5E92A

Tgf-beta receptor type 2 kinase domain (e431a,r433a,e485a,k488a,r493a,r495a) in complex with amppnp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
298
Chain Sequence
ELLPIELDTLVGKGRFAEVYKAKLKFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLASAMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVASMADNVLADAGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords TGF-beta receptor type-2
publication title Crystal structures of apo and inhibitor-bound TGF beta R2 kinase domain: insights into TGF beta R isoform selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 298
sequence length 304
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2015-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5e92A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5e92A01
2X4FA 5EKOA 4EHVA 3R83A 4AOTA 1WFCA 4IQ6A 1MUOA 3R2BA 1J1BA 3CS9A 3FLYA 4C3RA 5HD4A 4HCVA 5HTCA 5I4NA 4MCVA 4BZDA 5IZFA 3F9NA 5G6VA 3R8PA 4O84A 1ND4A 4RFMA 3IOPA 2VTSA 2OBJA 4D2TA 3R73A 4LYNA 3Q6WA 4F09A 5KMKA 2XEYA 3JY0A 5E8UA 3TIYA 4CTCA 4O7ZA 2UZBA 3W18A 4AW1A 4PPCA 5HVKA 4S2ZA 1UWHA 5JGDA 5J5SA 2G2HA 5BUEA 4O1PA 5BQ0A 3GQLA 2WKMA 4O21A 5EHYA 4PTCA 3KF7A 4U6RA 3PPKA 4C61A 4IWDA 3DAEA 2C5OA 4MXZA 5LWMA 4EL9A 3LCKA 4B9DA 2F9GA 2XA4A 4Z9LA 3PY3A 1U5RA 2W1FA 3DBEA 4C3FA 3QCXA 2VWBA 3DBCA 4O7RA 2CGWA 4RVMA 5EM7A 4ZTHA 3EH9A 3PVUA 5IUIA 4DEIA 2VTNA 3CY3A 3MVJA 5DI1A 3LMGA 3FMJA 3GCQA 2H8HA 5CZIA 5I3OA 3ZUTA 4HPTE 1YW2A 5FBNC 4G3FA 5J9ZA 4DH3A 2YM4A 2R0UA 2JKOA 3BEGA 4BCIA 3ORIA 4O0VA 4CRLA 3NW6A 3A7JA 1UNGA 3B8QA 2YDJA 3UIBA 5IEYA 4G2FA 4WSQA 4BWPA 5K5XA 3ORNA 1F3MC 2WMSA 2KULA 2PE1A 1ATPE 2DWBA 1JSVA 5HHWA 4APCA 5HE0A 3V04A 4BDDA 3BBTB 4C59A 