4E6CA

P38a-perifosine complex
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
348
structure length
330
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Lipid Molecules Induce p38 alpha Activation via a Novel Molecular Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 104
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e6cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e6cA01
2ZV2A 4BN1A 4Q5EA 3TI1A 3D7ZA 4K6ZA 4RVMA 1OBDA 4DFBA 5AP4A 3KQ7A 2W1ZA 2IW9A 4EHZA 2GQRA 1OITA 1IASA 2Y7JA 4IAYA 3LFAA 2XYUA 4M12A 1FOTA 3POZA 3UOLA 2JIUA 2W4KA 4IB5A 2VTNA 5B7VA 3KF4A 1WBOA 4IB3A 5J9YA 1Q8UA 1ZOHA 1ZYSA 2BRNA 2OJJA 2X81A 2ZDTA 5G1XA 3NWWA 3IDCA 2F7XE 3WZUA 2P3GX 4AG8A 1SVEA 3R8MA 4ERWA 4E4MA 3RAWA 2JBPA 4YJPA 4KAOA 3UVQA 3DTCA 2P33A 2CGUA 4K1BA 3R9OA 4C4EA 4DEGA 2YWPA 3VUHA 3JY0A 4V01A 4FNZA 5A4LA 5J9ZA 5L2WA 3BE2A 5EHOA 1W84A 4FL1A 2BTSA 1IR3A 5IA0A 4EH3A 5HQ0A 2W9FB 4FTCA 3F9NA 5IU2A 5CEIA 3DB6A 1GZKA 4D0WA 4LI5A 1MRYA 5ANDA 4ZY5A 4ZK5A 4ZLZA 1FMKA 4W4YA 3E87A 4WNPA 2J0KA 3BWFA 4I6QA 4TNBA 5AV4A 3CS9A 4FTNA 5BUEA 3TZMA 3C1XA 4CV9A 1GNGA 3JYAA 1G8AA 3A61A 2PE1A 2YACA 4GG5A 3R21A 3U4UA 2ZJWA 3THBA 3EFJA 3QKLA 2OIBA 3D2IA 4HOKA 4AZVA 4ZS4A 2HIWA 2UZLA 2V62A 1H1PA 4O22A 3FXZA 4UN0C 2CLXA 4A4OA 3PLAE 2E2BA 2ONLC 2XYNA 3ALNA 2QOOA 4BF2A 2X4ZA 1GZOA 1MQBA 2H34A 2Q0NA 3W1FA 5HU9A 4E26A 3QLFA 1SYKA 4MD7E 5EKNA 2BAQA 3BI6A 3NYXA 2R3LA 2X6EA 1YOMA 1YXSA 2B7AA 5AV0A 3QFVA 4EHEA 2XBJA 3MW1A 2YABA 3CD8A 4J53A 3UC4A 3IW8A 4RPVA 3WIKA 3UP7A 4NW6A 5AV1A 3HZTA 1QPCA 4ANMA 4FV2A 1Y6BA 1LPUA 2O8YA 3T9IA 1BI7A 4HVSA 3QTSA 4MXAA 3H0YA 3E8CA 4CQEA 1V1KA 4E3CA 2BRHA 4PNKA 4RIOA 3U9CA 3UIBA 3A8WA 1YQJA 2YJRA 4H3BA 3BHYA 3NX8A 3HV3A 4C2WA 2I1MA 4D1XA 4JQEA 4QTAA 3FZRA 5KNJA 1SVGA 2JIIA 2ZOQA 3PVUA 4I6BA 3GFWA 4WSQA 3CGOA 4HCVA 2HXQA 5HKMA 3UE4A 3FYJX 4AGCA 3WILA 4F9BA 4EI4A 1VJYA 5KZIA 4C3RA 3F82A 3S95A 3SW7A 4O0TA 4C58A 2VTQA 4GJ3A 4D1SA 2LGCA 2QOKA 5ANOA 2VTTA 3FQSA 3VHKA 4G3CA 4CTCA 4FTUA 3F7ZA 3K2LA 4CG9A 4QMWA 1IAHA 3Q5IA 3W18A 4CKJA 4KSPA 4LGHA 5EW8A 5JGDA 2XJ0A 2C6TA 3F3WA 3V6SA 3V5QA 4AX8A 3MVLA 3Q52A 4BDGA 4MTAA 4DT8A 3R1NA 2QOHA 5KE0A 5AM7A 5F94A 3EN4A 5AR2A 4BCQA 4WBOA 4I1ZA 4F9YA 5CAQA 3WYXA 3MB6A 5EH0A 5BVNA 2QCSA 5HO7A 1UKHA 3ZDIA 5AAFA 4FSYA 2WTCA 3EKNA 2BMCA 4QP4A 4R5YA 4QYYA 3ERKA 3HL7A 5EYMA 3BHVA 3FYKX 5A3XA 1DM2A 3CJGA 4FZDB 3D2KA 4CXAA 1NVSA 1A48A 5BQ0A 4CFXA 4YMJA 4AN9A 2CKPA 2ACXA 1PHKA 4EONA 4IVCA 5KKRB 3C13A 5AMNA 3KRLA 2QOFA 4ZLYA 4XG9A 2KTYA 2H8HA 4M66A 4J7BA 3QGWA 4IFCA 2YWVA 2SRCA 4YNEA 4EQCA 5JKGA 3F5UA 2FVDA 3NSZA 5DR2A 5EW3A 3WF5A 4Q9SA 4CLIA 4M7IA 4MBIA 2C0OA 4O6LA 5B2KA 1M2QA 4AZWA 3FAAA 4YZBA 2UVYA 3H3CA 1ZYDA 1Q3DA 2A27A 2C3LA 3AC4A 3FC1X 5CALA 4DTBA 1OPLA 5CT7A 3WF6A 4G9CA 1OIRA 2QR7A 4OTRA 5FEDA 4DT9A 3ZMMA 4I3ZA 3DU8A 3LAUA 2IZRA 4FICA 3KXXA 4YBKA 3SAYA 5EYCA 1PKDA 3WF8A 4M3QA 4AFEA 5J5TA 2YEXA 3HMIA 2CHLA 4C38A 3TV4A 1UU7A 5AAGA 4BCGA 4X7QA 1R0EA 2W05A 3D4QA 3EIDA 3BEGA 3F61A 4YHTA 4C4HA 4CSVA 2QO9A 4ACGA 5BYLA 5HG9A 4ASXA 3TT0A 5DT0A 1CKPA 2WU7A 2QKRA 3COHA 3HRFA 4IAIA 4W9WA 2J6MA 3UG2A 2GFSA 4CMTA 2RFNA 5DBXA 2GNJA 2X2LA 3BKBA 2XB7A 1Q5KA 5ETFA 2ZV9A 4I20A 4LL0A 5ANJA 5ACKA 2XK9A 5CEMA 5IEXA 2X39A 4RJ6A 4FV8A 2BRGA 4TYHA 4CYJA 4DA5A 3NPCA 2IVTA 1L3RE 2YCSA 3NYVA 5CXZA 3R02A 4IX4A 3C9WA 2VRXA 2WELA 4JIAA 1OUKA 5CWZA 4FSMA 5M51A 3OEFX 3LFNA 4MHAA 1M17A 1PMVA 1ZZLA 2VTHA 1R78A 1TQIA 2WOTA 4MKCA 4B6LA 5HESA 4G1WA 5HICA 4O84A 4G5PA 4PMPA 4FGRA 3G90X 3QAME 4J8NA 5KMKA 1DAYA 4N0SA 1OBGA 1J1CA 4YJRA 3CY2A 4MVFA 4AW2A 1KE6A 2NO3A 5ETCA 3UVPA 3C4EA 3Q53A 4RJ4A 3LQ5A 4YZ9A 3RHXA 4AP7A 4FSTA 2WTWA 4UMUA 2ITNA 3LCSA 2VD5A 4TYHB 5EQPA 3EQHA 1O6YA 5L3AA 1P14A 2FSTX 2GFCA 2IWIA 3AD5A 3CPBA 4L67A 3A7JA 4WT6A 4XCUA 5DIAA 4GK2A 1FGKA 3ZSIA 3WOWA 4EK3A 3GC9A 4DH5A 3Q4ZA 5DT3A 3TNHA 3I4BA 5IQCA 5HD4A 3MB7A 3LW0A 2BIYA 4QMMA 5CF4A 4QOXA 3N9XA 4Y8DA 2C3JA 3KMWA 2P2HA 2W1IA 3MPMA 4YHFA 5BVDA 5LVLA 4XBUA 2B9HA 3QXPA 3QRIA 1XH7A 3KY2A 3HYHA 4EBWA 3O23A 4R8QA 3VQUA 2CN5A 1GY3A 3OUNB 3LVPA 4PL4A 2XKDA 3VBVA 2XK3A 2W1GA 4O7TA 3RPYA 4O7NA 3S3IA 1OKZA 2QQ7A 4DLIA 2C0TA 4GYGA 3QYZA 3I6WA 3LE6A 4O2PA 5EOLA 5AX3A 1KV1A 5HGIA 5C03A 5G6VA 4M97A 4FG9A 3NEWA 2X1NA 3W2RA 5IDNA 4DG2E 2NP8A 2VO7A 4ARKA 2PVKA 4BB4A 5A6OA 2I0EA 2RGPA 3UBDA 5HBJA 3TNIA 2YIWA 3LJ1A 3Q9ZA 5HZNA 5C9CA 1YWRA 3BHTA 4I41A 1ZAOA 5HO6A 4LG4A 5M06A 2C5YA 2X7GA 5LJJA 3QBNA 1KSWA 5DE2A 3ELJA 3FPQA 4BCHA 1VR2A 3FZSA 4IAKA 3UG1A 2R3GA 1Q62A 4U40A 2R7IA 4FBXA 4C2VA 4DH7A 1ZARA 3G6GA 3II5A 5J5SA 5JFVA 4AQCA 5KO1A 2BDFA 3PRFA 5E90A 5E9EA 4FODA 4YTCA 4TYJA 5AR5A 4B8LA 3EQBA 3TZ9A 5CLPA 3MJ1A 3O51A 1Q61A 3LCDA 3MS9A 3OCGA 3PXZA 4FK6A 4L6QA 4AACA 4BR3A 1BYGA 4WHZA 4ZJIA 5HLNA 4O82A 4O7WA 4O1OA 3RM6A 5DA3A 4RWIA 3DJ6A 2QNJA 4CMOA 4FSWA 3LJ0A 3F3UA 2R3KA 1B39A 4FTQA 3LLAA 2YJSA 4O83A 5IQAA 3PJ2A 3CQEA 4S30A 3OD6X 3VIDA 2BRMA 5CXHA 1JLUE 5GZ8A 1GZNA 4W9XA 3QX4A 3I7CA 4C3PA 2ZDUA 5HU3A 4FT3A 3TNWA 2C5NA 3MV5A 2WQNA 3ZSHA 1REJA 3VAPA 3BHUA 3GCVA 5H9BA 3KB7A 4X3FA 