4C34A

Pka-s6k1 chimera with staurosporine bound
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
340
structure length
336
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title The Discovery of Potent Ribosomal S6 Kinase Inhibitors by High-Throughput Screening and Structure-Guided Drug Design.
pubmed rcsb
source organism Bos taurus
total genus 106
structure length 336
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c34A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c34A02
5FG8A 3OFMA 4JBQA 1OKYA 4L43A 3HKOA 1BYGA 4FSYA 4Z16A 2Y4IC 3F2AA 3PWYA 5K0KA 3R9DA 3V8TA 2JKOA 4BCMA 1UWJA 5EHLA 4NU1A 2SRCA 3KL8A 3VS5A 4CFWA 3R83A 2QOCA 5D9HA 2B7AA 1GOLA 1ZYJA 1CMKE 3FHIA 2VO0A 4BN1A 1PYXA 4AQCA 4XS2A 1FINA 4O2ZA 2CPKE 4IBMA 1JKKA 4O0SA 2UUEA 3TUCA 3TT0A 4EUTA 4I23A 2V7AA 2WOTA 2WQOA 2CCHA 4RIOA 1H25A 2FVDA 4G34A 2A19B 4LUEA 4AE6A 3LIJA 4AE9A 1OIYA 1LEZA 1TQIA 3OOMA 3QTUA 3Q60A 4ENXA 2R3KA 1Q97A 4KUJA 1WBNA 4RG0A 4EHZA 3M42A 4I94A 2UW7A 3VNTA 2ZM1A 4BCOA 4D0XA 4V0GB 3OY3A 5T6KA 4FKIA 3LFSA 1KE6A 5CYIA 4W4WA 2JDSA 2WXVA 3P79A 3OY1A 3QRUA 1H00A 3DFCB 1O6LA 3HMIA 5EW8A 4BWXA 5K3YA 4UWYA 3OBGA 3C13A 5IQCA 4HZRA 4C4GA 1TVOA 5B2LA 2FSOX 2GTNA 2BKZA 4KAOA 5FD2A 2Y9QA 3OCBA 4LL5A 4RIWA 3V8SA 3K5UA 3GBZA 4FKRA 2I0EA 2ITWA 2R3MA 2GNIA 2ZDTA 3ZFMA 4J7BA 2F9GA 4YBKA 5HX6A 4F0FA 1XH4A 3DJ6A 2OI4X 3A8XA 3NW7A 4KNBA 5JFWA 4NEUA 5D1JA 3OW3A 2OFUA 3SXSA 3U9CA 4BKJA 3EQFA 4OTHA 5CEIA 1H28A 3R04A 2YM7A 4DH8A 2QOHA 3OTVA 5F1ZA 2XA4A 1WAKA 5CQWA 1H1RA 2WHBA 3RM7A 3TNWA 2J2IB 4R7IA 3KULB 4BCFA 1MQBA 3IDBA 4F9YA 4OAVB 3JY0A 1YOJA 3P7AA 3UYSA 1PXJA 2ITVA 1NT2A 1KV1A 1OL7A 4Y85A 4I41A 2EVAA 1KOBA 1BI8A 3ZOSA 4C62A 2DWBA 4OLIA 2PZRA 4BHNA 1LEWA 3VQHA 4GG5A 3UE4A 3AC5A 1PYEA 3L8XA 4ACHA 3UP7A 2YZAA 5AAGA 1AQ1A 4FEWA 1O6KA 2C1AA 2OJJA 3UQGA 3PVWA 1K9AA 4LI5A 2VTMA 3R71A 4BKZA 4K33A 4DINA 4HVDA 4MCVA 3LXNA 2RL5A 4F9BA 4GSBA 1Z5MA 1ZAOA 2BMCA 3ZTXA 3G5DA 3VUIA 4DG0E 4F6SA 5LVNA 1R0EA 4II5A 2C47A 5LOHA 2Z7RA 3HV4A 3NUNA 4EH7A 4OR5A 3TJCA 5J9YA 4HYIA 3UOHA 4AWIA 3EH9A 3VWAA 3ORPA 4FKJA 3AT2A 1VJYA 5KMKA 4AAAA 2QD9A 2HZNA 3R9NA 2ZM4A 4YLLA 2QU6A 4TYHA 2FB8A 3CPBA 5CU4A 3V04A 4FV2A 5LVOA 2YWVA 3KMWA 2ITUA 1OKZA 3HMPA 3DOGA 2CNVA 3LXKA 3DKFA 4HCVA 2OKRA 2QR7A 4QYGA 4BICA 2WTDA 2OLCA 2WMXA 4W8DA 4LL0A 4FVPA 5AEPA 2IVSA 3DFAA 1Y8YA 3DJ7A 4TYHB 5IQDA 3TCPA 4F63A 1XH7A 5AP7A 3UZRA 4F08A 4EC8A 4AW0A 4RIXA 2W4JA 1H0WA 5I9YA 4CKRA 3R7YA 5AIKA 2R9SA 3FLSA 3PPZA 1YDTE 2OF4A 4BCKA 1H0VA 1J7LA 3TG1A 3IECA 2XJ1A 1CKPA 2C5NA 2XBAA 3O2MA 5D7AA 4FNXA 2YM4A 5A3XA 3F2NA 4W4YA 5CEQA 1NXKA 4FG7A 3KCKA 4L44A 4OBPA 3NW6A 2RF9A 1H08A 2OJ9A 2ZV2A 4O0WA 4P7EA 5HVKA 4N6ZA 5M07A 2EXCX 3LCOA 5ETFA 2Y0AA 4G6OA 2XK8A 5HCZA 1NVQA 5DT0A 4DGGA 3F2RA 1GIIA 1IASA 3QTRA 3I7BA 4GKIA 4P5QA 5HTCA 3SQQA 4FKQA 3GENA 4Y5QA 4FSWA 3W8LA 5EW9A 5JGDA 2IO6A 4FTOA 3V6SA 5BQ0A 3MJ2A 3EQBA 4ZXTA 5L6PA 3BGZA 3OS3A 3AXWA 4Q2AA 3Q9ZA 4H05A 2UZTA 1ZMWA 3R00A 4MD7E 2WMWA 5JKGA 3VHEA 1UU3A 2HZ0A 3BRBA 5CY3A 4DLIA 1MRVA 2QLQA 2C6IA 3FYJX 4TYIA 5FEQA 4DEHA 1SM2A 3D14A 3GU4A 4QP4A 2VD5A 3AGMA 5E8UA 2G9XA 2X7GA 5BMSA 3D2IA 3TACA 4D4SA 5AM7A 5M57A 1PMNA 2QNJA 4AW5A 4KRDA 3C4WA 3L9NA 2EWAA 2HWOA 3NYOA 2V22A 5BVEA 1Q61A 3OMVA 4PWNA 4GYIA 4XYFA 4LMUA 2G15A 4QMXA 2GQRA 3VUKA 4OTRA 4BCQA 4I6BA 5JT2A 3M2WA 5DWRA 4FYOA 5E1EA 3IW7A 3AMBA 2OXDA 4PMPA 4N57A 2XKEA 2QOQA 2WMTA 4HGTA 2ZV9A 2I40A 2C5YA 3LAUA 4O96A 4BL1A 4CMOA 3FY0A 3ZM4A 4C4HA 3L8PA 2R3PA 5AV2A 1XBAA 2UW4A 3LVPA 4U44A 2KULA 3EOCA 1AD5A 2VTLA 3U8WA 2JBOA 2XK4A 5I9ZA 3BV2A 5IH4A 3NMUF 3K3IA 2W5BA 3ZDIA 4PDOA 3I1AA 2X8DA 3FMLA 2R64A 1PMUA 1O6YA 2OBJA 4D2VA 5JK3A 4WD5A 1OL1A 2WEIA 3HAMA 2BDWA 3MPMA 4JJRA 2I6LA 4GJ2A 4TWNA 2O3PA 3DDPA 3JY9A 2I0VA 3ORNA 4QMWA 5M4CA 5KCVA 4FIHA 2YJSA 4FZ7A 3ET7A 4LQMA 2YN8A 4U40A 4W4VA 4Z7GA 5KMIA 3D5UA 1OITA 3KGAA 5I3OA 3PJ2A 2WELA 2W1GA 4FK3A 3VBVA 2BIYA 3KVWA 3MGYA 3NYXA 3ZBFA 3FMDA 2UZDA 3OXZA 4L3LA 2XNEA 4Q9SA 3U9NA 4H3QA 4AZEA 4F9AA 5CVGA 3DBCA 4O0TA 4TYGA 3QKLA 2J0KA 2OWBA 2VTIA 3EN7A 5H8GA 3ZDUA 3CY3A 4BCNA 2YM5A 3RPYA 2WMSA 3LM0A 1YXVA 2PE2A 3E93A 3MWUA 5DA3A 2X9FA 3OUNB 4BTFA 4CT2A 3HV5A 2X7FA 4EQUA 5KNJA 3POZA 2G2IA 3D4QA 5CANA 3BYUA 3TZ7A 2X6DA 5AFVA 4KD1A 4NSTA 5JFVA 3FMMA 3P7BA 3D94A 4BDJA 2PUNA 4BCPA 2P33A 3KN6A 4USDA 3NUSA 4ZY4A 2PVYA 3U6HA 4LFIA 4X2NA 2P3GX 4H58A 3VBTA 1WBSA 1PXLA 4UZHA 3QHRA 2E9PA 2OW3A 5KMMA 5M06A 4L52A 5LVLA 4DEEA 4O6LA 1OUKA 4R6VA 2X0GA 3EB0A 2XS0A 4FKSA 4JIAA 3TI1A 4AACA 4QMSA 3VQUA 3WILA 2BVAA 2YCQA 4I22A 1CKJA 5HBHA 4J53A 3PXFA 4P2KA 4BC6A 3SOAA 2GNFA 3GXLA 4FSMA 3VRZA 4ACGA 3PA5A 3N9XA 2CJMA 5ITAA 3R7IA 3H0YA 5CU0A 4QMQA 1BL6A 3EQGA 4XOYA 1SNUA 4WUAA 4FEVA 3F3WA 4XG8A 1VYWA 4YO6A 5EDRA 2W1EA 3Q3BA 4Y8DA 4EOMA 2ESMA 2XKDA 3M11A 3EKNA 4QMLA 3PJ8A 1APME 5FDXA 4TXCA 3D7TA 3ULZA 4A4OA 2JFMA 4DHFA 4FT3A 3EFJA 5EHOA 3FQHA 3BHUA 5IA2A 5FXRA 3RVGA 4GL9A 2VO6A 4E5BA 1RQQA 3PVUA 4PTCA 2YAAA 5AUWA 3PXZA 4C58A 4EONA 3TXOA 5KHWA 2OZOA 2ZYBA 4UWCA 2WMBA 4G9CA 4TRLA 4MNEA 5ANGA 2QOOA 5G6VA 3VS4A 4DAWA 