 3IK3A 3HP5A 2A4LA 4FNYA 4CCUA 1PMVA 1Q97A 3Q6UA 3PXZA 3E63A 4UN0C 3GUBA 3KVWA 5M06A 3QU0A 3QQHA 5EYKA 4FSYA 4EK4A 3G6GA 3ZSGA 2ITPA 5FUTA 1PXOA 3G9NA 1PW2A 2VWWA 4ZLOA 5DIAA 2HXQA 4EWHA 3OXZA 3QQJA 3EN9A 3HECA 4FYNA 1O6LA 5DYJA 4OGRA 3TM0A 3C0HA 2J0LA 3GU5A 3ORZA 3VRZA 1M2RA 4C4EA 3POZA 1DAYA 5HG9A 5CXZA 5JEBA 5K5NA 3R7YA 4JDHA 4F1TA 2NRUA 2ZAZA 5K5XA 1OIQA 4FTQA 4L8MA 1Y57A 4EH8A 4CRSA 2PUNA 5JFVA 3ZEPA 3FQEA 3FBVA 3TDWA 4QMLA 3V8WA 2BPMA 2GNIA 1KOBA 2OJIA 4FVRA 3NNWA 2PVFA 2YISA 3D7ZA 4QP1A 5TR6A 3W8QA 4C4GA 2WQEA 4XV9A 1Q4LA 1BUHA 4FV7A 4XHKB 4FTOA 4BCMA 3LCSA 3MPMA 4AA4A 5DEYA 5JKGA 4OTQA 2QG5A 4TYHA 2XIZA 3EQIA 4X2NA 5DFPA 2PTKA 4XRJA 4Y95A 4KB8A 4FV1A 4X2GA 2ZVAA 4CZUA 1ZZ2A 5DNRA 3RBWA 1AD5A 4TYHB 3QQFA 4IFGA 4ASEA 5HIEA 3RI1A 3HDNA 3QRKA 3NUAA 5E8YA 5EYDA 5FBNC 5I3RA 2BTSA 3OWPA 3UMWA 4F9CA 4ZSAA 5B0XA 2PZRA 3KL8A 5AR5A 4A9SA 2QOOA 3OXTA 2XVDA 3AC5A 4AF3A 4BDKA 4N70A 3V5TA 2OI4X 4IX5A 4AFJA 4ARKA 2XNPA 3RCJA 2W99B 3DXQA 4B0GA 4XLIA 3ATTA 4EOPA 1M17A 3HEGA 4HGLA 3GCSA 3L8SA 4TYIA 1ZMWA 2RFSA 5TOZA 3RAKA 5DGZA 4A9YA 5M4FA 4AUAA 1FQ1B 4EK3A 3I79A 3FZTA 3QUDA 4BDGA 1GZOA 3R9HA 5A6OA 4H3PA 4FTLA 2GNJA 3OCBA 2QVSE 4GU9A 1R39A 2J6MA 3P7CA 5JFSA 3C50A 5H3QA 4KRDA 3UOKA 4XBUA 2R9SA 1URCA 3FY0A 5M4IA 3PWDA 4J53A 3VBQA 3H30A 2E9OA 3TUCA 1BL6A 4YMJA 3EYGA 4FSRA 1ZXEA 3OD6X 2Y4IC 5FXQA 5IH6A 4R5SA 2XKEA 5AV4A 5LMBA 1TQPA 3T9IA 4JQEA 4KSQA 1FVTA 3CTQA 2JIUA 2XIRA 3BGZA 3E8DA 3KRWA 5L6OA 4DYMA 2VRXA 3ODYX 2XEYA 2BIYA 4FTAA 4YUQA 3U87A 1XH8A 3JUHA 2V55A 3NUUA 2HWOA 5E8UA 3BCEA 4D2PA 3U9NA 4RIYA 5A6NA 1BI7A 3F66A 3KMWA 4XBRA 4IVDA 2R3PA 3EFJA 2XNMA 4OUCA 2OSCA 1YVJA 2W5AA 3F69A 4M69B 1UKHA 3QA8A 5EHLA 2I7QA 3OS3A 3A7GA 4M0ZA 4XX9A 5HIDA 4RIYB 4FZAB 4FEUA 3ZRKA 5BVOA 1KV2A 3C4CA 3GNIB 3O96A 5GJGA 3SRVA 4AOTA 5J79A 4TYJA 4FV4A 3N4VA 3QTRA 3CC6A 4HOKA 4PTCA 3VNTA 4KIOA 1W8CA 4W4WA 2W1DA 4ZMEA 5C01A 3NUPA 2FA2A 3SRVB 3K2LA 3S95A 3MFTA 4BCGA 2PMOX 5HBJA 4V0GA 3ZU7A 2YLFA 4CVAA 5KO1A 2IJMA 4NU1A 4PPAA 2Y6OA 3G9LX 4KD1A 4UALA 2PVRA 4Z7HA 3VJNA 4FIHA 4RVLA 4XEYA 4J97A 2XBJA 4NFNA 4X2KA 2JGZA 2V7AA 4ZTMA 4R77A 2X7FA 4CFWA 3R00A 2H9VA 3HLLA 5K0KA 4NK9A 4QTEA 3F5XA 4V0GB 2XA4A 5M57A 5C03A 2X6DA 2YZLA 1KV1A 5M55A 5L2SA 3UODA 3ZC5A 3POOA 5LMKC 3UNKA 4N0SA 5L8KA 3PSDA 2PYWA 2JC6A 4IX4A 2BZJA 1IAJA 4WIHA 2EB3A 3ZH8A 2VO3A 3K5VA 5LJJA 4LL0A 2ZM1A 4OBPA 4F0FA 3C51A 1K2PA 3WZEA 3TUBA 5J9LA 4XJ0A 4I4FA 3WF7A 1A48A 2UW9A 1WBTA 4FTJA 3E93A 4JAJA 1PXKA 3BPRA 1WFCA 1PHKA 3VHEA 3PZEA 4YGAA 4RC4A 4ZTNA 3VS1A 3ZLYA 4CFNA 1NT2A 4K1BA 3TZ9A 1WVWA 1ZYJA 4EQUA 4YU2A 3PVWA 3ETAA 4XG6A 5GIPE 3PUPA 4JXFA 4DEEA 1OI9A 4X6QC 4YZNA 3DBFA 4DLIA 2O65A 3GC7A 5F9EA 1H1QA 2G2HA 4FL1A 2JKQA 4D1SA 3A7IA 3E62A 3R8MA 4RJ6A 4AZSA 3VS0A 3OOGA 1JSUA 3Q5ZA 2ITTA 2ZMDA 3R28A 1W98A 1J1BA 4F08A 4Y8DA 2R3NA 5J1VA 3OCSA 1OKVA 4FG7A 4QMPA 5E1SA 2WPAA 3SOAA 3UOLA 5CSPA 5HO6A 4BCJA 4F99A 3QZGA 2VTLA 3QRTA 3WARA 3MVHA 2QU5A 3F3TA 1DI8A 3FKLA 4AXAA 3E3PA 4YNOA 4E73A 3FAAA 4EWQA 3ITZA 4FSZA 5IQCA 2PMIA 2UVZA 5B2KA 3P1AA 4AGUA 3WYXA 4LRKA 3LZBA 2FSOX 3KEXA 1VR2A 2R3GA 2ITNA 3BYUA 2ITXA 1GZNA 3FC1X 1J1CA 4FV8A 4TYEA 4Z9LA 3B2WA 4GMYA 5CU4A 2C6DA 2VX1A 3P23A 5AV1A 2FSLX 1UU8A 5A14A 3I60A 4ASZA 4FSTA 2R3KA 4OR5A 2J0IA 2O5KA 2A0CX 2RL5A 3A8WA 4ASXA 4BGHA 3G90X 4FKVA 5HBEA 2DWBA 3NYXA 4YZBA 4C3RA 4UMPA 2F7ZE 2WMRA 5AP1A 5J9ZA 5GJFA 4CLIA 2V5QA 5BPYA 4PV0A 4O0VA 5CU6A 1Q41A 3UYTA 4MXOA 2XYNA 5HTCA 1WAKA 2R5TA 5JQ5A 