4C34A

Pka-s6k1 chimera with staurosporine bound
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
340
structure length
336
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA
publication title The Discovery of Potent Ribosomal S6 Kinase Inhibitors by High-Throughput Screening and Structure-Guided Drug Design.
pubmed rcsb
source organism Bos taurus
molecule tags Transferase/inhibitor
total genus 106
structure length 336
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c34A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c34A02
3E87A 5CNOA 5BQ0A 3NCGA 4ASZA 1R78A 3OCTA 3ZSGA 1OKZA 2BIYA 1QCFA 4J71A 4IWOA 4K77A 3CQEA 4RIOA 5I9ZA 4N70A 5CU6A 5M4IA 3MFRA 3V5LA 3IKAA 4FIFA 2ERKA 2J9MA 4DTBA 1ERKA 4YZBA 3EQCA 4E5AX 4KKEA 4NL0A 2O0UA 2EXEA 5DLSA 2XRWA 3RAWA 4Q9ZA 4YUQA 4IC7A 4UV0A 1VYWA 3HNGA 2VO6A 2PZYA 3BGQA 3W2OA 3GT8A 3LIJA 4F6WA 4QMWA 4U40A 5D1JA 2IN6A 2ZB0A 3RWPA 2Y4PA 1Q8TA 1WVXA 2VWYA 4QMQA 4KUJA 1H27A 2VRXA 3OBJA 4HPTE 5E8TA 4TYHB 2XNEA 2QOLA 1FVRA 5GHVA 1ZRZA 2HY0A 3QTQA 5E8VA 5I0BA 3GOKA 5BVFA 2CNUA 5K0XA 3D94A 3FV8A 1SNXA 2GHLA 4KB8A 1MRVA 1WBTA 4RFYA 4DN5A 2W7XA 4EH5A 2XK9A 4F9AA 4EORA 4WNMA 2BKZA 2XIXA 3GU5A 3LCKA 2QOQA 3HP5A 3DK3A 3O7LB 4QMXA 3NVMB 2XA4A 2R3IA 4D5KA 4YJRA 3DS6A 4L67A 2WMBA 4G3FA 3QWJA 2WTWA 3HRCA 3QXOA 3VBQA 5FTGA 4PMSA 4RWKA 4GEOA 3FZPA 3MJ1A 3CPCA 5EI8A 3OWPA 4C0TA 4F0IA 1H25A 4RRVA 4ANQA 5HLPA 2J0IA 2V5QA 2CMWA 3NUSA 4MQ1A 5CSVA 3EN5A 4IMYA 4TZRA 4DH5A 3U6JA 3BPRA 3CR0A 1VJYA 3VBTA 4E93A 3W55A 2PUIA 3KL8A 3PVGA 4RQVA 2YM5A 1K9AA 3D4QA 1WBNA 4G1WA 5EDPA 3K5VA 5LVOA 3ORIA 4I22A 4EOMA 5CZIA 3SAYA 3NYNA 3RAKA 3VAPA 4YJPA 4O83A 3HECA 4MK0A 5AUZA 4PP7A 5I9WA 3GOPA 3KEXA 2CCIA 4YHTA 4M15A 1MRUA 5HTCA 3Q96A 1V1KA 5ANKA 4JDJA 4U81A 4EWHA 2ESMA 3GGFA 2QU5A 4QT1A 3F5PA 2P4IA 3GQLA 3FSFA 4JBVA 3RPYA 4A9TA 2B4SB 4F70A 4FIGA 3G9LX 4KS8A 1OBGA 4FTOA 3LMHA 1F5QA 3SRVA 4ZSEA 1P14A 5FTQA 3IGGA 4AN2A 3QCQA 3FY2A 3P79A 5ETCA 4I5PA 2YIRA 4QMNA 3GCVA 2VX3A 3ENMA 5KUPA 4C3RA 4IB3A 3DLSA 5AUWA 2X4ZA 3VS4A 5TOZA 4AS0A 3E5AA 3QD0A 2G1TA 3ZLXA 1P4OA 1CKPA 4DEHA 4GK2A 3ZXTA 1O9UA 3L9MA 2VWXA 3WI6A 2Y4IB 3V01A 5DEYA 3WZKA 4B6LA 4E6DA 1YHSA 4GVJA 2BZJA 4QOXA 4X2GA 4KRDA 5L6WL 4HCTA 3TXOA 1BL7A 3U8WA 2F7ZE 1WBWA 4OAVB 4FKGA 5BYZA 1W98A 4ZP5A 1CKIA 3NIZA 1NA7A 4L45A 4ZTHA 5DYJA 4EKKA 3COIA 5J8IA 1PMUA 4JJRA 3QZHA 3P9JA 4FT0A 4Z7HA 4JBPA 3TJDA 4FR4A 4HZSA 4A9YA 4B99A 1GIJA 4JG6A 2YCSA 3RPOA 4PQNA 3V04A 3F82A 3LFSA 4I93A 4KIKA 3R0TA 2OZOA 4QPAA 5DOSA 4LRMA 2ZDUA 3Q04A 3ZMMA 3DDPA 3BYMA 5CS6A 3MFSA 3R00A 5AP3A 3CGFA 4BHZA 2VWIA 3DAKA 3LQ5A 4S34A 3UODA 4A06A 3EOCA 2F7EE 2ETKA 5AAFA 3ORXA 4NFMA 3UZTA 3RCDA 3SVVA 5EHLA 3RZBA 3LQ3A 3VS5A 2A1AB 2WB8A 2W17A 2GMXA 3OW3A 1PYXA 5EOLA 3DQXA 3LCTA 4J95A 5F4NA 4XX9A 5D7AA 4C02A 4BR3A 4JRVA 2WELA 1OL2A 2J4ZA 4TYJA 3UIMA 3P1AA 4QMYA 4AGWA 2WKMA 2R3HA 4RIYB 2VTSA 3M11A 3ANRA 4IACA 5CI6A 4MKCA 1JWHA 3A8XA 1R0PA 3OC1A 2VTHA 4I4FA 3Q3BA 5GJDA 2B55A 4IDTA 4ZXTA 1J7UA 2JKKA 4W4VA 4RZVA 4APCA 3K2LA 4HYSA 4L43A 4MWHA 2YERA 2XUUA 3F7ZA 3HV4A 4ARKA 1XH8A 2W96B 4IIRA 3CSVA 3I6WA 3V5TA 3MFUA 4AZVA 4HVDA 1XWSA 1JKSA 2GNFA 3DKOA 2PVYA 5EQEA 1OGUA 4C62A 3DLZA 3KFAA 4FKUA 1CTPE 4XLVA 1XBAA 4HYIA 3AQVA 2OJGA 2QNJA 5GZAA 3KA0A 3KRJA 3LXLA 4MHAA 2RG5A 4KBAA 2DS1A 2XNGA 2BRMA 1WFCA 1TVOA 4BDJA 2B52A 4BICA 5A4EA 1OITA 3IW4A 1XQZA 3KRXA 2XK8A 4JT3A 2CKPA 3DKCA 1KOBA 3HYHA 3KU2A 4IM3A 4UWYA 2OXXA 3IPHA 5CEQA 5KKRB 1WBPA 3Q5IA 3PA3A 3DKGA 4FEUA 3EZRA 1H0WA 3PVWA 2YDKA 4I3ZA 1XBCA 4IZ5A 3CJGA 4GK3A 4ZTLA 3W18A 3TM0A 5IMEA 4HVGA 5C4KA 3KXMA 2QCSA 4IANA 5LMKC 1JNKA 2BAQA 4TWOA 4DE4A 3R04A 3FMKA 3FMHA 4FVRA 2OJ9A 4IC8A 5JGDA 4FVQA 4BL1A 2BFXA 4OBQA 5AP4A 2X39A 1DI9A 3MVHA 1OPKA 1O6YA 5CY3A 3DBCA 5AR8A 1EH4A 5HI2A 1AGWA 5AWMA 5HD7A 4EK6A 4FTNA 3IGOA 5L2TA 3CLYA 3MW1A 2VWUA 4OBPA 2J6MA 5CF6A 3KY2A 1WMKA 2W9ZB 3SOAA 4MTAA 4K11A 1U54B 2UZEA 1KE7A 3FI3A 4G3CA 4FTUA 3TN8A 4C57A 4QMPA 4RVLA 4NT4A 4IEBA 2EWAA 4YC6A 5T6KA 5KBRA 1OIRA 4N4SA 2C30A 3U9NA 4G31A 3OZ6A 2C0OA 4R1VA 5ANGA 2GU8A 4IVBA 5DEWA 5HO6A 1W0XC 3NS9A 4NCTC 4NU1A 4ZOGA 2V7OA 3LKMA 4QO9A 5HCXA 3ZZEA 2W1HA 2HWPA 4BN1A 5CU4A 5FP6A 4YP8A 3POZA 2ZV2A 3DJ7A 3T3UA 4U3YA 3BGPA 2UZWE 4DFYA 4D0XA 4E1ZA 2WO6A 4FKSA 3NSZA 1OL7A 2C0TA 3D7TA 1Q24A 4O0RA 4O7ZA 4LGDA 1ZYSA 3R63A 4A07A 3KC3A 5CU3A 4RC2A 3BLQA 4ITIA 2Y4IC 4NIFB 4I41A 4GT3A 4PMMA 4MF0A 3THBA 4R1YA 5EYCA 2UVXA 5DR6A 2QC6A 3MY1A 4ANOA 4ALVA 4U43A 3F3UA 3PFQA 2XKCA 2IW6A 4L00A 2VZ6A 4UB7A 2YITA 2YM8A 3PJCA 4FOCA 5M44A 3CKWA 3V5WA 5E90A 4FKLA 4F6UA 3PY1A 3LPBA 3PJ8A 1QPJA 3R8MA 4WG4A 4R3RA 1HCKA 4GW8A 4U7ZA 4CCUA 3HRFA 4EZ3A 3NYXA 2FSLX 2XCKA 5CYIA 5HICA 3F7WA 3BV2A 3KULB 1PMVA 1U46A 2IZUA 2WMAA 3BEGA 2IVSA 1W82A 3GC8A 5BUIA 4CQEA 5B2LA 1SNUA 3SX9A 3K3IA 2DUVA 3DBDA 2FSTX 4NM0A 1YWVA 4NWMA 3WF6A 4FX3A 4DGOA 4EH3A 5CEPA 2OI4X 3CD3A 5CZHA 4N57A 3EFWA 4JX3A 4N6YA 4EJNA 3FXZA 3G33A 2IZTA 1E9HA 1V0OA 3VS6A 2YABA 3SG9A 4FV3A 2OIBA 4FL2A 4S32A 3UOJA 3UE4A 1NW1A 1KOAA 3FLZA 1JSTA 4G2FA 1XJDA 4X2NA 3TL8A 3H9FA 4XV3A 