2BILB 3I7BA 3SV0A 2AYPA 4WNOA 3O17A 4D9UA 2WQMA 3QUEA 1VYZA 3DJ5A 3ORMA 3QQJA 5IISA 4FIJA 4HZSA 4KB8A 3L9MA 3H9OA 4QNYA 3TKHA 4UMRA 4QD6A 2XM9A 5EI6A 3QL8A 2NRYA 2BHHA 3C50A 5HVJA 4YTFA 3S4QA 5IPJA 3DJ7A 5EM5A 3VUGA 4JBVA 2VGOA 4AFJA 3GBZA 1I09A 2X9FA 5IKWA 4FEXA 2Z7RA 3ZO2A 1YXXA 3TWJA 3KK9A 4AOJA 2KULA 4LOOA 4X2GA 4ZSGA 5K5NA 1NW1A 2C1AA 2WMTA 5KUPA 4FA2A 2GPHA 4X3FB 4H58A 3P23A 4I94A 2PU8A 5LMKA 3ZFMA 3N4VA 4D1ZA 1WBPA 5E8UA 3SHEA 2R3JA 4IMYA 4FE2A 4PP9A 1NXKA 4WSYA 2VN9A 3PIXA 4R7HA 3R63A 4DFUA 1OECA 1GIIA 2XK4A 3UTOA 4IWDA 3IPHA 2WPAA 2YM7A 4PL5A 3RK9A 1V0BA 3U6JA 1UWHA 3LCKA 4A9YA 3NMUF 1FGIA 5BPYA 1OB3A 4FKIA 3VS5A 4JR7A 4C36A 5IMEA 2BCJA 4DG3E 1UNGA 1M7QA 4X3FC 5F1ZA 4TTHB 5DGZA 3W32A 1M7NA 3FL4A 4JL9A 4PMTA 1YWNA 3HMNA 1OL5A 4C0TA 1H28A 3I0OA 3D5XA 4R3RA 5KMIA 4XG2A 2BDJA 4BIDA 3MTFA 3AT3A 4FTRA 3ZFXA 2PMNX 4BYJA 4R5SA 4FV5A 5IDPA 1MUOA 4ANQA 2IVSA 2PVYA 4C8BA 4GJ2A 2UZUE 4EBVA 5A4QA 5EFQA 3G5DA 1W98A 3ZEWA 1E9HA 1H25A 3NRMA 5E91A 5ETIA 1L8TA 5EQEA 1YOJA 3FI3A 3TUCA 1XBBA 2WHBA 3ORXA 3OROA 2JKKA 2WIHA 2WNTA 2OJFE 4PTCA 4RVLA 2XZSA 4QMQA 3WZJA 4A4XA 4L3PA 5LMKC 3IOKA 3ORNA 4Q5HA 1UU8A 4U81A 5CENA 5T6KA 4C62A 3VUKA 5FTGA 3OFMA 2VZ6A 4M0ZA 1XH5A 4RIYA 1OMWA 3A7HA 2OXYA 4O2ZA 4ACHA 4CVAA 2BHEA 3CTHA 4IAAA 4TYGA 2V0DA 4QMTA 3PJ1A 4JAIA 2WTKB 3COMA 2O63A 4QYHA 4AF3A 2CLQA 4KRCA 3PFQA 1PYEA 4O0RA 4DEEA 4XMOA 2RF9A 3R8UA 4BWXA 3C0IA 4FSUA 2OKRA 3S2PA 2WO6A 2PULA 4X6RA 3PJCA 4IQ6A 4ZXTA 5IQEA 4WG5A 3DZOA 4BDAA 2PUPA 3BLQA 3BZ3A 3RK7A 4IANA 2XKEA 4IM2A 2HCKA 3EYGA 5EM6A 2FUMA 4YLLA 5KMNA 2G2HA 4M15A 3KEXA 2J90A 2E9OA 2HOGA 2JKQA 3FMEA 3QUDA 3H9RA 3UZRA 1QPEA 2WTKC 1W82A 4JRNA 4XV2A 2A1AB 5HG7A 1GOLA 4I24A 5AEPA 5GINE 2ESMA 4JOAA 4APPA 2BUJA 3BU6A 3D5WA 1JSUA 5K5XA 4G3GA 3G15A 3KC3A 3P79A 3OW4A 3OY3A 3QCXA 4AN2A 4EOIA 2IW8A 4PDPA 1J3HA 2OJGA 3WBLA 2XH5A 2XKCA 3DBDA 3GI3A 2I6LA 3IO7A 2RFSA 3EQRA 4J71A 5CZHA 2FSMX 2QOLA 5AIKA 2HAKA 2W1EA 4EOMA 1NVQA 3WZDA 1YHWA 4GH2A 4LMUA 2C5OA 4E4XA 4YC6A 4R6VA 3QD4A 4F0GA 2GQSA 2WQEA 3ZC6A 1X8BA 3NUNA 5JGBA 3U9NA 5KCVA 1RQQA 2PVMA 4YNOA 3RPVA 4QMLA 1IAJA 5GJDA 4ZZMA 4ANSA 3K54A 4OTFA 2B53A 3D9VA 3FE3A 4PRJA 2XP2A 4N70A 4PUZA 4ANLA 3ID6C 1XHAA 3DNDA 4FTKA 4BFMA 3CPCA 1OPJA 2C68A 4UEUA 2YITA 4IZYA 4FSNA 4G31A 1WBWA 2F4JA 4FKGA 4PTEA 1MRVA 3OY1A 3M2WA 4GVAA 5E1SA 4ZJJA 3MI9A 1YHSA 1Q8TA 1YI4A 3ZBFA 2WQOA 3VS6A 4LFIA 3VS2A 2UZEA 4D2WA 3FKLA 4MEDA 3TIZA 3V5WA 4I6HA 3TDVA 2J0LA 3MFUA 4GRBA 4RQKA 3V8TA 3DTWA 3GXLA 4IZ5A 2G9XA 4OBQA 4F6SA 4X2FA 5KMLA 3ZO4A 4G3FA 3OBGA 2OJIA 3LMGA 5FP6A 5EM7A 4CRSA 2WMQA 2YISA 5J8IA 2UW5A 2WIPA 4N57A 3FZTA 5DEYA 4YJSA 5EG3A 5A54A 4H3QA 2QU6A 2WMBA 3R28A 4A7CA 2OIDA 5DVRA 1Q97A 5FXSA 4YHJA 2HZIA 4IWQA 2QOIA 3IW5A 4DGGA 5IQDA 2EB3A 4BIBA 3TIYA 2BRBA 3DBFA 3U8WA 3GU5A 3BX5A 2GS6A 2YIQA 3ACJA 5CF6A 4TT7A 4I23A 2VO0A 1SZMA 1JAMA 2C6KA 1MRUA 3PP0A 4IX6A 3P7BA 1LEZA 2W4JA 3PRIA 3D5VA 4XJ0A 3DT1A 5DFPA 2FSLX 4ZSLA 3DBCA 4FYNA 3UO6A 3O8PA 3OVVA 3P78A 3W8QA 3CCNA 5B0XA 4EL9A 3HAMA 4O6EA 3ANRA 4RC4A 1ZMUA 3DFAA 2F2CB 1OKWA 2W1CA 1R1WA 3UIMA 4YGAA 4JT3A 4PMMA 3N51A 3Q9WA 2OFUA 3I5ZA 3OW3A 3WF7A 4ZLOA 3L8PA 5LCKA 1KV2A 5FP5A 3VRYA 3WE4A 4ALUA 3NVMB 2F7ZE 4JDIA 3KRXA 3RINA 5M55A 4GCJA 3V5JA 5CAPA 4G3DA 4ZY4A 3RKBA 5GIOE 3RI1A 3V04A 3UODA 3BE9A 4U9AA 4W4VA 3W8LA 1FINA 2B9JA 4DH1A 4K33A 4CFNA 2VV9A 3SDJA 4AW0A 4AZTA 5JH6A 5L4QA 4DFYA 4U41A 3SRVA 2A2AA 4FIHA 2XNGA 3UC3A 4J97A 1BX6A 4FKTA 5ICPA 5JFXA 1O6KA 4E5BA 3OS3A 1O9UA 2X8IA 4X21A 4MD8E 2YCQA 4XYFA 3D0EA 3PYYA 3MH2A 5AJQA 4CCBA 2UVZA 5IQFA 2VO6A 3PY1A 3ORLA 4BHZA 5I9XA 4E5AX 4XP3A 3VRZA 3F7WA 2ETKA 3MH0A 4AWIA 4O7VA 3E62A 2QO2A 2Z7LA 4FV3A 4WKQA 5KBQA 4IWPA 4EYMA 5IQBA 4L45A 4OUCA 4RFZA 5D41A 5FQDC 3SOCA 4CKIA 4HNFA 5C4LA 3PSCA 4UV0A 4IW0A 3EL7A 3F2NA 3ZHPC 3FLZA 2I40A 3HRBA 2GCDA 2W1FA 3KVXA 4DGOA 3SVVA 4MD9E 3EQCA 4NSTA 3KCKA 4UZDA 3BU5A 5CVGA 4A9TA 4UWCA 4QP8A 4I0SA 3A2CA 4N4SA 1R39A 2ZM1A 3HV5A 3DKCA 2JDVA 3JUHA 3NGAA 4FVRA 2JKMA 4LRMA 5FTQA 3HP2A 1F5QA 3BBWA 3KRRA 2JLDA 3WYYA 2OK1A 3NR9A 2R4BA 4KABA 3R83A 3REPA 3ODYX 3QQGA 4HYHA 5CYIA 5FM3A 4ITIA 4H1JA 5I9WA 4AZSA 3ZTXA 4EH5A 3Q9XA 3TV6A 3T8OA 2GS2A 5D7AA 1M2RA 2R0UA 4QTCA 2WB8A 4H05A 5TKDA 3V8SA 1TVOA 1FVVA 1KUTA 3RAKA 5IQIA 4R1VA 1ZY5A 4YC8A 2UZVA 4AT3A 3QU0A 4FTJA 3FMHA 4BYIA 4QMNA 2Y8OA 4JJRA 4KRDA 3LCTA 4RMZA 1ZRZA 3BRBA 5H8EA 4E7WA 2YM6A 1P4OA 3ZRLA 3UZPA 5EOBA 4O81A 2ZM4A 3MGYA 1BUHA 4V04A 4O38A 2YHVA 5J95A 5HNBA 1SMHA 3OT8A 1W8CA 3RAHA 3UJGA 5IUGA 2XRUA 5DOSA 3R01A 2E9UA 3SKCA 3PPZA 4C33A 3VUIA 4FL3A 3OWJA 4JBPA 4FSQA 4BDIA 4JNWA 4EHGA 5AIRA 5L8LA 4G16A 5K9IA 1B38A 5AP5A 3RJCA 3VW8A 2JC6A 4YLJA 3P9JA 2VNWA 4P7EA 2OO8X 4HW7A 4EJ7A 3OWLA 2ITZA 3PJ8A 5AUVA 4AUAA 4DBNA 5L2IA 2XM8A 4NEUA 1RE8A 4F6WA 4B8MA 4O21A 3GOPA 4O0XA 4XV3A 3LXKA 4EH4A 3DV3A 3AC2A 4OTHA 4ZS0A 3R9DA 3FC2A 2PWLA 5KX8A 5FRIA 2R2PA 4JS8A 3BQCA 3ETAA 4DGLC 5IEYA 1YKRA 4OW8A 1ZYCA 3FWQA 5IUIA 4Z3VA 3KFAA 2Z7SA 5A4CA 3FMNA 4NUSA 2PPQA 3C4FA 3IW7A 2VTLA 4DGNA 3UQFA 3HMPA 1FVRA 4JXFA 5AADA 