5KX8A 3ANQA 1XQZA 4F09A 2YZAA 3HRFA 3Q4UA 5D9HA 4UXQA 3RP9A 4HGEA 2NO3A 2P33A 2Q83A 3SG9A 2J0MB 4P5ZA 3DAJA 3LCOA 3NW5A 5CT0A 4EUTA 2JBPA 1Y91A 3DJ7A 3D5UA 3HMPA 5J5SA 5CY3A 3VW8A 4AOJA 3AXWA 4UXLA 1Q61A 3MH1A 4GG7A 1WBOA 2EB2A 2FYSA 5E8SA 2WMTA 4APPA 5M08A 3R1QA 4WKQA 3PLAE 2UW6A 1BLXA 1OL5A 1OUYA 4FG8A 4DFLA 3GQLA 2C6EA 5JH6A 2CN5A 3VQUA 4AW2A 3DNEA 5JGAA 3FMDA 3OROA 4MBIA 4RVMA 3TUDA 2YDJA 3MA3A 2G2FA 4FV5A 3BYOA 5B7VA 3NW6A 3R8LA 4ANBA 4D4YA 3W16A 4C59A 4GIIA 4A4XA 5GZ9A 4I6HA 4DGOA 3OCTA 5G6VA 5C4KA 3FXXA 1Q5KA 3OW4A 4EEVA 4UV0A 4YJQA 4CFMA 3K54A 2WO6A 3DU8A 2OXYA 5EKNA 2YN8A 3W33A 3FKNA 2C5XA 4G3DA 5HLWA 3QCXA 3CQWA 5DI1A 4ZJIA 3C4WA 2R3OA 5FXRA 3COIA 3ZLWA 3PIXA 3DGKA 5ANGA 3KQ7A 4FZDB 3H3CA 3G0EA 3G0FA 4Q9SA 3KY2A 2OJFE 3E64A 2XNNA 3O51A 4FIIA 4NW5A 1ZYSA 4AN9A 4RC3A 5CXHA 2R7IA 4W4YA 3PJCA 4DFBA 3DDPA 4NCTA 4LMNA 3K3JA 1YWRA 4K9YA 2ETKA 3KCFA 4EOJA 4WSYA 4E1ZA 2E9NA 4D1XA 2ESMA 4L6QA 4F0GA 2O63A 4OT5A 4IBMA 3ZUUA 3ROCA 3BWJA 4JRNA 5AEPA 5AUYA 2JIVA 4RJ7A 4CG9A 4FF8A 1P14A 2I0VA 4XMOA 3FMLA 5HO8A 4BDDA 4GSBA 4ZJVA 2AC5A 5HTBA 3F2NA 4WOVA 5E8ZA 1YXTA 5BUIA 2RGPA 3RK5A 3TZ8A 2C6OA 4WRSA 5AP6A 4CNHA 4E20A 2CKQA 3CIKA 4RVTA 4EK8A 3FZOA 3QD3A 4MNFA 4HGSA 2P0CA 3L9LA 2XNOA 1V0OA 1ZYCA 3QQKA 3MFUA 3HV5A 1YOJA 3SXSA 2NPQA 5HLNA 5A4CA 5C8MA 1EH4A 3F61A 3VN9A 4FKUA 4DTAA 4AT3A 1YDTE 4U8ZA 4DTKA 4O2PA 1FOTA 1SYKA 2YFXA 4TZRA 4FKRA 4CKJA 4L3JA 3RPVA 4BTKA 5KUPA 5I3OA 2XH5A 3VW6A 5HVYA 2BAQA 3R21A 3OBJA 3ORXA 5JRSA 2BILB 4PL5A 2WMXA 2J90A 3NPCA 3ORIA 3LHJA 3D15A 4E6AA 4F70A 4UYNA 4XRLA 5EOBA 3ZFYA 4RZWA 3M11A 5J9YA 4GT5A 3B2TA 3CTJA 5IA4A 3KGAA 4TKSA 3ZS5A 2XNBA 4KABA 3U51A 4CCBA 3DAKA 2UZDA 2XNEA 4U79A 2EVAA 3MSSA 4RLLA 3D9VA 2JIIA 2ITOA 4RX8A 3R9DA 4BKZA 2UZNA 4FZFB 5L8LA 4XS2A 4BCNA 2IVVA 5AP2A 3QZFA 4AWIA 4QP7A 2YM8A 4H3QA 5HU9A 1WVYA 4FL3A 3COHA 2X6EA 3O8PA 3FLNC 3QXOA 3JY9A 4ZZOA 3DK3A 4PX6A 4U5JA 5CU2A 4JOAA 5ANIA 4LV8A 5AFVA 5FM3A 2HY0A 2WMWA 2AYPA 3RNYA 4O38A 2H6DA 1M2QA 4BWPA 3E7OA 4WNKA 4X3FB 1OPLA 2CKEA 2UW3A 3QRUA 4OTIA 5HG7A 4BDHA 5BVFA 1BYGA 1H0WA 3DJ6A 5JFXA 2WQMA 2YDKA 4BF2A 5I9WA 3CCNA 3Q96A 4FT0A 1YDRE 4IE9A 5FGKA 5HD4A 2OWBA 2XK7A 2W4KA 5ICPA 1J7LA 5C9CA 3L9MA 3AGLA 2FSTX 4D4SA 4ACCA 2ERZE 4RJ8A 4EL9A 2Z7SA 2JLDA 2OZAA 4UEUA 2X9EA 4R3PA 3TKUA 4FSNA 1W0XC 1GIHA 2WD1A 4U6RA 4ITHA 2W05A 2VWBA 2C47A 3R8VA 4RIXA 3V5PA 4QMXA 4G6LA 1JOWB 2VX3A 4EYMA 2Y8OA 2V22A 2OZAB 4QP2A 4YPSA 4TWNA 4CT1A 4HYHA 4BCPA 1MUOA 2VUWA 3NNVA 4QOXA 4IDTA 2R0IA 3WIKA 3CY3A 1BMKA 3CXWA 3SAYA 3LMHA 2WELA 4MXCA 3EN4A 4DGGA 3UPXA 4UYAA 3BEAA 4EOQA 4N57A 3EL8A 4CFFA 2DS1A 3OBGA 3Q52A 3ET7A 3QCSA 1O9UA 4A4OA 3JVSA 5DOSA 2OO8X 4JQ7A 2BRMA 4IAYA 5EYMA 4IC8A 2R3LA 4BY9E 2R3IA 4KIKA 1GJOA 2RFNA 3IW7A 4QRCA 4IAFA 3IGGA 3ZCLA 3EJ1A 4JAIA 3C1XA 2YITA 4KBCA 3FMNA 5KNJA 3DTCA 4BGGA 1ZY4A 3FMJA 4LOPA 4BL1A 4KIKB 3PVUA 5L6PA 2ERKA 1CMKE 1OIYA 4O6EA 1IAHA 4FKGA 2IO6A 3ANRA 4BR3A 2W4JA 2YCRA 3E8CA 1R3CA 3O8UA 4MXYA 3KKVA 4WRGA 4GCJA 3RPRA 4D2RA 2Q0NA 3HRBA 2WNTA 3GGFA 4HPUE 4CD0A 4EZ5A 2R0UA 3SX9A 5F1ZA 3T8OA 4C37A 4G9RA 3VUMA 3W10A 2HZ0A 5HVKA 1UWJA 3Q32A 3TZ7A 3WF9A 5IQEA 5EI6A 4R8QA 4O7WA 3FL4A 2OXXA 2QR8A 2V0DA 3NNXA 3OMVA 3QGYA 4DEGA 3KXMA 3VS2A 3HV4A 4YC8A 4DLJA 1XH7A 5K4JA 4OTWA 4FT9A 5HZNA 1IG1A 2VAGA 2VWIA 2X8IA 3AD5A 3R63A 4I6QA 2GNHA 4CMUA 2R3HA 4F4PA 2W1ZA 2XCKA 2XKDA 4HNIA 4W4VA 5DHJA 3RM7A 4AZFA 3QQUA 5B2MA 2YJSA 2GU8A 4R78A 4I1ZA 3I6WA 2NNWB 4MD8E 2XJ1A 