3BLRA 4PL5A 4ZMEA 3K3JA 2OK1A 4MNEA 3KVWA 2OKRA 1BLXA 3PLSA 2F2CB 2VX1A 3QTXA 1GNGA 2PVLA 3LQ8A 3ORKA 3WYXA 2W0JA 4TT7A 4O7NA 1OPJA 3GENA 2PZPA 4IB5A 3E62A 4LOQA 2I0EA 4LI5A 1GZ8A 1SYKA 5A4CA 3E7VA 5IU2A 4C2WA 3R1SA 2WU6A 3KKVA 4BKZA 4D2RA 5KBQA 2GQSA 1J7LA 3EQRA 4A4XA 3UVQA 2C6LA 4ZEGA 5EKOA 3SA0A 3OW4A 4R3CA 4F7SA 1PXPA 2R3RA 2EB2A 3SLSA 5HVKA 2C1AA 2QI8A 2R7BA 5CX9A 5BX0A 2NNWB 3L8XA 4G3EA 4J8NA 1YOLA 4JLCA 5AUYA 3I60A 3ATTA 4I94A 1Y8YA 5KKRC 4KIQA 3G90X 4MXCA 3S00A 4HCVA 3DK7A 2H9VA 4UWCA 2XEYA 4MH7A 1YOJA 3U9CA 3I0OA 4FOBA 4I6FA 4WD5A 3QHWA 2C6IA 3JUHA 4PMTA 4WIHA 3RK5A 2UZLA 4ACGA 3OCSA 1ZY4A 4JQ8A 4AOJA 3EQHA 5CT0A 1BMKA 3GQIA 5CEKA 4BY9E 2UV2A 3UO4A 3N4TA 4BIDA 4D1SA 5H8BA 3DBFA 2W5BA 1KV2A 3QGWA 2NO3A 2PL0A 2PVKA 4UXQA 3KCFA 2ACXA 2SRCA 2WQEA 3ACJA 3IW7A 4FTAA 5IEYA 3PSCA 3VUKA 4E6QA 3K5UA 5HE2A 4ASEA 4BBFA 4YLJA 3UPZA 5EYDA 4EKLA 4FTTA 2PTKA 3I4BA 3ZLWA 4J52A 5BYLA 4XOYA 2PVRA 4Z9LA 4JDIA 5KZ0A 3DXPA 2GTNA 1I09A 4ACDA 4WO5A 4ZMFA 4YZMA 5HX8A 3D5VA 4RWLA 4L52A 4UYNA 4AT5A 2YJRA 1FINA 2BDFA 5F20A 2ETRA 2A27A 4CG8A 3W32A 4J1RA 3S4QA 2Y0AA 4CFXA 4EH7A 4EH6A 5BUEA 3G15A 3QQJA 3SRVB 3VVHA 3DZOA 4JXFA 2ITPA 4M0YA 3REPA 3VW8A 3VS1A 5B7VA 3F3ZA 3DGKA 4RZWA 4YJSA 5EFQA 1Q8ZA 4FT9A 2B54A 4LV8A 3C5IA 5KMJA 2BIKB 3GU8A 2HW6A 2XNBA 2WEVA 2Z7RA 4LFIA 3ZBXA 2GS6A 3QD4A 4HVHA 2FH9A 3ODYX 5GIOE 3PIZA 2UVZA 2ITOA 3GC7A 3ZO3A 5JKGA 2Q0BA 4IADA 4GSBA 2VTNA 2JFMA 2UW3A 3D5XA 4FA2A 4AGCA 3NUXA 3FXXA 1WBVA 5DBXA 2EB3A 5BPYA 3NLBA 1Y6AA 1YWRA 3FEGA 3HAVA 4A4OA 2P33A 4XP3A 1W8CA 5EW8A 4GFOA 4YZNA 4GKHA 3QYZA 2A19B 5KZIA 4I21A 2ZM3A 1STCE 3G5DA 3W8QA 2H34A 4Q9SA 4AFEA 4XLIA 4KIKB 4YTFA 3EQGA 3KRWA 4LUDA 2CN5A 4XG3A 3VS7A 3F3VA 3MJ2A 4QYEA 2UW9A 3VRZA 4TN6A 5JFVA 1U5QA 4KINA 3IONA 1XHAA 4EEVA 3B2TA 4MXXA 1IAJA 2VUWA 4FG8A 3PY3A 5LWNA 4G3DA 2DYLA 3SC1A 4WNOA 3VF9A 2QQ7A 1CM8A 3GCSA 4IAFA 4YZ9A 3E3BX 4ORKA 1YVJA 1I44A 2PE1A 4D2PA 2AYPA 2Y6OA 3QUPA 2V55A 4DF3A 3DCVA 1MUOA 4CLJA 1H08A 1W83A 3MN3A 4OTGA 3P7BA 3RHKA 2WTKB 4U45A 4DCAA 4BDBA 4AA4A 2XNNA 3VUDA 3ZONA 2J51A 3C4CA 3C7QA 2FUMA 4KSQA 5BNJA 1V0BA 2F49A 2IZSA 4O91A 3FL5A 1DI8A 4RFMA 3EQDA 3Q52A 4FKWA 4AFJA 2QOOA 3P5KA 4DG3E 3AMYA 3PIYA 5L6PA 2CNVA 5AX3A 4AT4A 4BDDA 3ZXZA 5ANJA 3W1FA 2FB8A 2Y9QA 4BGGA 4QPMA 3D2IA 2RG6A 1WBSA 3HDMA 3EN4A 1FOTA 3IQ7A 4FTJA 5HNBA 2FO0A 4GG7A 4DFNA 4NFNA 4O7SA 3CE3A 1PJKA 4M67A 2FSMX 3RI1A 5AP0A 4C4FA 1XH4A 4EUTA 4PTGA 4FZDB 3LLTA 3FZOA 4PPBA 4QP4A 4O27B 5IH4A 5TF9A 3QCSA 4OAUC 5HVJA 4R77A 5C9CA 3QQGA 3AD4A 2ITXA 3QX2A 3FC1X 2JGZA 3L8VA 4LMUA 3PXYA 4O2ZA 4D1ZA 1XH5A 3ZYAA 1Z9XA 5LCKA 3VS3A 4W9XA 5J5TA 2CDZA 4G34A 4F6SA 5CAUA 3IW6A 4RA5A 5HBJA 2WMSA 3ZRKA 5HO7A 5FLFA 3U54A 1Q3DA 4W8EA 3RJCA 4F4PA 5IA4A 4C7TA 5IQHA 5AP1A 4AXAA 4BTJA 3T3VA 2Z02A 3PXRA 4FL1A 2YWPA 2FA2A 3BQCA 4L7SA 2QKRA 4FICA 3G51A 4HNFA 5KHWA 4L7FA 5FBOA 5F9EA 1QPDA 3HRBA 5LVNA 4XP2A 4NH1A 1Q8YA 4QQTA 2PE2A 4DLJA 4D58A 4MQ2A 4I0SA 3NW7A 4FTIA 5ETFA 4TPTA 3DTWA 4CT1A 4DA5A 5FP5A 4A9UA 1JKKA 4JG7A 3MTFA 4DEEA 3MH2A 1SMHA 4K9YA 2WHBA 4FV4A 4PV0A 3DAEA 4NM7A 2W99B 5CU0A 2C3JA 3L9NA 4FK6A 5JEBA 5H2UA 5J1WA 3CP9A 3KMUA 5A6NA 2ONLA 1UV5A 2C6KA 3WILA 3CBLA 3HKOA 3FKLA 3TNPC 3RMFA 2C0IA 3H0ZA 3MB7A 3NUAA 4NW5A 1OZ1A 4E26A 1TKIA 4DT8A 4BDCA 2WNTA 5F1ZA 4IM0A 1Y6BA 4JIAA 5EK7A 3WF5A 2GCDA 3DKFA 3BRBA 4W4XA 3GB2A 4QP6A 3R8ZA 4BI1A 2G15A 5E8SA 4ZSAA 3QTRA 4EOJA 3QTWA 3A61A 2J5EA 4GFGA 2PUUA 3W10A 3W33A 4B7TA 3VW6A 3CCNA 2JKMA 1YHWA 5AUXA 5BVOA 2RIOA 5AX9A 2PVMA 2RF9A 3PSBA 4BWXA 3MVLA 3D7TB 5HORA 5HQ0A 1ZOEA 3L8PA 5IISA 3UVPA 2BHHA 3A4OX 2OZAA 3V8WA 4ZJJA 3QFVA 3FXWA 4JI9A 5CI7A 4FF8A 2PUNA 4PY1A 3ATSA 3SHEA 4RLKA 4EYMA 4K1BA 5DNRA 2IW9A 3PZHA 3EQPA 4FEXA 3CGOA 4TWPA 1MQ4A 4QP3A 3CY2A 4TKSA 4TRLA 2OF2A 3QTSA 4X3JA 5DG5A 4PMPA 3NCZA 3OXIA 4YNEA 4DH7A 1ZMVA 3NIEA 4XRLA 4UMRA 3RALA 1JBPE 4ITHA 4DC2A 3GBZA 2BZIB 4WG3A 4FSQA 4JX7A 3LCOA 4QPSA 4RMZA 3TNQB 5HNGA 1Y91A 3DV3A 2OFVA 3Q6WA 2GHGA 3K54A 4HNIA 5AR2A 5I3RA 5FRIA 1J7IA 1HOWA 1Q3WA 2ZMDA 2CHLA 1J3HA 4GL9A 3ZFMA 4EZ7A 3DT1A 4Y5HA 3QQHA 1GZNA 4X2FA 5M55A 3A7JA 3MBLA 5BVKA 2I6LA 3MIAA 2ITYA 2BUJA 2RKUA 3JYAA 3FMJA 2PVJA 3D83A 4MVFA 2OFUA 4OTRA 3TZ8A 1TQPA 5ITAA 3D2KA 4DAWA 2QODA 4IAZA 5CF8A 4IZYA 5IDNA 2YDJA 3GP0A 3W8LA 4BVUA 5KMKA 2UZVA 2WTKC 1QMZA 4ALWA 3VUHA 1ZZLA 4TXCA 4OTIA 1UVRA 3OTUA 2XJ1A 4AUAA 3D15A 4W8DA 4Y83A 2VAGA 5ANEA 2O64A 1OPLA 4Y95A 5E1SA 4EK4A 4JOAA 3VRYA 1W84A 4IAAA 2WMUA 1H0VA 3FMDA 3VNTA 5C1QB 4RJ4A 4CV9A 1ZOGA 4PRJA 3BE9A 4DFUA 5H9BA 1H1QA 4TL0A 2PVNA 2WAJA 3T9IA 3PE1A 1OKWA 5HKMA 3H10A 5D10A 2JIVA 2BPMA 3ZFXA 4J53A 2WMQA 4O0WA 5ETIA 4AN9A 2Z2WA 2VTLA 2PHKA 2XNMA 4I0RA 2R5TA 3RINA 3PTGA 4JL9A 2XH5A 2PK9A 3U4UA 2XKFA 3DTCA 3PZEA 4QYGA 3FLSA 5HIEA 1X8BA 4IFCA 4R8QA 2R2PA 4QTAA 4FVPA 2LGCA 2Q83A 3NW6A 5HCZA 2X2MA 3BQRA 2X4FA 3FLQA 1VZOA 4FIIA 4EQUA 3BYUA 4AA0A 3C4EA 4D4VA 3C1XA 3QCXA 4FTQA 4OT5A 4RWJA 4HVSA 4CYIA 1H1SA 2KTYA 3H3CA 3BELA 5FXSA 1O6LA 1M7NA 5DR9A 5FDXA 5IA3A 5AP7A 4ITJA 1IAHA 4J98A 3C0HA 5CVFA 1VYZA 4KWPA 4AGDA 3LXPA 4P2KA 4QP8A 4YHFA 