3RNIA 4RX5A 4YURA 3MSSA 5CSVA 2J0MB 5J9LA 1PKGA 2YDIA 2XK3A 4P5ZA 4QO9A 1IAJA 3MYGA 4P90A 4TNBA 2DS1A 2UZUE 2W5AA 3NWWA 5HLWA 2CKPA 2VUWA 4K8AA 4RJ4A 4YJQA 1UV5A 2PTKA 4OAUC 4O82A 3W33A 2BRMA 3OC1A 3AD5A 5LMKC 4EK6A 1OBDA 2WTVA 3Q9WA 1Q8UA 5DMZA 4YSMA 3RKBA 1REJA 4CFVA 2WMVA 2GS7A 3D2KA 4FGBA 4YP8A 4PMTA 5DIAA 1ZYCA 4G3GA 2BFYA 3FLYA 2XH5A 4PPCA 2C3IB 2XNOA 4EQMA 5GZ8A 2IW6A 2QO7A 5C26A 5CVFA 4E4LA 3RPRA 3CPCA 4OTGA 4KWPA 4FC0A 4AFJA 5JQ5A 4W8EA 4H39A 3FPQA 1OL5A 4E6CA 2PULA 2W7XA 5T68A 1ZY5A 3GQIA 4NM0A 4BZDA 4USEA 3MH1A 3PXQA 3EN6A 3TL8A 5JSMA 3GT8A 4FUYA 5IF1A 3GEQA 4EI4A 4TWCA 4DG2E 4JXFA 4FV1A 2VTPA 4EHGA 5K5XA 1Z57A 2BZIB 4G3CA 2JKMA 3D83A 3T9IA 5E9EA 4ASEA 4EOKA 3WF6A 3BELA 1OECA 3EN9A 2WU7A 5E92A 3FXXA 5BPYA 3B2WA 5J87A 1Y57A 1YWRA 4CV9A 1PMEA 2GMXA 4LM5A 2IZUA 2C6LA 4MXZA 4JLCA 4ZLOA 4R3CA 4RA4A 5KBQA 3HGKA 4F0IA 3NUUA 4BWPA 1I09A 3GFWA 5CAQA 4GUEA 1RJBA 4O0XA 1XO2B 2DYLA 3KK8A 3C4ZA 4S34A 4HW7A 2C0TA 3QUDA 1YXXA 4ZSLA 3QZFA 2QU5A 2WKMA 4RQKA 4F70A 2HW7A 4J97A 1QL6A 2Z8CA 3MFUA 3RMFA 1H07A 5LARA 1LUFA 3QALE 5L8KA 3LMGA 4X0MA 4AOTA 4B6LA 5CALA 4GU9A 4L3PA 5DEYA 3FKNA 3UIBA 2CGWA 1LPUA 2NRUA 4B4LA 5EI8A 4IW0A 3DZOA 2YA9A 4QPMA 4XBRA 4QNAA 4AZFA 4L6QA 5A4CA 2R3NA 1OPLA 3FZTA 2G2HA 4B8LA 3HUCA 3UODA 4RVMA 2WAJA 4YHTA 3UQCA 2QOKA 2Z2WA 5BYYA 3PLSA 5DH3A 3UVRA 5J5SA 2R3JA 4ACCA 3E7VA 1RDQE 2CKQA 2QC6A 3PZEA 5CI6A 5M55A 4P4CA 2ZMCA 4ZY5A 4Z3VA 3AC1A 1LR4A 5KMJA 1JNKA 5DG5A 4DEGA 3W1FA 3Q6UA 3QL8A 2OZAB 4IX6A 5I5ZA 3TV7A 4ZIMA 3CQEA 3Q4ZA 4I6FA 3ENMA 4BF2A 4D2WA 2JGZA 3QZIA 1UU8A 4RBLA 3LLAA 3D15A 5C27A 3IOKA 3NW5A 4YJPA 5KZ0A 2JAVA 5CEPA 2GHLA 4I5MA 5K5NA 4ZS0A 3UYTA 4GW8A 3SDJA 3CGOA 3ROYA 2BPMA 1G5SA 5IH5A 4V05A 1JKSA 3G2FA 3BHTA 1PY5A 1ZRZA 2RG6A 3RCJA 1ERKA 1GIJA 1FGIA 1OIUA 2QOLA 3NAXA 3PXKA 3DCVA 4A9RA 2UZVA 4K2RA 5AA9A 3FZ1A 4JDJA 2KTYA 2QG7A 3WF7A 4GFGA 4NJDA 5J1VA 1E1VA 2E9UA 2W5HA 2X8IA 5EI2A 4C8BA 4E4MA 1Q99A 4G2FA 3QCYA 2WTKC 4I4EA 2XYNA 4I6HA 1Q3WA 2GNHA 4MBJA 1PRYA 4U0IA 1VZOA 2CDZA 4CMTA 5L2TA 4MWIA 2EXMA 3AT4A 4NM3A 3ULIA 5J1WA 1W82A 5HIDA 3ZRMA 1PXPA 3GU8A 4FVQA 5A6NA 5FGKA 3U55A 2XIYA 3DTCA 1CM8A 4JDIA 5EFQA 2HAKA 3FSKA 2BDJA 4R3PA 4NM7A 2OJGA 2ZV8A 3HDMA 4U43A 5HD7A 3SW7A 5LMBA 4CG8A 2HXQA 3HRCA 5IQHA 2PUUA 3CLYA 2GNLA 4ZAUA 2C6OA 4IB5A 5KHXA 3E3BX 2IZRA 2QCSA 4HOKA 4UXQA 3UIUA 4YNEA 4YC8A 5J7BA 3VUGA 4AN2A 3AD6A 2XCKA 4FF8A 5HLNA 4FBXA 2PPQA 3TV4A 5BX0A 1KE8A 3G9NA 4TW9A 3DK7A 4A9UA 3PJ1A 3U4UA 2PMNX 4E20A 4ALWA 4HGEA 4XJ0A 4BR3A 4BZNA 2E2BA 3KXZA 3QD4A 2WEVA 3R73A 2PUIA 5I9UA 1GZ8A 1F5QA 4M7IA 4IZAA 4IZ5A 5CQUA 2PWLA 5FTQA 5E8WA 3F5XA 4KBAA 4WIHA 3ZEPA 2WZJA 2XK7A 3B8RA 3NR9A 3UNJA 4BBMA 3GVUA 4CKIA 4XG2A 4EH4A 3QXOA 2YWPA 4U8ZA 1H26A 5AWMA 2ZM3A 4BCJA 5LWNA 2O5KA 2GFSA 2OH0E 4XRJA 2BRGA 3HEGA 4R3RA 3EFLA 1NVSA 3Q6WA 3QD2B 1VYZA 4RC4A 1T45A 4RIYA 5HG7A 5CF8A 4I20A 4D2SA 4LRMA 3BE9A 4G3EA 2W05A 3ERKA 5HICA 5HU9A 5AV3A 2PVRA 3R7EA 3A7HA 3C0IA 4I92A 3QXPA 2FYSA 2XK9A 4A9SA 3E5AA 5TR6A 4CD0A 3H30A 3UNKA 5AR4A 1AGWA 4BDIA 1HCLA 4JT3A 5BVKA 5AP1A 4CFNA 3U6JA 5C4LA 3RK7A 2YITA 5HI2A 1OMWA 3S2PA 4KA3A 1KE9A 3KVXA 2XF0A 3V5WA 3KMMA 5IDNA 2ITYA 1ZYLA 5L8JA 5HBJA 1OGUA 5CENA 4S31A 2ZB0A 3THBA 4G9RA 2Y7JA 3Q4UA 2C6DA 4FODA 4WBBB 2VWBA 4FEQA 4TKSA 4ANSA 2WB8A 4XOZA 1PF8A 1XBBA 3L8SA 2VRXA 3QQHA 4HCTA 3DKCA 4DGMA 3DZQA 2GS2A 3F6XA 3OVVA 4XG3A 5ICPA 4HYSA 4ZJVA 5L2IA 2UW8A 3R1NA 3AC8A 5C4KA 1YI6A 4FSZA 5CI7A 3FQSA 4OUCA 4KIKA 5HEZA 4U97A 2R4BA 3KXXA 2ETKA 4FX3A 4RX9A 3N4TA 5AUVA 3UVPA 4C4EA 3F9NA 4HGLA 3UBDA 1WZYA 3WZDA 4D0WA 3E88A 1JSUA 5GZAA 4X2JA 3EKKA 4B99A 4F99A 4XP3A 4BIDA 1UKIA 1XHAA 5CSHA 5IQBA 3A7GA 3HNGA 2AC5A 1SZMA 2W4KA 3PY0A 2F2UA 3CD8A 4IZ7A 4WBOA 2CHLA 5IMXA 2XIRA 1XJDA 4C02A 4CFUA 3W8QA 1ZWSA 3MIYA 1VR2A 4N4SA 3KA0A 3BCEA 3DS6A 4ANLA 2UW3A 5DEWA 4CRSA 3C9WA 5KKRB 3G15A 3NEWA 4C35A 5HNGA 3NCZA 3F3ZA 3KEXA 4JX7A 3COKA 1REKA 4BIBA 2DQ7X 2OK1A 3QBNA 3FMJA 4FTKA 4IACA 4JAJA 4NYEA 2WPAA 4M15A 5AP5A 3QX2A 1OL2A 4LYNA 5HIEA 5M51A 5A4LA 4Z55A 4IC8A 4ZEGA 1SVEA 4GKHA 3E8CA 1J1CA 4GVJA 2BAQA 2OIBA 4JR3A 4RJ5A 2VGPA 1WVWA 3OROA 3EQIA 5HO8A 4G1WA 4BGQA 2PU8A 2JAMA 3QGWA 3VIDA 4A9YA 2VN9A 2XMYA 4EH6A 4F7SA 2CSNA 3HECA 4WHZA 2UZOA 4E4NA 2OFVA 3R8LA 3QQFA 3R2BA 3LXPA 1H1SA 2ERKA 5JFSA 1DI8A 2AUHA 4TYEA 4U6RA 2REIA 5CTPA 5CZHA 4EKLA 2PHKA 4M67A 3DQXA 3C5UA 3O71A 3ZEWA 1SNXA 4L01A 2VX1A 3A61A 4F09A 3SRVB 2PZYA 4C0TA 4PDYA 2FGIA 3QWKA 3PP1A 5B0XA 3UDBA 5JZJA 4Y5HA 4L67A 2VTQA 2UZBA 2BZKB 4IVAA 4S30A 4V0GA 5CNOA 4YTHA 3RGFA 3HRBA 3RTPA 4A06A 4ORKA 5BVFA 3ZO1A 3IONA 3QCQA 2CN5A 5DN3A 1Z9XA 4FEXA 2W96B 3MB7A 4YO4A 4AZVA 4E6DA 5LVMA 3FMNA 2VGOA 5AP6A 5F20A 2XKFA 4IE9A 3TWJA 5LMKA 1Y6AA 3QYWA 3U6IA 4C59A 3E8NA 1STCE 4UBAA 1WVXA 1YHSA 2BRHA 4IAYA 4IVBA 4R8QA 3QTIA 2B1PA 2LAVA 2UW9A 4GMYA 2ZB1A 3WF5A 2PZ5A 3FZPA 4EH8A 2B9FA 3GB2A 5DRBA 5IA0A 3KULA 1JAMA 4RWKA 3NAYA 4BRXA 5LQFA 3WF9A 5DYJA 4QPSA 5KUPA 5AA8A 4MF1A 3JVRA 5HU3A 4HVSA 4APPA 4E73A 2XNMA 1NVRA 4MNFA 3IDCA 3V5JA 5IA4A 2BIKB 2YDKA 1UA2A 4G3FA 4NUSA 4IX3A 4RWLA 