1YHVA 3Q9WA 4BWKA 3NR9A 3CQWA 5AP6A 2VUWA 2YIWA 4K9YA 3VUDA 3F2RA 4XV2A 1M52A 3QTZA 3T3UA 3OC1A 5HIDA 4C4FA 1OI9A 3LFEA 5FEEA 2YZLA 3V6RA 2HZ4A 4QD6A 3AC3A 5I5ZA 4J52A 5A14A 5DRDA 4LRMA 3PXZA 4QMYA 4WNPA 5C8MA 4GUBA 2GFCA 3NYXA 4DEGA 3ZDUA 2GNJA 2J6MA 5CI7A 3U4UA 4AFEA 1O6LA 1LP4A 4YUQA 3IECA 5KMNA 3DJ6A 4HVHA 4UMUA 5L3AA 4RGJA 3TJDA 1OKYA 3QC9A 2OF4A 4GIHA 4FUYA 5AA9A 3A7HA 3W32A 4FV7A 5EI8A 3D14A 3TTJA 3D94A 3MIAA 1YXTA 2GNFA 3L9LA 5E8VA 3ZXTA 4AWIA 3BYSA 4L45A 5BVWA 1WBOA 4FSTA 4N0SA 5LOHA 5LVMA 3R7GA 1YWRA 5AR4A 1IRKA 2O8YA 3ZM4A 4M97A 3LJ0A 5DPVA 4OT5A 5HLPA 4L52A 3HA6A 3KVWA 2OSCA 1EH4A 1JKLA 3W2PA 2BAQA 4EHGA 2W5AA 1AQ1A 3LPBA 5JZNA 3OBGA 5AR2A 5HU3A 5JQ5A 1H1RA 3UPZA 3ANRA 3Q4UA 4XX9A 3BKBA 5DH3A 4E93A 4ANMA 5AUUA 4CMUA 2GMXA 4O1OA 3P0MA 3PWDA 2RG5A 2HZIA 4CFVA 4AU8A 1TQPA 3TNPC 4IVCA 4CV8A 2PSQA 2QOKA 3POZA 3OBJA 4QNYA 2UVXA 2W1EA 2ZM3A 5AEPA 3GEQA 5I9VA 2ITUA 3RPOA 5L6OA 2R7BA 5EYCA 3ZLWA 3ALOA 5GJDA 2J0MB 4GT3A 2C30A 3GC7A 3VS4A 4ACDA 4R6VA 5IQCA 2IVUA 1H28A 4HPUE 3ALNA 3TKUA 3VNTA 4ASEA 2PULA 2QR7A 3Q04A 2WQBA 4O6LA 2VZ6A 3S95A 5ITAA 4KB8A 3PXFA 3ZTXA 3DFAA 3UOKA 4ZMEA 3IW8A 2W06A 3DGKA 3RAKA 1H1WA 3QTUA 1XWSA 1VJYA 1PKGA 3GC8A 1UU9A 4ARKA 2VTMA 1XH5A 3GFWA 2PE0A 3PPZA 3IGOA 4HNIA 4IANA 4TN6A 4IACA 4AOJA 2R5TA 5CF8A 1Z9XA 2C5NA 4R5YA 2CPKE 5D9HA 1YKRA 2V7OA 3FQHA 2OFVA 3NNUA 2HYYA 4QMPA 4G9CA 4XBUA 3FXXA 1RJBA 1F5QA 5J87A 2HELA 1XH6A 2A27A 4TPTA 2ZB1A 4KIPA 2VTTA 4O83A 4QP8A 3MVLA 5I0BA 1DM2A 2ZM1A 3KK8A 3SV0A 3TKIA 4MBJA 3FSFA 3UQCA 2XIKA 2EWAA 5ANOA 3ROYA 4E6CA 1BL6A 1GY3A 4YZNA 5BMSA 4Y46A 4FTIA 4EOLA 3MV5A 1DAWA 4U40A 1LEWA 4ZIMA 1JKKA 2WTCA 3FV8A 5D7AA 3P7AA 2OXXA 5CF4A 3UIXA 4DITA 3QCSA 4EJNA 1PYEA 