3QRUA 4OW8A 3PWYA 3GVUA 4U80A 1UNLA 3QCYA 4JAIA 3P23A 3S0OA 5LWMA 1LPUA 4UEUA 1NT2A 5B2KA 1H26A 4A9RA 4NYEA 4KNBA 4FV9A 3V3VA 4RT7A 1YI3A 4WKQA 3I79A 5HD4A 1B39A 2CKOA 3F5UA 4EOIA 2UVYA 5FXRA 3TDVA 5CAOA 1KE9A 5DMZA 3KXXA 5K4IA 3FC2A 2XB7A 2PULA 1WAKA 2HZIA 4FKJA 4FSYA 4KAOA 5JFWA 4PL3A 4NJDA 1WCCA 5EI6A 4JIKA 3DFCB 2VTRA 2Z7QA 3E64A 1BI8A 1M17A 5EDQA 5HOAA 3E92A 3C4FA 3LZBA 4GKIA 3OTVA 3KN6A 4DTAA 4FTMA 3BZ3A 3A7IA 3RK9A 4ZIMA 4W9WA 5CEOA 4R6VA 1YWNA 2PMNX 3HEGA 3NNXA 3R02A 4AZWA 2QLQA 1IASA 1ZY5A 2XM9A 2BALA 1J1CA 3DU8A 4MBJA 1SM2A 5HBHA 3R8PA 4QMVA 5ICPA 3VUTA 4ZTNA 1U4DA 3QTIA 4LRJA 5HIDA 4BB4A 2UW8A 3TI1A 3FKOA 1S9JA 5HESA 5I9UA 1GJOA 3D7ZA 3MFTA 5AP6A 2OH0E 3HV7A 3TNIA 4Y73A 5GIPE 1PXNA 2P2HA 2YAAA 5EQPA 4R5SA 1QL6A 2G2IA 4XRJA 5DT4A 4LMNA 2VV9A 5HEZA 3LCDA 2ZYBA 5HIBA 5CT7A 5ACBC 3ZZWA 3KMWA 2EUFB 2C5YA 2H96A 2BHEA 4H36A 4RIWA 2WTIA 3Q2MA 3UIBA 4L8MA 3OCGA 2IW8A 2EVAA 4TYGA 2W1GA 1ATPE 3MPTA 4JQ7A 4BI0A 4FNZA 4I5HA 1LEWA 4YJNA 3RBWA 4QYFA 3QYWA 1UU9A 2QOHA 4RJ8A 3FMLA 3UBDA 4C2VA 5CALA 3PXKA 1YXXA 3DB6A 3CIKA 3ORLA 4GMYA 3ERKA 3BKBA 5K3YA 4JDKA 5G6VA 4EONA 4E5WA 3PYYA 3VHEA 2ITTA 3HV5A 3BU6A 5L8JA 4UWBA 2QD9A 4C4EA 3JS2A 4H58A 2X0GA 3PPKA 5FM2A 2Y8OA 4XS2A 1E1XA 5JT2A 5JSMA 4BGHA 5A4TA 5I3OA 5M07A 3PRFA 4R7BA 1XH6A 3NNWA 5LVMA 4IWPA 3QC4A 4WRSA 3OOGA 4PPAA 2IVTA 2VO0A 3DBEA 4IH8A 4IZAA 5CWZA 4EQMA 4O21A 1GIHA 5TT7A 3OP5A 4KKHA 4K18A 2YIQA 5IEVA 2CKQA 4UX9A 2W1ZA 5AEPA 1JOWB 3ZLYA 4KSPA 3WARA 4F9CA 3SKCA 2BDWA 3FDNA 3HMNA 4WT6A 4KIOA 5GINE 5HGIA 2VTAA 4TYIA 3QUDA 3FYKX 1URCA 4WSQA 4DT9A 5B2MA 3TEIA 3CPBA 4CFWA 2ZV7A 3CQUA 3V6SA 3M2WA 5L2SA 1Q61A 4FUXA 3AXWA 4WRGA 5BMSA 5AFVA 4YBJA 2ERZE 3FMEA 3QXPA 4TNDA 3DPKA 1JAMA 2GNJA 3UIXA 4BDKA 2ZMCA 2OXYA 3UOHA 2REIA 3DAJA 4O86A 5IMXA 2QVSE 1VR2A 2CKEA 3BBTB 4F9WA 4CRSA 4B4LA 2E9UA 4BDFA 3UZPA 2OJIA 2V62A 2YM7A 4O6LA 4UBAA 4F63A 2QG7A 3B2WA 4FE2A 2CCHA 4IAYA 3O23A 5CSXA 3QA8A 3AC5A 4DEDA 3W2QA 3HP2A 4UMPA 2YCFA 2JITA 3OFMA 5JRSA 3WE8A 3N4UA 4O7RA 3F69A 5AR4A 4XV2A 5EYMA 4AU8A 5EKNA 4L44A 5AV0A 2EU9A 3QBNA 2BTRA 4U97A 5BYYA 2B9FA 3I1AA 2VTTA 3MB6A 5DRBA 5IA0A 4MWIA 4P5QA 4O96A 3HUCA 4EH2A 3EFKA 4PX6A 3HV6A 3NVKI 2C6TA 5HTIA 2E9VA 5G1XA 5C8KA 2WIPA 4RVKA 4IHPA 4QP2A 4WUNA 3TJCA 1F0QA 3FHRA 2J50A 3BBWA 3KGAA 4FV5A 3ALOA 4QMUA 4EC9A 5J7BA 2ZVAA 4HW7A 4HZRA 4DG0E 3ANQA 4QTEA 1ZZ2A 3ZDIA 2I7QA 3WZJA 3SGCA 3A8WA 1BUHA 2GNLA 5IPJA 3FLWA 4DGMA 4FC0A 4FIJA 2XBAA 4FGRA 1PXKA 4NKSA 4G9CA 5E7RA 5CAVA 3RM7A 4TTHB 4R78A 2UZUE 2GPHA 2VTPA 2UZTA 4ANNA 1H1RA 1XH9A 2R0IA 3PP0A 4EK8A 2QOCA 3SDJA 3ET7A 3RK7A 3GNIB 5BVDA 2DQ7X 1QPEA 5J9ZA 4LQMA 5I9VA 3AC2A 4D0WA 4C37A 3HVCA 4F1MA 3MGYA 5I5ZA 5EHYA 4D2TA 4GIIA 1JLUE 3ZS5A 5CVHA 4YNOA 5L8LA 4G6NA 4U8ZA 3O8TA 3FY0A 4BCGA 4RGJA 4G3GA 3TNHA 1FMOE 4BBMA 3TUBA 2OZAB 3EQIA 3EB0A 4MBIA 5HE3A 4BKYA 2O63A 2HWOA 5KHXA 4LGGA 2WD1A 2EXMA 4USEA 2ETMA 1PYEA 2WMWA 4HPUE 4YTHA 2BAKA 4PNIA 4RC3A 4A9SA 1PY5A 2WTVA 4YZCA 3FJQE 3TUDA 4X0MA 4EBWA 3AD5A 1PXIA 2OG8A 2I1MA 3L9LA 3IW8A 2UW6A 3GFEA 4QMSA 5FTOA 3UPXA 2CN8A 2BVAA 1ZLTA 2ZAZA 1UU8A 3GI3A 5FD2A 4QNAA 3EIDA 3QX4A 5HLWA 1H8FA 1PXLA 2BMCA 3IG7A 3ORNA 4O0VA 3S2PA 3FYJX 3D9VA 4ZLYA 3GEQA 3MI9A 5EM5A 3GC9A 2XIRA 4MYGA 3FI4A 5ACKA 1YDRE 4N6ZA 3GU7A 4OLIA 5D41A 1YI6A 4BF2A 4DHFA 1REJA 1UU7A 4ZK5A 3R9DA 4C59A 1AD5A 3Q9WA 2W9FB 1OB3A 5FUTA 2GFCA 4KS7A 3UMXA 1UA2A 4EHGA 2YDIA 1JSUA 4NM5A 2C6DA 4O6EA 4BCMA 3C9WA 3AMAA 5DR2A 2GFSA 3QQUA 2VTMA 1YI4A 4QYHA 3TZMA 3VUIA 3RZFA 3PIXA 2WQOA 1ZARA 2ZDTA 3BWJA 4X2JA 3NX8A 3S95A 1KE6A 1KV1A 1OL1A 2XK7A 2OH4A 1FGKA 2JDTA 3OEFX 4FV8A 4UYAA 2JFLA 3UVRA 4DEBA 2HK5A 4OUCA 5ANOA 5AUUA 5AR3A 3BWFA 1F3MC 3PJ3A 3ORMA 2AC5A 3H4JA 3RPRA 4A4LA 4EWQA 3EN7A 2F9GA 1QPCA 1NVSA 1Y57A 3Q4TA 2B1PA 4IX6A 3BHVA 3NPCA 4EOKA 5LJJA 4CMTA 5M53A 2YM6A 5LCJA 1PRYA 2BCJA 2RSVA 3SV0A 2YJSA 2CJMA 3ZBFA 3GCPA 4PP9A 2JAVA 4YR8A 2PPQA 5AA8A 5IKWA 3R8UA 4EYJA 1SVGA 3UQFA 4DEGA 4FYNA 4I4EA 3SXRA 3JVRA 5HLNA 2W5AA 5IF1A 1H1WA 4FG7A 4WUAA 5D12A 3FHIA 5AAGA 4L6QA 3GU6A 3KREA 3I5NA 5AUVA 2B7AA 4FSWA 3OROA 2BRNA 2NRUA 4LOPA 3PXFA 2W5HA 4XG2A 4Y8DA 5H8GA 4F64A 1G8SA 3OUKA 1P2AA 3ETAA 4ZTSA 3E3PA 3QRTA 3QHRA 5KMLA 2XMYA 1UKIA 4IW0A 5CEIA 2QOIA 1FMKA 4CTCA 4O7TA 3EYHA 3ZRLA 1YKRA 5BVWA 3G6HA 3OWLA 4BDGA 5AV4A 3VN9A 3FKNA 4WNPA 3EQFA 3S3IA 5I4NA 2E9OA 5IUIA 4M68A 4ZSLA 4MX9A 1YRPA 5AIRA 5GNKA 5C01A 5C27A 3O17A 4RX7A 5HX6A 3WIKA 3VJNA 1M14A 4D2SA 3IOKA 4M97A 2NPQA 2IZRA 3QRKA 2C68A 3UGCA 4WHZA 3O8PA 3C0GA 4M69A 3ZUVA 1RE8A 4X3FA 2BRHA 3WYYA 4DFZE 4EOPA 4FKIA 3UC4A 2IWIA 2XIYA 2R3LA 3ROYA 3NUPA 3OUNB 2WGJA 1U59A 3U4WA 4X7QA 2X9EA 5DT0A 2B9JA 3P86A 3A2CA 3RGFA 1R39A 4ZZMA 4AE6A 4F0GA 3A99A 3COKA 3QQKA 2UZDA 1IA9A 1L8TA 1FPUA 3EFLA 4IXPA 3PA4A 4YJUA 3WBLA 5IA1A 4KBKA 2GTMA 3L8SA 4FV2A 2KULA 5ETAA 4IDVA 4YTIA 2VWVA 4CMOA 3AGLA 4HJOA 5K9IA 3CTHA 3QRJA 1ZYDA 3RNIA 2JDOA 2C5NA 3JY0A 3UO6A 5E8ZA 2ONLC 3F6XA 4DBXA 2BROA 5LXMA 4NW6A 1TQIA 5IQBA 3FZRA 4QQJA 5KMIA 4J8MA 3DJ5A 4GJ2A 4EQCA 2PZIA 4BKJA 2JDSA 3PXQA 1Q8WA 4U6RA 4YHJA 3OOMA 2OO8X 4BTKA 