5EM6A 3FQEA 3WIKA 4BBEA 3MPTA 4BGHA 1J7UA 2AC3A 3DY7A 4B9DA 2H8HA 1I44A 4AXAA 4NJ3A 2XUUA 3FDNA 1IAHA 2ONLC 4ENYA 4UWBA 4Y83A 2VTTA 3HLLA 4GUBA 3SXRA 3KRRA 2QHMA 4YZBA 5JGAA 5EYDA 4USFA 2R3FA 4QP3A 4E5AX 2ITOA 3VHKA 3F5GA 1UVRA 1JSTA 3P5KA 5ETAA 3W2PA 4EYJA 4O21A 1GIHA 2JEDA 3DAJA 4CV8A 4FOBA 3PY3A 4EOQA 5D41A 3W2QA 4GK2A 2PVMA 3I5NA 1CKIA 4J96A 4DFZE 3LW0A 3MN3A 5JH6A 4I5CA 3QKKA 4J98A 3CBLA 3DBFA 4MAOA 5K4JA 3ZLWA 4QQCA 3VS0A 2JITA 3A99A 4WKQA 3VS2A 3UZPA 1M2QA 4B7TA 4BDBA 4X6RA 2CMWA 3TIYA 3FZRA 3Q52A 3O0GA 4O7RA 1JOWB 2GHGA 4ZTRA 4F9CA 5AUTA 1XH9A 4BDDA 3W2OA 2ITNA 4QD6A 2RGPA 4PL3A 4QQ5A 2ZDUA 3R63A 4WRGA 3L1SA 4HYUA 1KUTA 4FKWA 3JUHA 2XCHA 4M0ZA 5AUXA 3FZOA 4Q9ZA 3Q5IA 3WZKA 4CFFA 2OIDA 2VTRA 4BYIA 3KU2A 4I4FA 4OW8A 4OBQA 4O7SA 4RJ6A 1A06A 4TL0A 4PP9A 5AMNA 3GCQA 4E6AA 4EK4A 5CVHA 3GU6A 5AR5A 2RFDA 3VS6A 2CLXA 4M3QA 2V7OA 5KMOA 4OGRA 1DS5A 5HBEA 2XNPA 4NTSA 4YMJA 2V0DA 3F7WA 4MYGA 5CX9A 3GNIB 1ZZLA 4FT5A 5EH0A 2W17A 3UOLA 5KBRA 1V0OA 4EYMA 1PXNA 2C3JA 2R3IA 4C3PA 4UALA 3MPAA 5FEEA 5E91A 3W16A 5HHWA 1YDSE 1ZOHA 3PTGA 2X39A 2JIUA 2Y6OA 3OT8A 4X2GA 4EH3A 3SHEA 4FE2A 3EZVA 4QTAA 3R7OA 3HMNA 1WBPA 4MXOA 2YLFA 3FMHA 3UMXA 3PIYA 3VUDA 5HCXA 4W9XA 3RBWA 4K0YA 1YKRA 4HZSA 4G17A 1UNLA 2BHEA 5F4NA 2YDJA 3O8TA 1E1XA 1ZXEA 1CDKA 5H9BA 3ORXA 3PG1A 1R39A 2IVTA 3E3PA 3CSVA 3CC6A 5E7RA 5E8TA 4UN0C 2OJFE 4BTJA 2XJ0A 3DAEA 4BWKA 4ZS4A 2QI8A 3O17A 5EK7A 2OJIA 2FUMA 3AMAA 3RAWA 3W32A 4JX3A 3FLNC 5HE0A 2X81A 3K2LA 5DVRA 3LJ2A 2B9IA 3C1XA 4I93A 3R7UA 3BEAA 4H1JA 1Q8TA 3GGFA 3CIKA 3RWQA 2EU9A 4QNYA 4MWHA 5HE3A 5L8LA 4CRLA 3D5XA 1FQ1B 4FTJA 1HOWA 1S9JA 4M66A 5HCYA 3AT3A 4DTBA 3AGLA 1KWPA 4ONAA 4XH6A 4L00A 5K0XA 4PMSA 4W9WA 4FSUA 4B8MA 3ZO4A 2PVHA 1NW1A 1MRYA 1YOMA 2VWWA 3QLGA 4AG8A 3P78A 4ANNA 3C0HA 5IPJA 5ANEA 5H8BA 2P0CA 4C4IA 5I9WA 5HIBA 3UOJA 1Q4LA 4K11A 4MF0A 4CZTA 3MESA 4FKGA 2RG5A 3PE2A 4I1ZA 4AA5A 5DRDA 5IH6A 2ITXA 3CR0A 5CSWA 5GZ9A 1JWHA 3E8EA 3W18A 3PPJA 4OTWA 4E26A 5IA3A 3SG8A 5ACKA 4M69B 2J7TA 3MJ1A 4RX8A 4ID7A 3Q2JA 3TTIA 2C3KA 1P5EA 2JDOA 5HE1A 2XP2A 3IS5A 2E9OA 1G3NA 4FL1A 5AJQA 5DGZA 3BBWA 2HXLA 3DJ5A 3DTWA 3LFCA 4H1MA 4ZY6A 2OSCA 3OP5A 3ZUVA 4FNWA 4E3CA 2X6EA 3AOXA 3KFAA 2B53A 4F7LA 3DDQA 4UMRA 2WU6A 4ZK5A 4FZDB 5G1XA 3UPZA 2R3LA 2CGVA 4N70A 4D1SA 1PXIA 3ZLYA 5AUUA 2R7BA 2I0HA 3DKOA 4RFMA 3FUPA 3BE2A 2GQSA 3VAPA 3FI3A 5AR7A 4WA9A 4ASZA 4BTKA 1ZLTA 2C6TA 3R2YA 4OTFA 4V01A 4AGDA 3FMEA 2FSLX 2ITTA 3G90X 4K77A 4TWPA 4DFYA 4F65A 5HOAA 3QA8A 4KBKA 4S33A 3DBEA 3FZSA 4C4FA 5AX3A 3T3UA 3VUTA 3QC4A 4WG4A 4M14A 4QQJA 2IW8A 3R6XA 4A4XA 5EOBA 1JVPP 1H01A 3OG7A 5AAEA 4N0SA 4AGCA 3EZRA 5AADA 3QRJA 3FBVA 4YZ9A 4PF4A 4F1OA 4O7YA 5JMSA 2QR8A 3NNUA 3PA3A 4OBOA 4JOAA 3NYNA 4S2ZA 2XNGA 4UMPA 4RA5A 3HA8A 4DA5A 5CT0A 3NVKI 3IW6A 2HYYA 3D9VA 4AU8A 5FEDA 3QRIA 3FL4A 4EJ7A 1V0PA 5I4NA 2O0UA 3HX4A 4IX5A 3V5LA 4C3RA 5KKRC 2A2AA 3POOA 3JVSA 3SGCA 3K3JA 4K6ZA 4XP0A 2HCKA 4NCTA 5EKOA 3A7FA 4EH2A 3JXWA 5TOZA 2PE0A 4J95A 4ZTNA 4EK3A 5FBNC 5AX9A 5L6OA 2F2CB 4KSQA 3DQWA 5HO6A 2XEYA 4G5PA 4D2PA 2UW5A 2UZLA 4XV9A 2F49A 2H96A 2J50A 3HUBA 2F7XE 3LCKA 4HNIA 3UG1A 2OG8A 4ZTQA 3BYVA 5TE0A 3T9TA 3DK6A 4O0VA 1Q8YA 5ANIA 4MD9E 4X21A 3PUPA 4DEAA 4GVAA 1MQ4A 4XLIA 3LFQA 5DLSA 3PVBA 4IANA 2FO0A 5GNKA 3HRFA 3W55A 2CCIA 3Q4TA 3CS9A 3PIZA 4IFCA 5BVWA 3V5QA 5D12A 4DCAA 3EQHA 5IISA 3VF8A 2GU8A 3EYGA 1UU9A 3WE8A 4EC9A 2HWPA 3ORKA 3QRKA 4L7FA 4NKSA 5CEMA 2PK9A 5JRQA 5B7VA 2PMIA 5HG9A 1JSVA 4MXCA 4AN3A 4O7ZA 3KRLA 3JYAA 1MUOA 4MXYA 2B4SB 4RJ3A 5EG3A 3F7ZA 2XK6A 2IZSA 1J7IA 5IA1A 5FDPA 3HVCA 4C2VA 2PY3A 2HOGA 3FAAA 1KE7A 3D0EA 3OCGA 4PDSA 4QP8A 4AW1A 3S0OA 3F61A 4DH1A 5BVOA 4YTFA 2WD1A 1H24A 2YEXA 4FZ6A 5LVPA 5AIRA 3P0MA 3EN4A 5AV4A 3U4WA 4KRCA 4XCUA 5EM8A 3TDWA 5ETCA 2JFLA 3EQCA 3UZTA 3VJNA 1PXOA 2B9HA 2E9NA 3GC7A 4FV3A 4QMOA 4WO5A 4WG3A 4BFMA 3GOPA 3RAKA 4GT5A 5TO8A 4PTEA 1OL6A 2B54A 2BUJA 3A8WA 4BDEA 3FY2A 3KN5A 4ANOA 3UP2A 3RINA 5JN2A 2X4ZA 3BHYA 3PXYA 3MY0A 3IOPA 4J8MA 3O96A 5JFXA 2I7QA 2X4FA 5EI6A 2XRWA 4M84A 4D9TA 4H3PA 2Q83A 4QP9A 2QO9A 1E9HA 1T46A 4X6QC 2BKKA 2VTHA 2F7ZE 4XG9A 1SVGA 5KZIA 3ZLXA 4C36A 4IH8A 1M2PA 2BTRA 3SOCA 3DB6A 2IG7A 3OWJA 4FZFB 4KKHA 2YISA 3U51A 2W06A 4GT3A 4GEOA 3ALNA 4EH9A 5A6OA 4EZ3A 2QLUA 3EQPA 2UZWE 2FA2A 2ITQA 4KIOA 3IKAA 4QMVA 4F7JA 5IQFA 3CY2A 3V5PA 3QQUA 4IDVA 4GS6A 3QUEA 3EYHA 4FUXA 4GT4A 3QHWA 5HNIX 2R3HA 2YIYA 3G6GA 3PRFA 4UEUA 4XEYA 2J6MA 3R8ZA 5H3QA 1QPJA 2XJ2A 4E4XA 4E93A 3DNEA 5HG5A 3TIZA 3ZO2A 2R7IA 3I4BA 1FMKA 3G6HA 5AV0A 3FMKA 2BRNA 4JAIA 1OZ1A 4FIIA 2DUVA 5B2MA 2EB3A 4FZAB 3N4VA 4BKYA 4C57A 2BAJA 3BU3A 3R8UA 2HENA 5KX8A 4FEUA 2R3RA 2ITZA 3I79A 4NT4A 4FSQA 1VEBA 4ZSEA 4D5KA 2X9EA 4DEBA 4HCUA 4O7LA 3PFQA 3UIXA 1NA7A 3BLRA 4O2PA 1P4OA 1YI4A 2ONLA 3LE6A 4XP2A 4EOLA 3PYYA 4PY1A 3CJFA 3UO5A 2O63A 5J8IA 4FTCA 2W4OA 3I60A 3UQFA 2UW6A 4APCA 4FNYA 3C7QA 3EN5A 3FWQA 1ZMVA 3H4JA 4U81A 5FP5A 5M44A 5IEXA 4PL4A 3CTJA 3MS9A 1Q5KA 4ASXA 3GI3A 4QQTA 3H0ZA 3K5VA 4WG5A 4CZYB 4G6LA 5HVYA 3BV3A 3CEKA 4AZWA 4E7WA 4XLVA 2J9MA 3FE3A 4XUFA 1M7NA 3BQCA 4J8NA 