1UVRA 2BZKB 3FC1X 3TXOA 4X2NA 3FZPA 4FV9A 3W10A 4GL9A 3ROCA 2CKQA 4Y95A 3ENHA 4L42A 4DFZE 3EQCA 5IH4A 4XG7A 4AE9A 4KAOA 3NZ0A 2WIHA 3LMIA 4CT2A 4KRCA 3PA3A 3O7LB 2OKRA 3VBWA 4ZLZA 1PHKA 4C4IA 2ONLC 2PK9A 4O2PA 3NAXA 5TOZA 4DLJA 3R1QA 1ZMUA 4L7FA 4Y85A 5L6PA 5EM8A 4K1BA 1VR2A 3IGGA 4H3QA 3I6WA 5EYDA 2PE2A 5I9YA 2F7ZE 4BCHA 4JQ8A 3RZFA 5JFVA 4R1YA 4AZVA 4XG9A 3DZOA 3F61A 4EKKA 5D10A 2CHLA 2X9FA 2J2IB 2JBOA 3DBDA 5DWRA 4LOPA 5HCYA 2RL5A 2PVYA 3QQLA 3OWPA 2J5EA 4O0SA 3GXLA 3KCFA 3BBWA 5M4CA 1H00A 2JDRA 3H10A 2WMAA 4WO5A 3UQGA 4ASXA 4E4NA 2G2IA 2XEZA 2IVTA 5H9BA 5CENA 2BZJA 4PL5A 4LL5A 5ANEA 2PVLA 4F70A 2XYNA 2ACXA 2ZAZA 1XHAA 3TNQB 4CGAA 4L46A 4LV5A 4BDJA 3FDNA 5IMEA 4FSNA 3CTHA 5LCJA 4FL3A 2WTWA 4YTCA 2C6OA 2XS0A 3QA0A 3O2MA 2PU8A 3H30A 4YSJA 3GI3A 5J95A 4BBEA 4JR3A 2C6LA 4V01A 5IU2A 2B0QA 4KBCA 2V5QA 2FO0A 3W16A 4KIQA 2GNGA 2UZUE 4I0TA 4ERKA 4IWOA 2HENA 4EOPA 5M55A 1OECA 3ORPA 1DI8A 2B9HA 5EQEA 5CSXA 5KHXA 1XH9A 3QD4A 1YXXA 4JS8A 4HZSA 3P79A 1PRYA 2H96A 4PY1A 5FDPA 4NT4A 3MFSA 5H8BA 3EB0A 4LV8A 4AT3A 2BTRA 3HV4A 4CRSA 4BI1A 3JVSA 2EUFB 3UPXA 3CLYA 4FIHA 4QPMA 2X6DA 5D7VA 4DEAA 3EL8A 5HO6A 4G1WA 3PVBA 3HX4A 5CT0A 1FGIA 2P2IA 4MHAA 3GOKA 2FH9A 4RZWA 1GZKA 4PNKA 4GEOA 4AOIA 5EW8A 3KGAA 4FT7A 4MBLA 3ZH8A 4ANLA 3H3CA 4F1TA 5AADA 2ITTA 2XUUA 2OLCA 1XBCA 4DGLC 4FV1A 1UU7A 5JFSA 1PXLA 1R0PA 4Y72A 4CTBA 4C4JA 4IZAA 4FKIA 4F1OA 5HTBA 5J7HA 2J0JA 3MJ2A 3WZKA 2YAAA 4XJ0A 3UJGA 2FB8A 1HOWA 3MN3A 3NEWA 5I9XA 5ICPA 1H0WA 1W84A 3BHTA 2C1BA 1PXNA 2Z7LA 3FY0A 4LUEA 4PDSA 5DE2A 3ZZWA 2XK6A 4C4HA 4F4PA 3HV5A 3O0GA 5CU4A 3ZSIA 3AT2A 4M14A 2EU9A 2ZV2A 3W8QA 5AP0A 1OVEA 4ANNA 4CMTA 2PUUA 3G33A 3TT0A 3NVMB 3RI1A 4F65A 2OFUA 2OJJA 2YLFA 3DJ7A 2V0DA 