4QQJA 3PXRA 4YZMA 4XS2A 3GU6A 2BAKA 3O8UA 2WGJA 4DH3A 2CNVA 3TNPC 3I1AA 3GVUA 3AGLA 3BV3A 3COIA 4YTHA 4BDKA 1SM2A 2JDTA 1UWJA 2VX3A 1NA7A 5FEQA 3UYTA 4HPUE 4ITHA 1VEBA 3DAJA 3F88A 5EKOA 4NW5A 4G9RA 3A4OX 1ZMVA 2Y4PA 3NUSA 3FLWA 5BX0A 2PL0A 5EYKA 3VQHA 3EFLA 3VULA 4CQGA 5M53A 4KIQA 4KIKA 3R7IA 4EK6A 3F2AA 4BVUA 5BNJA 5LVNA 2VTSA 3QRJA 4UYAA 3ROCA 4A07A 2V22A 2C5XA 3KRWA 4YU2A 3TKUA 4YZDA 5E8VA 5HEZA 4CFUA 3PG3A 4Z7GA 3OZ6A 4CKRA 4EYJA 3LXNA 2IZSA 3FI2A 3QTUA 3W10A 3E92A 4DITA 1ZWSA 4KKHA 4KIPA 2PVNA 4DC2A 2OIQA 3MVHA 3UP2A 2WMAA 4CYIA 3AMBA 4G5JA 5DRDA 3RM7A 3L8VA 3NNVA 4ZP5A 3NCZA 3WZEA 4YP8A 3COKA 4AOIA 3LMIA 2UV2A 4RA5A 4U45A 3R8LA 3RCJA 4IADA 2GDOA 4RJ7A 4HNIA 1XO2B 3QZIA 3KXZA 3O7LD 1RDQE 1Z9XA 1BLXA 2PMIA 1U46A 3NIZA 4YPDA 1JBPE 5M4CA 3TM0A 2CN8A 1JSVA 3FSFA 4GS6A 2I0VA 3EOCA 2V55A 2B0QA 2PMOX 2H96A 2UW3A 2DQ7X 1ZY4A 4JRVA 4I5CA 3TACA 3EQIA 3VHEA 5JFSA 5FBNC 2JFLA 3FPMA 3OCTA 4A9RA 2XNOA 4NWMA 3TEIA 3HNGA 4DGMA 2R0IA 3PSDA 3QTXA 2OH4A 4WIHA 5CU6A 3BYMA 4AU8A 2G15A 4U3ZA 5CI6A 4FSRA 2XNPA 4UXQA 4PDYA 4S32A 1G3NA 4D28A 2CGWA 5FLFA 5I4NA 5IH5A 3L9PA 4DBXA 3RZBA 3K3JA 1LP4A 3HA8A 3EFKA 1FBNA 4OTDA 4OBOA 3H30A 4UYNA 4ASZA 1JWHA 4DF3A 4D2RA 5I3RA 4X2JA 4G17A 5AR8A 2R3NA 1WBVA 1G8SA 1XH6A 2W1HA 4BTFA 2VWXA 2EXEA 4U44A 1PMUA 2F2UA 4L01A 4NIFA 2UZTA 2BIKB 3HV7A 3C5UA 4RX8A 3ZU7A 3ET7A 5FDXA 3R2BA 2HK5A 2R3QA 3OXTA 2XA4A 3F3ZA 3K5VA 4K9YA 3M1SA 4MXYA 4RVTA 4U5JA 4AGWA 3I5NA 4GKHA 1SNUA 2CMWA 4IXPA 5DMZA 3FHRA 4NT4A 3AMYA 1SVHA 4EH9A 3VVHA 2XJ2A 4FX3A 5LWNA 2YZLA 3EWHA 3NVKI 3MPAA 3ZONA 3B2WA 4OBPA 4F0FA 3GGFA 3OEZA 3RK5A 5CVHA 3UO4A 4L44A 3QC4A 4RBLA 5JMSA 3P7CA 3ATSA 3DFCB 3UOJA 1PXJA 4NYEA 3Q2MA 5HIEA 4F1OA 4NM3A 3PTGA 4FOBA 3IK3A 4NM7A 2Q83A 4MNEA 5J9LA 1H1RA 3R9RA 2YM8A 2ITQA 3KULA 1UNHA 3PA3A 3VF9A 4NIFB 1DAWA 3R7YA 2VU3A 3DLZA 2VTOA 3BPRA 1YW2A 3QCSA 1YDSE 3WF9A 4DTKA 5ANIA 5C8MA 2YLEA 3FDNA 4IJ9A 1H08A 4ENXA 2C0IA 3GQLA 5H8BA 2UW7A 1Y91A 3NAYA 4QMYA 5CU2A 2RG5A 4DE4A 4I0RA 3HDNA 1MQ4A 2HENA 4K8AA 4JX7A 2QI8A 5DRBA 2PTKA 4QTDA 5HHWA 3QTRA 2OF2A 4O7YA 4USFA 1YOLA 3PWYA 3RAIA 1QCFA 3R7EA 1YRPA 4QMUA 5ANGA 3MY5A 4LMNA 5IH6A 5KMOA 3PSBA 1U5RA 3EHAA 4RJ8A 5HCZA 1Q8WA 4O7ZA 4MNEB 4D4RA 3ZXZA 2AC5A 4XX9A 5DHJA 3FLYA 5L8JA 3TDWA 3PWDA 4NFNA 3G33A 3RALA 4M14A 4FSZA 4ALWA 4KIOA 4B0GA 3UQCA 2CNQA 2XKFA 2XIKA 3QTQA 4MF0A 3UO5A 4BCJA 2UW9A 5CQUA 3ZLSA 2ETRA 2QU5A 1BL7A 3HVCA 4AW5A 2H6DA 2OW3A 3Q96A 3LJ2A 4FNWA 2ZV7A 3WI6A 4BGGA 4BCMA 2JAVA 3I60A 3IOPA 3GFEA 5LVMA 3ZLXA 2XCKA 3RNIA 2ZB0A 3E7OA 3BGQA 4HYUA 4B4LA 1PXPA 3NNXA 4BDFA 1CKJA 2QURA 4HYIA 2OZAA 4R7IA 4BCPA 3W2OA 4DFXE 4QYGA 2J5FA 3KCFA 3CQUA 2UZNA 2P55A 3MH3A 2VWUA 4LM5A 3Q9YA 5AV2A 5CEPA 5FDPA 5I9ZA 4O86A 4ORKA 3SD0A 1WVXA 4FV0A 4UWBA 4WUNA 3UZTA 1HCLA 2R3RA 4FI1A 4BKJA 3QD0A 1QPJA 1UNLA 3FJQE 4HGTA 1PXKA 2XEZA 4AT4A 2QLQA 4ENYA 2IO6A 2FYSA 4EOPA 4O1PA 4TXCA 3BGZA 5CU4A 3ZC5A 2JEDA 4FEUA 2VO3A 4BC6A 4TWCA 2Z02A 2B1PA 5IA1A 5CQWA 4YO6A 4ZTNA 4ZIMA 4P5ZA 1WVWA 4Y72A 2QVSE 1PXLA 4RIXA 2X2MA 3KRJA 4M84A 5BVWA 3BHHA 1YXUA 3OBJA 1CM8A 2YERA 4L43A 5CSHA 3AGMA 4BKZA 2GHMA 5IA4A 3HLLA 4NU1A 4NK9A 5CNOA 4PQNA 1IEPA 2R3HA 4ID7A 4D2SA 4UMPA 1HCKA 5AP2A 4FGBA 3V51A 3Q6WA 2J4ZA 3PLSA 2EB2A 4AE9A 4C37A 5L6PA 3VC4A 5LQFA 3Q4UA 2HW6A 3HUBA 2IN6A 5EI8A 4BCNA 5AA9A 1XH8A 1WBNA 5CI7A 3SXSA 1ZYJA 3CE3A 3SLSA 5KHXA 2VX0A 4WO5A 5BVOA 1ZZ2A 5J7HA 3PIYA 4J98A 5LMBA 2ETMA 4Y83A 5H8GA 2G2FA 2VWWA 4X6QC 3QQFA 5AP7A 3ZDUA 5HG5A 1NVRA 3TG1A 4C57A 4HVGA 5GJFA 3TUBA 2W06A 5LVPA 3DK7A 3DB8A 1J1BA 2WFYA 4QMOA 5HBEA 4AZEA 3F5GA 1K3AA 2XRWA 3UVRA 5LWMA 4JAJA 3R7VA 4EJNA 3DXPA 5DPVA 4LYNA 2JBOA 4IZAA 3HMMA 3OUKA 4HVHA 1Z57A 3C51A 3ITZA 4YJUA 4CMUA 4DEAA 3DS6A 2PUIA 4GSBA 4DTAA 4FKSA 4A9UA 2IJMA 4HVIA 2VTPA 5H2UA 1Q8YA 4QO9A 2C4GA 3R9NA 1Y8YA 1PXNA 2WAJA 2XNEA 4DINA 4Y85A 2UZBA 3HEGA 2O65A 5IEVA 5J1WA 3OTVA 4I93A 4ZTQA 5T68A 5AUYA 4FKQA 1JPAA 4ZZNA 3GEQA 4NM5A 4L7FA 4E6AA 3PY0A 3UNZA 3GC8A 3I81A 4BCKA 4WG4A 5FM2A 3RPSA 3DA6A 4BI2A 2O2UA 3EQFA 1ERKA 4NJDA 4O0UA 3D5UA 4AT5A 3PVGA 4TPTA 2CCIA 4E4LA 2WOUA 2F57A 3A7FA 4J95A 3E64A 3LZBA 3U51A 1OL1A 5E7RA 2X4FA 3R8ZA 2BZKB 3MVMA 4FT5A 3N4TA 2J51A 4CT2A 1OGUA 2A19B 4JX3A 3VJNA 3QHWA 3I79A 4GK3A 4J99A 3DQWA 4KBCA 4OGRA 2ITOA 4ZTRA 3QQHA 3CJFA 5D1JA 3SX9A 4FV4A 5HIDA 4CZUA 4FG7A 2PZIA 4DHFA 4YJTA 3NUPA 4OTWA 2EUFB 4HYSA 3L9LA 5J87A 5EI2A 4CT1A 4R3CA 4WA9A 4D2PA 2UZDA 4JQ7A 4XOYA 2YLFA 3B8RA 4CTBA 3PP1A 2XBAA 3RHKA 4NFMA 3ORIA 3P0MA 4ZAUA 1ZYLA 3BIZA 4KA3A 3MTLA 1IA9A 4D5HA 4BDEA 3BYVA 4P90A 3JVSA 3K5UA 3DOGA 4H39A 4L53A 4KS7A 4YJVA 5E1EA 5HVKA 1Q24A 1WBTA 2C6MA 5C4KA 4AS0A 3EQGA 4EOLA 5L2TA 4ACMA 2IG7A 4AXAA 5EM8A 4X0MA 4FV1A 4Z16A 3U6IA 3QZHA 5CU3A 3MDYA 3MVJA 5TF9A 4GUBA 2RIOA 4FEWA 4KBAA 3ORTA 4PV0A 3E63A 4XBRA 5AR3A 3ZOSA 4RA4A 2WMRA 3NW7A 4RGJA 4O0VA 5FBOA 3GC0A 2PZYA 5T3QA 1KE8A 3VF8A 4UMQA 4FTIA 5HORA 4YSJA 1KOBA 4W4XA 3EKKA 4RWKA 3P86A 3VS3A 2JAMA 2YN8A 3PY3A 2UVXA 3BBTB 4YJNA 4BZOA 3ORPA 3H0ZA 3NCGA 4IB1A 2GTNA 2PYWA 5CX9A 4BZDA 5B2MA 2XIXA 2YM3A 4KSQA 