2B52A 3SW4A 3EHAA 1FVTA 1Q3DA 4XBUA 4I5HA 4M97A 4QP1A 4YZDA 4D5HA 2OZAA 2XB7A 4TZRA 4FTUA 4Y46A 4CYJA 3MH3A 1BL7A 4FTTA 3BYSA 4RZVA 3BU6A 1FVRA 1H1PA 4QRCA 4JR7A 2XIKA 5AUYA 1ND4A 3QTWA 3IPHA 2ZV7A 4FKPA 2YFXA 3FSFA 3GCSA 3ZUUA 4B0GA 4FG9A 3MBLA 4JRNA 3ACJA 1YHWA 4F1MA 4YU2A 3RPOA 2X2LA 3L9LA 1IA9A 3BIZA 4OTPA 2VWUA 1QPEA 2JDVA 4DTAA 4KS8A 2PVKA 5J79A 4FA2A 4XV2A 4JG7A 3PWDA 4C3FA 4J52A 2YZLA 3R8VA 4PQNA 3NNWA 4PP7A 2ETRA 4FTQA 4MTAA 5ACBC 1H8FA 1WBOA 1XH8A 4EEVA 5IU2A 2QURA 4RJ7A 2CLQA 4IXPA 4ZZMA 3V01A 4A07A 1ZZ2A 4BB4A 4F7NA 4D28A 2PMOX 3S95A 1KV2A 4YJUA 3P08A 2J51A 3MIAA 5M4IA 2Z02A 2YIQA 1PKDA 3OCTA 2R3GA 5EM7A 3FC1X 2A4LA 3QTSA 1UU7A 3ITZA 3R1SA 4CVAA 2X8EA 5CAUA 4EZ7A 4YZCA 2OH4A 1SVHA 5AR8A 4CFXA 4BTMA 2R0UA 3R1YA 4EBWA 5IQEA 2W9FB 4FV5A 1V1KA 4YLKA 3CCNA 3UPXA 1GZKA 4FTNA 3MVMA 3TUDA 3NIZA 4C33A 3BHHA 3H3CA 3DXQA 4EHVA 1X8BA 3MB6A 3PJ3A 2LGCA 3B8QA 3QQKA 4QYYA 3C5IA 4FV7A 5HNBA 3EIDA 3RHKA 3RZFA 3LCSA 5DR2A 4YGAA 2O65A 4F0GA 2UZNA 2QO2A 4YZMA 4FSTA 4BYJA 3UVQA 3OF0A 5CSPA 3HAVA 5JGBA 3UO4A 2BR1A 4FKVA 3PIXA 3F82A 4IJPA 4FTIA 3TKIA 4IAZA 1P4FA 4W4XA 4BZOA 5F9EA 5LJJA 2XNNA 4ITIA 4YBJA 4EOJA 5IUIA 1IR3A 5A54A 3R30A 3DK3A 2W9ZB 4L46A 1BUHA 5DOSA 4C34A 3TZ9A 3QAME 3ODYX 3LJ1A 4O0YA 5FWKK 3RM6A 4AOIA 5GIOE 4NH1A 4O7NA 4IC7A 2UVYA 3F3TA 4NFMA 3DXPA 2VAGA 4O84A 2C1BA 2H34A 3MTFA 3A2CA 1W83A 4L3JA 3WZUA 1DAWA 4FT9A 4O81A 4FV6A 3F3VA 4RFYA 1GJOA 2HIWA 4TNDA 2WNTA 1JLUE 4DFXE 4HNFA 4D4VA 2Z7LA 3Q96A 3QA0A 3PLAE 3NNVA 3AQVA 4IVCA 4OTIA 2HELA 4DN5A 3VW8A 2YM6A 3KREA 3MVLA 3UOKA 5I0BA 5CXZA 3R02A 5CF5A 3FXZA 4EK8A 2XM9A 4IMYA 2ACXA 1IG1A 4I0SA 4DFUA 1YXTA 4UB7A 4ZSGA 5L2SA 2P4IA 1ZYSA 4CQEA 4NTTA 4QP6A 1G8AA 3I7CA 2JIVA 4KIQA 5DE2A 4UY9A 5BUEA 2JDRA 4E5WA 4MHAA 5ETIA 4NKAA 1U59A 2BAKA 3ZSGA 4WT6A 5J7HA 3G0FA 3KF7A 4FTMA 4U5JA 4MKCA 3LJ0A 3MA6A 4AZTA 5CU2A 5L3AA 4JVGA 4OT5A 3CTHA 3LXLA 2UVXA 2XIXA 4X2FA 3VRYA 4CCUA 5L2WA 4ZMFA 3IG7A 1KOAA 2GQGA 3C0GA 1YXUA 3TV6A 2W0JA 2YIRA 4EBVA 4XG7A 5FTGA 2BTSA 3MVHA 3QZHA 4LOOA 3NGAA 4RLKA 4FNZA 5E8XA 4BDAA 4QP2A 3Q53A 2XVDA 5CNNA 4RVLA 4NCTC 2WIHA 3DGKA 2C5OA 4OTQA 1DI9A 2ZVAA 3DT1A 4ALUA 2VWYA 3EL7A 2UZEA 4DGOA 4RRVA 4JQ8A 5J5TA 3D5WA 3NSZA 4FIFA 3TNIA 5CASA 3JPVA 4O7WA 3ANRA 4G3DA 2YIXA 1OI9A 3FI2A 5FLFA 4DBXA 3SD0A 2YLEA 4EKKA 4L7SA 3VBYA 3GCUA 5L6WL 1OUYA 3KKVA 2HY0A 4O83A 1PW2A 2I0YA 3CXWA 4U9AA 2R2PA 3S1HA 2XKCA 2PSQA 3AG9A 3FKOA 1M17A 1YHVA 3WOWA 3CTQA 5J95A 5IG1A 3QC9A 3Q32A 4PL5A 4GIIA 5EYCA 3TKHA 1CSNA 4ALVA 4FKLA 4DGLC 4YHFA 3RK9A 2VO3A 4OT6A 5IUHA 3W10A 2WMAA 4XG4A 2VWVA 5EW3A 4E8AA 5IUGA 4H36A 4KKEA 1WCCA 4G6NA 4LGHA 4N6YA 2A27A 3OBJA 1B6CB 1J1BA 4NZWB 3OZ6A 3RK5A 4JL9A 5LCJA 1FMOE 3DV3A 4ITHA 4R77A 1Q8ZA 1YDRE 4QMTA 5DT3A 2OICA 3JR1A 3SRVA 3ETAA 1W7HA 2YAKA 3BQRA 1BLXA 3RJCA 1ZARA 2VNWA 3ORTA 4HPTE 3EFWA 1XH5A 1ZOGA 5IQIA 4MQ1A 1JKLA 4D2TA 2JKQA 3EQRA 3HV3A 4RGJA 3TZMA 3E87A 4QYHA 5A46A 4FIEA 1IEPA 3TNPC 2PL0A 4O0UA 5FP6A 3V3VA 3HZTA 4XHKB 4X3FB 4RJ8A 3IGGA 4L45A 4EZ5A 2GHMA 3U87A 5EQYA 2IPXA 4AUAA 2IVUA 2W1CA 5AP2A 4BGGA 4GFMA 3WF8A 3PZHA 2HZIA 5AP4A 2CKEA 5BNJA 4CSVA 2WOUA 3TDVA 4ZLZA 3ORIA 4BDFA 1FOTA 3KRWA 3VBQA 5LCKA 2F57A 3AC3A 4NWMA 4ZTMA 4EOSA 4PMMA 5CU3A 3HV7A 3LQ5A 4NM5A 4DLJA 4PPAA 1K2PA 3HYHA 2FH9A 4BI0A 4CLIA 4CTBA 2PUPA 3P9JA 4QMMA 3VBWA 5J9ZA 3LFAA 5KE0A 4EOOA 4F9WA 3I6WA 4DFLA 4HYHA 1OPKA 4EQCA 1F0QA 3VO3A 3P86A 3P23A 3VS3A 2CGXA 2GPHA 4GJ3A 3A60A 1XWSA 5AM6A 1HCKA 3BHVA 2NPQA 4QYFA 2PVFA 3E62A 1J91A 3O8UA 4Y72A 3WI6A 2OIQA 4M68A 2CKOA 3A7JA 3RPSA 2F4JA 3ZONA 3O8PA 4G5JA 5JEBA 2C6EA 2OU7A 3ZSIA 3LMIA 2P2IA 5L4QA 2C0IA 3ODZX 5C8KA 3G51A 3HV6A 5FXQA 3BYMA 3HA6A 4LV8A 4U79A 4R1YA 2NNWB 2C5VA 5AR3A 4LRKA 4O22A 2V55A 4D4RA 3F88A 3OT3A 4YTCA 4O7TA 3AD4A 3BZ3A 3TEIA 3E64A 5EDQA 1PXMA 4LG4A 3C4XA 3O51A 3TZ8A 3ZS5A 1A9UA 3AC2A 3LM5A 3ZRLA 2WQBA 3VN9A 4AT4A 5FM3A 3I5ZA 2ZMDA 3RAIA 2XRUA 4XG6A 4BCGA 3TM0A 5IKWA 3NNXA 5EDPA 3SX9A 4AN9A 2C3LA 5GIPE 3ZC5A 1H27A 1P2AA 3I0OA 4RIWB 5C03A 4HPUE 5IDPA 3CP9A 5CWZA 3VJOA 1GNGA 3PA4A 3ZC6A 3V5TA 4LMNA 2HW6A 4FV0A 4FVRA 3ALOA 3F66A 2QKWB 4TT7A 3PJCA 5ANOA 4R7BA 1UWHA 2YACA 3TTJA 3REPA 5KMNA 4ERWA 4RSSA 4FR4A 4BDHA 1IA8A 2CNQA 2PVLA 1R0PA 3VUMA 5HQ0A 4DE4A 2ZAZA 4CMUA 4FKTA 5FRIA 4KSPA 3PSBA 3C4CA 4IB0A 3FL5A 4D4YA 4O27B 3OD6X 5AP3A 5LWMA 5E4HA 3CQUA 2GDOA 3NRMA 1JKTA 4GH2A 4Q5HA 5F94A 3N4UA 4IAKA 2QOBA 5AUZA 2PVNA 3HMMA 3M1SA 4I24A 5IEYA 1P14A 2QOIA 3A62A 4FOCA 3WE4A 4FV9A 2G1TA 4BDCA 3H9FA 5I3RA 1GZNA 4JG8A 4BCHA 4HVIA 3U54A 3ROCA 4FTRA 2J5EA 1PMVA 3EL8A 3ZFYA 1FVVA 2VNYA 3UC3A 4JG6A 3A7IA 3ZBXA 3DU8A 3RAHA 5IZFA 2QHNA 2OO8X 4M8TA 1W8CA 4V04A 1J3HA 5HLPA 3MDYA 4WNOA 4XX9A 3ATTA 4G16A 1TQPA 4IADA 4Z7HA 3COMA 3GQLA 3L9MA 3OWLA 4PX6A 4GCJA 4R5YA 4J1RA 2C5XA 2H9VA 2PE1A 3QU0A 3IW8A 4OTDA 2BHHA 1Q41A 4I0RA 5A4QA 1OPJA 4D1ZA 3DBQA 2ERZE 4CFMA 3R8MA 1BMKA 4FV8A 4MBLA 4BDKA 3BI6A 2C4GA 3IDPA 5C01A 4F64A 4YJVA 3OHTA 5IEVA 3NUYA 1SMHA 5EQPA 4RPVA 1WMKA 2R5TA 3P7CA 3UGCA 5LXMA 3OXIA 2J5FA 3Q2MA 5HD4A 3NUPA 4WSQA 2V62A 3C4EA 4FL3A 3G0EA 3VVHA 