5J8IA 5EK7A 2QO7A 4LGGA 3O23A 2XNPA 2ZVAA 4I92A 4CQGA 4E6AA 5IQBA 1OIQA 5EI6A 4PP9A 4G31A 5FDXA 1OL5A 5FTQA 4D4RA 3NW5A 4X2FA 3G0FA 4DHFA 3H9FA 4CNHA 2EB3A 4FKVA 4GH2A 4EK8A 2JBPA 2BKKA 5AP7A 4YNOA 3A60A 2R3LA 4ZJVA 4DBNA 4QMZA 1ZOEA 3PYYA 3SHEA 4DTBA 3W2OA 3ZUUA 4DGMA 4G6OA 4IAFA 4C2WA 4FK6A 4FYNA 3UODA 2QOLA 4R7IA 1YXVA 4PQNA 1OUYA 3IDPA 2B9IA 2WOUA 3O51A 1G8SA 2XIXA 3ZRMA 4XEYA 2F49A 2J0LA 4BB4A 4NW5A 2QO2A 4G3EA 5AV2A 3W33A 3UZTA 4DH8A 2OXDA 4LGHA 3VUMA 4DFXE 5JSMA 4TZRA 3AT3A 3COIA 1PXMA 3FI4A 5KBQA 2VV9A 4U41A 4YZDA 3D15A 4D5HA 4GKHA 3WZJA 2IWIA 1IG1A 4CCUA 2C4GA 3RALA 3LQ8A 3QUEA 4BIEA 4EZ7A 1TKIA 5C8KA 4MF0A 3ZBFA 5K4JA 3EOCA 4XRLA 4CKIA 1XR1A 2XNOA 2HZNA 2YM5A 3MIYA 3RZBA 4I20A 4GS6A 4IX6A 4B8LA 5J9YA 4EOKA 3GCSA 5TKDA 2C3IB 3R2YA 1Q3DA 3UP2A 5IUHA 4CD0A 3I5NA 2J0IA 4BZOA 3QA8A 3D5VA 4KNBA 3VS2A 4F08A 5B0XA 4CYJA 1JSUA 3OOGA 3Q4CA 3OOMA 4M15A 4OTHA 1BKXA 4BZNA 1DAYA 4FT9A 4CZTA 1B6CB 3FKLA 5CAVA 3P7BA 4BICA 4V04A 3CPCA 2FGIA 3PXRA 2ZB0A 5TE0A 4F6UA 2PTKA 2UW8A 1H1PA 1O6KA 3RPVA 5HNIX 4BCGA 2VNWA 2O63A 4CG8A 2BKZA 3PXYA 4LOQA 3V5JA 5CAOA 5EKNA 3MPTA 4L3LA 2NNWB 4FUXA 2R0IA 4IAKA 5DR9A 3SXRA 4C7TA 3U55A 3PJ8A 3UO6A 4FIJA 3UZRA 2B55A 5L2WA 2QOBA 4X3JA 2LGCA 2P55A 4H3BA 4JIAA 5DN3A 3C7QA 1BL7A 4NL0A 2PUNA 3FMLA 5FEQA 1GAGA 5A4CA 1SNXA 2I0YA 3BLQA 2WGJA 3MSSA 4AA0A 3QTWA 4XG4A 3LCSA 3VUKA 3DB8A 4EQMA 1W83A 3RGFA 4A9TA 3DXPA 3R1SA 5KO1A 3MA6A 3F3UA 1W8CA 3AC4A 4DFBA 2PL0A 4YZ9A 4QMMA 3S00A 5L2TA 2XK7A 3EQHA 4QT1A 3RWPA 1IR3A 4NSTA 1Q24A 5L8JA 4FTUA 3UBDA 3FUPA 3QYZA 2NRYA 5BNJA 3C4ZA 4GCJA 3QD0A 4XP2A 4F7SA 5IG1A 4K0YA 4WNMA 5DT4A 5I9WA 3GBZA 3PG1A 1H1SA 4QTBA 1ZOGA 3QCQA 2GS7A 1SYKA 4I93A 2YCFA 3Q52A 4JNWA 5J1WA 