2R9SA 1NT2A 4RJ5A 4A9SA 4F1MA 3ODZX 3R7UA 3TL8A 4YSMA 1G5SA 5ITAA 3DPKA 4AGDA 3GOKA 3GUBA 3DXQA 3ZZEA 3ZYAA 4FTOA 4FMQA 3QQUA 4TRLA 4MH7A 4EOKA 5IUHA 4GIHA 4KKGA 2QOBA 4I4FA 5M09A 1RW8A 3OXIA 5HCXA 5D9HA 2YAAA 4U7ZA 4IVBA 3PG1A 4EZ5A 4WG3A 3ZLYA 2YDIA 2ZMDA 3OP5A 3PA5A 3W2QA 2O64A 4D4YA 2QR8A 3KN6A 4II5A 4BTKA 3OT3A 4GT5A 5E8WA 3U4WA 5M4IA 4RIWA 5EHLA 5HO8A 5IA3A 2BZJA 4RIYB 2VWIA 4RWJA 2BVAA 4Y5QA 3FMMA 1GAGA 1KE7A 3QRKA 1ATPE 3A8XA 3DBQA 3FZ1A 3QZGA 4UB7A 3MSSA 3UMXA 5GZAA 3AOXA 4J1RA 2ZMCA 2OGVA 3PVWA 4PMSA 3UNJA 4BI0A 4IJPA 2G1TA 3P7AA 2ITYA 5FEEA 2QD9A 4EH2A 2Y4IB 4C4IA 3C7QA 1WBSA 2R3MA 3VS0A 3ZUVA 4ZJVA 5EQYA 3FZOA 2XVDA 3KKVA 4CNHA 3R8PA 4XHKB 3SQQA 5IA2A 4EH8A 3OG7A 2XK7A 2YIXA 5LMAA 4LOPA 5GZ9A 3AD6A 4ZY6A 3QRUA 4TYIA 5BVEA 3RCDA 5I9YA 2R3IA 1BL6A 2HWOA 2PVFA 2YIYA 3KA0A 3V5LA 3A7GA 3NDMA 4FTLA 4H1MA 4RJ3A 3V01A 2F7EE 3OOMA 3ORZA 4DFZE 4MF1A 3A4PA 1XR1A 4JLCA 3QUPA 4PX6A 4EKLA 3BELA 4ITJA 2IZTA 3RBWA 3VUTA 4QT1A 4CD0A 4YLKA 3MIAA 4CFMA 3CBLA 3SOAA 2C6IA 2E9NA 2Y4IC 2PVRA 1IA8A 3HKOA 5D11A 4BL1A 4IWOA 3V3VA 1RJBA 3CGFA 5M44A 4QQCA 3FUPA 5DT4A 3ZO1A 5LOHA 2I7QA 2A4LA 5AAEA 2B4SB 4IEBA 5EK7A 2R3OA 4HJOA 4PDSA 5BMMA 4Z7HA 1PXIA 3ANQA 3ULZA 2OICA 4GMYA 3DKFA 5HTIA 2YCRA 4TZRA 1APME 1XH4A 4JG8A 4LL5A 4ACDA 4GUEA 2PVHA 2VGPA 1K9AA 3BYUA 3QZFA 4FYOA 1TKIA 4DEIA 5DLSA 4XLVA 4ZSEA 4M67A 4Y95A 5DR6A 2QKWB 3BGPA 5CEQA 4YR8A 3L9NA 2YA9A 4U3YA 4FZFB 1M2PA 4FV6A 3AC5A 5JQ5A 1UVRA 2YM5A 5ACBC 3HA6A 4OLIA 4CFWA 2O3PA 4LUDA 1XH9A 2VTRA 3F69A 4U6RA 4QP2A 1KWPA 4ANOA 1E1VA 3UGCA 4XP2A 4S2ZA 4Y46A 3CTJA 3ENHA 3I0QA 3C0HA 2ITXA 1OPKA 3KXHA 1YHVA 1CTPE 4OT6A 1Q41A 4DN5A 4IBMA 2ITUA 5KHWA 3KXGA 2ZM3A 3PXYA 4PTGA 3FQHA 5DYJA 3M42A 5CU0A 3HUCA 4O7RA 2V5QA 1OUYA 1UKIA 2J50A 2XJ1A 4EHVA 3S1HA 4EOOA 2Q0BA 4QTBA 2YFXA 3P5KA 4BGHA 5LVOA 2C1BA 2HZ4A 2YDKA 5IQGA 3GQIA 2O5KA 3VUMA 4K18A 4E8AA 4NH1A 3UPZA 3MJ2A 4E1ZA 1UU3A 3GNIB 3JS2A 4HGLA 3EN5A 4F70A 3AT4A 4Q2AA 3DK3A 1PY5A 1F0QA 3RPOA 3UOHA 2WTIA 4E6CA 3NW6A 5C8KA 4MXXA 4FKVA 5E8XA 3F66A 2PZRA 4FV7A 3MFSA 4L3JA 3VWAA 4KS8A 2ZYBA 4O27B 4BDCA 3GU7A 1GIJA 3PPKA 3VS4A 1XKKA 3E8NA 2XS0A 3Q04A 2ITPA 2IVUA 4IZ7A 5EDRA 2R64A 3D7TA 4E6QA 4GK4A 3LFCA 3OWKA 3W2CA 2ZAZA 4KD1A 3QA8A 4FEVA 2B54A 4EOSA 3OMVA 5HIBA 4QTEA 4Z55A 3CC6A 5HD7A 4ZOGA 4F7LA 3UNKA 4MWIA 3LKMA 5HE0A 2RFDA 4MYGA 3Q32A 3OWPA 3GB2A 2QHNA 4G6LA 2GNHA 4MQ1A 3DY7A 3S00A 3MY0A 2VTJA 1Q8ZA 3R7OA 3R2YA 4HPTE 2R3FA 4K77A 4NKAA 4GW8A 3MH1A 2Z60A 4TKSA 1GIHA 4GEOA 5BVKA 5FXQA 2OJ9A 2GS7A 4TN6A 2J9MA 3OF0A 5C27A 1XJDA 4FT7A 1F3MC 4RZWA 5K4JA 4XG4A 3QRTA 3OOGA 5DEWA 3F3VA 3PVBA 4Y5HA 3NAXA 3ZRKA 3JXWA 1B6CB 4KUJA 4U0IA 3ZS5A 3LFDA 2C47A 3QYWA 4BWPA 3TKIA 2GNIA 4DH8A 4ERKA 3SC1A 3A7IA 2B52A 2YCFA 5EW9A 3SRVB 3W2SA 2OZOA 4EZ3A 4BY9E 5IA5A 1FVTA 3PXQA 1CDKA 4BCIA 2GSFA 4FTMA 4C02A 4CRLA 1OIQA 3DAKA 5CVFA 3AD4A 2X6DA 4ONAA 4QPSA 5HNIX 3G0FA 4PWNA 2NRUA 2JDSA 3KL8A 4N6YA 4AA4A 4XP0A 2VTMA 3PXFA 3MPTA 3LFBA 3O7LB 3K3IA 3G2FA 4MAOA 4MNFA 2XNBA 4TYEA 5C01A 4RFYA 4TWPA 2XUUA 3G9LX 4G2FA 4GFGA 4OAVB 5HLWA 2JDRA 3NUXA 3VNTA 4AOTA 1H1QA 4WNKA 5IG1A 2JGZA 3FBVA 2GNLA 3R8VA 1CSNA 1PW2A 3GP0A 5JT2A 2C30A 4F9WA 3E93A 4C34A 4A06A 2FA2A 2X7FA 3QQKA 3CIKA 1WZYA 4GT3A 3RZFA 5KMJA 1WCCA 3R1SA 4L42A 4FT9A 3V8WA 3LQ3A 4ZTHA 4B7TA 1JQHA 2RFEA 3UPXA 3FSKA 3QKKA 2VTAA 4X2NA 4CLJA 1XWSA 2OBJA 5HX8A 4DLJA 4LOQA 3EFWA 1WAKA 3GU8A 4I0TA 4Q9ZA 3R04A 4NCTA 3TTIA 5A46A 2YM4A 3FHIA 3GU4A 3W55A 2RKUA 3NLBA 2F49A 4P5QA 5TE0A 4QQTA 4UX9A 3DK6A 3B2TA 4BBEA 2IZUA 3AC1A 3Q6UA 1KE9A 5JSMA 4I5MA 5HTCA 4ZTMA 3F5PA 4OR5A 1Y6AA 3Q4CA 2W4OA 3ZBXA 3AXWA 2C3IB 2QLUA 5FTOA 5DI1A 3RP9A 2XF0A 4JG7A 1U59A 3GCPA 3W33A 4EUTA 5AP6A 3T3VA 3L8XA 4IAFA 3H10A 4P4CA 5AWMA 4GVJA 2WD1A 3ATTA 2O0UA 3R22A 4EEVA 3BLRA 3EYHA 3F2RA 3LXPA 3HECA 1EH4A 3BWJA 1CKIA 3E7VA 4O0YA 4QMXA 1K2PA 3DKGA 4IVAA 4BZNA 2CSNA 3OCBA 3QGYA 1PYXA 4E5WA 2JD5A 1T45A 3F5XA 3P4KA 2Z2WA 3UQGA 3DLSA 1O6LA 4EWQA 1LEWA 4HGEA 4MBLA 5TOZA 5IZFA 3OC1A 2C5VA 1HOWA 4DEHA 4F63A 2QOQA 4MX9A 3U87A 1YDRE 4UALA 2ZB1A 2Y6OA 4QQ5A 5AUWA 5F4NA 3H4JA 3ZXTA 4FF8A 4DCAA 3GC7A 4UBAA 3ZRMA 1H1SA 3QD3A 3T3UA 4AN3A 4E93A 3O71A 4IE9A 1PKGA 2GNGA 1OI9A 3DDPA 2UW0A 4NCTC 4E4NA 5B2LA 4NL0A 2JFMA 3VS1A 3TV7A 5AUUA 3O2MA 1YI6A 3ZM4A 3V5TA 4F1TA 5CASA 1UU9A 3NUYA 4S33A 3LXLA 2CDZA 5DR9A 4ALVA 2WMVA 2XIZA 5EYDA 4RX7A 4USDA 3E5AA 3KXNA 4DEBA 5C26A 1H07A 4PDOA 4TW9A 4KIKB 4DYMA 2BPMA 1T46A 3QTZA 5AM6A 4ZTLA 2JITA 3TJCA 3SA0A 3QTIA 3PE2A 2OXXA 2ZV8A 4BHNA 3CEKA 3GCSA 1Q99A 3NUUA 4I6FA 5JRSA 4WUAA 5JRQA 3U55A 4FKJA 5JGAA 3LFEA 4J8MA 4PL3A 5AUXA 2VWZA 1ZOGA 3UYSA 3FY2A 4D4VA 1OL7A 4YJOA 3BV2A 4IC8A 4S31A 5AA8A 4FC0A 4K0YA 3LFSA 5JQ8A 3EQPA 1PJKA 3ZZWA 1QPDA 4HZRA 4JDHA 5GIPE 4YPSA 4D55A 4F9AA 3CSVA 5K3YA 1LUFA 3PIZA 5DG5A 1DS5A 5FGKA 1R3CA 3HGKA 3IECA 4IM0A 4E6DA 4I92A 3UMWA 4C4JA 4FVQA 4ZEGA 4EZ7A 2WMXA 3ZEPA 1A9UA 4FTAA 4JBOA 4C7TA 3B8QA 5L6OA 1OVEA 2ERZE 5AX9A 3KMMA 3OTUA 4BTMA 1I44A 4YURA 4ANNA 4WBBB 1FMOE 4AZFA 4L9IA 1H00A 1XBCA 3IGOA 4M8TA 2WMWA 4MXOA 3CD3A 