5K3YA 4G5JA 1H08A 4YJVA 4BC6A 3ZUTA 3NGAA 4PUZA 4BDFA 4JR7A 2UUEA 3TCPA 3DKOA 3AC1A 3F2RA 3E7VA 5CQUA 4P2KA 2OICA 4CLJA 4NYEA 3OUNB 4RWJA 2QOQA 4YURA 3BBWA 5TKDA 2VTNA 2OK1A 3PA4A 3TJCA 1CSNA 5F4NA 4D58A 3V3VA 3QX4A 2XB7A 2XK3A 3W8LA 4LRMA 5KZIA 2I6LA 4U41A 3PY0A 1U59A 3RK9A 3EYHA 1U4DA 2OH4A 1LR4A 3MPTA 4DTBA 5J8IA 4ONAA 4QTBA 1TQIA 3I5ZA 3R7GA 4IEBA 4DINA 4Q5EA 5DBXA 2W7XA 4J95A 4DITA 1YI3A 4U42A 3ULIA 1G8AA 2BHEA 3G51A 4FR4A 1JNKA 1OPJA 4JBOA 4NKSA 2Y4IB 2UZLA 4DAWA 4EBVA 5BNJA 4I22A 2ZB0A 2HXLA 4F6SA 3FV8A 3NUYA 4USDA 5BVNA 5CEQA 3C13A 4D5KA 3PVGA 3SW7A 2HELA 3IOPA 3D5VA 4TNBA 5CEPA 2R2PA 4E4MA 3BLRA 2XEZA 3IGOA 4H3BA 4H58A 4Q2AA 5T6KA 2BAJA 4DH8A 5LVOA 1H0VA 3OC1A 2UW5A 3UC4A 1REKA 3DBQA 3MTFA 4ZMFA 1ZRZA 4ZXTA 3HL7A 2Z7LA 1REJA 3F5UA 4PWNA 1Y6AA 2G9XA 3UQGA 4AE9A 2WMAA 3LIJA 4L3PA 3QQGA 4CTCA 3RPYA 3VUHA 3ZYAA 3UMXA 4BKJA 3R7IA 3ZOSA 5FP5A 4AN3A 2PU8A 3II5A 5EH0A 4FZ6A 1KWPA 4JRVA 4HW7A 3VO3A 3BHYA 4ZSLA 5CEOA 2CCHA 4FKSA 4FNWA 3UGCA 3MFRA 3TTIA 1SVGA 4YHFA 5IA2A 3UQFA 4BCKA 5M4UA 3U6JA 2FO0A 2X39A 2VWYA 4EYJA 3LPBA 4JDJA 2C1AA 4A07A 4YO4A 3K3IA 1T46A 3LFDA 4DG3E 3TV4A 4XP3A 1OITA 1L3RE 2DUVA 2CKOA 2BRGA 3RWPA 2ONLC 1XWSA 3EKKA 4LQMA 5G1XA 3OCGA 5DLSA 4E5AX 4DG0E 2QOIA 4CMOA 2XJ0A 2ZDUA 2EXEA 4GJ3A 4U40A 5EOLA 4WG5A 3GFWA 3LCKA 4Y85A 3KF7A 4IM2A 4PRJA 4MBLA 5AX9A 1IASA 2JKOA 3LFEA 3ZSHA 4D4RA 5CEIA 4F7LA 3FQSA 4IZAA 2IVTA 1B6CB 4JIAA 1L8TA 3O7LB 1SNXA 4BWKA 3MVLA 1UA2A 3NAYA 3AQVA 2YAKA 4G5PA 3W32A 5AAEA 2R4BA 4TW9A 2J7TA 1CKJA 4XH6A 3QL8A 2IW9A 2W4OA 3DK7A 3UZTA 3WILA 4L3LA 4EOLA 3PWYA 4C2WA 3VS3A 4QNAA 1WCCA 3V5LA 2QO7A 1XH5A 3BBTB 5ANKA 4W9XA 3M2WA 4D2TA 4F7NA 3R7OA 3IOKA 3ZDUA 2VTPA 1YXVA 1KOAA 2XMYA 5IQFA 3LXKA 2RFEA 3A61A 3EFKA 1VEBA 4L43A 3P79A 4UWBA 4MYGA 4F0IA 4MKCA 4O22A 5LVMA 4L7SA 3F82A 3LXPA 4ZS0A 4FTMA 4AOIA 4DFNA 1XH4A 2X81A 3SVVA 5GINE 4L53A 3BV2A 3FLYA 3TN8A 3MDYA 3O8TA 1WVXA 4XNEA 4YTHA 3CQUA 5HTIA 4U3YA 2B9FA 4EBWA 2OKRA 3A2CA 4GL9A 4U9AA 4USFA 2IPXA 2V7OA 5L2IA 4K8AA 3WBLA 3ORTA 2R3JA 3GOKA 4E4XA 1YI6A 3UTOA 3VAPA 2IG7A 3WE4A 5HNGA 4QQTA 2F2UA 1OKWA 4PPCA 3FZRA 4WT6A 2VV9A 3VWAA 4A06A 4XV2A 5KMJA 3VIDA 3PXYA 2VNYA 4PMTA 2RFDA 3QTXA 2PHKA 3ZO1A 5EI8A 3F7WA 2I0EA 2Y6MA 3DOGA 2CSNA 2B4SB 4IANA 3FSKA 4RFZA 2BFYA 5E8VA 5CENA 3SC1A 2QLUA 1ZYDA 3PXKA 3QTWA 3VBWA 5IMXA 3W1FA 4K33A 3OXIA 1Q8YA 2OFUA 4DT8A 2OBJA 2R3QA 5AP7A 1FMKA 4D9UA 3LE6A 4IAZA 4CFVA 3DY7A 4CEGA 5J7HA 2ZV2A 2EWAA 1O6KA 1LUFA 4YR8A 4FTIA 4ZTHA 5JK3A 1JKKA 5HGIA 1YHSA 3G2FA 3W2RA 4CQEA 4O7NA 5HVJA 5A46A 4L44A 3UBDA 3EWHA 4B8MA 4G17A 4S2ZA 4O84A 3F7ZA 4ID7A 1M52A 3UPZA 3BZ3A 1W7HA 4GU6A 4LM5A 3LW0A 3WIGA 5JRQA 5CAVA 2UW0A 2ZMCA 4AW1A 4B9DA 3HMIA 3ORNA 5A3XA 4I4EA 3CD8A 3FZ1A 4JVGA 2WIHA 1Q62A 5ANEA 3C0IA 5M09A 3V6SA 2Y0AA 1E1VA 4ZTLA 3HDMA 2F49A 2JKMA 3BKBA 3EQDA 4BBMA 4DEHA 4MF0A 1YQJA 5D7VA 3UNJA 4DEIA 4XCUA 4M69A 4IVAA 1ZZLA 5BVWA 5A4LA 3QTQA 2VTOA 1OB3A 4QP9A 3WF8A 4E93A 4RWLA 4JJRA 4PMPA 5EM6A 4CZTA 1PKGA 2XRWA 3C9WA 4M97A 3W2OA 4BDEA 2E2BA 4PP9A 4AGDA 4E3CA 4MD9E 5CF8A 1XBCA 4IW0A 5CF5A 3N4UA 1OL2A 2P3GX 5BYLA 5CALA 1H26A 4F7JA 3NYVA 4O7LA 4B4LA 3FLZA 4EZ3A 5HI2A 5EQEA 4X3JA 5B2LA 1R78A 1Z5MA 5BUJA 3S1HA 4I0TA 3UO5A 4JT3A 4CKRA 1I09A 3FSFA 2C5NA 3TACA 4I94A 4LRJA 3DZQA 2PVNA 4A9RA 4BIBA 5JGDA 1LP4A 4UMQA 2C6TA 4IACA 4GK3A 3O7LD 4OBQA 4LFIA 3T3UA 4G2FA 5DPVA 3Q5IA 4TNDA 2VTIA 1W84A 5A54A 4RVKA 4DGMA 5C26A 3VF9A 4G34A 3AG9A 4LI5A 3ZDIA 1JQHA 4BCOA 4MEDA 