3K5VA 4IZYA 5HORA 2QKWB 4S33A 4AF3A 1LPUA 5IQHA 3ZRKA 3QU0A 4D0XA 3TZ8A 4DGOA 4BIDA 4HYUA 3RK9A 2WFYA 3PWYA 2PZ5A 2JAVA 3A2CA 4W8EA 3TZMA 3U9NA 5JQ8A 5LMKC 3MH3A 4RLKA 5LWNA 4KUJA 2QR8A 2X9EA 1ZZ2A 4BDGA 4OTRA 1JQHA 2HY81 2Y4PA 5A54A 4IJ9A 1GZNA 4QMSA 4BCNA 5HBJA 4IZ5A 4GVJA 4OTWA 2VWUA 3NS9A 1ZZLA 5T6KA 3IW7A 4G34A 3OROA 3TV6A 3DB6A 4APPA 4YLLA 3ACJA 2XVDA 4IM2A 5A4QA 3NW7A 1URWA 4JT3A 2WO6A 4M0YA 4CLIA 3VWAA 3QRIA 4M69B 4K8AA 4AXAA 4G5JA 3DQWA 3PY1A 4JDJA 4FV4A 4TNBA 4YHTA 2Y8OA 3BELA 4M68A 1Q8UA 3SGCA 4WSYA 3DBFA 3KULB 4QQJA 3PZHA 2BFYA 3PDTA 4HVGA 3AD6A 1KE8A 4BCQA 5GZAA 4QMTA 4BDAA 1XKKA 5CAUA 5CZHA 4BGQA 3QALE 2XKFA 1Q8WA 3SW4A 5KBRA 3FHIA 5HCXA 2JKKA 1IAHA 3AC5A 2VO6A 4USFA 1OL7A 1CMKE 4J97A 4QP3A 4J95A 5K4IA 2EXEA 3FMHA 2CLXA 1JLUE 4XLIA 3O7LD 2LAVA 3ZFXA 4F1MA 3E8EA 3LFSA 4I6HA 3VF9A 2E9VA 4JI9A 3UNZA 5FGKA 3A61A 3KQ7A 4WIHA 3CQEA 3R01A 1ZYCA 4ALWA 2PHKA 2X2MA 4UZDA 5CU6A 4C4GA 3TNHA 4ERWA 3LW0A 2W17A 4UXLA 1Y8YA 2ETMA 4QP2A 2OJIA 2VTIA 4KKGA 2BROA 3MPAA 2C3KA 3TACA 4PP7A 4A4XA 2IW8A 4MWHA 2WTJA 2ZDUA 3U9CA 1M7QA 1WBWA 4W4YA 1YOLA 3UTOA 5EQYA 3R30A 3NSZA 2X0GA 3OS3A 3QTQA 5IISA 5M53A 3CQUA 3KY2A 4ALVA 3MPMA 1UKHA 4CFUA 3Q6UA 4MF1A 4RJ4A 5DVRA 4AN2A 2PMLX 4F99A 2CNVA 3RPRA 3TIZA 3SX9A 2OIDA 3UVPA 4W9XA 4EHZA 5K5NA 2XM9A 4AGDA 3AXWA 5HIBA 4DG2E 4FICA 2FSOX 3F3VA 4HNFA 1L8TA 4RLLA 5HE2A 2R3MA 1KOAA 3I0QA 4IB0A 4EORA 4O0UA 4NTTA 4OUCA 5JT2A 4BDKA 2QLQA 3MYGA 4UWCA 4PL3A 2I7QA 2A0CX 4OTDA 1TVOA 3QFVA 3PP0A 4E5WA 1CDKA 2X2LA 4PMTA 2H34A 4XOYA 3K3IA 4XV3A 4DEDA 3U6HA 4KD1A 3COKA 3KXGA 5J1VA 4ZSJA 4M69A 1M2PA 1YDSE 3DKCA 3QLFA 4W9WA 3EFWA 4C4EA 2GSFA 3ETAA 4O7VA 3A4OX 1RQQA 4YJSA 3P23A 4B0GA 4E73A 5H8EA 4XNEA 2VWXA 