3E7OA 5L2QA 2VO7A 5D7VA 4RIXB 3TJDA 3UJGA 1M52A 4UYAA 4GV1A 3F3UA 4IIRA 5JZNA 3SA0A 3GC0A 4GFOA 3DA6A 4X7QA 4CTCA 4I5PA 3CJGA 3QQGA 4GIHA 4CXAA 4GYGA 4U3ZA 5C8MA 4KINA 3IO7A 5BUJA 1BX6A 1ZY4A 2BILB 3NLBA 4RT7A 1U4DA 1XQZA 4YJOA 2VTSA 4JRVA 3ZMMA 2VWZA 5GJDA 3GCPA 4FKUA 4YNOA 2QG5A 4ZTLA 3ZCLA 5HTIA 3P4KA 4LRJA 5DHJA 2XIZA 4TWOA 3C51A 1V0BA 4MXAA 4X2KA 3RNYA 3V6RA 2NO3A 2XBJA 3R9HA 3ZUTA 3MFSA 4M69A 3I6UA 2PVJA 3OUKA 3WBLA 3ANQA 1NY3A 4RWIA 1QMZA 5M08A 3PY1A 4ZTHA 4Y95A 1U5QA 3KXMA 1Q8WA 1UKHA 1ZYDA 4K1BA 3LHJA 4JBPA 5ANJA 5BYZA 4ANQA 5HESA 1MP8A 4O7VA 2IWIA 2OF2A 3IW5A 2WTCA 4IHPA 2WTKB 3Q4CA 5GINE 1S9IA 4WOVA 4JIKA 1FBNA 1H1WA 1QCFA 3QUPA 4YLJA 1YWVA 3GC8A 5M09A 5KO1A 1ATPE 2QQ7A 4MD8E 5HTBA 3LFNA 3RP9A 2PZIA 3MFRA 4C7TA 4RC3A 3SV0A 4J71A 5DI1A 3ORMA 4JBOA 1Q62A 4IM0A 3VF9A 3MH0A 2WFYA 1QPDA 4TN6A 4DFNA 3W2RA 1R78A 3B2TA 3QCXA 1ZOEA 4WSYA 5H8EA 4ZJIA 4F4PA 3QD3A 1RE8A 3PE1A 4Y73A 5I9VA 4AGWA 2JD5A 3BBTB 3ZZEA 3VS7A 2I1MA 4D55A 3VULA 2ZJWA 4XRLA 4H3BA 3KRXA 2YERA 3VC4A 2WMRA 4E1ZA 2C6KA 3GU7A 4HJOA 2OXYA 3R9OA 2QOFA 1GAGA 2YM8A 2WMUA 5HX8A 3QZGA 4O6EA 5M4UA 3RPVA 3CKWA 3MY5A 4M13A 1DM2A 4D2RA 5EKNA 3EWHA 3COIA 3I0QA 5DBXA 3PP0A 5HKMA 3MFTA 1YI3A 3E92A 4UMQA 4YPSA 4BI1A 4ZMEA 4QTCA 3EJ1A 5T3QA 3O23A 4QYEA 3II5A 3W2SA 3P1AA 2QODA 2P55A 3BU5A 2BZJA 3QYZA 4IM2A 1OIQA 4FK6A 4IWQA 4G31A 1U46A 2R0IA 5ANDA 3QF9A 5JRSA 3ZHPC 4TTHB 2WGJA 5E8VA 5AR2A 3LCTA 4CNHA 3UMWA 2BCJA 2X1NA 4D1XA 3HP2A 2X2MA 3S00A 3QX4A 4CZUA 2C68A 4JDHA 4ZOGA 2GS6A 4AGUA 4M0YA 2BRBA 2VTJA 4AZSA 2IVVA 4YSJA 3ORLA 4ZP5A 3WYXA 4CLJA 4U7ZA 3ENHA 3OOGA 3FLZA 3A4OX 3CKXA 3NPCA 4UZDA 4IAFA 4EORA 3NX8A 4ZTSA 2OGVA 5DR9A 4K18A 4DH3A 4HVHA 3QTXA 1XKKA 1JBPE 3A4PA 3OEFX 4EWHA 2O8YA 3TN8A 1R3CA 5LMAA 1WBVA 4DBNA 1F3MC 3OCSA 5AV1A 3BLHA 4RX7A 4C2WA 1QPCA 3NDMA 4FIGA 4UX9A 4WUNA 4YJRA 3GFEA 5EHYA 5EOLA 1YWNA 4GK3A 3ZO3A 4C37A 4U41A 5F95A 5CEOA 2JBPA 4QTDA 4NW6A 4X3FC 3KC3A 2IJMA 3T3VA 5EYKA 4CKJA 2YM3A 1OB3A 2GNJA 5IA5A 2W1ZA 4RFZA 1B39A 4U45A 4CQGA 3MV5A 2E9VA 3R0TA 3COHA 4QOXA 4U3YA 5E8ZA 4LOPA 3CE3A 4RVTA 1BKXA 3PPKA 5M4FA 3LKMA 5B2KA 1OBGA 4F6WA 4PTGA 1TKIA 4NW5A 4YPDA 3OTUA 5A4EA 5BUIA 3WZJA 4FKOA 3ACKA 3R21A 5E90A 3ZXTA 2XZSA 3SLSA 4YR8A 2JIIA 3FHRA 3PRIA 1R1WA 3Q9YA 4F6UA 3OWPA 5BMMA 5IQAA 3S3IA 3R22A 3DNDA 3PSDA 4DGNA 4NL0A 2ETMA 4I3ZA 4EOPA 2NP8A 1JQHA 4YJTA 1URWA 4U42A 1XH6A 3L9PA 4ZLYA 3QQJA 5BYLA 1FPUA 4FTAA 1BI7A 1L3RE 3D7TB 4L68A 4UV0A 4K9YA 2BALA 4BY9E 4DH5A 3KMUA 4ZZNA 4I6QA 4R1VA 3MVJA 2VU3A 4UMTA 2G01A 2Q0NA 2YHVA 3BX5A 4LGGA 5K9IA 4L42A 5DFPA 1OKWA 1Y91A 2PMLX 2J0IA 2OXXA 3R7VA 3QFVA 2Z7QA 4NK9A 4CYIA 4CGAA 3KB7A 4TPTA 1KE5A 2Y4IB 4MNEB 3KRJA 4TY1A 5IMEA 2W1HA 5A14A 2HY81 3FXWA 4IQ6A 4ZSJA 4FT7A 3RHXA 4DEIA 2VZ6A 2GCDA 3FKLA 3IQ7A 4FT0A 4YTIA 3DPKA 2F7EE 3DXNA 4DEDA 5H2UA 2O2UA 3QD0A 4AT3A 2A1AB 2RSVA 3DKGA 3UO6A 5KMLA 3FEGA 2W1DA 4DYMA 1WBTA 5GJGA 1OM1A 3E8DA 4QMNA 2FSMX 4YZNA 5CSXA 3VW6A 4FIJA 2VV9A 5E8YA 3LZBA 4BBFA 2W99B 2XNBA 1FGKA 4IDTA 3MW1A 3BWJA 4JDKA 3PVGA 4Q5EA 5AP0A 4YC3A 2BDFA 4BCIA 4GU6A 1M14A 3ORZA 4UMUA 3ATSA 4QMYA 4GG7A 5HVJA 3QWJA 4IZYA 4DT8A 5HGIA 5EYMA 4S32A 2WTWA 3G33A 2IN6A 4L53A 3ZU7A 3F69A 3OW4A 4EWQA 4LV5A 2JKKA 2UW0A 5GHVA 1M7QA 1JPAA 4JS8A 2G2FA 1RW8A 4R78A 2W1IA 1WVYA 1CTPE 4XNEA 4KS7A 3RI1A 2V5QA 4ITJA 3I81A 4A4LA 3BYOA 1W84A 1YRPA 2IW9A 3SXFA 4IFGA 4XMOA 4O86A 4IEBA 3KXHA 2C6MA 3F5UA 5CEKA 5M56A 4O0RA 5CT7A 3SC1A 3BWFA 3AC4A 3VUHA 4NFNA 3LFDA 3DAKA 3TKUA 2WIPA 3ZXZA 2J0LA 5HZNA 4IM3A 2FSTX 3D5VA 2QONA 3FI4A 5M53A 3DB8A 3BPRA 4L8MA 1PHKA 2C30A 2WTIA 3QLFA 4QTBA 4DFBA 3BLQA 4ZSAA 3MI9A 3QCSA 2C0OA 1G8SA 4MEDA 4QP7A 4CT1A 3IK3A 2PYWA 4D9UA 4IAIA 3Q04A 2J0JA 4MK0A 3LLTA 5CF4A 5D11A 5EM5A 4DCEA 4DITA 4O1PA 5DR6A 3LOKA 4ARKA 4EL9A 5BVDA 5K4IA 4RC2A 2NRYA 3C4FA 4LUDA 4AW2A 2HK5A 4JI9A 2YCRA 3LCDA 3PG3A 1LP4A 4RWJA 3PDTA 4AA0A 2EB2A 4QMZA 3SG9A 3D7ZA 2Y6MA 3K54A 4BIEA 3NYVA 2J4ZA 2YJRA 5TKDA 3O50A 2P2HA 5C8NA 2X7OA 4FMQA 4MQ2A 3MY1A 4TYJA 5DT4A 1MRUA 1PJKA 3ZZWA 4DG3E 4PDPA 3HDNA 3UTOA 2EXEA 3HMOA 4YJSA 4AFEA 4ERKA 1L8TA 3KF4A 3NCGA 4UXLA 4J99A 2GSFA 4IB3A 3LPBA 4MVFA 4MXXA 4RMZA 4DF3A 4JBVA 3KQ7A 3BGQA 2CGUA 3WARA 1KSWA 2EUFB 2JC6A 2Z60A 2WTJA 1Y8GA 3ID6C 5CF6A 2AYPA 2Y4PA 3RZBA 1GY3A 4FYNA 3RWPA 2WQEA 1Y6BA 2VX0A 3RCDA 3NUAA 3VBXA 4IJ9A 1ZMUA 1DAYA 3GP0A 3MTLA 4PV0A 4CG9A 4FI1A 1A48A 2H6DA 3GU5A 2B9JA 2Z7SA 2BFXA 3GCVA 4QMUA 4E6QA 4F1TA 4FSRA 5CLPA 2YCFA 3IW4A 1WBWA 3HP5A 4QMPA 3TUBA 2GFCA 4O1OA 2XYUA 3E63A 4NIFA 4ACDA 4CCBA 4WRSA 3LMHA 4HGSA 2WO6A 5CS6A 3MH2A 4BI2A 4LGDA 5FM2A 1OIRA 4ASDA 3NZ0A 4AP7A 5IQGA 4PNIA 3KCFA 3Q5ZA 1O9UA 3OWKA 4DH7A 4EHEA 5EQEA 3IGOA 3GOKA 3FLQA 4PPBA 3CGFA 5FXSA 5TF9A 4AF3A 4NIFB 3RALA 4O38A 4BHZA 2QVSE 2R3OA 1XBCA 4YJNA 4ZZOA 4QTEA 1H4LA 2UV2A 5HORA 4D58A 1H1QA 5JQ8A 3O7LB 4EJNA 4CEGA 1YVJA 3CD3A 3R28A 5HG8A 2W1FA 4FL2A 5CU6A 3R8PA 1TQMA 2GNGA 4WNKA 1PXKA 4BVUA 4YC6A 4YUQA 5I9XA 5CAOA 4AOJA 3G9LX 3QTZA 3V8WA 3DLZA 4KIPA 1WFCA 3UNZA 2J90A 2BROA 4EUUA 2X2KA 3C50A 3FLWA 1SYKA 1YQJA 5FQDC 3WZEA 5DPVA 