2PY3A 5LQFA 4XG8A 2ZM1A 2WTDA 5AM7A 2XM8A 3LFCA 3LM0A 1YXTA 4FKQA 5EHOA 3CEKA 4GG5A 4BGQA 4K33A 5JZNA 4FG9A 3V5PA 2XCHA 4ACCA 1XBBA 1UWHA 1SVHA 5E1EA 4C3FA 3R7UA 3FZSA 1OKVA 4XG6A 4M84A 5C8MA 3RHXA 4AA5A 1T46A 5HU9A 2ITZA 5DT3A 5HZNA 4IFGA 3UYSA 1G8AA 4XCUA 2I0VA 3UQGA 3R9OA 3R01A 3SXSA 4FZAB 3PG1A 4EI4A 2JLDA 4W4WA 5AA9A 4NTSA 4OTDA 3BX5A 3ULIA 5L6OA 1NY3A 4B0GA 2ITWA 5IQDA 4CMUA 4FTCA 2XK4A 4IJPA 3QQLA 4O7YA 5AP5A 4G6OA 4JBOA 3QGYA 5L8KA 4FSNA 4BHNA 4IQ6A 1RJBA 1B6CB 4C33A 2NRYA 4RIWB 2GSFA 5E8YA 1OL6A 2GQRA 3Q2JA 2HYYA 3FBVA 4D9TA 4AZFA 4BCJA 4AGUA 2XIKA 4Q5HA 1UWJA 4BWPA 1OIUA 1CDKA 3HA8A 4RFZA 3TG1A 3FQHA 4Y72A 2QHNA 3L9PA 4WNKA 5L2WA 3IDBA 3LFDA 3LFFA 4RWIA 4E6CA 3OWKA 5AADA 1OBDA 4FEVA 3EFJA 5F94A 2UZOA 3DZQA 3LXNA 3NNVA 4GYGA 5DIAA 4H39A 2VNWA 2WMXA 4ZY5A 4U44A 5EOBA 5L2IA 3LFQA 4RIYA 4DFLA 3NUYA 2UW5A 3BEAA 2CNQA 3ENHA 2J0LA 1OIYA 2UZNA 4M8TA 4BFMA 2B0QA 4PDSA 5JQ5A 2RFEA 3BI6A 4QP7A 5GZ9A 5A4QA 3EN9A 1Q99A 3QLGA 4YLKA 4RSSA 3AT4A 3WF8A 2BKKA 4DITA 4L53A 2C69A 2YIYA 4YPSA 2Z8CA 1JVPP 4F7LA 3MA6A 4GU6A 4KBCA 5C03A 5E4HA 2JIIA 3NUUA 3V5JA 4G16A 3R8LA 3P08A 5JK3A 2XKEA 1RQQA 4H1MA 1M7QA 2C4GA 4AG8A 4Z16A 3ORZA 4D9UA 4MXOA 2PMOX 4HGSA 4GUBA 2VN9A 3A7FA 4FMQA 4ALUA 4D55A 2WOUA 4ASDA 3HMOA 2OJJA 3UG1A 2QO7A 4D2WA 3AC4A 2VTOA 3MIYA 4AW5A 4EOOA 3PG3A 2VWZA 5JFXA 1VEBA 4YC3A 3PPJA 3NAXA 3HGKA 4QMMA 4YTCA 2CGUA 4GS6A 4I6BA 4NSTA 1H1PA 4L9IA 3EJ1A 3UOLA 5M51A 4CD0A 4EZ5A 4RBLA 4CV8A 2XRUA 4QMZA 4WG5A 3CS9A 3KCKA 4HGEA 3C4WA 1K2PA 4I5CA 3VS0A 4BRXA 4CKJA 3FMNA 1W7HA 5EM6A 5J7HA 5E8XA 2GNHA 1PXMA 3ORPA 3R2YA 2BRBA 4O0XA 2XS0A 5LVLA 4ANMA 4PDYA 2XJ0A 2YAKA 4RIXA 4EJ7A 1H07A 3ITZA 2V7AA 3CKXA 3MPMA 4DLIA 1YHVA 2JAMA 4MF1A 4YGAA 5HCYA 1P4FA 4BZDA 3C4ZA 5J1VA 3LM5A 3MDYA 1AQ1A 1PKDA 1PXOA 1H24A 2XBJA 4QD6A 3UNZA 3DOGA 4FKVA 1GY3A 4XG9A 4L01A 4Y46A 3ZEWA 2PVHA 3HLLA 3OBGA 3CY3A 1LUFA 4B9DA 1ZXEA 5DRDA 4TY1A 4M13A 4CFFA 4G17A 4IJ9A 5T68A 3TKUA 1U54A 3S1HA 4YC8A 3BYOA 4J99A 1A48A 2XNPA 4DGGA 1WVWA 1GIIA 4FGBA 2A2AA 2VD5A 4GFMA 2VX0A 2G9XA 2WFYA 4FKTA 4QMTA 4OTFA 4BI2A 2YZLA 1YDTE 3LE6A 3ODZX 4V0GA 4DEIA 4YBKA 3OD6X 4HCUA 4IAIA 3F3WA 1R0EA 3DDQA 4YLLA 4CG9A 5CEMA 4ANLA 2FVDA 2QR8A 2PU8A 1UNHA 4DCEA 1LR4A 3NYVA 5A14A 3KN5A 5M56A 4I92A 4QQ5A 4I20A 2W1EA 4BDAA 4J7BA 4AQCA 3MY0A 4DEAA 2BZHB 2JDVA 2JKOA 2HZNA 3O2MA 4M14A 3IDCA 3FLNC 3AC8A 2X1NA 4APPA 4CKIA 3MVJA 3C4XA 4MXZA 5IA2A 5J9YA 4ZJIA 5M57A 3EZVA 4AW1A 2E9NA 4BZOA 4EHVA 5AR7A 2HOGA 5FG8A 3ZO4A 5IDPA 2WPAA 1KE5A 3D0EA 5H3QA 2OIDA 2XJ2A 3DNDA 4OTPA 3QC9A 4LM5A 3E8NA 4IVCA 5DPVA 4BBEA 1U5RA 4HOKA 4ZY6A 3VJOA 3H30A 4CFUA 2R0UA 4NK9A 3FMMA 2R4BA 3VBVA 3ULZA 3MSSA 2PZ5A 3R7GA 4CGAA 5KMOA 2QR7A 2QOBA 2V22A 5M4FA 4MXYA 4A7CA 4PPCA 4CKRA 4IWDA 4BCHA 5M08A 4ACMA 3I0QA 3W2CA 4E8AA 4ZTQA 4H3BA 5LMAA 3FI8A 2J0MB 4C8BA 3BE2A 3NWWA 2X7OA 3NNUA 4MD9E 3VWAA 4FIHA 4L42A 4MAOA 5AP2A 3ZC6A 3RNYA 5DFPA 1UKHA 4ZZNA 3TV4A 5M4UA 3MH0A 4FSMA 2VGPA 5AR5A 3N4VA 2LAVA 3O7LD 3KK8A 5HG7A 4OTQA 4M3QA 2PVFA 1FGIA 4OGRA 4F1OA 2Z7SA 2YM3A 4MNEB 2IPXA 3TZ9A 4TWNA 2YCQA 3ORTA 4XBRA 3R1YA 2GDOA 1A9UA 1GAGA 4EHEA 2JBOA 1JKLA 4GT5A 5FWKK 1P5EA 4FUYA 4JQEA 3RPVA 4EH4A 2G01A 4V01A 1REKA 3VO3A 4O2PA 5A54A 1JPAA 4BTMA 4OT6A 4IE9A 5K5NA 3G6GA 2BAJA 3WZDA 5C8NA 4YO6A 5JMSA 3PVBA 5LARA 3PJ1A 3FAAA 4O81A 4ZLOA 4RX8A 2XF0A 5KMMA 3MWUA 4AW2A 4C38A 3UQCA 2QKWB 2WTCA 4FZ6A 3PSDA 1CKJA 2XIZA 1B38A 3FSKA 3V8SA 4RA4A 1Y8GA 5FQDC 1PKGA 2XK6A 1RW8A 5CSHA 3UYTA 5K5XA 2I40A 3DY7A 5K0KA 3G0FA 4C4JA 3MTLA 1YXSA 3M42A 5HHWA 1CSNA 3OCBA 3QTZA 2R3NA 4K8AA 3R6XA 3TTJA 4P90A 3VHKA 3MESA 4MCVA 4EL9A 5HG8A 3AC1A 4E4LA 5DGZA 3LW0A 5HE0A 4CFVA 2R3PA 2HAKA 3BU3A 1WBOA 2W1IA 3QAME 4BCPA 3ZM9A 1Q5KA 4BCIA 3OVVA 5L4QA 3F5GA 3HDNA 3NAYA 4QNYA 2W1DA 2B9IA 5EYKA 3TACA 3TDWA 2W06A 4ZS4A 4CZUA 4FKRA 3TV6A 3ZM4A 3LJ2A 3KK9A 5IA5A 2WTJA 3A60A 4BDHA 2H6DA 4XG7A 1APME 1YQJA 5AM6A 4M69B 3AT3A 4U3ZA 4X3FB 2E9PA 2X8DA 4IX3A 2HZ4A 3IK3A 2C5VA 3M1SA 1IEPA 2XYNA 3OHTA 1FVTA 3U51A 1NXKA 4RPVA 5AIKA 4Z7GA 2QU6A 4FYOA 3BYSA 4AW0A 4RX5A 2OU7A 3ID6C 4YMJA 4J96A 3QWKA 2QOKA 3C0IA 3EKNA 3V51A 5J79A 5LOHA 4ERKA 4QP9A 3H9OA 5DI1A 2IVUA 1MRYA 3FWQA 3AOXA 1OL5A 5D11A 4AN3A 3SXFA 1Q97A 3NRMA 4QYYA 3OG7A 4F9BA 3ACKA 5EM8A 4W4YA 3CTQA 2PMLX 4GUEA 2X6EA 3IO7A 3LFNA 3PUPA 3KXGA 3ZO2A 4QP1A 3OF0A 2OW3A 3CC6A 1O6KA 1A06A 4E7WA 3MS9A 2IJMA 2UW0A 3DFAA 2A4LA 2J0JA 4OR5A 3G9NA 5E91A 4FV6A 3QL8A 3ZTXA 3HZTA 1H00A 4D28A 2HIWA 5A4LA 4P4CA 3QALE 5EW9A 4Y85A 3W2RA 4XV9A 3PRIA 5IUHA 4UXLA 2O2UA 2OBJA 4LL5A 5HVYA 3VULA 3I81A 3KRRA 3QZGA 4O0UA 2YWVA 4FV7A 5E9EA 2P3GX 1GZOA 2Z60A 3KF7A 1KE8A 2XK3A 4XJ0A 4X2KA 4UN0C 4DYMA 2JIUA 3GCUA 2BFYA 3P78A 4H3QA 4NKAA 4O7VA 2UZBA 3R7EA 4XG4A 4BIBA 4C36A 4S33A 5IQAA 4TW9A 4JR7A 5D7VA 4RVTA 5AV2A 3LLAA 1XR1A 3FLYA 3VUGA 2ZM4A 3JY9A 4FIEA 2YIWA 1SVEA 4RC4A 5CQWA 3UZRA 3LFEA 2WOTA 3ZLSA 4D5HA 1CMKE 4FODA 4LUEA 2YFXA 3E8EA 3BLHA 2HELA 1R3CA 4LRKA 3FZ1A 1ZYCA 4I24A 3LAUA 3HV3A 5GJFA 2WMVA 4Y5QA 5FBNC 4K0YA 2XYUA 4FV1A 3F66A 1OKYA 3RKBA 4C35A 4BDIA 1KWPA 5JGAA 4QRCA 2OIQA 