1BI8A 1U4DA 2W0JA 2OSCA 3RGFA 4CG8A 2OF4A 5E8TA 1OL6A 2YZAA 2XMYA 4O96A 5KBRA 1QL6A 1H01A 4B99A 3E8DA 3VN9A 5ANKA 2GQGA 1JSTA 3Q3BA 4EWHA 3PA4A 5KKRC 4R1YA 4G34A 3Q4TA 4JVGA 4QYFA 3BLHA 1A06A 2PHKA 3QHRA 4RX5A 3MY1A 2C3KA 4QPMA 4MQ2A 2BZIB 2H9VA 2LAVA 3N4UA 3CR0A 3OXZA 3EMGA 2BZHB 4E20A 5HE2A 5AR4A 2EVAA 4GG7A 3LLTA 2UZWE 3HDMA 5J79A 3FKNA 3QXOA 5E8ZA 2VUWA 3S0OA 5CAOA 4F64A 3SG8A 2HW7A 4R77A 2GTMA 2RL5A 4L8MA 1GZ8A 3IDPA 3D14A 4GV1A 4LRKA 3QCQA 3U54A 1YXTA 2FGIA 2XCHA 3NUAA 4FV9A 2C6DA 3EN7A 2UUEA 1Y57A 1OIUA 2W9ZB 4WD5A 1YWVA 1OL2A 1Q3WA 5DN3A 4EORA 4RFMA 2I0HA 1H4LA 5CS6A 4GT4A 3IQ7A 5BVFA 2OWBA 2CGVA 2WTDA 5CANA 2FO0A 4RVKA 1JKSA 1P2AA 3FXWA 4IM3A 4YJQA 2CCHA 5JZNA 3UIUA 5EDQA 5ETAA 4KBKA 2G2IA 4BGQA 4MCVA 5AV3A 4KWPA 4EC8A 4RC2A 3TN8A 5ANEA 4BCFA 5HBHA 2R5TA 4JDKA 3FMLA 2UZOA 1JOWB 3F3TA 3FKOA 1AD5A 4E73A 3KULB 4BCOA 2Z8CA 4QP3A 3PZEA 3GENA 2C6OA 4I22A 5D7VA 5CF5A 4V0GA 3D15A 2OXDA 1VZOA 3UDBA 5F20A 4FOCA 3V5PA 5CEKA 2XIRA 4MXCA 2EXMA 2PK9A 4FEQA 3AQVA 1NY3A 4GL9A 1J91A 2CKEA 2JIVA 3IGGA 1S9JA 3R0TA 3ZO3A 2HZNA 4QP6A 4M68A 3VS7A 4EQUA 4HCUA 4IDVA 1V0OA 4FZ6A 3QALE 3IW4A 1GJOA 4I4EA 4XV1A 5IF1A 5HVYA 4FL2A 1PMEA 3FXXA 2OFVA 5I0BA 1E1XA 3NS9A 1PF8A 3FL5A 3QWKA 5DH3A 4BWKA 3R7GA 4M69A 4XG7A 4XUFA 1ZLTA 1J7IA 4IACA 4AW1A 4XNEA 3WARA 3WIGA 5E4HA 3KREA 4JDJA 3C4ZA 3LMHA 2CJMA 2JDOA 1W0XC 4IC7A 4CZYB 4QPAA 3VO3A 3BYSA 3LHJA 3D94A 4IX5A 4JG6A 4V0GB 5LXMA 4BDBA 2B9FA 3CKWA 4FIIA 5M07A 3IS5A 2VTIA 1YI3A 3FLQA 5I9UA 3CTQA 3VBQA 5IMXA 2FH9A 2J0MB 3EN6A 3EB0A 1BKXA 4L00A 4RX9A 3C0GA 3G51A 3IG7A 2PE0A 2PUNA 2WKMA 3JVRA 3ROYA 3UOKA 4U79A 4NM0A 4X2KA 2YIRA 2OZAB 1H8FA 2REIA 1OZ1A 1JKTA 2BDWA 1TQMA 4M69B 4W8DA 5TR6A 4AAAA 3TZ7A 1CMKE 4UY9A 3R9HA 3E3PA 4N6ZA 3ALOA 5CY3A 3VBTA 2P0CA 5M4FA 2X2KA 3QX2A 4F08A 3FY0A 4FKOA 1PRYA 3VBYA 4GYIA 2DUVA 3ACKA 1SNXA 4FUXA 4QMPA 4S34A 4G3EA 3WE8A 5CSPA 5CSVA 4ZSJA 2VAGA 2OLCA 3AMAA 1JVPP 5JK3A 2VWVA 4X3JA 2OU7A 3G6HA 4QMZA 4J96A 5HE1A 2HXLA 2GHGA 3O8TA 2EXCX 4OTPA 4HVDA 2J0IA 4ANBA 3FLNC 4UWYA 4DCEA 4ZSAA 4RIXB 2W1DA 4PPBA 1OM1A 2PVJA 3QQLA 4NZWB 4FIFA 5J1VA 3C4WA 4PPCA 3EJ1A 4L7SA 4FKWA 3TCPA 1R0PA 3JY9A 3O96A 4FKLA 4U43A 5A4EA 3MA6A 4R7BA 4L68A 3R30A 4ASDA 1UA2A 2FB8A 4PP7A 4LRJA 4GFOA 1LR4A 3LPBA 2CNUA 2J7TA 4I5PA 2XEYA 1QMZA 1Q4LA 2W5AA 3FMDA 3BYOA 4I21A 3RPRA 1U5QA 4BDJA 1URCA 4IVDA 3H9FA 3FLSA 5AUZA 4F7JA 5CSWA 3DKOA 4XG3A 2ITTA 4LQMA 5AR7A 4DAWA 4F99A 4OAUC 3HV6A 4AA5A 1M52A 3VW6A 5HX6A 2XNNA 3NYNA 3LQ8A 4WNMA 1UV5A 2P4IA 4RLLA 5CAUA 2HZ0A 4HGSA 5HTBA 2Y0AA 1Z5MA 5A4TA 4AE6A 4L46A 4P2KA 2BFYA 4U80A 2X8EA 3AC8A 1ZXEA 2DS1A 3DDQA 3JPVA 4FIGA 3DAEA 4IB0A 4TWNA 2J2IB 4LV8A 3CXWA 1S9IA 4JIKA 4IH8A 4NJ3A 4XG6A 3JR1A 4BRXA 3ZFYA 1WMKA 2BROA 5GNKA 2V7AA 3BCEA 2WXVA 4M0YA 2P2IA 1AQ1A 4KKEA 4C4GA 1OKYA 3NZ0A 4BTJA 1JKKA 2W96B 3MWUA 4C61A 4FIEA 3GCUA 2J5EA 1BMKA 4O7LA 4NTTA 4C59A 4RRVA 3KU2A 5E8SA 4QP9A 4W4WA 2WMUA 4OTQA 2PZ5A 2PMLX 5BMSA 4CGAA 4F7NA 5I5ZA 4YTIA 4TNDA 3HRCA 4D58A 1J7UA 4FTTA 2BALA 4D9TA 3G9NA 1H0WA 2X7OA 3HMOA 4O0WA 4YBJA 2GMXA 3MFTA 4CV8A 2QG7A 3W16A 5AP1A 2QO7A 3RTPA 5BUIA 1ZMWA 4TY1A 3IDBA 4JR3A 2A0CX 3EL8A 5FUTA 3LFQA 2XK6A 2Y6MA 2BFXA 5BYZA 5JFWA 2W5HA 4L52A 4OTGA 4M13A 4RWLA 4GU9A 2WEIA 5K0KA 4V05A 3C5IA 2GNFA 2CGXA 3P08A 2QG5A 3PJ3A 2BTRA 4Y73A 5CEOA 3WZKA 3CY3A 3LCOA 4FVPA 2G01A 3HAVA 1IG1A 5L8KA 4F7SA 4KINA 4QNAA 5CAVA 1AGWA 3IONA 4CEGA 1PMNA 3QTWA 3POOA 3RWQA 1XBAA 5IQHA 4EC9A 3MN3A 3TZ8A 5E92A 3PZHA 3MIYA 2PVLA 3D83A 3RWPA 5L2SA 5M56A 5K4IA 3Q5ZA 5H3QA 3LFFA 4C35A 5F9EA 2NPQA 3AG9A 4F09A 3KVWA 4K11A 2NNWB 4FNYA 1W83A 3IW6A 1XQZA 2VNYA 3P1AA 4RG0A 1OKVA 3VBWA 5D10A 4F4PA 3CLYA 5JN2A 3TJDA 4IDTA 5GHVA 4QMSA 4W8EA 1DI9A 3MA3A 5CZIA 4FZAB 4D0XA 4FR4A 4XRJA 4K2RA 5TT7A 4MXZA 4U8ZA 4XOZA 4F6UA 4RLKA 4XV9A 5JEBA 4FKRA 5IH4A 3VBXA 3QC9A 3PXKA 3R71A 4O0SA 5EDPA 3IKAA 3SXRA 3ENMA 4D2TA 3CQWA 2R7BA 4PF4A 2HY0A 3NW5A 4QRCA 4MWHA 2FSOX 3TXOA 5AUTA 3TTJA 4ZMEA 5LARA 4QP7A 4YZCA 5M4UA 4GIIA 3M11A 4C3FA 4ZMFA 4XRLA 5HCYA 4BBMA 4JBQA 4ZTSA 2WU6A 4F65A 4YUQA 1OIYA 4BI1A 4FG8A 1KE5A 2WQBA 4UZHA 1JKLA 2ITVA 4H3PA 4WRGA 3A99A 4R3PA 2HY81 5HI2A 2OG8A 3Q2JA 3QWJA 2VWBA 2ITWA 4XLIA 5L6WL 5J7BA 2X8DA 3QF9A 4Z9LA 5C1QB 2W5BA 3FQEA 1PXOA 1MP8A 2IVVA 4D2VA 3HV4A 4EK5A 3T9TA 4RIWB 3ZM9A 2YDJA 3NIEA 2BKZA 4LUEA 4LV5A 5M57A 1ND4A 3DNEA 4BDHA 2QHMA 2VX1A 2XIYA 1H26A 3I6UA 2PUUA 1FPUA 3TNQB 4D4SA 1STCE 2WTVA 4CFFA 3RMFA 1YXVA 3LOKA 1KOAA 2X9EA 3PUPA 2IW6A 3KF7A 4F0IA 4UXLA 2DWBA 4MBJA 2CKOA 3KN5A 3R1YA 3FMKA 3DQXA 4FZ7A 2V7OA 4EUUA 4QP1A 3VUDA 4EOQA 3FMJA 3LIJA 5FWKK 2B9IA 4CZTA 3SGCA 1WFCA 4AGUA 1M14A 2AC3A 3U6HA 4BKYA 2QONA 5AFVA 2QOCA 3EZVA 4BDDA 4QYEA 4U97A 3E88A 3R6XA 3ZUTA 2ERKA 3MBLA 2XK8A 3KMUA 4FUYA 1Y8GA 1YDTE 1TQPA 4WRSA 3SW4A 4ACCA 4GU6A 4PPAA 4XH6A 3BQRA 2RG6A 4YO4A 5HLPA 3RNYA 2PE2A 4BIEA 4MK0A 5HE3A 4RZVA 4TL0A 1J7LA 3FEGA 2DYLA 3ZSGA 3DCVA 3FV8A 4QMVA 4A4LA 3AC3A 2E9VA 5L2QA 4DG0E 1VYWA 4R78A 1DI8A 2VWYA 4O7SA 3FI4A 4UMTA 3SG9A 1H0VA 1U54A 3DXNA 2J0JA 3EH9A 5FXRA 3MESA 2E9PA 