3VUDA 4D5HA 3NR9A 4YNEA 4IWDA 1ZMVA 4ANSA 4PDSA 3ROYA 4NJDA 4GK2A 3RHKA 4BTMA 1URWA 4A7CA 1SZMA 2A1AB 2CLXA 3I7CA 4UWCA 3UE4A 2X4ZA 4TWPA 5I4NA 4QD6A 5L2QA 2C69A 1AGWA 3H10A 2C68A 2O8YA 4EH5A 1PYEA 3QCYA 1NVQA 4OTDA 5J87A 4M66A 4HVHA 5KKRB 2W1HA 3DLZA 3PVBA 4PTGA 3FWQA 5H8BA 3LMGA 3CQEA 4E4NA 4O7VA 4BBFA 1PRYA 2W1EA 4FSQA 4DCEA 3CSVA 3FMKA 2YLEA 3R1YA 4AZTA 3C4EA 4L01A 3PJ2A 3V8SA 5IEYA 5CU3A 3VS6A 4C2VA 4O7SA 2OW3A 5HESA 2X8EA 3DK6A 4QMOA 5EKOA 3F5PA 3AC2A 2V62A 3ID6C 4ZEGA 3NRMA 2WMBA 3KRXA 3FI8A 5GJDA 3F5GA 3JPVA 4C4HA 5BVDA 2YCSA 4WNPA 4O6LA 1LPUA 3PY3A 3QLFA 4QMUA 3Q3BA 4EORA 3Q4TA 1GAGA 4QMSA 5E8WA 3ZO4A 2IZTA 2WZJA 2Y7JA 3IDBA 4YLJA 5H2UA 4BHZA 4EZ7A 2XZSA 3OW3A 2F9GA 3F3VA 3QCQA 4BICA 4ZK5A 3VBYA 5EM5A 4ENYA 4EJNA 4UMUA 1ZAOA 3ZXTA 4D2SA 5IH4A 3BGPA 2WHBA 4MHAA 4EH9A 3EB0A 2PUPA 3HV7A 1Q8ZA 3QAME 5D7AA 4O96A 2ITUA 3JS2A 3UIMA 4DEBA 3V6RA 4RC2A 3DBDA 3KFAA 4WO5A 3W2CA 3LFSA 3LFAA 2YAAA 4II5A 5CNNA 4LOOA 2W0JA 4JI9A 4EH4A 4O0TA 1Z57A 3QRJA 3QTSA 1YRPA 3AT3A 2J5EA 5L2TA 2JAMA 3DV3A 1PMEA 4CG8A 3KC3A 4C33A 4I6BA 4I5HA 3GCUA 5LQFA 4WUNA 4F1MA 3PXRA 4AFEA 1OM1A 2YHVA 5J95A 5AV3A 3QTIA 1XBAA 3O2MA 3RGFA 5A4QA 2UZTA 4DEAA 4O0WA 3N9XA 3SD0A 2Z8CA 2IN6A 1KE6A 3LJ1A 3R01A 4MTAA 5DT4A 2CJMA 3ZSIA 3MTLA 5A4EA 1H27A 2WGJA 3Q9WA 5I5ZA 5FG8A 4AZVA 2HK5A 4YPDA 5L4QA 3MH2A 1Q24A 2BZIB 3D14A 3FY2A 4ZLZA 3QFVA 3FXWA 3W2PA 4D2WA 3U4WA 1RW8A 5F94A 4V01A 3NCGA 4MQ2A 4L68A 4LGDA 3R2BA 3EQCA 1P2AA 3TV6A 2RG6A 3DJ5A 1UU3A 4X2JA 5HNBA 3K5UA 4BB4A 2HCKA 4TL0A 1OIUA 5BUEA 2C0IA 4FV0A 4KKGA 5IA5A 3BX5A 3LLAA 3FZSA 5EM8A 3HAVA 2LAVA 5GNKA 4O7ZA 4FOBA 5BYYA 3FMHA 4J96A 2FSMX 4FKWA 4GFMA 4JX7A 2RIOA 3QUEA 4AU8A 3QC4A 4R5YA 5HLPA 4QMVA 2JDSA 4QNYA 1K3AA 4O0UA 3SA0A 4K6ZA 4L00A 1TQMA 3A4PA 4M12A 3FYJX 1VZOA 1A06A 2ITYA 3GENA 3LFCA 1X8BA 4JG8A 4O1PA 1U54A 3WZDA 3U6IA 2CKPA 4GKHA 3CJGA 4F64A 5DR6A 3QHWA 5BYZA 3IKAA 3D5XA 5CTPA 3WZKA 4NEUA 1J7UA 5CSWA 3E92A 4U80A 4UB7A 4A4LA 3NCZA 1SVHA 4EOIA 2P2HA 1U54B 4GRBA 5CF6A 3GU6A 2WU6A 1HCKA 3MN3A 2C3IB 3PIZA 3ACKA 3LAUA 3FKOA 5AAFA 1GIIA 4JX3A 5HD7A 3REPA 2XCHA 3FE3A 4GT4A 4PMSA 3U9CA 5IZFA 4I21A 3FXZA 4FGRA 3GI3A 4FODA 3VBVA 3AGMA 4W4XA 3SKCA 3ULZA 5AX3A 4RJ4A 4XG8A 3RALA 4AW5A 4X7QA 3MA6A 2WAJA 4GFOA 3TV7A 1NW1A 4QMZA 2ZOQA 4WNOA 1VYZA 4KSPA 2QHNA 4MXXA 1J7IA 3GB2A 5ETIA 4KS8A 3IW6A 4QYEA 3ZXZA 1OKYA 2BKZA 2C6MA 2E9PA 2OIBA 3D83A 3PE2A 5AP0A 4TPTA 3COKA 3U54A 1Q8UA 4AQCA 2C0OA 4EC8A 2QKWB 2GPHA 4YHJA 3Q6WA 1QCFA 4OW8A 4B99A 5KKRC 2JAVA 1XHAA 3BE9A 4YZCA 3TKHA 4NZWB 5HKMA 1QL6A 2BDWA 3EQPA 3QBNA 1PXIA 3KK9A 2YA9A 1Y6BA 4S33A 4ZTQA 3OHTA 2VWVA 5CSVA 4BCFA 3FI3A 3PA3A 4FUXA 2C5OA 3NZ0A 4GKIA 4IB3A 4RWIA 3R6XA 2RKUA 2WMSA 2ACXA 5HE2A 4AT4A 4BIDA 4CMTA 3AMAA 1P4OA 3P78A 5JQ8A 5IQGA 2GDOA 3FHRA 3HMOA 4D28A 2ETRA 3EN6A 3Q9YA 4ALVA 3MS9A 4CT2A 3GU4A 5TO8A 3SV0A 3WZJA 4YHTA 3E87A 4YZMA 3D5WA 1SMHA 5AUTA 4MWIA 5H8GA 4OTGA 1Y8GA 1ZOGA 2PWLA 4YSMA 5C1QB 2CGXA 2YIXA 2OF4A 3RHXA 3IDPA 3UOHA 2H34A 4QTCA 3VUTA 4GG5A 4E7WA 3R8ZA 2B52A 5KMOA 3ZO3A 4ERWA 3RPOA 1ATPE 5CASA 4D9TA 5CS6A 3DXNA 2YIQA 3SOCA 2YM3A 3IECA 4QP6A 4KIQA 4TYGA 2QONA 4O7RA 4U7ZA 4GFGA 2FB8A 2HZ4A 3TNWA 3PZHA 3SXRA 5EDQA 5CU0A 3R30A 1UVRA 2A2AA 3NWWA 2CGUA 5HCZA 2VTRA 3LM5A 1HOWA 5IQAA 5KBRA 4X3FA 4BRXA 1UWHA 1OL1A 5AR3A 5KCVA 4FBXA 4DH7A 2ZB1A 2C30A 2O3PA 1B38A 1H00A 3CPBA 4JLCA 5DR9A 4YJOA 2IZSA 3UG2A 5K0XA 2UZEA 4U45A 5HIBA 5C8KA 4DE4A 2ZJWA 3PG3A 1QPJA 3HP2A 4MXZA 4M84A 4ZP5A 3KB7A 4IZYA 3QYWA 3OTUA 5I9UA 4QYHA 2I0YA 1Q99A 2IZRA 2YERA 2WTKC 3H9OA 3HV6A 4K11A 3NUNA 4LUEA 4RFMA 3VVHA 3FEGA 2PMNX 3JY0A 2YWPA 3MI9A 1Q8WA 3SDJA 3LCTA 3Q4CA 3QKLA