4O0TA 3ALNA 1Q4LA 3Q6UA 4C3PA 3UIUA 3Q9ZA 2CPKE 4BCNA 2WXVA 1R1WA 2VGOA 3PLAE 4F65A 5HG5A 4EHZA 2VO3A 3WZEA 4WSYA 4YURA 4FNYA 4TYEA 4WOVA 3V8TA 3CQWA 3DJ6A 1DS5A 2X81A 2FSOX 2JC6A 4FEQA 4JRNA 5J95A 1ZOHA 3IDPA 4CFNA 3A7GA 2GS2A 3B8RA 3ZRMA 4EH8A 4ZAUA 2CGWA 1DM2A 3UP2A 4AOIA 4NJ3A 3SG8A 3VS2A 1OUKA 4I1ZA 2PE0A 4UMTA 4CZYB 4CSVA 3ZU7A 3QLFA 2NP8A 2G2HA 4ZSGA 1G3NA 5F95A 2UUEA 3CTJA 4RJ5A 2HCKA 1M52A 1M2PA 5CASA 3EYGA 3I7CA 5IZFA 2X9FA 2OF4A 4O7LA 4YU2A 5J87A 2X8IA 4I6QA 5HBEA 5TR6A 3G0EA 2FYSA 4NM3A 2ZJWA 3E88A 4HGLA 5KMNA 5CU2A 4PDOA 3R9NA 2R3OA 4FTLA 4O22A 2GQGA 3Q60A 3TKHA 5IQEA 3EKKA 4G5PA 1YW2A 4NZWB 4TNBA 3ZUTA 4QQCA 3PP1A 3IS5A 1TQMA 4XEYA 4O82A 4GVAA 5TO8A 3PXZA 4DGNA 5CXZA 3OY3A 3ZH8A 5IQGA 4ENXA 5HTBA 3OT8A 3NEWA 4JVGA 5FEQA 2PWLA 3ZSIA 4CXAA 1XKKA 4AF3A 4F08A 4WBOA 3KF4A 3PVUA 4IX5A 2WQMA 2I0HA 4RLLA 5H8EA 3UP7A 4ANSA 4ZTMA 5JFSA 5IQIA 2ITNA 2QONA 3VC4A 4YSJA 4H1JA 3NGAA 5CVGA 2ZOQA 2P2IA 4GJ3A 3LVPA 3OWJA 1YXUA 4E20A 4HVIA 3IECA 1MQBA 5DA3A 4FBXA 2UW4A 3UG2A 2FGIA 5M4CA 4RIXB 4II5A 4XNEA 4MEDA 3QZFA 5IQCA 4E5BA 5FEDA 2XKDA 4LYNA 3F3TA 2YA9A 4G9RA 4X3FC 2WMTA 3MV5A 3VF8A 4D1XA 4TWCA 2YLFA 2J0KA 3Q4CA 3QKKA 3P0MA 3WOWA 1WVYA 3II5A 3PPZA 4DH1A 1OM1A 2ITUA 3DQWA 4E4MA 1OECA 5LVPA 3QZIA 3TZ7A 4MD8E 5IG1A 3OMVA 3NDMA 1S9IA 3ZHPC 3FQEA 4AP7A 4UZDA 4DGLC 3CD8A 3KMMA 3ZO1A 5C26A 1J91A 4OTWA 3KXNA 1M2QA 2E2BA 3AGMA 4U5JA 3U6IA 2OGVA 4K6ZA 3DNEA 3SD0A 2XNOA 2WQNA 2QURA 4FV0A 4V0GB 5A6OA 2RFSA 4IM2A 4O0YA 2PMIA 5CSWA 3TIYA 3PE2A 2OXDA 2C5OA 5FGKA 4AZEA 4QMOA 2R3QA 5BVNA 4CT2A 3LMGA 4S31A 3BHYA 4KA3A 4M7IA 5GZ8A 3E8DA 3MA3A 1MP8A 4IVDA 4U9AA 3RAHA 4EK3A 4JS8A 4CYJA 4G6LA 2BTSA 1PF8A 2J90A 4RJ7A 4S2ZA 2ITQA 4CCBA 2RFNA 3N9XA 4RX9A 3R1QA 4IBMA 5D9HA 4JNWA 5ANIA 4KKGA 1IR3A 3C13A 4S30A 4EUUA 5AAEA 4FK3A 4JBQA 2R9SA 5EI2A 4USFA 3QA0A 4FI1A 2VU3A 3KXHA 3ZSHA 2W05A 1NVRA 3W2SA 1IG1A 4WA9A 3TNWA 3WIGA 2R3GA 1PMEA 3L1SA 3RPSA 4GU9A 4M66A 3O96A 3T9TA 3KQ7A 4FTKA 3D5UA 2R7IA 1ZWSA 3AC3A 2WEIA 4XP0A 4XV1A 4ZSJA 5AV3A 3LFAA 2C3KA 3EMGA 1DAWA 4Z3VA 3KRLA 4AE9A 1Q41A 2IG7A 5BUJA 4O1PA 4JR3A 4YO4A 1KSWA 4JDHA 3W16A 4LGHA 3D14A 2YACA 2AC3A 5EW3A 3RCJA 5FXQA 5HU3A 1Z5MA 4PDPA 1GZKA 2B9HA 3Q53A 3WZUA 1JKTA 2X7GA 5C4LA 1UU3A 4RG0A 4EBVA 4U42A 1FVVA 4LL0A 4ANBA 4K2RA 4ZZOA 4V05A 2ZV8A 4PTEA 1H28A 2W4JA 4PTCA 4IZ7A 4FL3A 5CANA 4CFMA 4FTRA 3ZUUA 4RJ3A 4YJQA 2PYWA 2VNYA 1H4LA 3COHA 3IW5A 2GS7A 3AD6A 4HYHA 3UNJA 4CVAA 4J97A 3R22A 4N0SA 4BCQA 4DFXE 2ZV9A 4NEUA 4DFBA 3P4KA 4YPDA 1FQ1B 2BILB 5E8UA 3UOKA 4L3LA 4ACHA 2PZRA 3FL4A 3GXLA 2VWBA 3DK6A 4L3PA 3T8OA 4F99A 2X6DA 2Y7JA 3A4PA 4OBOA 2YZAA 1SZMA 1UNGA 4TYHA 5CSPA 4CZTA 2WIHA 4XH6A 4BC6A 2GNGA 3ELJA 3Q9XA 1M2RA 5K4JA 4RQKA 2CGXA 5AUTA 1ZMUA 3EN6A 4GCJA 2JBPA 4NTTA 4EH9A 4F9YA 1GOLA 3HMIA 3LJ0A 4LOOA 4M12A 3R1NA 4B8LA 5FM3A 4BWKA 4UY9A 5DHJA 3Q4ZA 4YSMA 5CF4A 3PA5A 4YJVA 1Q8UA 5KX8A 1OMWA 3U6HA 3O50A 4KRCA 2J2IB 3P7AA 4LV5A 5LMKA 3HL7A 1LP4A 3RP9A 3F2NA 1PXJA 4L3JA 3TV7A 4O84A 2BR1A 4YJOA 5GJGA 2VTIA 4F1TA 2ZB1A 5I9XA 1OI9A 4P7EA 5DH3A 4USDA 4EC8A 3V6RA 2O65A 3NW5A 3JR1A 5KNJA 5JH6A 3C50A 3H0YA 3NMUF 3QU0A 3ZEPA 3WF7A 2OICA 3HAMA 2VTJA 3PY0A 1JQHA 3MVMA 3E7OA 3QD2B 2YLEA 4FKPA 3R9HA 4HYUA 3A7HA 4CRLA 5IH5A 1H01A 3E8CA 2R3FA 3ZOSA 4F7JA 4XOZA 3QUEA 4CLIA 3U55A 4XMOA 1ND4A 4PL4A 3I5ZA 4HGTA 4P5ZA 3JXWA 3G2FA 1PW2A 2CLQA 4NCTA 4CQGA 5CQUA 2JKQA 3BHTA 2CSNA 4AOTA 4E3CA 4XUFA 1IA8A 2QLUA 2R64A 4AX8A 5HE1A 2C3IB 3BGZA 5EQYA 2YN8A 2Z7LA 5L2QA 2B53A 2GHMA 4O1OA 2W4OA 2YISA 3GU4A 3FI2A 4FT5A 5HO8A 3TT0A 3UDBA 4AZSA 5JQ8A 2F57A 3OXZA 5IQFA 5HNIX 1IRKA 3F61A 3MYGA 2DWBA 4L46A 5ANDA 3OS3A 4AWIA 4ERWA 4BTFA 5JN2A 2RL5A 3SW4A 4IWQA 4UZHA 4C61A 3HMPA 3KB7A 4ZY4A 5JGBA 2W1CA 5FEEA 3RAIA 3ZDUA 5JZJA 4F0FA 4UMQA 5AMNA 3VBYA 3TUCA 1PHKA 4FKOA 3R7OA 3LOKA 3R8VA 1LEZA 4FSRA 3F2AA 2VTQA 3R30A 3AG9A 1L3RE 1BI7A 3N51A 5FDPA 3LMIA 4Z55A 3VQUA 1PMNA 2C47A 3QKMA 3SQQA 2JEDA 3KXZA 1ZAOA 3WE4A 4R7HA 2OLCA 4QTBA 2ITVA 3HX4A 3WF9A 4PF4A 3VQHA 2QHMA 4DH8A 4R5YA 1OVEA 3BU5A 5JRQA 4O7WA 5A3XA 5M09A 1XO2B 1NVQA 1DAYA 5TKDA 4CTBA 4M0ZA 3SOCA 3R83A 3H9RA 2H8HA 2O5KA 2JDRA 4FT3A 5IH6A 3HA6A 5CXHA 1RDQE 4KIPA 1JSVA 2YM4A 4BCOA 3UMWA 3C51A 4E73A 3A62A 3QRIA 1FBNA 4B8MA 4PWNA 1URWA 3R7IA 3OEZA 4AAAA 1OUYA 3MH1A 3FPQA 4GK4A 2QOFA 1BL6A 4MD7E 2CGVA 3LFBA 3UO5A 4QTCA 4C34A 1Z57A 1WZYA 3NR9A 2WU7A 3U87A 2A0CX 4H3PA 4ASXA 4C58A 4XYFA 5L3AA 3AMBA 4UMUA 3BCEA 5A9UA 1Q62A 4EOQA 4IVAA 4ID7A 4MNFA 3JVSA 2OSCA 3P7CA 2BDJA 3BV3A 5CTPA 5CF5A 5LMBA 3R9RA 5DVRA 2YCRA 2CLXA 4GH2A 3E63A 4I0TA 5EDRA 4ENYA 5I9YA 3VIDA 3R2BA 3E93A 3PJ2A 4EOSA 4D2VA 1E1VA 3AT2A 5J5SA 4R7IA 3UJGA 3R73A 3BIZA 4I6HA 2HY81 4U41A 4BCFA 5IEXA 2J5FA 2QG5A 4GT4A 4UALA 2WQBA 4DTKA 3OT3A 4KD1A 4GYIA 3EHAA 3B8QA 5A46A 5TE0A 3VBWA 2Y6MA 2C6OA 3FE3A 5DN3A 2AUHA 2P0CA 3TTIA 3JPVA 5E8WA 3FZTA 2HXQA 4YJTA 4AT3A 4BDEA 4CNHA 1KUTA 2Q0NA 4BZNA 3BYVA 2W4KA 3F2RA 2IVVA 3LXKA 3D5WA 3O0GA 1ZYLA 3QKLA 1ZMWA 3RTPA 1YXVA 3EQBA 4JG8A 4RJ6A 4WBBB 3OY1A 4O0SA 4XHKB 3UC3A 4FEWA 5DWRA 4PNKA 5KO1A 2X7FA 3QTUA 4V04A 