4CFVA 4NTSA 4IFGA 3ORKA 5E8YA 3V6RA 2AUHA 5HG8A 5I9VA 3KK8A 1URWA 4EH6A 2W17A 4GFMA 3C4CA 1W7HA 3LM5A 3ZH8A 4XG8A 4IAZA 1P4FA 2HWPA 2C69A 3O0GA 3ULIA 3AT2A 1YVJA 3A60A 4LGGA 2Z7QA 4OTIA 3LM0A 4AA0A 3MYGA 5A9UA 3FI8A 3HP5A 3KGAA 3QD2B 2GHLA 3DZQA 2EWAA 3F6XA 2WZJA 3QA0A 4FKUA 4IX3A 5FD2A 4C4FA 4JQ8A 5LCJA 3BEAA 3NNWA 2BR1A 3L1SA 4U42A 5FG8A 2W7XA 2WTJA 3R73A 4L3LA 4YC3A 1PXMA 4FK3A 4FT0A 4BBFA 3G0EA 1U54B 3BU3A 5AP0A 1JNKA 2OH0E 3SXFA 4TWOA 5DWRA 3OHTA 2HELA 5CNNA 2RSVA 2UW8A 2F9GA 5A14A 2PSQA 5GJGA 5CF8A 5AP3A 3ZUUA 4EKKA 2QC6A 2YAKA 3QKMA 4D5KA 4DFNA 3VJOA 5D12A 4XEYA 3OCSA 2PZPA 4BICA 3ZCLA 5BYYA 3PPJA 4G6NA 4DFLA 2CPKE 3Q60A 2XNMA 3QCYA 2UW6A 3TUDA 3L8SA 1H27A 1ZOEA 4RT7A 1P5EA 3E3BX 2IPXA 3A62A 4O91A 3DBEA 2ZVAA 4GKIA 3EN9A 2OI4X 2UW4A 3O50A 5KMMA 4PY1A 4EOJA 5A6NA 3W2PA 4IHPA 2R3PA 1H1WA 2C6LA 3QLGA 5EHYA 4EH7A 2WMSA 3FZPA 3HX4A 2EU9A 4PNIA 1WVYA 4F9CA 1H24A 3NNUA 5I3OA 4ASEA 4RSSA 2HYYA 2JKOA 3R00A 4H36A 4EK8A 4J52A 4FNXA 5JZJA 3KXMA 3MFRA 5CT0A 4I5HA 5F95A 5KZ0A 4EK4A 4WOVA 2GU8A 1FQ1B 2X0GA 3D7TB 4HCTA 5DNRA 4IIRA 2BKKA 4DEDA 3DGKA 3E8EA 4RQVA 2BAJA 2PY3A 4LGDA 3UIXA 5BUJA 2B55A 4YZNA 5M08A 2W99B 3EZRA 3GCQA 5TO8A 4G6OA 3ZLWA 5CTPA 1REKA 2C6EA 1IRKA 3CKXA 5HOAA 3PE1A 2CKQA 4EQMA 3RVGA 4JI9A 2I0YA 4FKPA 3PDTA 5K0XA 3EQDA 4KNBA 4CCUA 2QODA 3NYOA 2WEVA 3GT8A 3C4XA 4OT5A 4RC3A 4NKSA 5C8NA 3CP9A 2ONLA 3R1QA 4ZZOA 1V0PA 2Y9QA 5CSXA 4USEA 4APCA 5HNGA 4B9DA
chains in the Genus database with same CATH superfamily
2ZV2A 4BN1A 4Q5EA 3TI1A 3D7ZA 4K6ZA 4RVMA 1OBDA 4DFBA 5AP4A 3KQ7A 2W1ZA 2IW9A 4EHZA 2GQRA 1OITA 1IASA 2Y7JA 4IAYA 3LFAA 2XYUA 4M12A 1FOTA 3POZA 3UOLA 2JIUA 2W4KA 4IB5A 2VTNA 5B7VA 3KF4A 1WBOA 4IB3A 5J9YA 1Q8UA 1ZOHA 1ZYSA 2BRNA 2OJJA 2X81A 2ZDTA 5G1XA 3NWWA 3IDCA 2F7XE 3WZUA 2P3GX 4AG8A 1SVEA 3R8MA 4ERWA 4E4MA 3RAWA 2JBPA 4YJPA 4KAOA 3UVQA 3DTCA 2P33A 2CGUA 4K1BA 3R9OA 4C4EA 4DEGA 2YWPA 3VUHA 3JY0A 4V01A 4FNZA 5A4LA 5J9ZA 5L2WA 3BE2A 5EHOA 1W84A 4FL1A 2BTSA 1IR3A 5IA0A 4EH3A 5HQ0A 2W9FB 4FTCA 3F9NA 5IU2A 5CEIA 3DB6A 1GZKA 4D0WA 4LI5A 1MRYA 5ANDA 4ZY5A 4ZK5A 4ZLZA 1FMKA 4W4YA 3E87A 4WNPA 2J0KA 3BWFA 4I6QA 4TNBA 5AV4A 3CS9A 4FTNA 5BUEA 3TZMA 3C1XA 4CV9A 1GNGA 3JYAA 1G8AA 3A61A 2PE1A 2YACA 4GG5A 3R21A 3U4UA 2ZJWA 3THBA 3EFJA 3QKLA 2OIBA 3D2IA 4HOKA 4AZVA 4ZS4A 2HIWA 2UZLA 2V62A 1H1PA 4O22A 3FXZA 4UN0C 2CLXA 4A4OA 3PLAE 2E2BA 2ONLC 2XYNA 3ALNA 2QOOA 4BF2A 2X4ZA 1GZOA 1MQBA 2H34A 2Q0NA 3W1FA 5HU9A 4E26A 3QLFA 1SYKA 4MD7E 5EKNA 2BAQA 3BI6A 3NYXA 2R3LA 2X6EA 1YOMA 1YXSA 2B7AA 5AV0A 3QFVA 4EHEA 2XBJA 3MW1A 2YABA 3CD8A 4J53A 3UC4A 3IW8A 4RPVA 3WIKA 3UP7A 4NW6A 5AV1A 3HZTA 1QPCA 4ANMA 4FV2A 1Y6BA 4AXFA 1LPUA 2O8YA 3T9IA 1BI7A 4HVSA 3QTSA 4MXAA 3H0YA 3E8CA 4CQEA 1V1KA 4E3CA 2BRHA 4PNKA 4RIOA 3U9CA 3UIBA 3A8WA 1YQJA 2YJRA 4H3BA 3BHYA 3NX8A 3HV3A 4C2WA 2I1MA 4D1XA 4JQEA 4QTAA 3FZRA 5KNJA 1SVGA 2JIIA 2ZOQA 3PVUA 4I6BA 3GFWA 4WSQA 3CGOA 4HCVA 2HXQA 5HKMA 3UE4A 3FYJX 4AGCA 3WILA 4F9BA 4EI4A 1VJYA 5KZIA 4C3RA 3F82A 3S95A 3SW7A 4O0TA 4C58A 2VTQA 4GJ3A 4D1SA 2LGCA 2QOKA 5ANOA 2VTTA 3FQSA 3VHKA 4G3CA 4CTCA 4FTUA 3F7ZA 3K2LA 4CG9A 4QMWA 1IAHA 3Q5IA 3W18A 4CKJA 4KSPA 4LGHA 5EW8A 5JGDA 2XJ0A 2C6TA 3F3WA 3V6SA 3V5QA 4AX8A 3MVLA 2ZFYA 3Q52A 4BDGA 4MTAA 4DT8A 3R1NA 2QOHA 5KE0A 5AM7A 5F94A 3EN4A 5AR2A 4BCQA 4WBOA 4I1ZA 4F9YA 5CAQA 3WYXA 3MB6A 5EH0A 5BVNA 2QCSA 5HO7A 1UKHA 3ZDIA 5AAFA 4FSYA 2WTCA 3EKNA 2BMCA 4QP4A 4R5YA 4QYYA 3TYKA 3ERKA 3HL7A 5EYMA 3BHVA 3FYKX 5A3XA 1DM2A 3CJGA 4FZDB 3D2KA 4CXAA 1NVSA 1A48A 5BQ0A 4CFXA 4YMJA 4AN9A 2CKPA 2ACXA 1PHKA 4EONA 4IVCA 5KKRB 4O4DA 3C13A 5AMNA 3KRLA 2QOFA 4ZLYA 4XG9A 2KTYA 2H8HA 4M66A 4J7BA 3QGWA 4IFCA 2YWVA 2SRCA 4YNEA 4EQCA 5JKGA 3F5UA 2FVDA 3NSZA 5DR2A 5EW3A 3WF5A 4Q9SA 3UDSA 4CLIA 4M7IA 4MBIA 2C0OA 4O6LA 5B2KA 1M2QA 4AZWA 3FAAA 4YZBA 2UVYA 3H3CA 1ZYDA 1Q3DA 2A27A 2C3LA 3AC4A 3FC1X 5CALA 4DTBA 1OPLA 5CT7A 3WF6A 4G9CA 1OIRA 2QR7A 4OTRA 5FEDA 4DT9A 3ZMMA 4I3ZA 3DU8A 3LAUA 2IZRA 4FICA 3KXXA 4YBKA 3SAYA 5EYCA 1PKDA 4AXDA 3WF8A 4M3QA 4AFEA 5J5TA 2YEXA 3HMIA 2CHLA 4C38A 4O4EA 3TV4A 1UU7A 5AAGA 4BCGA 4X7QA 1R0EA 2W05A 3D4QA 3EIDA 3BEGA 3F61A 4YHTA 4C4HA 4CSVA 2QO9A 4ACGA 5BYLA 5HG9A 4ASXA 3TT0A 5DT0A 3W0MA 1CKPA 2WU7A 2QKRA 3COHA 3HRFA 4IAIA 4W9WA 2J6MA 3UG2A 2GFSA 4CMTA 2RFNA 5DBXA 2GNJA 2X2LA 3BKBA 2XB7A 1Q5KA 5ETFA 2ZV9A 4I20A 4LL0A 5ANJA 5ACKA 2XK9A 5CEMA 3ML1A 5IEXA 2X39A 4RJ6A 4FV8A 2BRGA 4TYHA 4CYJA 4DA5A 3NPCA 2IVTA 1L3RE 2YCSA 3NYVA 5CXZA 3R02A 4IX4A 3C9WA 2VRXA 2WELA 4JIAA 1OUKA 5CWZA 4FSMA 5M51A 3OEFX 3LFNA 4MHAA 1M17A 1PMVA 1ZZLA 2VTHA 1R78A 1TQIA 2WOTA 4MKCA 4B6LA 5HESA 4G1WA 5HICA 4O84A 4DHZA 4G5PA 4PMPA 4FGRA 3G90X 3QAME 4J8NA 5KMKA 1DAYA 4N0SA 1OBGA 1J1CA 4YJRA 3CY2A 4MVFA 4AW2A 1KE6A 2NO3A 5ETCA 3UVPA 3C4EA 3Q53A 4RJ4A 3LQ5A 4YZ9A 3RHXA 4AP7A 4FSTA 2WTWA 4UMUA 2ITNA 3LCSA 2VD5A 4TYHB 5EQPA 3EQHA 1O6YA 5L3AA 1P14A 2FSTX 2GFCA 2IWIA 3AD5A 3CPBA 4L67A 3A7JA 4WT6A 4XCUA 5DIAA 4GK2A 1FGKA 3ZSIA 3WOWA 4EK3A 3GC9A 4DH5A 3Q4ZA 5DT3A 3TNHA 3I4BA 5IQCA 5HD4A 3MB7A 3LW0A 2BIYA 4QMMA 5CF4A 