chains in the Genus database with same CATH superfamily
2WTIA 2ITVA 3DAEA 3UIBA 2WIPA 2GSFA 2YJRA 3OT3A 3LOKA 3R02A 3QUPA 4ZLYA 1R0PA 5LMAA 5KHXA 3EZVA 2QOCA 4TRLA 1RJBA 3H4JA 3EH9A 5HE0A 4RMZA 5HOAA 2A27A 1JLUE 3KRLA 3PPKA 3QXPA 2XKCA 5D11A 4JBVA 2ONLA 2JITA 4AG8A 4GH2A 4F9YA 1ZMUA 1CTPE 2R3MA 1WZYA 4N6YA 3ELJA 2WOTA 1BI8A 2BR1A 3DKGA 4KBAA 4YBKA 4RX5A 3UDTA 3C4ZA 3MPAA 4J7BA 4ZS4A 4U44A 1V1KA 2HZIA 4OTHA 5DE2A 5DN3A 5M44A 2BUJA 3ZRLA 5DT0A 5HORA 4BWXA 1GOLA 2F4JA 3GOPA 4U3ZA 5EW8A 5FD2A 1YHWA 5AV0A 2PSQA 4EK5A 2ZM3A 3H9RA 2HOGA 5HE3A 4UX9A 4QPMA 3W55A 3N4TA 3WE8A 3D2KA 1OECA 3NX8A 4U97A 3A8XA 4O86A 3CY2A 3O23A 4MAOA 5F20A 3R1NA 2UZVA 4FK6A 3PYYA 3MVJA 2G1TA 2Z7RA 3ZO2A 2GFCA 3FLSA 4TXCA 2XK6A 4AE6A 1KSWA 3PJ1A 3I1AA 5D1JA 1Y8YA 3KXZA 4DHZA 1R1WA 5DRDA 2KTYA 1H4LA 3GC8A 3KXXA 1JAMA 3EQRA 3NNUA 2EXCX 4C4IA 3OEFX 3LQ3A 2O2UA 2XK8A 4FNXA 2PVHA 1P4FA 3V51A 1KUTA 3SG8A 3ZZEA 3S00A 5CI6A 4BFMA 3DNDA 3BHTA 3ERKA 1FVRA 4RGJA 2VN9A 4HPTE 4XP2A 1VJYA 4EI4A 3CKXA 4ZIMA 4C36A 3ZFMA 1UNLA 2PVKA 1MQ4A 3GEQA 2SRCA 4IDVA 2GQSA 4NJ3A 3ZM9A 5CQWA 1BX6A 4XYFA 4NIFB 3BE2A 3IS5A 4AZEA 3PG1A 4JBQA 4DGLC 2XS0A 3KU2A 4MX9A 3VUGA 4ERKA 2QCSA 5EHYA 5KMIA 2GQGA 4DHJA 4UBAA 4E5BA 4DH5A 1PXPA 1H28A 4KS7A 4LL5A 1PXJA 4BI2A 3G33A 4KNBA 4O91A 1CDKA 2GFSA 2QOHA 3COMA 4B8LA 2J5FA 2ZYBA 3IPHA 4ZTRA 3E8EA 4AGCA 3TNIA 5DMZA 2WKMA 1FBNA 4C35A 3QGWA 2P2IA 4I6LA 3BHVA 3WF6A 4NW6A 3NEWA 5AMNA 1GY3A 2R7BA 3DFAA 4EQMA 5IPJA 2W1GA 4G31A 3IO7A 4R3RA 3E8NA 4XV1A 2WTDA 5FEDA 2CNUA 1GIJA 2QO9A 4BDBA 3VS7A 4FKQA 3AD4A 4MCVA 4HVDA 2WXVA 4YTFA 3UDZA 1PMUA 3ZBFA 3MB6A 2AUHA 3CGFA 3IONA 4L45A 2XK9A 4IQ6A 3VUKA 2XKFA 2CMWA 2WB8A 3OOMA 4KKEA 4RSSA 3TWJA 2OG8A 4M8TA 3VS4A 4BDCA 1ND4A 3EQFA 2I0HA 4CFXA 3AMBA 2VO0A 2H8HA 1YWVA 3A99A 2HIWA 2Y4PA 3LKMA 4W8DA 4CKIA 5EK7A 2Z02A 4WNMA 3TIYA 4TWOA 4AZWA 2BDFA 4KRCA 4M13A 5F95A 3UQCA 1H25A 5JGBA 3ZZWA 4AW0A 3QKMA 5KZ0A 5DR2A 5AR2A 2J51A 3RK7A 2A19B 4X6RA 4OTFA 5AP4A 5FP6A 4YSJA 5KHWA 4APCA 3OEZA 3MBLA 3HX4A 2UVYA 3I5NA 3L8PA 4HYUA 4RA4A 5E8TA 4BYIA 4ZZNA 2Q0BA 4OBOA 4K18A 4IJ9A 3PSCA 5CI7A 4FSUA 3MWUA 4QP8A 5CLPA 2YWVA 3CEKA 1ZWSA 3QZIA 2B9IA 4LYNA 1STCE 4P5QA 4PDOA 4EJ7A 4NKAA 3PFQA 3PIYA 4QMMA 4WA9A 3EL7A 1H07A 2HAKA 5E90A 4LG4A 2AEGA 4I0SA 2J9MA 3EHAA 3R7VA 2BROA 2HZNA 4G3GA 4I6FA 1I44A 5HEZA 2BKKA 5IQBA 3RMFA 4OLIA 4C02A 2B54A 4AP7A 4KAOA 5L6WL 1FINA 5M4CA 2JKKA 4XG2A 3MIAA 4K0YA 1YXXA 3TZMA 3F88A 4ZSJA 2JDOA 2JDVA 4V05A 5E1EA 4YC6A 3NAXA 2QODA 3WI6A 4IHPA 2VTJA 2B1PA 4A9UA 3QZHA 4FKJA 2YDIA 3L8VA 3BYMA 3MJ1A 4QYYA 4RX9A 3I4BA 4DGNA 4USEA 4CXAA 2OJ9A 4C3PA 3NS9A 2QOKA 2X7OA 4DFZE 5T3QA 1M7QA 4L46A 4IM3A 3QWKA 4EQCA 4J8MA 4QMYA 4BCQA 4EUUA 4JG6A 3G6HA 1IEPA 1QPDA 3HRCA 1OZ1A 2VU3A 4GVJA 2FGIA 4EHVA 2YM6A 3HA8A 3P7BA 4IVBA 5IUHA 5BMMA 5AR8A 3P86A 3KMUA 4JG7A 3E5AA 1PMNA 2R64A 1V0PA 4FTTA 1H8FA 4G3EA 3RPSA 4BTFA 4E6CA 4I92A 3R7UA 5CYIA 2OFVA 1M2PA 4KINA 1PY5A 1F5QA 1NXKA 5LVLA 5CEKA 3AOXA 4NH1A 3BEGA 4MWHA 4PQNA 3U4UA 2QG7A 1AQ1A 5K9IA 3A7HA 1XMLA 5ANJA 4C7TA 2WU7A 5JZNA 5LMKA 1LEZA 5AUZA 2UV2A 2IF8A 2VTSA 4OTPA 5CVGA 4FV2A 4DH1A 4A9TA 1GZKA 4PDPA 2YIWA 2GTNA 3TMOA 1YHVA 2QURA 4QTDA 4XOYA 2HY81 4BCHA 4EKKA 2GCDA 3WZUA 2PE2A 4MBJA 4UZHA 3H9FA 1UU7A 3CP9A 1XH6A 2DQ7X 4NM5A 5CT7A 