4QTDA 3NZ0A 3LJ1A 3HUBA 3MH3A 4AACA 4EOLA 2HXLA 4FSTA 4Q5EA 3VBXA 3C5UA 3NYOA 2PUPA 4BCKA 2C6MA 3UTOA 2V0DA 4MBLA 2HW7A 5AJQA 2XEZA 2G2FA 2X2LA 3CXWA 3POOA 5EH0A 4F09A 2C5XA 3ZCLA 3QQFA 5HG9A 2EXCX 3O51A 2BRGA 4NUSA 2OWBA 5AV1A 2HENA 4BYIA 3F9NA 2YIXA 4MXAA 5M06A 2UW7A 3O71A 4G5JA 4IX4A 3BHUA 2XZSA 2BZKB 3R7VA 4X6RA 1YOMA 1BKXA 2C1BA 3OXTA 2WZJA 4GIHA 5IUGA 4JAJA 4OTHA 5B0XA 2X8EA 3QF9A 3DBQA 4KABA 3ROCA 5BVEA 3V5QA 4D4YA 5CAPA 4D4SA 4FSUA 4FNWA 4IB0A 3TWJA 4Q2AA 3LCSA 3RWQA 4BYJA 3GFWA 4DINA 5CAQA 1J1BA 2P55A 4FNXA 5DE2A 2RFDA 3Q32A 4E4NA 3EL7A 3UNKA 3EWHA 2QO2A 3R21A 5T3QA 5KCVA 2R3KA 4GRBA 4XBUA 3Q9YA 4FZFB 4E4XA 2F4JA 4X6QC 3GUBA 4FSZA 1BX6A 3QD3A 2R3MA 2PSQA 4FT7A 3BHHA 5EM7A 3TKIA 4D4RA 5CNNA 4H05A 4U79A 3CJFA 1ZYJA 3HMMA 3Q5ZA 2VWWA 2IO6A 3I7BA 3Q4UA 4NIFA 4PUZA 1T45A 3DA6A 3RVGA 4U0IA 4GV1A 1BYGA 4CEGA 4YZDA 3MPAA 3ZC5A 4DG2E 1K3AA 4E6AA 5J9LA 3NUNA 4QMLA 2I0YA 3R71A 2OJFE 4I5MA 4LG4A 4ONAA 5E92A 3MY5A 4DH3A 4O38A 4F7NA 2QO9A 2R3JA 4IB1A 4X21A 5BMMA 3I6UA 4C4HA 3W2PA 4FZ7A 4RVMA 3SW7A 3DXNA 1XH7A 4ZJVA 4ZLZA 3DXQA 4EK5A 4DBNA 2F7XE 2WMRA 1V0PA 3EH9A 2O3PA 1YDSE 1OIQA 2X2KA 2YEXA 3KULA 3RM6A 3R7YA 4R3PA 2XVDA 3FUPA 3R28A 2XP2A 3FPMA 2C3LA 1G5SA 3EL8A 3PWDA 4ZS0A 4ZTRA 2HZ0A 5CENA 4AZTA 4C4IA 3COMA 3O8UA 3DB8A 3F88A 3FQSA 4C4GA 2JD5A 3LHJA 3VUMA 5EG3A 4BIEA 2J7TA 2GNIA 4I23A 2RGPA 3F5XA 2VO7A 2C6EA 2W1FA 4IAKA 1HCLA 3GC0A 3GCQA 3KVXA 2F2UA 3ZFYA 5KE0A 4L68A 2YHVA 5CLPA 2O8YA 3PDTA 3IOPA 3TIZA 3TCPA
chains in the Genus database with same CATH superfamily
3E87A 5CNOA 5BQ0A 3NCGA 4ASZA 1R78A 3OCTA 3ZSGA 1OKZA 2BIYA 1QCFA 4J71A 4IWOA 4K77A 3CQEA 4RIOA 5I9ZA 4N70A 5CU6A 5M4IA 3MFRA 3V5LA 3IKAA 4FIFA 2ERKA 2J9MA 4DTBA 1ERKA 4YZBA 3EQCA 4E5AX 4KKEA 4NL0A 2O0UA 2EXEA 5DLSA 2XRWA 3RAWA 4Q9ZA 4YUQA 4IC7A 4UV0A 1VYWA 3HNGA 2VO6A 2PZYA 3BGQA 3W2OA 3GT8A 3LIJA 4F6WA 4QMWA 4U40A 5D1JA 2IN6A 2ZB0A 3RWPA 2Y4PA 1Q8TA 1WVXA 2VWYA 4QMQA 4KUJA 1H27A 2VRXA 3OBJA 3AKLA 4HPTE 5E8TA 4TYHB 2XNEA 2QOLA 1FVRA 5GHVA 1ZRZA 2HY0A 3QTQA 5E8VA 5I0BA 3GOKA 5BVFA 2CNUA 5K0XA 3D94A 3FV8A 1SNXA 2GHLA 4KB8A 1MRVA 1WBTA 4RFYA 4DN5A 2W7XA 4EH5A 2XK9A 4F9AA 4EORA 4WNMA 2BKZA 2XIXA 3GU5A 3LCKA 2QOQA 3HP5A 3DK3A 3O7LB 4QMXA 3NVMB 2XA4A 2R3IA 4D5KA 4YJRA 3DS6A 4L67A 2WMBA 4G3FA 3QWJA 2WTWA 3HRCA 3QXOA 3VBQA 5FTGA 4PMSA 4RWKA 4GEOA 3FZPA 3MJ1A 3CPCA 5EI8A 3OWPA 4C0TA 4F0IA 1H25A 4RRVA 4ANQA 5HLPA 2J0IA 2V5QA 2CMWA 3NUSA 4MQ1A 5CSVA 3EN5A 4IMYA 4TZRA 4DH5A 3U6JA 3BPRA 3CR0A 1VJYA 3VBTA 4E93A 4F78A 3W55A 2PUIA 3KL8A 3PVGA 4RQVA 2YM5A 1K9AA 3D4QA 1WBNA 4G1WA 5EDPA 3K5VA 5LVOA 3ORIA 4I22A 4EOMA 5CZIA 3SAYA 3NYNA 3RAKA 3VAPA 4YJPA 4O83A 3HECA 4MK0A 5AUZA 4PP7A 5I9WA 3GOPA 3KEXA 2CCIA 4YHTA 4M15A 1MRUA 5HTCA 4MUQA 3Q96A 1V1KA 5ANKA 4JDJA 4U81A 4EWHA 2ESMA 3GGFA 2QU5A 4QT1A 3F5PA 2P4IA 3GQLA 3FSFA 4JBVA 3RPYA 4A9TA 2B4SB 4F70A 4FIGA 3G9LX 4KS8A 2X0QA 1OBGA 4FTOA 3LMHA 1F5QA 3SRVA 4ZSEA 1P14A 5FTQA 3IGGA 4AN2A 3QCQA 3FY2A 3P79A 5ETCA 4I5PA 2YIRA 4QMNA 3GCVA 2VX3A 3ENMA 5KUPA 4C3RA 4IB3A 3DLSA 5AUWA 2X4ZA 3VS4A 5TOZA 4AS0A 3E5AA 3QD0A 2G1TA 3ZLXA 1P4OA 1CKPA 4DEHA 4GK2A 3ZXTA 1O9UA 3L9MA 2VWXA 3WI6A 2Y4IB 3V01A 5DEYA 3WZKA 4B6LA 4E6DA 1YHSA 4GVJA 2BZJA 4QOXA 4X2GA 4KRDA 5L6WL 4HCTA 3TXOA 1BL7A 3U8WA 2F7ZE 1WBWA 4OAVB 4FKGA 5BYZA 1W98A 4ZP5A 1CKIA 3NIZA 1NA7A 4L45A 4ZTHA 3VONA 5DYJA 4EKKA 3COIA 5J8IA 1PMUA 4JJRA 3W0RA 3QZHA 3P9JA 4FT0A 4Z7HA 4JBPA 3TJDA 4FR4A 4HZSA 4A9YA 4B99A 1GIJA 4JG6A 2YCSA 1TFFA 3RPOA 4PQNA 3V04A 3F82A 3LFSA 4I93A 4KIKA 2ZFYA 3R0TA 2OZOA 4QPAA 5DOSA 4LRMA 2ZDUA 3Q04A 3ZMMA 3DDPA 3BYMA 5CS6A 3MFSA 3R00A 5AP3A 3CGFA 4BHZA 2VWIA 3DAKA 3LQ5A 4S34A 3UODA 4A06A 3EOCA 2F7EE 2ETKA 5AAFA 3ORXA 4NFMA 3UZTA 3RCDA 3SVVA 5EHLA 3RZBA 3LQ3A 3VS5A 2A1AB 2WB8A 2W17A 2GMXA 3OW3A 1PYXA 5EOLA 3DQXA 3LCTA 4J95A 5F4NA 4XX9A 5D7AA 4C02A 4BR3A 4JRVA 2WELA 1OL2A 2J4ZA 4TYJA 3UIMA 3P1AA 4QMYA 4AGWA 2WKMA 2R3HA 4RIYB 2VTSA 3M11A 3ANRA 4IACA 5CI6A 1OGYA 4MKCA 1JWHA 3A8XA 1R0PA 3OC1A 2VTHA 4I4FA 3Q3BA 5GJDA 2B55A 4IDTA 4ZXTA 1J7UA 2JKKA 4W4VA 4RZVA 4APCA 3K2LA 4HYSA 4L43A 4MWHA 2YERA 2XUUA 3F7ZA 3HV4A 4ARKA 1XH8A 2W96B 4IIRA 3CSVA 3I6WA 3V5TA 4DDGA 3MFUA 4AZVA 4HVDA 1XWSA 1JKSA 2GNFA 3DKOA 2PVYA 5EQEA 1OGUA 4C62A 3DLZA 3KFAA 4FKUA 1CTPE 4XLVA 1XBAA 4HYIA 3AQVA 2OJGA 2QNJA 5GZAA 3KA0A 3KRJA 3LXLA 4MHAA 2RG5A 4KBAA 2DS1A 2XNGA 2BRMA 1WFCA 1TVOA 4BDJA 2B52A 4BICA 5A4EA 1OITA 3IW4A 1XQZA 3KRXA 2XK8A 4JT3A 2CKPA 3DKCA 1KOBA 3HYHA 3KU2A 4IM3A 4UWYA 2OXXA 3IPHA 5CEQA 5KKRB 1WBPA 3Q5IA 3PA3A 4DHJA 3DKGA 4FEUA 3EZRA 1H0WA 3PVWA 2YDKA 4I3ZA 1XBCA 4IZ5A 3CJGA 4AQKA 4GK3A 4ZTLA 3W18A 3TM0A 5IMEA 4HVGA 5C4KA 3KXMA 2QCSA 1W2FA 4IANA 5LMKC 1JNKA 2BAQA 4TWOA 4DE4A 3R04A 3FMKA 3FMHA 4FVRA 2OJ9A 4IC8A 5JGDA 4FVQA 4BL1A 2BFXA 4OBQA 5AP4A 2X39A 1DI9A 3MVHA 1OPKA 1O6YA 5CY3A 3DBCA 5AR8A 1EH4A 5HI2A 1AGWA 5AWMA 5HD7A 4EK6A 4FTNA 3IGOA 5L2TA 3CLYA 3MW1A 2VWUA 4OBPA 2J6MA 5CF6A 3KY2A 1WMKA 2W9ZB 3SOAA 4MTAA 4K11A 1U54B 2UZEA 1KE7A 3FI3A 4G3CA 4FTUA 3TN8A 4C57A 4QMPA 4RVLA 4NT4A 4IEBA 2EWAA 4YC6A 5T6KA 