4QOXA 3N9XA 4Y8DA 2C3JA 3KMWA 2P2HA 2W1IA 3MPMA 4YHFA 5BVDA 5LVLA 4XBUA 2B9HA 3QXPA 3QRIA 1XH7A 3KY2A 3HYHA 4EBWA 3O23A 4R8QA 3VQUA 2CN5A 1GY3A 3OUNB 3LVPA 4PL4A 2XKDA 3VBVA 2XK3A 2W1GA 4O7TA 3RPYA 4O7NA 3S3IA 1OKZA 2QQ7A 4DLIA 2C0TA 4GYGA 3QYZA 3I6WA 3LE6A 4O2PA 5EOLA 5AX3A 1KV1A 5HGIA 5C03A 5G6VA 4M97A 4FG9A 3NEWA 2X1NA 3W2RA 5IDNA 4DG2E 4BJJA 2NP8A 2VO7A 4ARKA 2PVKA 4BB4A 5A6OA 2I0EA 2RGPA 3UBDA 5HBJA 3TNIA 2YIWA 3LJ1A 3Q9ZA 5HZNA 5C9CA 1YWRA 3BHTA 4I41A 1ZAOA 5HO6A 4LG4A 5M06A 2C5YA 2X7GA 5LJJA 3QBNA 1KSWA 5DE2A 3ELJA 3FPQA 4BCHA 1VR2A 3FZSA 4IAKA 3UG1A 2R3GA 1Q62A 4U40A 2R7IA 4FBXA 4C2VA 4DH7A 1ZARA 3G6GA 3II5A 5J5SA 5JFVA 3W0SA 4AQCA 5KO1A 2BDFA 3PRFA 5E90A 5E9EA 4FODA 4YTCA 4TYJA 5AR5A 4B8LA 3EQBA 3TZ9A 5CLPA 3MJ1A 3O51A 1Q61A 3LCDA 3MS9A 3OCGA 3PXZA 4FK6A 4L6QA 4AACA 4BR3A 1BYGA 4WHZA 4ZJIA 5HLNA 4O82A 4O7WA 4O1OA 3RM6A 5DA3A 4RWIA 3DJ6A 2QNJA 4CMOA 4FSWA 3LJ0A 3F3UA 2R3KA 1B39A 4FTQA 3LLAA 2YJSA 4O83A 5IQAA 3PJ2A 3CQEA 4S30A 3OD6X 3VIDA 2BRMA 5CXHA 1JLUE 5GZ8A 1GZNA 4W9XA 3QX4A 3I7CA 4C3PA 2ZDUA 5HU3A 4FT3A 3TNWA 2C5NA 3MV5A 2WQNA 3ZSHA 1REJA 3VAPA 3BHUA 3GCVA 5H9BA 3KB7A 4X3FA 2BILB 3I7BA 3SV0A 2AYPA 4WNOA 3O17A 4D9UA 2WQMA 3QUEA 1VYZA 3DJ5A 3ORMA 3QQJA 5IISA 4FIJA 4HZSA 4KB8A 3L9MA 3H9OA 4QNYA 3TKHA 4UMRA 4QD6A 2XM9A 5EI6A 3QL8A 2NRYA 2BHHA 3C50A 5HVJA 4YTFA 3S4QA 5IPJA 3DJ7A 5EM5A 3VUGA 4JBVA 2VGOA 4AFJA 3GBZA 1I09A 3UDZA 2X9FA 5IKWA 4FEXA 2Z7RA 3ZO2A 1YXXA 3TWJA 3KK9A 4AOJA 2KULA 4LOOA 4X2GA 4ZSGA 5K5NA 1NW1A 2C1AA 2WMTA 5KUPA 4FA2A 2GPHA 4X3FB 4H58A 3P23A 4I94A 2PU8A 5LMKA 3ZFMA 3N4VA 4D1ZA 1WBPA 5E8UA 3SHEA 2R3JA 4IMYA 4FE2A 4PP9A 1NXKA 4WSYA 2VN9A 3PIXA 4R7HA 3R63A 4DFUA 1OECA 1GIIA 2XK4A 3UTOA 4IWDA 3IPHA 2WPAA 2YM7A 4PL5A 3RK9A 1V0BA 3U6JA 1UWHA 3LCKA 4A9YA 3NMUF 1FGIA 5BPYA 1OB3A 4FKIA 3VS5A 4JR7A 4C36A 5IMEA 2BCJA 4DG3E 1UNGA 1M7QA 4X3FC 5F1ZA 4TTHB 5DGZA 3W32A 1M7NA 3FL4A 4JL9A 4PMTA 1YWNA 3HMNA 1OL5A 1G8JA 4C0TA 1H28A 3I0OA 3D5XA 4R3RA 5KMIA 4XG2A 2BDJA 4BIDA 3MTFA 3AT3A 4FTRA 3ZFXA 2PMNX 4BYJA 4R5SA 4FV5A 5IDPA 1MUOA 4ANQA 2IVSA 2PVYA 4C8BA 4GJ2A 2UZUE 4EBVA 5A4QA 5EFQA 3G5DA 1W98A 3ZEWA 1E9HA 1H25A 3NRMA 5E91A 5ETIA 1L8TA 4JMQA 1YOJA 5EQEA 3FI3A 3TUCA 1XBBA 2WHBA 3ORXA 3OROA 2JKKA 2WIHA 2WNTA 2OJFE 4PTCA 4RVLA 2XZSA 4QMQA 3WZJA 4A4XA 4L3PA 5LMKC 3IOKA 3ORNA 4Q5HA 1UU8A 4U81A 5CENA 5T6KA 4C62A 3VUKA 5FTGA 3OFMA 2VZ6A 4M0ZA 1XH5A 4RIYA 1OMWA 3A7HA 2OXYA 4O2ZA 4ACHA 4CVAA 2BHEA 3CTHA 4IAAA 4TYGA 2V0DA 4QMTA 3PJ1A 4JAIA 2WTKB 3COMA 2O63A 4QYHA 4AF3A 2CLQA 4KRCA 3PFQA 1PYEA 4O0RA 4DEEA 2IF8A 4XMOA 2RF9A 3R8UA 4BWXA 3C0IA 4FSUA 2OKRA 3S2PA 2WO6A 2PULA 4FJVA 4X6RA 3PJCA 4IQ6A 4ZXTA 5IQEA 4WG5A 3DZOA 4BDAA 2PUPA 3BLQA 3BZ3A 3RK7A 4IANA 2XKEA 4IM2A 2HCKA 3EYGA 5EM6A 2FUMA 4YLLA 5KMNA 2G2HA 4M15A 3KEXA 2J90A 2E9OA 2HOGA 2JKQA 3FMEA 3QUDA 3H9RA 3UZRA 1QPEA 2WTKC 1W82A 4JRNA 4XV2A 2A1AB 5HG7A 1GOLA 4I24A 5AEPA 5GINE 2ESMA 4JOAA 4APPA 2BUJA 3BU6A 3D5WA 1JSUA 5K5XA 4G3GA 3G15A 3KC3A 3P79A 3OW4A 3OY3A 3QCXA 4AN2A 4EOIA 2IW8A 4PDPA 1J3HA 2OJGA 3WBLA 2XH5A 2XKCA 3DBDA 3GI3A 2I6LA 3IO7A 2RFSA 3EQRA 4J71A 5CZHA 2FSMX 2QOLA 5AIKA 2HAKA 2W1EA 4EOMA 1NVQA 3WZDA 4AXCA 1YHWA 4GH2A 4LMUA 2C5OA 4E4XA 4YC6A 4R6VA 3QD4A 4F0GA 2GQSA 2WQEA 3ZC6A 1X8BA 3NUNA 5JGBA 3U9NA 5KCVA 1RQQA 2PVMA 4YNOA 3RPVA 4QMLA 1IAJA 5GJDA 4ZZMA 4ANSA 3K54A 4OTFA 2B53A 3D9VA 3FE3A 4PRJA 2XP2A 4N70A 4PUZA 4ANLA 3ID6C 1XHAA 3DNDA 4FTKA 4BFMA 3CPCA 1OPJA 2C68A 4UEUA 2YITA 4IZYA 4FSNA 4G31A 1WBWA 2F4JA 4FKGA 4PTEA 3O5AA 1MRVA 3OY1A 3M2WA 4GVAA 5E1SA 4ZJJA 3MI9A 1YHSA 1Q8TA 1YI4A 3ZBFA 2WQOA 3VS6A 4LFIA 3VS2A 2UZEA 4D2WA 3FKLA 4MEDA 3TIZA 3V5WA 4I6HA 3TDVA 2J0LA 3MFUA 4GRBA 4RQKA 3V8TA 3DTWA 3GXLA 4IZ5A 2G9XA 4OBQA 4F6SA 2XARA 4X2FA 5KMLA 3ZO4A 4G3FA 3OBGA 2OJIA 3LMGA 5FP6A 5EM7A 4CRSA 2WMQA 2YISA 5J8IA 2UW5A 2WIPA 4N57A 4DHIB 3FZTA 5DEYA 4YJSA 5EG3A 5A54A 4H3QA 2QU6A 2WMBA 3R28A 4A7CA 2OIDA 5DVRA 1Q97A 5FXSA 4YHJA 2HZIA 4IWQA 2QOIA 3IW5A 2AQXA 4DGGA 5IQDA 2EB3A 4BIBA 3TIYA 2BRBA 3DBFA 3U8WA 3GU5A 3BX5A 2GS6A 2YIQA 3ACJA 5CF6A 4TT7A 4I23A 2VO0A 1SZMA 1JAMA 2C6KA 1MRUA 3PP0A 4IX6A 3P7BA 1LEZA 2W4JA 3PRIA 3D5VA 4XJ0A 3DT1A 5DFPA 2FSLX 4ZSLA 3DBCA 4FYNA 3UO6A 3O8PA 3OVVA 3P78A 3W8QA 3CCNA 5B0XA 4EL9A 3HAMA 4O6EA 3ANRA 4RC4A 1ZMUA 3DFAA 2F2CB 3BLAA 1OKWA 2W1CA 1R1WA 3UIMA 4YGAA 4JT3A 4PMMA 3N51A 3Q9WA 2OFUA 3I5ZA 3OW3A 3WF7A 4ZLOA 3L8PA 5LCKA 1KV2A 5FP5A 3VRYA 3WE4A 4ALUA 3NVMB 3BL7A 2F7ZE 2IEWA 4JDIA 3KRXA 3RINA 5M55A 4GCJA 3V5JA 5CAPA 4G3DA 4ZY4A 3RKBA 5GIOE 3RI1A 3V04A 3UODA 3BE9A 4U9AA 4W4VA 3W8LA 1FINA 2B9JA 4DH1A 4K33A 4CFNA 2VV9A 3SDJA 4AW0A 4AZTA 5JH6A 5L4QA 3AKLA 4DFYA 4U41A 3SRVA 2A2AA 2X0OA 4FIHA 2XNGA 3UC3A 4J97A 1BX6A 4FKTA 5ICPA 5JFXA 1O6KA 4E5BA 3OS3A 1O9UA 2X8IA 4X21A 4MD8E 2YCQA 4XYFA 3D0EA 3PYYA 3MH2A 5AJQA 4CCBA 2UVZA 5IQFA 2VO6A 3PY1A 3ORLA 4BHZA 5I9XA 4E5AX 4XP3A 3VRZA 3F7WA 2ETKA 3MH0A 4AWIA 4O7VA 3E62A 2QO2A 2Z7LA 4FV3A 4WKQA 5KBQA 4IWPA 4EYMA 5IQBA 4L45A 4OUCA 4RFZA 5D41A 5FQDC 3SOCA 4CKIA 4HNFA 5C4LA 3PSCA 4UV0A 4IW0A 