4R1VA 4KBKA 1G3NA 4EOMA 4MNEB 3G15A 2PL0A 3A7JA 4M67A 3UYSA 3DXPA 4O82A 5AP3A 4C58A 5LVPA 3F3WA 2C6KA 4F1OA 2F7XE 3W2QA 3M1SA 4NM3A 2VWXA 4E26A 2UW8A 3CE3A 4QMTA 3UIUA 4TN6A 3PFYA 4PTEA 5E8XA 2W5BA 4KWPA 3QD2B 5ACKA 3IW8A 3ZFXA 3LJ0A 2C5VA 1UNGA 3QD0A 5HCYA 4R3CA 1V0BA 3BV3A 5CX9A 2XIXA 2QD9A 3GXLA 4IIRA 2B9HA 4FTCA 4D0XA 4JDKA 5BMSA 4YJTA 4IMYA 2OJGA 3FHIA 4ASDA 4OAUC 2ITZA 3GU7A 4ACDA 3IQ7A 1BL7A 4IADA 1J3HA 4GVAA 3QALE 4TT7A 3JYAA 4QQJA 4NFMA 2GHMA 1KE5A 2XM9A 3A4OX 4QQCA 4QP4A 1ZLTA 5I9VA 2YM7A 2GQRA 4DFYA 2XIKA 3KRRA 1UNHA 4U43A 5TT7A 4AAAA 3BU3A 1W82A 3SGCA 4IVCA 4RBLA 3WOWA 3EMGA 4DHFA 4C0TA 4RX7A 5FLFA 2R3RA 5IEXA 2XBAA 3I0QA 3ODZX 4ACGA 4HNFA 2PE0A 5DG5A 3MGYA 2I40A 4WG3A 2FVDA 4WD5A 4XLVA 3HMNA 2F7EE 3MIYA 1KE9A 1YDSE 2WQNA 3N51A 4EOSA 2GS2A 2WMUA 5CZHA 3LLTA 4YJPA 4EONA 2QC6A 4O0RA 1K9AA 5FTQA 3QWJA 4S30A 1H1PA 4Y73A 2UZUE 2ZDTA 3NYNA 1XKKA 4G1WA 4JNWA 3UVQA 4BDJA 5IA3A 2C6LA 3GQIA 3L8XA 5IISA 2WFYA 4TWCA 3NUXA 4FX3A 4WSQA 3NLBA 5HG5A 1APME 3VF8A 3BQRA 3R0TA 4GV1A 3NVMB 5CAOA 3P08A 5AIRA 4CRLA 3P9JA 4CZYB 3TT0A 2G01A 3NSZA 2JBOA 3QRIA 5LXMA 1JBPE 2JFLA 4GUBA 3D2IA 5AV2A 1O6YA 2C1BA 2HENA 2Z2WA 4PNKA 2W9ZB 5JSMA 4FV6A 2BRHA 2YIRA 3D94A 4EKLA 1FGIA 2BVAA 2F57A 3LFFA 3NIEA 3R8PA 5FTOA 4IWPA 1OBDA 4FGBA 3BIZA 2JFMA 2EUFB 4S31A 4JQ8A 4C61A 4IX3A 4PP7A 3NIZA 3ZUVA 3CJFA 3BHUA 2J2IB 5FWKK 2EXMA 2IZUA 2X2LA 4ZSGA 3R1SA 5FDPA 2HWPA 3RNIA 4DFUA 3FUPA 4FC0A 4NT4A 4W9WA 1HCLA 2GNLA 2AC3A 3I6UA 4P90A 2XF0A 5HCXA 5HE1A 4AA0A 5HICA 4Y5QA 5M51A 3UOJA 3ATSA 3KXNA 4FEXA 1PF8A 2B7AA 3F9NA 2ZV8A 5IQHA 3VS5A 3PTGA 2OH0E 2PK9A 5FEQA 4WUAA 5AR7A 2XNGA 5E4HA 1U5QA 3R73A 2YCQA 3SXFA 2W1IA 3QA0A 4ITIA 4I5MA 1DAWA 3DQWA 3BRBA 4U81A 4XG3A 2XJ2A 3ZTXA 5FRIA 5CF4A 5HX6A 2X7GA 4RG0A 4LV7A 4OTRA 5AP5A 3E3BX 5CEMA 3FMEA 5IUIA 4BZOA 3LMIA 4J8NA 2BZKB 4I5PA 4Y72A 2QNJA 2PUIA 2Z7QA 4J71A 5AR4A 1JVPP 3S3IA 3RAHA 4K2RA 2ETMA 4QQ5A 3RWQA 4Y46A 3CLYA 4MQ1A 4C4JA 3LCDA 2FUMA 4O27B 2WTJA 4YC3A 4YO6A 4E4LA 3QC9A 4YTIA 2JEDA 3FMMA 4EK6A 4GYGA 4PL4A 1XO2B 5GHVA 3R9OA 4CQGA 3KVXA 3V01A 4IAKA 3Q2MA 3ACJA 2OGVA 4MVFA 4DT9A 1WMKA 2GTMA 3D0EA 4LGHA 2XIYA 2WTCA 5M53A 4HVIA 3OUKA 2ITQA 3R83A 5IUGA 3S4QA 3AMYA 1DI9A 2CGVA 4FTRA 2YM5A 4FZ7A 5GZ8A 2WTVA 2XYUA 3CTHA 4NSTA 1UU9A 2C3JA 3LJ2A 4G9CA 5DRBA 3THBA 2IVSA 4O2ZA 4ANMA 4GEOA 4C3FA 3KA0A 5GIOE 3A60A 3KF4A 4HZRA 4X0MA 4I23A 2J4ZA 3ML1A 4BTJA 3HZTA 3NUSA 2B55A 4R7BA 1F3MC 1Z9XA 3LXLA 4NTSA 1H1RA 1M7NA 4YLKA 2CLQA 5IKWA 1SVEA 2VTQA 2DYLA 1OPKA 4GS6A 3V5WA 5BV3A 3TJDA 5HQ0A 4C8BA 4R1YA 4O0YA 3HGKA 3MYGA 5BVKA 4DBNA 1ZOEA 4IFCA 4WHZA 5JMSA 4FEVA 3IW4A 5FM2A 2XAMA 4FE2A 2O0UA 4O4FA 2VWUA 2J0JA 5A9UA 3Q2JA 5KMLA 2BHHA 5IA1A 1FMOE 1ZARA 2NP8A 2ZV7A 3AT2A 5DT3A 3ZRMA 3NMUF 3TNPC 2CHLA 4IX6A 1M14A 3O71A 4EOKA 3B8QA 3R7EA 3PRIA 1H1WA 2WMVA 3MW1A 4FKLA 4ZOGA 4G3FA 2XP2A 1YOMA 4IAIA 5DWRA 2VO6A 2QO2A 3MY0A 3A7FA 2QHMA 4FEWA 3TDVA 4UY9A 5FQDC 5CNOA 4BI1A 1VYWA 2QR7A 4HCVA 4YBJA 1RDQE 4ANNA 3QHRA 1ST4A 3EQGA 3TG1A 4C38A 1JKTA 4EC9A 2C0TA 3PLSA 5HX8A 2C6IA 4CTBA 2PVJA 4F7SA 2P55A 2GS7A 3E88A 3I0OA 4ANLA 3KRJA 4WG4A 3OTVA 4AAYA 4XOZA 3RINA 4Q9ZA 1KE8A 2BRNA 4QTAA 3VBXA 4PDYA 3SHEA 2GMXA 3LVPA 3QX2A 4FK3A 4QPAA 5IMEA 4FV3A 1G8KA 3VUIA 3HAMA 3FPQA 3ZBXA 4FKTA 4XP0A 3AD6A 2CGWA 1W2FA 3PRFA 4J1RA 1MRYA 3T3VA 4BDIA 4BKYA 5HNIX 4X21A 3V5JA 2FH9A 5T68A 1YOLA 4F78A 2O64A 2BMCA 3GBZA 1WBPA 4NWMA 4J98A 4RJ5A 2IW6A 3PA5A 4IZ7A 1MP8A 4I3ZA 4JS8A 2ITWA 3HNGA 