5KBRA 1OIRA 4N4SA 2C30A 3U9NA 4G31A 3OZ6A 2C0OA 4R1VA 5ANGA 2GU8A 4IVBA 5DEWA 5HO6A 1W0XC 3NS9A 4NCTC 4NU1A 4ZOGA 2V7OA 3LKMA 4QO9A 5HCXA 3ZZEA 3PUFC 2W1HA 2HWPA 4BN1A 5CU4A 5FP6A 4YP8A 3POZA 2ZV2A 3DJ7A 3T3UA 4U3YA 3BGPA 2UZWE 4DFYA 4D0XA 4E1ZA 2WO6A 4AXEA 4FKSA 3NSZA 1OL7A 2C0TA 3D7TA 1Q24A 4O0RA 4O7ZA 4LGDA 1ZYSA 3R63A 4A07A 3KC3A 5CU3A 4RC2A 3BLQA 4ITIA 2Y4IC 4NIFB 4I41A 4GT3A 4PMMA 4MF0A 3THBA 4R1YA 5EYCA 2UVXA 5DR6A 2QC6A 3MY1A 4O4BB 4ALVA 4U43A 4ANOA 3F3UA 3PFQA 2XKCA 2IW6A 4L00A 4BJJA 2VZ6A 4UB7A 2YITA 2YM8A 3PJCA 4FOCA 5M44A 3CKWA 3V5WA 5E90A 4FKLA 4F6UA 3PY1A 3LPBA 3PJ8A 1QPJA 3R8MA 4WG4A 4R3RA 1HCKA 4GW8A 4U7ZA 4CCUA 3HRFA 4EZ3A 3NYXA 2FSLX 2XCKA 3O5AA 5CYIA 5HICA 3F7WA 3BV2A 3KULB 1PMVA 1U46A 2IZUA 2WMAA 3BEGA 2IVSA 1W82A 3GC8A 5BUIA 4CQEA 5B2LA 1SNUA 3SX9A 3K3IA 2DUVA 3DBDA 2FSTX 4NM0A 1YWVA 4NWMA 3WF6A 4FX3A 4DGOA 4EH3A 5CEPA 2OI4X 3CD3A 5CZHA 3AKJA 4N57A 3EFWA 4JX3A 4N6YA 4EJNA 3FXZA 3W0PA 3G33A 2IZTA 1E9HA 1V0OA 3VS6A 2YABA 3SG9A 4FV3A 2OIBA 4FL2A 4S32A 3UOJA 3UE4A 1NW1A 1KOAA 3FLZA 1JSTA 4G2FA 1XJDA 4X2NA 3TL8A 3H9FA 4XV3A 3BLRA 4PL5A 4ZMEA 3K3JA 2OK1A 4MNEA 3KVWA 2OKRA 1BLXA 3PLSA 2F2CB 2VX1A 3QTXA 1GNGA 2PVLA 3LQ8A 3ORKA 3WYXA 2W0JA 4TT7A 4O7NA 1OPJA 3GENA 2PZPA 4IB5A 3E62A 4LOQA 2I0EA 4LI5A 1GZ8A 1SYKA 5A4CA 3E7VA 5IU2A 4C2WA 3R1SA 2WU6A 3KKVA 4BKZA 4D2RA 5KBQA 2GQSA 1J7LA 3EQRA 4A4XA 3UVQA 2C6LA 4ZEGA 5EKOA 3SA0A 3OW4A 4R3CA 4F7SA 1PXPA 2R3RA 2EB2A 3SLSA 5HVKA 2C1AA 2QI8A 2R7BA 5CX9A 5BX0A 2NNWB 3L8XA 4G3EA 4J8NA 1YOLA 4JLCA 5AUYA 3I60A 3ATTA 4I94A 1Y8YA 5KKRC 4KIQA 3G90X 4MXCA 3S00A 4HCVA 3DK7A 2H9VA 4UWCA 2XEYA 4MH7A 1YOJA 3U9CA 3I0OA 4FOBA 4I6FA 4WD5A 3QHWA 2C6IA 3JUHA 4PMTA 4WIHA 3RK5A 2UZLA 4ACGA 3OCSA 1ZY4A 4JQ8A 4AOJA 3EQHA 5CT0A 1BMKA 3GQIA 5CEKA 4BY9E 2UV2A 3UO4A 3N4TA 4BIDA 4D1SA 5H8BA 3DBFA 2W5BA 1KV2A 3QGWA 3BLAA 2NO3A 3UDTA 2PL0A 2PVKA 4UXQA 2AQXA 3KCFA 2ACXA 2SRCA 2WQEA 3ACJA 3IW7A 4FTAA 5IEYA 3PSCA 3VUKA 4E6QA 3K5UA 5HE2A 4ASEA 4BBFA 4YLJA 3UPZA 5EYDA 4EKLA 4FTTA 2PTKA 3I4BA 3ZLWA 4J52A 5BYLA 4XOYA 2PVRA 4Z9LA 4JDIA 5KZ0A 3DXPA 2GTNA 1I09A 4ACDA 4WO5A 4ZMFA 4YZMA 5HX8A 3D5VA 4RWLA 4L52A 4UYNA 4AT5A 2YJRA 1FINA 2BDFA 5F20A 2ETRA 4LDTA 2A27A 4CG8A 3UDZA 3W32A 4J1RA 3S4QA 2Y0AA 4CFXA 4EH7A 4EH6A 5BUEA 3G15A 3QQJA 3SRVB 3VVHA 3DZOA 2X0PA 4JXFA 2ITPA 4M0YA 3REPA 3VW8A 5BV3A 3VS1A 5B7VA 3F3ZA 3DGKA 4RZWA 4YJSA 5EFQA 1Q8ZA 4FT9A 2B54A 4LV8A 3C5IA 5KMJA 2BIKB 3GU8A 2HW6A 2XNBA 2WEVA 2Z7RA 4LFIA 3ZBXA 2GS6A 3QD4A 4HVHA 2FH9A 3ODYX 5GIOE 3PIZA 2UVZA 2ITOA 3GC7A 3ZO3A 5JKGA 2Q0BA 4IADA 4GSBA 2VTNA 2JFMA 2UW3A 3D5XA 4FA2A 4AGCA 3NUXA 3FXXA 1WBVA 5DBXA 2EB3A 5BPYA 3NLBA 1Y6AA 1YWRA 3FEGA 3HAVA 4A4OA 2P33A 4XP3A 1W8CA 5EW8A 4GFOA 4YZNA 4GKHA 3QYZA 2A19B 5KZIA 4I21A 2ZM3A 1STCE 3G5DA 3W8QA 2H34A 4Q9SA 4AFEA 4XLIA 4KIKB 4YTFA 3EQGA 3KRWA 4LUDA 2NYAA 2CN5A 4XG3A 3VS7A 3F3VA 3MJ2A 4QYEA 2A98A 2UW9A 3VRZA 4TN6A 1W2DA 5JFVA 1U5QA 4KINA 3IONA 1XHAA 4EEVA 3B2TA 4MXXA 1IAJA 2VUWA 4FG8A 3PY3A 5LWNA 4G3DA 2DYLA 3SC1A 4WNOA 3VF9A 3NFGB 2QQ7A 1CM8A 3GCSA 4IAFA 4YZ9A 3E3BX 4ORKA 1YVJA 1I44A 2PE1A 4D2PA 2AYPA 2Y6OA 3QUPA 2V55A 4DF3A 3DCVA 1MUOA 4CLJA 1H08A 1W83A 3MN3A 4OTGA 3P7BA 3RHKA 2WTKB 4U45A 4DCAA 4BDBA 4AA4A 2XNNA 3VUDA 3ZONA 2J51A 3C4CA 3C7QA 2FUMA 4KSQA 5BNJA 1V0BA 2F49A 2IZSA 4O91A 3FL5A 1DI8A 4RFMA 3EQDA 3Q52A 4FKWA 4AFJA 2QOOA 3P5KA 4DG3E 3AMYA 3PIYA 5L6PA 2CNVA 5AX3A 4AT4A 4BDDA 3ZXZA 5ANJA 3W1FA 2FB8A 2Y9QA 4BGGA 4QPMA 3D2IA 2RG6A 1WBSA 3HDMA 3EN4A 1FOTA 3IQ7A 4FTJA 5HNBA 2FO0A 4GG7A 4DFNA 4NFNA 4O7SA 3CE3A 1PJKA 4M67A 2FSMX 3RI1A 5AP0A 4C4FA 1XH4A 4EUTA 4PTGA 4FZDB 3LLTA 3FZOA 4PPBA 4QP4A 4O27B 5IH4A 5TF9A 3QCSA 4OAUC 5HVJA 4R77A 5C9CA 3QQGA 3AD4A 2ITXA 3QX2A 3FC1X 2JGZA 3L8VA 4LMUA 3PXYA 4O2ZA 4D1ZA 1XH5A 3ZYAA 1Z9XA 5LCKA 3VS3A 4W9XA 5J5TA 2CDZA 4G34A 4F6SA 5CAUA 3IW6A 4RA5A 5HBJA 2WMSA 3ZRKA 5HO7A 5FLFA 3U54A 1Q3DA 4W8EA 3RJCA 4F4PA 5IA4A 4C7TA 5IQHA 5AP1A 4AXAA 4BTJA 3T3VA 2Z02A 3PXRA 4FL1A 2YWPA 2FA2A 3BL9A 3BQCA 4L7SA 2QKRA 4FICA 3G51A 4HNFA 5KHWA 4L7FA 5FBOA 5F9EA 1QPDA 3HRBA 5LVNA 4XP2A 4NH1A 1Q8YA 4QQTA 2PE2A 4DLJA 4D58A 4MQ2A 4I0SA 3NW7A 4FTIA 5ETFA 4TPTA 3DTWA 4CT1A 4DA5A 5FP5A 4A9UA 1JKKA 4JG7A 3MTFA 4DEEA 3MH2A 1SMHA 4K9YA 2WHBA 4FV4A 4PV0A 3DAEA 4NM7A 2W99B 5CU0A 2C3JA 3L9NA 4FK6A 5JEBA 5H2UA 5J1WA 3CP9A 3KMUA 5A6NA 2ONLA 1UV5A 2C6KA 3WILA 3CBLA 3HKOA 3FKLA 3TNPC 3RMFA 2C0IA 3H0ZA 3MB7A 3NUAA 4NW5A 1OZ1A 4E26A 1TKIA 4DT8A 4BDCA 2WNTA 5F1ZA 4IM0A 1Y6BA 4JIAA 5EK7A 3WF5A 2GCDA 3DKFA 3BRBA 4W4XA 3GB2A 4QP6A 3R8ZA 4BI1A 2G15A 5E8SA 4ZSAA 3QTRA 4EOJA 3QTWA 3A61A 2J5EA 4GFGA 2PUUA 3W10A 3W33A 4B7TA 3VW6A 3CCNA 2JKMA 1YHWA 5AUXA 5BVOA 2RIOA 5AX9A 2PVMA 2RF9A 3PSBA 4BWXA 3MVLA 3D7TB 5HORA 5HQ0A 1ZOEA 3L8PA 5IISA 3UVPA 2BHHA 3A4OX 2OZAA 3V8WA 4ZJJA 3QFVA 3FXWA 4JI9A 5CI7A 4FF8A 2PUNA 4PY1A 3ATSA 3SHEA 4RLKA 4EYMA 4K1BA 5DNRA 2IW9A 3PZHA 3EQPA 4FEXA 3CGOA 4TWPA 1MQ4A 4QP3A 3CY2A 4TKSA 4TRLA 2OF2A 3QTSA 4X3JA 5DG5A 4PMPA 4BJJB 3NCZA 3OXIA 4YNEA 4DH7A 1ZMVA 3NIEA 4XRLA 4UMRA 3RALA 1JBPE 4ITHA 4DC2A 3GBZA 