3EL7A 3F2NA 3ZHPC 3FLZA 2I40A 3HRBA 2GCDA 2W1FA 3KVXA 4DGOA 3SVVA 4MD9E 3EQCA 4NSTA 3KCKA 4UZDA 3BU5A 5CVGA 4A9TA 4UWCA 4QP8A 4I0SA 3A2CA 4N4SA 1R39A 2ZM1A 3HV5A 3DKCA 2JDVA 3JUHA 3NGAA 4FVRA 2JKMA 4LRMA 5FTQA 3HP2A 1F5QA 3BBWA 3KRRA 2JLDA 3WYYA 2OK1A 3NR9A 2R4BA 4KABA 3R83A 3REPA 3ODYX 3QQGA 4HYHA 5CYIA 5FM3A 4ITIA 4H1JA 5I9WA 4AZSA 3ZTXA 4EH5A 3Q9XA 3TV6A 3T8OA 2GS2A 5D7AA 1M2RA 2R0UA 4QTCA 2WB8A 4H05A 5TKDA 3V8SA 1TVOA 1FVVA 1KUTA 3RAKA 5IQIA 3W0NA 4R1VA 1ZY5A 4YC8A 2UZVA 4AT3A 3QU0A 4FTJA 3FMHA 4BYIA 4QMNA 2Y8OA 4JJRA 4KRDA 3LCTA 4RMZA 1ZRZA 3BRBA 5H8EA 4E7WA 2YM6A 1P4OA 3ZRLA 3UZPA 5EOBA 4O81A 2ZM4A 3MGYA 1BUHA 4V04A 4O38A 3TMOA 2YHVA 5J95A 5HNBA 1SMHA 3OT8A 1W8CA 3RAHA 3UJGA 5IUGA 2XRUA 5DOSA 4QDEA 3R01A 2E9UA 3SKCA 3PPZA 4C33A 3VUIA 4FL3A 3OWJA 4JBPA 4FSQA 4BDIA 4JNWA 4EHGA 5AIRA 5L8LA 4G16A 5K9IA 1B38A 5AP5A 3RJCA 3VW8A 2JC6A 4YLJA 3P9JA 2VNWA 4P7EA 2OO8X 4HW7A 4EJ7A 3OWLA 2ITZA 3PJ8A 5AUVA 4AUAA 4DBNA 5L2IA 2XM8A 3UDTA 4NEUA 1RE8A 4F6WA 4B8MA 4O21A 3GOPA 4O0XA 4XV3A 3LXKA 4EH4A 3DV3A 3AC2A 4OTHA 4ZS0A 3R9DA 3FC2A 2PWLA 5KX8A 5FRIA 2R2PA 4JS8A 3BQCA 3ETAA 4DGLC 5IEYA 1YKRA 4OW8A 1ZYCA 3FWQA 5IUIA 4Z3VA 3KFAA 2Z7SA 5A4CA 3FMNA 4MUQA 4NUSA 2PPQA 3C4FA 3IW7A 2VTLA 4DGNA 3UQFA 3HMPA 1FVRA 4JXFA 5AADA 4QQJA 3PXRA 1XMLA 4YZMA 4XS2A 3GU6A 2BAKA 3O8UA 2WGJA 4DH3A 2CNVA 3TNPC 3I1AA 3GVUA 3AGLA 3BV3A 3COIA 4YTHA 4BDKA 1SM2A 2JDTA 1UWJA 2VX3A 1NA7A 5FEQA 3UYTA 4HPUE 4ITHA 1VEBA 3DAJA 3F88A 5EKOA 4NW5A 4G9RA 3A4OX 1ZMVA 2Y4PA 3NUSA 3FLWA 5BX0A 2PL0A 5EYKA 3VQHA 3EFLA 3VULA 4CQGA 5M53A 4KIQA 4KIKA 3R7IA 4EK6A 3F2AA 4BVUA 5BNJA 5LVNA 2VTSA 3QRJA 4UYAA 3ROCA 4A07A 2V22A 2C5XA 3KRWA 4YU2A 3TKUA 4YZDA 5E8VA 5HEZA 4CFUA 3PG3A 4Z7GA 3OZ6A 4CKRA 4EYJA 3LXNA 2IZSA 3FI2A 3QTUA 4O4CA 3W10A 3E92A 4DITA 1ZWSA 4KKHA 4KIPA 2PVNA 4DC2A 2OIQA 3MVHA 3UP2A 2WMAA 4CYIA 3AMBA 4G5JA 5DRDA 3RM7A 3L8VA 3NNVA 4ZP5A 3NCZA 3WZEA 4YP8A 3COKA 4AOIA 3LMIA 2UV2A 4RA5A 4U45A 3R8LA 3RCJA 4IADA 2GDOA 4RJ7A 4HNIA 1XO2B 3QZIA 3KXZA 3O7LD 1RDQE 1Z9XA 1BLXA 2PMIA 1U46A 3NIZA 4YPDA 1JBPE 5M4CA 3TM0A 2CN8A 1JSVA 3FSFA 4GS6A 2I0VA 3EOCA 2V55A 2B0QA 2PMOX 2H96A 2UW3A 2DQ7X 1ZY4A 4JRVA 4I5CA 3TACA 3EQIA 3VHEA 5JFSA 5FBNC 2JFLA 3FPMA 3OCTA 4A9RA 2XNOA 4NWMA 3TEIA 3HNGA 4DGMA 2R0IA 3PSDA 3QTXA 2OH4A 4WIHA 5CU6A 3BYMA 4AU8A 2G15A 4U3ZA 5CI6A 4FSRA 2XNPA 4UXQA 4PDYA 4S32A 1G3NA 4D28A 2CGWA 5FLFA 5I4NA 5IH5A 3L9PA 4DBXA 3RZBA 3K3JA 1LP4A 3HA8A 3EFKA 1FBNA 4OTDA 4OBOA 3H30A 4UYNA 4ASZA 1JWHA 4DF3A 4D2RA 5I3RA 4X2JA 4G17A 5AR8A 2R3NA 1WBVA 1G8SA 2XALA 1W2FA 1XH6A 2W1HA 2VWXA 4BTFA 2EXEA 4U44A 1PMUA 2F2UA 4L01A 4NIFA 2UZTA 2BIKB 3HV7A 3C5UA 4RX8A 3ZU7A 3ET7A 5FDXA 3R2BA 2HK5A 2R3QA 3OXTA 2XA4A 3F3ZA 3K5VA 4K9YA 3M1SA 4MXYA 4RVTA 4U5JA 4AGWA 3I5NA 4GKHA 1SNUA 2CMWA 4IXPA 5DMZA 3FHRA 4NT4A 3AMYA 1SVHA 4EH9A 3VVHA 2XJ2A 4FX3A 5LWNA 2YZLA 3EWHA 3NVKI 3MPAA 3ZONA 3B2WA 4OBPA 4F0FA 3GGFA 3OEZA 3RK5A 5CVHA 3UO4A 4L44A 3QC4A 4RBLA 5JMSA 3P7CA 3ATSA 3DFCB 3UOJA 1PXJA 4NYEA 3Q2MA 5HIEA 4F1OA 4NM3A 3PTGA 4FOBA 3IK3A 4NM7A 2Q83A 4MNEA 5J9LA 1H1RA 3R9RA 2YM8A 2ITQA 3KULA 1UNHA 3PA3A 3VF9A 1W2DA 4NIFB 3W0OA 1DAWA 3R7YA 2X0PA 2VU3A 3DLZA 2VTOA 3BPRA 1YW2A 3QCSA 1YDSE 3WF9A 4DTKA 5ANIA 5C8MA 2YLEA 3FDNA 4IJ9A 1H08A 4ENXA 2C0IA 3GQLA 5H8BA 2UW7A 1Y91A 3NAYA 4QMYA 5CU2A 2RG5A 4DE4A 4I0RA 3HDNA 1MQ4A 2HENA 4K8AA 4JX7A 2QI8A 5DRBA 4AQKA 2PTKA 4QTDA 1XMMA 5HHWA 3QTRA 2OF2A 4O7YA 4USFA 1YOLA 3PWYA 3RAIA 1QCFA 3R7EA 1YRPA 4QMUA 5ANGA 3MY5A 4LMNA 5IH6A 5KMOA 3PSBA 1U5RA 3EHAA 4RJ8A 5HCZA 1Q8WA 4O7ZA 4MNEB 4D4RA 3ZXZA 2AC5A 4XX9A 5DHJA 3FLYA 5L8JA 3TDWA 3PWDA 4NFNA 3G33A 3RALA 4M14A 4FSZA 4ALWA 4KIOA 4B0GA 3UQCA 2CNQA 2XKFA 2XIKA 3QTQA 4MF0A 3UO5A 4BCJA 2UW9A 5CQUA 3ZLSA 2ETRA 2QU5A 1BL7A 3HVCA 4AW5A 2H6DA 2OW3A 3Q96A 3LJ2A 4FNWA 2ZV7A 3WI6A 4BGGA 4O4BB 2JAVA 3I60A 3IOPA 3GFEA 4BCMA 3ZLXA 5LVMA 2XCKA 3RNIA 2ZB0A 3E7OA 3BGQA 4HYUA 4B4LA 1PXPA 3NNXA 4BDFA 1CKJA 2QURA 4HYIA 2OZAA 4R7IA 4BCPA 3W2OA 4DFXE 4QYGA 2J5FA 3KCFA 3CQUA 2UZNA 2P55A 3MH3A 2VWUA 4LM5A 3Q9YA 5AV2A 5CEPA 5FDPA 5I9ZA 4O86A 4ORKA 3SD0A 3NFFB 1WVXA 4FV0A 4UWBA 4WUNA 4QEBA 3UZTA 1HCLA 2R3RA 4QDVA 4FI1A 4BKJA 2A98A 3QD0A 1QPJA 1UNLA 3FJQE 4HGTA 1PXKA 2XEZA 4AT4A 2QLQA 4ENYA 2IO6A 2FYSA 4EOPA 4O1PA 4TXCA 3BGZA 5CU4A 3ZC5A 2JEDA 4FEUA 2VO3A 4BC6A 4TWCA 2Z02A 2B1PA 5IA1A 5CQWA 4YO6A 4ZTNA 4ZIMA 4P5ZA 1WVWA 4Y72A 2QVSE 1PXLA 4RIXA 2X2MA 3KRJA 4M84A 5BVWA 3BHHA 1YXUA 3OBJA 1CM8A 2YERA 4L43A 5CSHA 3AGMA 4BKZA 2GHMA 5IA4A 3HLLA 4NU1A 4NK9A 5CNOA 4PQNA 1IEPA 2R3HA 4ID7A 4D2SA 4UMPA 1HCKA 5AP2A 4FGBA 3V51A 3Q6WA 4BJJB 2J4ZA 3PLSA 2EB2A 4AE9A 4C37A 5L6PA 3VC4A 5LQFA 3Q4UA 2HW6A 3HUBA 2IN6A 5EI8A 4FRFA 4BCNA 5AA9A 1XH8A 1WBNA 5CI7A 3SXSA 1ZYJA 3CE3A 3SLSA 5KHXA 2VX0A 4WO5A 5BVOA 1ZZ2A 5J7HA 3PIYA 4J98A 5LMBA 2ETMA 4Y83A 5H8GA 2G2FA 2VWWA 4X6QC 3QQFA 5AP7A 3ZDUA 5HG5A 1NVRA 3TG1A 4C57A 4HVGA 5GJFA 3TUBA 2W06A 5LVPA 3DK7A 3DB8A 1J1BA 2WFYA 4QMOA 5HBEA 4AZEA 3F5GA 1K3AA 2XRWA 3UVRA 5LWMA 4JAJA 3R7VA 4EJNA 3DXPA 5DPVA 4LYNA 2JBOA 4IZAA 3HMMA