1XR1A 4WNPA 3R1QA 2B55A 5BVNA 5C9CA 4L9IA 2VTNA 3SVVA 2XM8A 4FGRA 3UG2A 4BDGA 2WMQA 4IWDA 4IWOA 3EMGA 2JDTA 4RLLA 4DC2A 1B38A 4AS0A 3KXGA 3WIGA 3R7GA 3NIEA 2YABA 3T8OA 4I21A 2WQNA 3FI8A 3ZLSA 2YCSA 2O64A 3VS1A 3LQ3A 5TT7A 3SKCA 2ZOQA 3FV8A 4AX8A 3TNQB 2WQMA 3ZM9A 5CXHA 4KB8A 4KABA 3V51A 3EQDA 3KK9A 4X3JA 4A9TA 5CAVA 3ZRKA 1YXSA 3QGYA 4RZWA 4FG8A 3KXNA 1UNHA 2RFEA 3NUXA 5CZIA 4ZJJA 2ITPA 1K3AA 2IZTA 4FICA 5E1SA 3ZH8A 1IRKA 1W0XC 3JS2A 4DT9A 2VWIA 4EOIA 3LFFA 2JLDA 3AMYA 2RKUA 3QTQA 3GUBA 4XV3A 4YHJA 3ELJA 3OXTA 4IX4A 4C4JA 3ZYAA 4RIYB 3H9RA 2GTMA 2UVZA 2VTAA 5FTOA 3FJQE 5GJFA 5FBOA 3L8VA 3UIMA 3HL7A 3OEZA 4AA4A 5D10A 2CNUA 4Z9LA 5A4TA 2HZ4A 3R01A 4HVGA 3BKBA 2PZPA 4MH7A 2QKRA 4I0TA 3TNHA 5HO7A 2B0QA 2Y8OA 4FTLA 4KBCA 4ANBA 5ANKA 4UYNA 3QKMA 3DLSA 4ANMA 1U5RA 4EK5A 3EFKA 1YW2A 3FYKX 4JQEA 2BZHB 4PNKA 2RFNA 5HE2A 4RVKA 4QPAA 4MBIA 4RQVA 2A0CX 4FV4A 5AAFA 3N51A 1U54A 3BGPA 4M12A 4MX9A 4PUZA 4R5SA 4EH5A 4IAAA 4IB1A 4QT1A 4AT5A 3R9RA 2Q0BA 1UNGA 4LOQA 2R3QA 3GC9A 4A7CA 1GZOA 3LFEA 3O7LD 4O91A 2VWXA 3QQLA 3Q9XA 4IWPA 1OVEA 5FUTA 2C69A 3W2CA 4IVDA 4R7HA 1EH4A 3SAYA 2YIWA 3ZFXA 4C38A 4C61A 1U54B 5CAPA 3BEGA 3FPMA 3NVMB 1M2RA 3PXRA 4ACMA 4KIKB 3ZSHA 3CQWA 1YOLA 5DNRA 4JQ7A 3NS9A 4FSNA 4GRBA 4PRJA 3FC2A 2XEZA 3DBDA 3MA3A 3WYYA 2RFSA 4U80A 4DTKA 3LQ8A 5C1QB 4X3FA 4KKGA 2VX3A 5E8SA 3LFBA 1Q24A 1W98A 2VTOA 3H9OA 3QRTA 4XV1A 5A9UA 1OKVA 3H10A 2CN8A 3F5PA 4JNWA 3KY2A 4WNMA 3S4QA 1URCA 3UC4A 3PSCA 2RIOA 4GK4A
chains in the Genus database with same CATH superfamily
5FG8A 3OFMA 4JBQA 1OKYA 4L43A 3HKOA 1BYGA 4FSYA 4Z16A 2Y4IC 3F2AA 3PWYA 5K0KA 3R9DA 3V8TA 2JKOA 4BCMA 1UWJA 5EHLA 4NU1A 2SRCA 3KL8A 3VS5A 4CFWA 3R83A 2QOCA 5D9HA 2B7AA 1GOLA 1ZYJA 1CMKE 3FHIA 2VO0A 4BN1A 1PYXA 4AQCA 4XS2A 1FINA 4O2ZA 2CPKE 4IBMA 1JKKA 4O0SA 2UUEA 3TUCA 3TT0A 4EUTA 4I23A 2V7AA 2WOTA 2WQOA 2CCHA 2X0OA 4RIOA 1H25A 2FVDA 4G34A 2A19B 3TMOA 4LUEA 4AE6A 3LIJA 4AE9A 1OIYA 1LEZA 1TQIA 3OOMA 3QTUA 3Q60A 4ENXA 2R3KA 1Q97A 4KUJA 1WBNA 4RG0A 4EHZA 3M42A 4I94A 2UW7A 3VNTA 2ZM1A 4BCOA 4D0XA 4V0GB 3OY3A 5T6KA 4FKIA 3LFSA 1KE6A 5CYIA 4W4WA 2JDSA 2WXVA 3P79A 3OY1A 3QRUA 1H00A 3DFCB 1O6LA 3HMIA 5EW8A 4BWXA 5K3YA 4UWYA 3OBGA 3C13A 5IQCA 4HZRA 4C4GA 1TVOA 5B2LA 2FSOX 2GTNA 2BKZA 4KAOA 5FD2A 2Y9QA 3OCBA 4LL5A 4RIWA 3V8SA 3K5UA 3GBZA 4FKRA 2I0EA 2ITWA 2R3MA 2GNIA 2ZDTA 3ZFMA 4J7BA 2F9GA 4YBKA 5HX6A 4F0FA 1XH4A 3DJ6A 2OI4X 3A8XA 3NW7A 4KNBA 5JFWA 4NEUA 5D1JA 3OW3A 2OFUA 3SXSA 3U9CA 4BKJA 3EQFA 4OTHA 5CEIA 1H28A 3R04A 2YM7A 4DH8A 2QOHA 3OTVA 5F1ZA 2XA4A 1WAKA 5CQWA 1H1RA 2WHBA 3RM7A 3TNWA 2J2IB 4R7IA 3KULB 4BCFA 1MQBA 3IDBA 4F9YA 4OAVB 3JY0A 1YOJA 3P7AA 3UYSA 1PXJA 2ITVA 1NT2A 1KV1A 1OL7A 4Y85A 4I41A 2EVAA 1KOBA 1BI8A 3ZOSA 4C62A 1XMMA 2DWBA 4OLIA 2PZRA 4BHNA 1LEWA 3VQHA 4GG5A 3UE4A 3AC5A 1PYEA 3L8XA 4ACHA 3UP7A 2YZAA 5AAGA 1AQ1A 4FEWA 1O6KA 2C1AA 2OJJA 3UQGA 3PVWA 1K9AA 4LI5A 2VTMA 3R71A 4BKZA 4K33A 4DINA 4HVDA 4MCVA 3LXNA 2RL5A 4F9BA 4GSBA 1Z5MA 1ZAOA 2BMCA 3ZTXA 3G5DA 3VUIA 4DG0E 4F6SA 5LVNA 1R0EA 4II5A 2C47A 5LOHA 2Z7RA 3HV4A 4O4EA 3NUNA 4EH7A 4OR5A 3TJCA 5J9YA 4HYIA 3UOHA 4AWIA 3EH9A 3VWAA 3ORPA 4FKJA 3AT2A 1VJYA 5KMKA 4AAAA 2QD9A 2HZNA 3R9NA 2ZM4A 4YLLA 2QU6A 4TYHA 2FB8A 3CPBA 5CU4A 3V04A 4FV2A 5LVOA 2YWVA 3KMWA 2ITUA 1OKZA 3HMPA 3DOGA 2CNVA 3LXKA 3DKFA 4HCVA 2OKRA 2QR7A 4QYGA 4BICA 2WTDA 2OLCA 2WMXA 4W8DA 4LL0A 4FVPA 5AEPA 2IVSA 3DFAA 1Y8YA 3DJ7A 4TYHB 5IQDA 3TCPA 4F63A 1XH7A 5AP7A 3UZRA 4F08A 4EC8A 4AW0A 4RIXA 2W4JA 1H0WA 5I9YA 4CKRA 3R7YA 5AIKA 2R9SA 3FLSA 3PPZA 1YDTE 2OF4A 4BCKA 1H0VA 1J7LA 3TG1A 3IECA 2XJ1A 1CKPA 2C5NA 2XBAA 3O2MA 5D7AA 4FNXA 2YM4A 5A3XA 3F2NA 4W4YA 5CEQA 1NXKA 4FG7A 3KCKA 4L44A 4OBPA 3NW6A 1TZDA 2RF9A 1H08A 2OJ9A 2ZV2A 4O0WA 4P7EA 5HVKA 4N6ZA 5M07A 2EXCX 3LCOA 5ETFA 2Y0AA 4G6OA 2XK8A 5HCZA 1NVQA 5DT0A 4DGGA 3F2RA 1GIIA 1IASA 3QTRA 3I7BA 4GKIA 4P5QA 5HTCA 3SQQA 4FKQA 3GENA 4Y5QA 4FSWA 3W8LA 5EW9A 5JGDA 2IO6A 4FTOA 3V6SA 5BQ0A 3MJ2A 3EQBA 4ZXTA 5L6PA 3BGZA 3OS3A 3AXWA 4Q2AA 3Q9ZA 4H05A 2UZTA 1ZMWA 3R00A 4MD7E 2WMWA 5JKGA 3VHEA 1UU3A 1G8KA 2HZ0A 3BRBA 5CY3A 4DLIA 1MRVA 2QLQA 2C6IA 3FYJX 4TYIA 5FEQA 4DEHA 1SM2A 4FRFA 3D14A 3GU4A 4QP4A 2VD5A 3AGMA 5E8UA 2G9XA 2X7GA 5BMSA 3D2IA 3TACA 4D4SA 5AM7A 5M57A 1PMNA 2QNJA 4AW5A 4KRDA 3C4WA 3L9NA 2EWAA 2HWOA 3UDTA 3NYOA 2V22A 5BVEA 1Q61A 3OMVA 4PWNA 4GYIA 4XYFA 4AAYA 4LMUA 2G15A 4QMXA 2GQRA 3VUKA 4OTRA 4BCQA 2XANA 4I6BA 5JT2A 3M2WA 5DWRA 4FYOA 5E1EA 3IW7A 3AMBA 2OXDA 4PMPA 4N57A 2XKEA 2QOQA 2WMTA 4HGTA 2ZV9A 2I40A 2C5YA 3LAUA 4O96A 4BL1A 4CMOA 3FY0A 3ZM4A 4C4HA 3L8PA 2R3PA 5AV2A 1XBAA 2UW4A 3LVPA 4U44A 2KULA 3EOCA 1AD5A 2VTLA 3U8WA 2JBOA 2XK4A 5I9ZA 3BV2A 5IH4A 3NMUF 3K3IA 2W5BA 3ZDIA 4PDOA 3I1AA 2X8DA 3FMLA 2R64A 1PMUA 1O6YA 2OBJA 4D2VA 5JK3A 4WD5A 1OL1A 2WEIA 3HAMA 2BDWA 3MPMA 4JJRA 2I6LA 4GJ2A 4TWNA 2O3PA 3DDPA 3JY9A 2I0VA 3ORNA 4QMWA 5M4CA 5KCVA 4FIHA 2YJSA 4FZ7A 3ET7A 4LQMA 2YN8A 4U40A 4W4VA 4Z7GA 5KMIA 3D5UA 1OITA 3KGAA 5I3OA 3W0OA 3PJ2A 2WELA 2W1GA 4FK3A 3VBVA 2BIYA 3KVWA 3MGYA 3NYXA 3ZBFA 3FMDA 2UZDA 3OXZA 4L3LA 2XNEA 