3L9PA 3EZRA 4I20A 5EHOA 4F9BA 3GCVA 4G6NA 2WTKB 5BVEA 2BFXA 4HCUA 4C34A 4E8AA 4Z7GA 3LFQA 4FL2A 4ALUA 4EHGA 5KE0A 2OZOA 1S9JA 3Q04A 2Y9QA 4ZTSA 5AUWA 3FYKX 5A4TA 4FSMA 4YLLA 4K77A 4C4FA 4CV9A 2QU6A 2VGOA 5EW3A 4Y83A 3KREA 4FIJA 4BVUA 3L1SA 2VX0A 3PXQA 3AC4A 3H0ZA 4MXAA 4YJUA 3LQ5A 4HVGA 3Q4ZA 2RF9A 4FSWA 2WOUA 4FMQA 3S0OA 3HUBA 2WTWA 5C4LA 3L9NA 3F6XA 4ACMA 2KULA 2HYYA 1NY3A 2UZBA 4IB0A 4RRVA 4QMWA 3DPKA 1RQQA 5EQYA 5EG3A 5JFWA 3SW4A 1OL6A 3RKBA 2W9FB 3HUCA 3B8RA 4PPBA 2CPKE 1KE7A 1NVSA 4L52A 1Q3WA 2GNFA 2PUUA 2GHGA 3KN5A 4HGTA 5HO7A 4YTCA 4G3CA 4BHNA 4FYOA 2YCFA 3ZEWA 4BBEA 4EH6A 2PMLX 3MVMA 3QQLA 3GP0A 4P4CA 3TNHA 1OL7A 4ALWA 5EDPA 3KK8A 3HV3A 4FT7A 4YJNA 1JPAA 5JZJA 2X8DA 3DLSA 3CKWA 3PY1A 3P0MA 5ETCA 1GZ8A 2CNVA 2PY3A 2OU7A 2B9JA 3R2YA 4CFUA 2QOBA 4FKIA 3DKFA 4D4VA 1E1XA 3PJ8A 3UZPA 3TEIA 3OVVA 3QTZA 2E9UA 2P4IA 5KBQA 1XH9A 5CSXA 4XG9A 2J0KA 4BYJA 2JDRA 4E6DA 4UMTA 4I93A 4L9IA 1IR3A 4BZNA 5IDPA 2UVXA 1NVRA 2ZV9A 3ORPA 3KULA 5LCKA 5LWNA 3IW5A 4D0WA 5AIKA 3RCDA 5KMMA 2CCIA 2CNQA 4O83A 2WEVA 4YJSA 1OMWA 3IDCA 5DH3A 4CYIA 5AUUA 1ZOHA 3C0GA 5LARA 1OVEA 2IVUA 3GC9A 4AXEA 4R6VA 3NFFB 3KULB 4QYGA 4RQVA 1H01A 3DB6A 3LQ8A 4M14A 5CAPA 4RWKA 4AA5A 2BTRA 2PULA 5AA8A 5CWZA 3RAWA 4FKOA 1B39A 1TKIA 4O1OA 1G8JA 3FLQA 1QPCA 3NW7A 4YP8A 4DG2E 4XUFA 3MY5A 4PL3A 3DT1A 4PF4A 3UP7A 3TTJA 4EH2A 2VTMA 4PMMA 4TTHB 5EDRA 5BQ0A 3I7BA 4QO9A 3KCKA 3BU6A 1PXMA 4GW8A 1OIRA 3OZ6A 5ETFA 5GZAA 5KMNA 4J52A 5LOHA 1GNGA 2X1NA 1SM2A 4FJVA 4WBBB 4F9WA 2PZPA 3C4FA 1F0QA 4XG7A 3BHHA 4IZ5A 1WBSA 4Z3VA 1H24A 4FTNA 4AT5A 1T45A 2X4FA 4XG4A 1IA9A 3TXOA 3UVPA 3EFLA 3RJCA 4BGQA 2X9FA 3DFCB 4ZY4A 3RAIA 5J5TA 3UP2A 4QMNA 3MESA 3W0NA 3TI1A 4DEDA 3BU5A 5M56A 3UNZA 3DQXA 3O17A 2JD5A 4BDAA 4AN2A 3GCQA 1H1SA 3V5QA 5J7BA 4NUSA 3P5KA 5ANDA 4FT5A 1DM2A 2OIQA 4LOQA 3VJOA 3U55A 2PE1A 3LFBA 3ZM4A 5EYCA 5BX0A 4YZ9A 4PNIA 5HHWA 3EQBA 4HCTA 2CDZA 3ENMA 4LV5A 1WBNA 1ZYLA 3OP5A 3UG1A 3C4XA 3S2PA 1U5RA 3DDQA 5AUXA 5C8NA 3CGOA 4CV8A 3GC0A 4FUYA 4MK0A 4ZZMA 5FEEA 2IW8A 3NVKI 5H8EA 4ACHA 3ZHPC 4RPVA 5AUVA 4OAVB 3EKNA 4G6OA 3O0GA 4IC7A 4NTTA 4QP3A 4ITJA 3Q9ZA 4FNZA 3KMMA 2BAKA 3OY1A 4FOCA 2PVMA 4JL9A 2W17A 4RZVA 5HG8A 3AKJA 4AXCA 1JKLA 2YACA 3VRYA 4LUDA 4Q5HA 3HMMA 5K4IA 2G15A 3BLHA 4O4DA 3PSBA 2EU9A 2F2CB 1YI4A 4X2FA 5IQDA 2I1MA 4FTUA 4E5WA 3Q60A 1QPEA 1A9UA 5FTGA 1OBGA 3FDNA 4N6ZA 1DS5A 4IB5A 3W2SA 5I9XA 4FT3A 3UJGA 5IDNA 5HU3A 2OXDA 3ORKA 4QDEA 4H1JA 4O4BB 3SLSA 2QKRA 3D7TA 3FJQE 1FGKA 1JKSA 3BYSA 2RSVA 3OWJA 4V04A 3VBTA 4AS0A 2UW4A 4C57A 4RA5A 4MH7A 2QI8A 3W0OA 5JN2A 1JSTA 3D7TB 4KKHA 5AAGA 1NA7A 2GHLA 3FZPA 3OWKA 4AX8A 3CBLA 4FIGA 2PVLA 3R8UA 2VGPA 3KN6A 3CPCA 3EOCA 2H96A 3NDMA 4HYSA 3UO4A 3T9TA 4J99A 1Q3DA 4UZDA 2WEIA 3OF0A 4KIPA 4QT1A 3BWFA 2X2KA 3QF9A 1CKIA 2BZHB 5AM6A 5HBHA 2OF2A 5CAUA 4GIHA 3MH3A 1PKDA 3TIZA 3H0YA 5LCJA 1MRUA 3ALNA 5L8JA 1Q8TA 1MRVA 2WQBA 3MH0A 4RJ3A 3WF5A 5IA0A 3WYYA 1LEWA 3DTWA 3NYOA 5DA3A 3RVGA 3VQHA 4FICA 5L2WA 4IXPA 3GT8A 4RIOA 1YKRA 3FI4A 4TY1A 5IEVA 5EQPA 3OWLA 3C5UA 3PXFA 2J50A 4QYFA 4GT3A 4KUJA 2PPQA 4AXDA 5E92A 4BIEA 3JVRA 1ERKA 2C5YA 4B6LA 5JT2A 1FPUA 4H05A 3BELA 2UZOA 4E6QA 1PXNA 5DEWA 2YM4A 4S34A 4D1ZA 1ST0A 4XV3A 4RIXB 5ETAA 2HW7A 1CM8A 1PJKA 1YXUA 3DB8A 3OFMA 3BGQA 1J91A 3A62A 2BRBA 2X0PA 1OUKA 4CSVA 3CD3A 4RT7A 4UMRA 4FVQA 2B53A 5DVRA 1JSVA 4AGWA 2BIKB 3EN5A 3W18A 3CS9A 4NIFA 4P7EA 4AACA 5IG1A 4IWOA 1QMZA 5CSHA 4JBPA 2C4GA 1G8SA 4FTKA 4FG9A 2WQOA 4O0XA 4OT6A 