2BZIB 4WG3A 4FSQA 4JX7A 3LCOA 4QPSA 4RMZA 3TNQB 5HNGA 1Y91A 3DV3A 2OFVA 3Q6WA 2GHGA 3K54A 4HNIA 5AR2A 5I3RA 5FRIA 1J7IA 1HOWA 1Q3WA 2ZMDA 2XARA 2CHLA 1J3HA 4GL9A 3ZFMA 4EZ7A 3DT1A 4Y5HA 3QQHA 1GZNA 4X2FA 5M55A 3A7JA 3MBLA 5BVKA 2I6LA 3MIAA 2ITYA 2BUJA 2RKUA 3JYAA 3FMJA 2PVJA 3D83A 4MVFA 2OFUA 4OTRA 3TZ8A 1TQPA 5ITAA 3D2KA 4DAWA 2QODA 4IAZA 4FRFA 4IZYA 5CF8A 5IDNA 2YDJA 3GP0A 3W8LA 4BVUA 5KMKA 2UZVA 2WTKC 1QMZA 4ALWA 3VUHA 1ZZLA 4TXCA 4OTIA 1UVRA 3OTUA 2XJ1A 4AUAA 3D15A 4W8DA 4Y83A 2VAGA 5ANEA 2X0OA 2O64A 1OPLA 4Y95A 5E1SA 4EK4A 4JOAA 3VRYA 1W84A 4IAAA 2WMUA 1H0VA 3FMDA 3VNTA 5C1QB 4RJ4A 4CV9A 1ZOGA 4PRJA 3BE9A 4DFUA 5H9BA 1H1QA 4TL0A 2PVNA 2WAJA 3T9IA 3PE1A 1OKWA 5HKMA 3H10A 5D10A 2JIVA 2BPMA 3ZFXA 4J53A 2WMQA 4O0WA 1ST0A 5ETIA 4AN9A 2Z2WA 2VTLA 2PHKA 2XNMA 4I0RA 2R5TA 3RINA 3PTGA 4JL9A 2XH5A 2PK9A 3U4UA 2XKFA 3DTCA 3PZEA 4QYGA 3FLSA 5HIEA 1X8BA 4IFCA 4R8QA 2R2PA 3P5JC 4QTAA 4FVPA 2LGCA 2Q83A 3NW6A 5HCZA 2X2MA 3BQRA 2X4FA 3FLQA 1VZOA 4FIIA 4EQUA 3BYUA 4AA0A 3C4EA 4D4VA 3C1XA 3QCXA 4FTQA 4OT5A 4RWJA 4HVSA 4CYIA 1H1SA 2KTYA 3H3CA 3BELA 5FXSA 1O6LA 1M7NA 5DR9A 5FDXA 5IA3A 5AP7A 4ITJA 1IAHA 4J98A 3C0HA 5CVFA 1VYZA 4KWPA 4AGDA 3LXPA 4P2KA 4QP8A 4YHFA 3QRUA 4OW8A 3PWYA 3GVUA 4U80A 1UNLA 3QCYA 4JAIA 4DHIB 3P23A 3S0OA 5LWMA 1LPUA 4UEUA 1NT2A 5B2KA 1H26A 4A9RA 4NYEA 4KNBA 4O4CA 4FV9A 3V3VA 4RT7A 1YI3A 4WKQA 3I79A 5HD4A 1B39A 2CKOA 3F5UA 4EOIA 2UVYA 5FXRA 3TDVA 5CAOA 1KE9A 5DMZA 3KXXA 5K4IA 3FC2A 2XB7A 2PULA 1WAKA 2HZIA 4FJVA 4FKJA 4FSYA 4KAOA 5JFWA 4PL3A 4NJDA 1WCCA 5EI6A 4JIKA 3DFCB 2VTRA 2Z7QA 3E64A 1BI8A 1M17A 5EDQA 5HOAA 3E92A 3C4FA 3LZBA 4GKIA 3OTVA 3KN6A 4DTAA 4FTMA 3BZ3A 3A7IA 3RK9A 4ZIMA 4W9WA 5CEOA 4R6VA 1YWNA 2PMNX 3HEGA 3NNXA 3R02A 4AZWA 2QLQA 1IASA 1ZY5A 2XM9A 2BALA 1J1CA 3DU8A 4MBJA 1SM2A 5HBHA 3R8PA 4QMVA 5ICPA 3VUTA 4ZTNA 1U4DA 3QTIA 4LRJA 5HIDA 4BB4A 2UW8A 3TI1A 3FKOA 1S9JA 5HESA 5I9UA 1GJOA 3D7ZA 3MFTA 5AP6A 2OH0E 3HV7A 3TNIA 4Y73A 5GIPE 1PXNA 2P2HA 2YAAA 5EQPA 4R5SA 1QL6A 2G2IA 4XRJA 5DT4A 4LMNA 2VV9A 4O4EA 5HEZA 3LCDA 2ZYBA 5HIBA 5CT7A 5ACBC 3ZZWA 3KMWA 2EUFB 2C5YA 2H96A 2BHEA 4H36A 4RIWA 2WTIA 3Q2MA 4I6LA 3UIBA 4L8MA 3OCGA 2IW8A 2EVAA 4TYGA 2W1GA 1ATPE 3MPTA 4JQ7A 4BI0A 4FNZA 4I5HA 1LEWA 4YJNA 3RBWA 4QYFA 3QYWA 1UU9A 2QOHA 4RJ8A 3FMLA 3UBDA 4C2VA 5CALA 3PXKA 1YXXA 3DB6A 3CIKA 3ORLA 4GMYA 3ERKA 3BKBA 5K3YA 4JDKA 5G6VA 4EONA 4E5WA 3PYYA 3VHEA 2ITTA 3HV5A 3BU6A 5L8JA 4UWBA 2QD9A 4C4EA 3JS2A 4H58A 2X0GA 3PPKA 5FM2A 2Y8OA 4XS2A 1E1XA 5JT2A 5JSMA 4BGHA 5A4TA 5I3OA 5M07A 3PRFA 4R7BA 1XH6A 3NNWA 5LVMA 4IWPA 3QC4A 4WRSA 3OOGA 4AXDA 4PPAA 2IVTA 2VO0A 3DBEA 4IH8A 4IZAA 5CWZA 4EQMA 4O21A 1GIHA 5TT7A 3OP5A 4KKHA 4K18A 2YIQA 5IEVA 2CKQA 4UX9A 2W1ZA 5AEPA 1JOWB 3ZLYA 4KSPA 3WARA 4F9CA 3SKCA 4QDVA 2BDWA 3FDNA 3HMNA 4WT6A 4KIOA 5GINE 5HGIA 2VTAA 4TYIA 3QUDA 3FYKX 1URCA 4WSQA 4DT9A 5B2MA 3TEIA 3CPBA 4CFWA 2ZV7A 4QDEA 3CQUA 3V6SA 2XANA 3M2WA 5L2SA 1Q61A 4FUXA 3AXWA 4WRGA 5BMSA 5AFVA 4YBJA 2ERZE 3FMEA 3QXPA 4TNDA 3DPKA 1JAMA 2GNJA 3UIXA 4BDKA 2ZMCA 2OXYA 3UOHA 2REIA 3DAJA 4O86A 5IMXA 2QVSE 1VR2A 2CKEA 3BBTB 4F9WA 4CRSA 4B4LA 2E9UA 4BDFA 3UZPA 2OJIA 2V62A 2YM7A 4O6LA 4UBAA 4F63A 2QG7A 3B2WA 4FE2A 2CCHA 4IAYA 3O23A 5CSXA 3QA8A 3AC5A 4DEDA 3W2QA 3HP2A 4UMPA 2YCFA 2JITA 3OFMA 5JRSA 3WE8A 3N4UA 4O7RA 3F69A 5AR4A 4XV2A 5EYMA 4AU8A 5EKNA 4L44A 5AV0A 2EU9A 3QBNA 2BTRA 4U97A 5BYYA 2B9FA 3I1AA 2VTTA 3MB6A 5DRBA 5IA0A 4MWIA 4P5QA 4O96A 3HUCA 4EH2A 3EFKA 4PX6A 3HV6A 3NVKI 2C6TA 5HTIA 2E9VA 5G1XA 5C8KA 2WIPA 4RVKA 4IHPA 4QP2A 4WUNA 3TJCA 1F0QA 3FHRA 2J50A 3BBWA 3KGAA 4FV5A 3ALOA 4QMUA 4EC9A 5J7BA 2ZVAA 4HW7A 4HZRA 4DG0E 3ANQA 4QTEA 1ZZ2A 3ZDIA 2I7QA 3WZJA 3SGCA 3A8WA 1BUHA 2GNLA 5IPJA 3FLWA 4DGMA 4FC0A 4JMQA 4FIJA 2XBAA 4FGRA 1PXKA 4NKSA 4G9CA 5E7RA 5CAVA 3RM7A 4TTHB 4R78A 2UZUE 2GPHA 2VTPA 2UZTA 4ANNA 1H1RA 1XH9A 2R0IA 3PP0A 4EK8A 2QOCA 3SDJA 3ET7A 3RK7A 3GNIB 5BVDA 2DQ7X 1QPEA 5J9ZA 4LQMA 5I9VA 3AC2A 4D0WA 4C37A 3HVCA 4F1MA 3MGYA 5I5ZA 5EHYA 4D2TA 4GIIA 1JLUE 3ZS5A 5CVHA 4YNOA 5L8LA 4G6NA 4U8ZA 3O8TA 3FY0A 4BCGA 4RGJA 4G3GA 3TNHA 1FMOE 4BBMA 3TUBA 2OZAB 3EQIA 3EB0A 4MBIA 5HE3A 4BKYA 2O63A 2HWOA 5KHXA 4LGGA 2WD1A 2EXMA 4USEA 2ETMA 1PYEA 2WMWA 4HPUE 4YTHA 2BAKA 4PNIA 4RC3A 4A9SA 1PY5A 2WTVA 4YZCA 3FJQE 3TUDA 4X0MA 4EBWA 3AD5A 1PXIA 2OG8A 2I1MA 3L9LA 3IW8A 2UW6A 3GFEA 4QMSA 5FTOA 3UPXA 2CN8A 2BVAA 1ZLTA 2ZAZA 1UU8A 3GI3A 5FD2A 4QNAA 3EIDA 3QX4A 5HLWA 1H8FA 1PXLA 2BMCA 3IG7A 3ORNA 4O0VA 3S2PA 3FYJX 3D9VA 4ZLYA 3GEQA 3MI9A 5EM5A 3GC9A 2XIRA 4MYGA 3FI4A 5ACKA 1YDRE 4N6ZA 3GU7A 4OLIA 5D41A 1YI6A 4BF2A 4DHFA 1REJA 1UU7A 4ZK5A 3R9DA 4C59A 1AD5A 3Q9WA 2W9FB 1OB3A 5FUTA 2GFCA 4KS7A 3UMXA 3W0SA 1UA2A 4EHGA 2YDIA 1JSUA 4NM5A 2C6DA 4O6EA 4BCMA 3C9WA 3AMAA 5DR2A 2GFSA 3QQUA 2VTMA 1YI4A 4QYHA 3TZMA 3VUIA 3RZFA 3PIXA 2WQOA 1ZARA 2ZDTA 3BWJA 4X2JA 3NX8A 3S95A 1KE6A 1KV1A 1OL1A 2XK7A 2OH4A 1FGKA 2JDTA 3OEFX 4FV8A 4UYAA 2JFLA 3UVRA 4DEBA 2HK5A 4OUCA 5ANOA 5AUUA 5AR3A 3BWFA 1F3MC 3PJ3A 3ORMA 2AC5A 3H4JA 3RPRA 4A4LA 4EWQA 3EN7A 2F9GA 3W0QA 1QPCA 1NVSA 1Y57A 3Q4TA 2B1PA