4Q9SA 3U9NA 4H3QA 4AZEA 4F9AA 5CVGA 3DBCA 4O0TA 4TYGA 3QKLA 4O4CA 2J0KA 2OWBA 2VTIA 3EN7A 5H8GA 3ZDUA 3CY3A 4BCNA 2YM5A 3RPYA 2WMSA 3LM0A 1YXVA 2PE2A 3E93A 3MWUA 5DA3A 2X9FA 3OUNB 4BTFA 4CT2A 3HV5A 2X7FA 4DLJA 4EQUA 3POZA 2G2IA 3D4QA 5KNJA 5CANA 3BYUA 2XARA 3TZ7A 2X6DA 5AFVA 4KD1A 4NSTA 5JFVA 3P5JC 3FMMA 3P7BA 3D94A 4BDJA 2PUNA 4BCPA 2P33A 3KN6A 4USDA 3NUSA 4ZY4A 2PVYA 3U6HA 4LFIA 4X2NA 2P3GX 4H58A 3VBTA 1WBSA 1PXLA 4UZHA 3QHRA 2E9PA 2OW3A 3BL9A 5KMMA 5M06A 4L52A 5LVLA 4DEEA 4O6LA 1OUKA 4R6VA 2X0GA 3EB0A 2XS0A 4FKSA 4JIAA 3TI1A 4AACA 4QMSA 3VQUA 3WILA 2BVAA 2YCQA 4I22A 1CKJA 5HBHA 4J53A 3PXFA 4P2KA 4BC6A 3SOAA 2GNFA 3GXLA 4FSMA 3VRZA 4ACGA 3PA5A 3N9XA 2CJMA 5ITAA 3R7IA 3H0YA 5CU0A 4QMQA 1BL6A 3EQGA 4XOYA 1SNUA 4WUAA 4FEVA 3F3WA 4XG8A 1VYWA 4YO6A 5EDRA 2W1EA 3Q3BA 4Y8DA 4EOMA 2ESMA 2XKDA 3M11A 3EKNA 4QMLA 3PJ8A 1APME 5FDXA 4TXCA 3D7TA 3ULZA 4A4OA 2JFMA 4DHFA 4FT3A 3EFJA 5EHOA 3FQHA 3BHUA 5IA2A 5FXRA 3RVGA 4GL9A 2VO6A 4E5BA 1RQQA 3PVUA 4PTCA 2YAAA 5AUWA 3PXZA 4C58A 4EONA 3TXOA 5KHWA 2OZOA 2ZYBA 4AXFA 4UWCA 2WMBA 4G9CA 4TRLA 4MNEA 5ANGA 2QOOA 5G6VA 3VS4A 4DAWA 3RNIA 4RX5A 4YURA 3MSSA 5CSVA 2J0MB 5J9LA 1PKGA 2YDIA 2XK3A 4P5ZA 4QO9A 1IAJA 3MYGA 4P90A 4TNBA 2DS1A 2UZUE 2W5AA 3NWWA 5HLWA 1ST0A 2CKPA 2VUWA 4K8AA 4RJ4A 4YJQA 1UV5A 2PTKA 4OAUC 4O82A 3W33A 2BRMA 3OC1A 3AD5A 5LMKC 4EK6A 1OBDA 2WTVA 3Q9WA 1Q8UA 5DMZA 4YSMA 3RKBA 1REJA 4CFVA 2WMVA 2GS7A 3D2KA 4FGBA 4YP8A 4PMTA 5DIAA 1ZYCA 4G3GA 2BFYA 3FLYA 2XH5A 4PPCA 2C3IB 2XNOA 4EQMA 5GZ8A 2IW6A 2QO7A 5C26A 5CVFA 4E4LA 3RPRA 3CPCA 4OTGA 4KWPA 4FC0A 4AFJA 5JQ5A 4W8EA 4H39A 3FPQA 1OL5A 4E6CA 2PULA 1W2FA 2W7XA 5T68A 1ZY5A 3GQIA 4NM0A 4BZDA 4USEA 3MH1A 3PXQA 3EN6A 3TL8A 5JSMA 3GT8A 4FUYA 5IF1A 3GEQA 4EI4A 4TWCA 4DG2E 4JXFA 4FV1A 2VTPA 4EHGA 5K5XA 1Z57A 2BZIB 4G3CA 2JKMA 3D83A 3T9IA 5E9EA 4ASEA 4EOKA 3WF6A 3BELA 1OECA 3EN9A 2WU7A 5E92A 3FXXA 5BPYA 3B2WA 5J87A 1Y57A 1YWRA 4CV9A 1PMEA 2GMXA 4LM5A 2IZUA 2C6LA 4MXZA 4JLCA 4ZLOA 4R3CA 4RA4A 5KBQA 3HGKA 4F0IA 3NUUA 4BWPA 1I09A 3GFWA 5CAQA 4GUEA 1RJBA 4O0XA 1XO2B 2DYLA 3KK8A 3C4ZA 4S34A 4HW7A 3VONA 4AQKA 2C0TA 3QUDA 1YXXA 4ZSLA 3QZFA 2QU5A 2WKMA 4RQKA 4F70A 2HW7A 4J97A 1QL6A 2Z8CA 3MFUA 3RMFA 1H07A 5LARA 1LUFA 3QALE 5L8KA 3LMGA 4X0MA 4AOTA 4B6LA 5CALA 4GU9A 4L3PA 5DEYA 3FKNA 3UIBA 2CGWA 1LPUA 2NRUA 4B4LA 5EI8A 4IW0A 3DZOA 2YA9A 4QPMA 4XBRA 4QNAA 4AZFA 4L6QA 5A4CA 2R3NA 1OPLA 3FZTA 2G2HA 4B8LA 3HUCA 3UODA 4RVMA 2WAJA 4YHTA 3UQCA 2QOKA 2Z2WA 5BYYA 3PLSA 5DH3A 3UVRA 5J5SA 2R3JA 4ACCA 3E7VA 1RDQE 2CKQA 2QC6A 3PZEA 5CI6A 5M55A 4P4CA 2ZMCA 4ZY5A 4Z3VA 3AC1A 1LR4A 5KMJA 1JNKA 5DG5A 4DEGA 3W1FA 3Q6UA 3QL8A 2OZAB 1G8JA 4IX6A 5I5ZA 4QDEA 3TV7A 4ZIMA 3CQEA 3Q4ZA 4I6FA 3ENMA 4BF2A 4D2WA 2JGZA 3QZIA 1UU8A 4RBLA 3LLAA 3D15A 5C27A 3IOKA 3NW5A 4YJPA 5KZ0A 2JAVA 5CEPA 2GHLA 4I5MA 5K5NA 4ZS0A 3UYTA 4GW8A 3SDJA 3CGOA 3ROYA 2BPMA 1G5SA 5IH5A 4V05A 1JKSA 3G2FA 3BHTA 1PY5A 1ZRZA 2RG6A 3RCJA 1ERKA 1GIJA 1FGIA 1OIUA 2QOLA 3NAXA 3PXKA 3DCVA 4A9RA 2UZVA 4K2RA 5AA9A 3FZ1A 4JDJA 2KTYA 2QG7A 3WF7A 4GFGA 4NJDA 5J1VA 1E1VA 2E9UA 2W5HA 2X8IA 5EI2A 4C8BA 4E4MA 1Q99A 4G2FA 3QCYA 2WTKC 4I4EA 2XYNA 4I6HA 1Q3WA 2GNHA 4MBJA 1PRYA 4U0IA 1VZOA 2CDZA 4CMTA 5L2TA 4MWIA 2EXMA 3AT4A 4NM3A 3ULIA 5J1WA 1W82A 5HIDA 3ZRMA 1PXPA 3GU8A 4FVQA 5A6NA 5FGKA 3U55A 2XIYA 3DTCA 1CM8A 4JDIA 5EFQA 2HAKA 3FSKA 2BDJA 4R3PA 4NM7A 2OJGA 2ZV8A 3HDMA 4U43A 5HD7A 3SW7A 5LMBA 4CG8A 2HXQA 3HRCA 1OGYA 5IQHA 2PUUA 3CLYA 2GNLA 4ZAUA 2C6OA 4IB5A 5KHXA 3E3BX 2IZRA 2QCSA 4HOKA 4UXQA 3UIUA 4YNEA 4YC8A 5J7BA 3VUGA 4AN2A 3AD6A 2XCKA 4FF8A 5HLNA 4FBXA 2PPQA 3TV4A 5BX0A 1KE8A 3G9NA 4TW9A 3DK7A 4A9UA 3PJ1A 3U4UA 2PMNX 4E20A 4ALWA 4HGEA 4XJ0A 4BR3A 4BZNA 2E2BA 3KXZA 3QD4A 2WEVA 3R73A 2PUIA 5I9UA 1GZ8A 1F5QA 4M7IA 4IZAA 4IZ5A 5CQUA 2PWLA 5FTQA 5E8WA 3F5XA 4KBAA 4WIHA 3ZEPA 2WZJA 2XK7A 3B8RA 3NR9A 3UNJA 4BBMA 3GVUA 4CKIA 4XG2A 4EH4A 3QXOA 2YWPA 4U8ZA 1H26A 5AWMA 2ZM3A 4BCJA 5LWNA 2O5KA 2GFSA 2OH0E 4AXDA 4XRJA 2BRGA 3HEGA 4R3RA 3EFLA 1NVSA 3Q6WA 3QD2B 1VYZA 4RC4A 1T45A 4RIYA 5HG7A 5CF8A 4I20A 4D2SA 4LRMA 3BE9A 3UDSA 4G3EA 2W05A 3ERKA 5HICA 5HU9A 5AV3A 2PVRA 3R7EA 3A7HA 3C0IA 4I92A 3QXPA 2FYSA 2XK9A 4A9SA 3E5AA 5TR6A 4CD0A 3H30A 3UNKA 5AR4A 1AGWA 4BDIA 1HCLA 4JT3A 5BVKA 5AP1A 4CFNA 3U6JA 5C4LA 3O5AA 3RK7A 2YITA 5HI2A 1OMWA 3S2PA 3W0RA 4KA3A 1KE9A 3KVXA 2XF0A 3V5WA 3KMMA 5IDNA 2ITYA 1ZYLA 5L8JA 5HBJA 1OGUA 5CENA 4S31A 2ZB0A 3THBA 4G9RA 2Y7JA 3Q4UA 2C6DA 4FODA 4WBBB 2VWBA 4FEQA 4TKSA 4ANSA 2WB8A 4XOZA 1PF8A 1XBBA 3L8SA 2VRXA 3QQHA 4HCTA 3DKCA 4DGMA 4AXCA 3DZQA 2GS2A 3F6XA 3OVVA 4XG3A 5ICPA 4HYSA 4ZJVA 5L2IA 2UW8A 3R1NA 3AC8A 5C4KA 1YI6A 4FSZA 5CI7A 3FQSA 4OUCA 4KIKA 5HEZA 4U97A 2R4BA 3KXXA 2ETKA 4FX3A 4RX9A 3N4TA 5AUVA 3UVPA 4C4EA 3F9NA 4HGLA 3UBDA 1WZYA 3WZDA 4D0WA 3E88A 1JSUA 5GZAA 4X2JA 3EKKA 4B99A 4F99A 4XP3A 4BIDA 1UKIA 1XHAA 5CSHA 5IQBA 3A7GA 3HNGA 2AC5A 1SZMA 2W4KA 3PY0A 2F2UA 3CD8A 4IZ7A 4WBOA 2CHLA 5IMXA 2XIRA 1XJDA 4C02A 4CFUA 3W8QA 1ZWSA 3MIYA 1VR2A 4N4SA 3KA0A 3BCEA 3DS6A 4ANLA 2UW3A 5DEWA 4CRSA 3C9WA 5KKRB 3G15A 