3OT8A 5IH5A 2QOLA 3ZMMA 4DC2A 4Z55A 2XUUA 2JDTA 5H9BA 4W8EA 2X2MA 4DFXE 4EH3A 3ZLSA 4DA5A 2X0GA 4UWYA 4ZY6A 2CN8A 2XK4A 4IAAA 3R04A 5TF9A 3MFSA 5I9ZA 4QMQA 2BALA 5AM7A 3VC4A 1OKZA 4YJRA 2BDJA 3AT4A 4LMUA 5ANOA 5D41A 2VD5A 5KMKA 4M68A 4FIEA 4DH3A 3HYHA 4MF1A 3MV5A 4HYIA 4Z16A 2HW6A 4O0SA 2PZIA 4L67A 2B0QA 3GU8A 3BI6A 5D10A 1UKIA 4RFYA 4C62A 1PYXA 4NCTC 1BKXA 2PVYA 4F6WA 4EH7A 4JMQA 3UDSA 4M7IA 3RZFA 1YXSA 4M3QA 3PDTA 3R9RA 4O7TA 4JIKA 1WBVA 2QQ7A 4FKPA 5FXSA 5M07A 2PZ5A 3AC8A 3KXHA 3M42A 1XR1A 5C27A 4DF3A 3QD4A 4R7HA 2NRYA 4O21A 3OG7A 4IM0A 3I81A 2YABA 3JXWA 2IWIA 3AC3A 4M15A 4WBOA 3C5IA 5LVNA 4DBXA 4MD7E 1IA8A 5J1WA 3UO6A 4ZSEA 4PY1A 3PPZA 2VWZA 5EFQA 3RZBA 3DS6A 3GFEA 3GVUA 5ACBC 3LFNA 2QLQA 4D2VA 4ANQA 1R0EA 1SNUA 4U0IA 4FEQA 1YWNA 3FI2A 4IH8A 4N4SA 4NM7A 4JDIA 3CR0A 5CZIA 4ZAUA 3DZOA 2RG5A 2GNGA 2VNWA 3QKKA 4GUEA 3IG7A 4JR3A 3ZLXA 4ORKA 3U8WA 4F65A 4LGGA 4Y5HA 4QPSA 3RTPA 5AJQA 5I0BA 3P7AA 3V04A 5IF1A 3EQHA 5IU2A 3C7QA 2VO7A 5EI2A 3MB7A 3Q9XA 4DDGA 2W1CA 4I41A 4RIWA 3DBEA 4HZSA 2YIYA 5AA9A 4HJOA 5CVHA 4O7YA 2REIA 4FA2A 4FVPA 4FV9A 1YW2A 4S32A 3ZC6A 3FL5A 3UZRA 1ZY5A 4DCAA 4BZDA 1P5EA 4IWQA 2YEXA 3UDBA 3V8TA 4GYIA 4RIWB 2WMQA 3TL8A 1WBWA 4H1MA 4F6UA 1RE8A 2LGCA 1JWHA 3Q53A 1S9IA 4EHEA 4GJ2A 2PZYA 3EFWA 3VHKA 3P4KA 3FQHA 3DKCA 5ITAA 3QYZA 5CVFA 3R22A 3R71A 4IJPA 4NM0A 4H36A 2OJJA 2W5HA 4RLKA 4ANOA 1TVOA 1XJDA 3F2AA 3U6HA 3QTUA 1E9HA 2ZFYA 3MJ2A 4KA3A 5TE0A 4DN5A 3LM0A 3TNQB 4EHZA 3F3UA 1FVVA 2UW7A 4YZDA 4F63A 3DBCA 5LWMA 4X3FC 3EN7A 1XBBA 3UVRA 4D55A 3O50A 4R7IA 2X0QA 3DA6A 3D4QA 3BYVA 5E7RA 5CANA 3BLQA 4O81A 4H39A 4I24A 3F3ZA 2QOFA 3FLWA 3HA6A 3HVCA 2W1FA 1G5SA 3VULA 3EIDA 4RQKA 5FBOA 2ZM4A 3ORLA 3PP1A 2C3KA 2XRUA 2C3LA 2W96B 2E9VA 4ZJJA 5IQIA 2VTTA 3PUFC 3RM6A 3ALOA 4BI0A 3MY1A 3PJ3A 2XM8A 4I5CA 4ZY5A 3HKOA 1MQBA 1OGUA 3ORMA 3PPJA 5I9YA 1UV5A 4L42A 4MNEA 4NL0A 3KXGA 5E91A 1W83A 3OY3A 3UIXA 5E9EA 2R3FA 3FPMA 2OLCA 5L3AA 5EW9A 1U46A 3BQCA 4G16A 2G2IA 4BCIA 3DCVA 4CGAA 5D12A 3LXNA 2OIDA 3SQQA 3TKIA 4M0YA 4B7TA 2Z60A 4BN1A 4EOOA 4GK4A 1CKPA 2GS6A 5FDXA 4F9AA 4I0RA 4L7FA 2VZ6A 3FC2A 3UC3A 5AADA 2VTHA 3ENHA 3G5DA 3PP0A 2W06A 5EM7A 4ENXA 3JR1A 3PE1A 1OGYA 1IRKA 3QLGA 2BCJA 4CYJA 2UZWE 4FIFA 2VTAA 3ZONA 4FI1A 5AWMA 3GCPA 3R9NA 4IB1A 5CAQA 1PXLA 4HVSA 3IK3A 3HP5A 2A4LA 4FNYA 4CCUA 1PMVA 1Q97A 3Q6UA 3PXZA 3E63A 4UN0C 3GUBA 3KVWA 5M06A 3QU0A 3QQHA 5EYKA 4FSYA 4EK4A 3G6GA 3ZSGA 2ITPA 2A98A 5FUTA 1PXOA 3G9NA 1PW2A 4DDIA 2VWWA 4ZLOA 5DIAA 2HXQA 4EWHA 3OXZA 3QQJA 3EN9A 3HECA 4FYNA 1O6LA 5DYJA 4OGRA 3TM0A 3C0HA 2J0LA 3GU5A 3ORZA 3VRZA 1M2RA 4C4EA 3POZA 1DAYA 5HG9A 5CXZA 5JEBA 5K5NA 3R7YA 4JDHA 4F1TA 2NRUA 2ZAZA 5K5XA 1OIQA 4FTQA 4L8MA 1Y57A 4EH8A 4CRSA 2PUNA 5JFVA 4QDVA 3ZEPA 3FQEA 3FBVA 3TDWA 4QMLA 3V8WA 2BPMA 2GNIA 1KOBA 2OJIA 4FVRA 3NNWA 2PVFA 2YISA 3D7ZA 4QP1A 5TR6A 3W8QA 4C4GA 2WQEA 4XV9A 1Q4LA 1BUHA 4FV7A 4XHKB 4FTOA 4BCMA 3LCSA 3MPMA 4AA4A 5DEYA 5JKGA 4OTQA 2QG5A 4TYHA 2XIZA 3EQIA 4X2NA 5DFPA 2PTKA 4XRJA 4Y95A 4KB8A 4FV1A 4X2GA 2ZVAA 4CZUA 1ZZ2A 5DNRA 3RBWA 1AD5A 4TYHB 3QQFA 4IFGA 4ASEA 5HIEA 3RI1A 3HDNA 3QRKA 3NUAA 5E8YA 5EYDA 5FBNC 5I3RA 2BTSA 3OWPA 3UMWA 4F9CA 4ZSAA 5B0XA 2PZRA 3KL8A 5AR5A 4A9SA 2QOOA 3OXTA 2XVDA 3AC5A 4AF3A 4BDKA 4N70A 3V5TA 2OI4X 4IX5A 1TZDA 4AFJA 4ARKA 2XNPA 3RCJA 2W99B 3DXQA 4B0GA 4XLIA 3ATTA 4EOPA 1M17A 3HEGA 4HGLA 3GCSA 3L8SA 4TYIA 1ZMWA 2RFSA 5TOZA 3RAKA 5DGZA 4A9YA 5M4FA 4AUAA 1FQ1B 4EK3A 3I79A 3FZTA 3QUDA 4BDGA 1GZOA <