3NEWA 4C35A 2AEGA 5HNGA 3NCZA 3F3ZA 3KEXA 4JX7A 3COKA 1REKA 4BIBA 2XAOA 2DQ7X 2OK1A 3QBNA 3FMJA 4FTKA 4IACA 4JAJA 4NYEA 2WPAA 4M15A 5AP5A 3QX2A 1OL2A 4LYNA 5HIEA 5M51A 5A4LA 4Z55A 4IC8A 4ZEGA 1SVEA 4GKHA 3E8CA 1J1CA 4GVJA 2BAQA 2OIBA 4JR3A 4RJ5A 2VGPA 1WVWA 3OROA 3EQIA 5HO8A 4G1WA 4BGQA 2PU8A 2JAMA 3QGWA 3VIDA 4A9YA 2VN9A 2XMYA 4EH6A 4F7SA 2CSNA 3HECA 4WHZA 2UZOA 4E4NA 2OFVA 3R8LA 3QQFA 4MUQA 3R2BA 3LXPA 1H1SA 2ERKA 5JFSA 1DI8A 2AUHA 4TYEA 4U6RA 2REIA 5CTPA 5CZHA 4EKLA 2PHKA 4M67A 3DQXA 3C5UA 3O71A 3ZEWA 1SNXA 4L01A 2VX1A 3A61A 4F09A 3SRVB 2PZYA 4C0TA 4PDYA 2FGIA 3QWKA 2ZFYA 3PP1A 5B0XA 3UDBA 5JZJA 4Y5HA 4L67A 2VTQA 2UZBA 2BZKB 4IVAA 4S30A 4V0GA 5CNOA 4YTHA 3RGFA 3HRBA 3RTPA 4A06A 4ORKA 5BVFA 3ZO1A 3IONA 3QCQA 2CN5A 5DN3A 1Z9XA 4FEXA 2W96B 3MB7A 4YO4A 4AZVA 4E6DA 5LVMA 3FMNA 2VGOA 5AP6A 5F20A 2XKFA 4IE9A 3TWJA 5LMKA 2AQXA 1Y6AA 3QYWA 3U6IA 4C59A 3E8NA 1STCE 4UBAA 1WVXA 1YHSA 2BRHA 4IAYA 4IVBA 4R8QA 3QTIA 2B1PA 2LAVA 2UW9A 4GMYA 2ZB1A 3WF5A 2PZ5A 3FZPA 4EH8A 2B9FA 3GB2A 5DRBA 5IA0A 3KULA 1JAMA 4RWKA 3NAYA 4BRXA 5LQFA 3WF9A 5DYJA 4QPSA 5KUPA 5AA8A 4MF1A 3JVRA 5HU3A 3BL7A 4HVSA 4APPA 4E73A 2XNMA 1NVRA 4MNFA 3IDCA 3V5JA 5IA4A 2BIKB 2YDKA 1UA2A 4G3FA 4NUSA 4IX3A 4RWLA 5EM6A 3FQEA 3WIKA 4BBEA 3MPTA 4BGHA 1J7UA 2AC3A 3DY7A 4B9DA 2H8HA 1I44A 4AXAA 4NJ3A 2XUUA 3FDNA 1IAHA 2ONLC 4ENYA 4UWBA 4Y83A 2VTTA 3HLLA 4GUBA 3SXRA 3KRRA 2QHMA 4YZBA 5JGAA 5EYDA 4USFA 2R3FA 4QP3A 4E5AX 2ITOA 3VHKA 3F5GA 1UVRA 1JSTA 3P5KA 5ETAA 3W2PA 4EYJA 4O21A 1GIHA 2JEDA 3DAJA 4CV8A 4FOBA 3PY3A 4EOQA 5D41A 3W2QA 4GK2A 2PVMA 3I5NA 1CKIA 4J96A 4DFZE 3LW0A 3MN3A 5JH6A 4I5CA 3QKKA 4J98A 3CBLA 3DBFA 4MAOA 5K4JA 3ZLWA 4QQCA 3VS0A 2JITA 3A99A 4WKQA 3VS2A 3UZPA 1M2QA 4B7TA 4BDBA 4X6RA 2CMWA 3TIYA 3FZRA 3Q52A 3O0GA 4O7RA 1JOWB 2GHGA 4ZTRA 4F9CA 5AUTA 1XH9A 4BDDA 3W2OA 2ITNA 4QD6A 2RGPA 4PL3A 4QQ5A 2ZDUA 3R63A 4WRGA 3L1SA 4HYUA 1KUTA 4FKWA 3JUHA 2XCHA 4M0ZA 5AUXA 3FZOA 4Q9ZA 3Q5IA 3WZKA 4CFFA 2OIDA 2VTRA 4BYIA 3KU2A 4I4FA 4OW8A 4OBQA 4O7SA 4RJ6A 1A06A 4TL0A 4PP9A 5AMNA 3GCQA 4E6AA 4EK4A 5CVHA 3GU6A 5AR5A 2RFDA 3VS6A 2CLXA 4M3QA 2V7OA 5KMOA 4OGRA 1DS5A 5HBEA 3ML1A 2XNPA 4NTSA 4YMJA 2V0DA 3F7WA 4MYGA 5CX9A 3GNIB 1ZZLA 4FT5A 5EH0A 2W17A 3UOLA 5KBRA 1V0OA 4EYMA 1PXNA 2C3JA 2R3IA 4C3PA 4UALA 3MPAA 5FEEA 5E91A 3W16A 5HHWA 1YDSE 1ZOHA 3PTGA 2X39A 2JIUA 2Y6OA 3OT8A 4X2GA 4EH3A 3SHEA 4FE2A 3EZVA 4QTAA 3R7OA 3HMNA 1WBPA 4MXOA 2YLFA 3FMHA 3UMXA 3PIYA 3VUDA 5HCXA 4W9XA 3RBWA 4K0YA 1YKRA 4HZSA 4G17A 1UNLA 2BHEA 5F4NA 2YDJA 3O8TA 1E1XA 1ZXEA 1CDKA 5H9BA 3ORXA 3PG1A 1R39A 2IVTA 3E3PA 3CSVA 3CC6A 5E7RA 5E8TA 4UN0C 2OJFE 4BTJA 2XJ0A 3DAEA 4BWKA 4ZS4A 2QI8A 3O17A 5EK7A 2OJIA 2FUMA 3AMAA 3RAWA 3W32A 4JX3A 3W0QA 3FLNC 5HE0A 2X81A 3K2LA 5DVRA 3LJ2A 2B9IA 3C1XA 4I93A 3R7UA 3BEAA 4H1JA 1Q8TA 3GGFA 3CIKA 3RWQA 2EU9A 4QNYA 4MWHA 5HE3A 5L8LA 4CRLA 3D5XA 1FQ1B 4FTJA 1HOWA 1S9JA 4M66A 5HCYA 3AT3A 4DTBA 3AGLA 1KWPA 4ONAA 4XH6A 4L00A 5K0XA 4PMSA 4W9WA 4FSUA 4B8MA 3ZO4A 2PVHA 1NW1A 1MRYA 1YOMA 2VWWA 3QLGA 4AG8A 3P78A 4ANNA 3C0HA 5IPJA 5ANEA 5H8BA 2P0CA 4C4IA 5I9WA 5HIBA 3UOJA 1Q4LA 4K11A 4MF0A 4CZTA 3MESA 4DDGA 4FKGA 2RG5A 3PE2A 4I1ZA 4AA5A 5DRDA 5IH6A 2ITXA 3CR0A 5CSWA 5GZ9A 1JWHA 3E8EA 3W18A 3PPJA 4OTWA 4E26A 5IA3A 3SG8A 5ACKA 4M69B 2J7TA 3MJ1A 4RX8A 3PFYA 4ID7A 3W0PA 3Q2JA 3TTIA 2C3KA 4FJVA 1P5EA 2JDOA 5HE1A 2XP2A 3IS5A 2E9OA 1G3NA 4FL1A 5AJQA 5DGZA 3BBWA 2HXLA 3DJ5A 3DTWA 3LFCA 4H1MA 4ZY6A 2OSCA 3OP5A 3ZUVA 4FNWA 4E3CA 2X6EA 3AOXA 3KFAA 2B53A 4F7LA 3DDQA 4UMRA 2WU6A 4ZK5A 4FZDB 5G1XA 3UPZA 2R3LA 2CGVA 4N70A 4D1SA 1PXIA 3ZLYA 5AUUA 2R7BA 2I0HA 3DKOA 4RFMA 3FUPA 3BE2A 2GQSA 3VAPA 3FI3A 5AR7A 4WA9A 4ASZA 4BTKA 1ZLTA 2C6TA 3R2YA 3AKJA 4I6LA 4OTFA 4V01A 4AGDA 3FMEA 2FSLX 2ITTA 3G90X 4K77A 4TWPA 4DFYA 4F65A 5HOAA 3QA8A 4KBKA 4S33A 3DBEA 3FZSA 4C4FA 5AX3A 3T3UA 3VUTA 3QC4A 4WG4A 4M14A 4QQJA 2IW8A 3R6XA 4A4XA 5EOBA 1JVPP 1H01A 3OG7A 5AAEA 4N0SA 4AGCA 3EZRA 5AADA 3QRJA 3FBVA 4YZ9A 4PF4A 4F1OA 4O7YA 5JMSA 2QR8A 3NNUA 3PA3A 4OBOA 4JOAA 3NYNA 4S2ZA 2XNGA 4UMPA 4RA5A 3HA8A 4DA5A 5CT0A 3NVKI 3IW6A 2HYYA 3D9VA 4AU8A 5FEDA 3QRIA 1W2CA 3FL4A 4EJ7A 1V0PA 5I4NA 2O0UA 3HX4A 4IX5A 3V5LA 4C3RA 5KKRC 2A2AA 4DDIA 3POOA 3JVSA 3SGCA 3K3JA 4K6ZA 4XP0A 2HCKA 4NCTA 5EKOA 3A7FA 4EH2A 3JXWA 5TOZA 2PE0A 4J95A 4ZTNA 4EK3A 5FBNC 5AX9A 5L6OA 2F2CB 4KSQA 3DQWA 5HO6A 2XEYA 4G5PA 4D2PA 4JMQA 2UW5A 2UZLA 4XV9A 2F49A 2H96A 2J50A 3HUBA 2F7XE 3LCKA 4HNIA 3UG1A 2OG8A 4ZTQA 3BYVA 5TE0A 3T9TA 3DK6A 4O0VA 1Q8YA 5ANIA 4MD9E 4X21A 3PUPA 4DEAA 4GVAA 1MQ4A 4XLIA 3LFQA 5DLSA 3PVBA 4IANA 2FO0A 5GNKA 3AKLA 3HRFA 3W55A 2CCIA 3Q4TA 3CS9A 3PIZA 4IFCA 5BVWA 3V5QA 5D12A 4DCAA 3EQHA 5IISA 3VF8A 2GU8A 3EYGA 1UU9A 3WE8A 4EC9A 2HWPA 3ORKA 3QRKA 4L7FA 4NKSA 5CEMA 2PK9A 5JRQA 5B7VA 2PMIA 5HG9A 1JSVA 4MXCA 4AN3A 4O7ZA 3KRLA 3JYAA 1MUOA 4MXYA 2B4SB 4RJ3A 5EG3A 3F7ZA 2XK6A 2IZSA 1J7IA 5IA1A 5FDPA 3HVCA 4C2VA 2PY3A 2HOGA 3FAAA 1KE7A 3D0EA 3OCGA 4PDSA 4QP8A 4AW1A 3S0OA 3F61A 4DH1A 5BVOA 4YTFA 2WD1A 1H24A 2YEXA 4FZ6A 5LVPA 5AIRA 3P0MA 3EN4A 5AV4A 3U4WA 4KRCA 4XCUA