3KULA 3OTUA 3ZO1A 4EZ5A 2WMXA 4F7NA 1Y91A 4PMPA 5EDQA 3L9PA 1BUHA 3C51A 3PJ2A 4NCTC 4P5QA 4BYIA 4JOAA 5J5TA 4KIOA 2F7EE 2XIRA 2ZDTA 2UW0A 4J99A 3R8ZA 5FWKK 4GYGA 5KMMA 1M17A 3CGFA 3JYAA 3MGYA 5CEQA 4Z16A 4Z7GA 1H25A 2J50A 3Q60A 2DUVA 4RJ7A 3HLLA 4KRDA 5JGBA 4JX7A 4ZSAA 3KMUA 4RJ5A 4CFFA 5IQAA 3E7OA 4FVRA 4PV0A 2P0CA 3IKAA 3C4FA 4KIKB 4U9AA 2GHGA 3LFDA 2QOIA 4I1ZA 4IX3A 3N4UA 1TQMA 2PMIA 4FC0A 4AGUA 2QODA 3V5PA 3NAYA 3D7TB 4RC3A 3F5UA 3MY1A 2FYSA 2WB8A 4GU6A 5CANA 5FEDA 4NCTA 3V5LA 4O82A 3ZOSA 4AN3A 3ZLXA 4P4CA 3RK5A 2WNTA 4XYFA 3LIJA 3AMYA 3ITZA 5JKGA 3FC2A 3VRZA 2WEVA 3A8XA 5B2MA 1H07A 1PMVA 5AUXA 3CSVA 5AP3A 3KRWA 3NPCA 1G5SA 3HRFA 5T68A 4EK6A 2OO8X 2IZSA 2XK9A 4XBRA 3GT8A 1H0VA 1L3RE 2QC6A 4QTAA 1REJA 3KKVA 4OLIA 1OBDA 4UZHA 1H08A 4TXCA 3NIEA 4O96A 4A07A 4P90A 2CGXA 2QHMA 3S3IA 4BDIA 5AP1A 2FSMX 3PE1A 5M57A 3NUYA 2AUHA 1ZMWA 4HOKA 2OGVA 5L6WL 1T46A 3R9NA 4OBPA 2YM3A 5LMBA 5HESA 4EOMA 5A9UA 5EW9A 5EOBA 2VGPA 3F88A 1JPAA 1XH4A 5IMXA 3II5A 1OPLA 2FSTX 2UZOA 4AT4A 4YMJA 3GQIA 2WHBA 1QCFA 3GCVA 4I23A 3MH0A 2C5YA 1UU8A 2BRMA 2YERA 3I7BA 4M8TA 2ETKA 3C50A 4FNZA 3QTSA 4F9WA 2OWBA 2WMTA 3WARA 3KXMA 1OIYA 3BU3A 4MXYA 2IG7A 2CSNA 2J7TA 3IONA 2R3NA 5KMOA 5IA2A 2CDZA 4QP6A 4AP7A 3D83A 1W7HA 5BVEA 3KXXA 4X7QA 3WIKA 4Q9SA 4AA5A 3TCPA 1QMZA 4CYIA 3TUCA 4RIWB 2CCHA 2R3RA 4CZUA 5DBXA 2VX0A 4IX5A 3QX2A 4FX3A 2V55A 4EOQA 2OG8A 2YCSA 4II5A 4KIKA 5E4HA 5HLNA 3CKXA 3PSCA 4F6SA 4YJRA 4F9BA 5GINE 3RTPA 4TYGA 3F7WA 3D7TA 4JRVA 2QU6A 3VW6A 3FWQA 2YAKA 3RKBA 4O27B 2XZSA 3BYOA 1WBNA 4BYJA 1H26A 4FIGA 4IHPA 4JX3A 5BVFA 4FTLA 3R9RA 3TUDA 2JLDA 3WE8A 3HUBA 3MI9A 3T9TA 3O17A 2PUPA 2GNHA 5E1SA 3KXHA 2R3IA 1PXKA 5HVYA 4UEUA 4EC9A 2GHLA 4FTRA 1ZYSA 2WIPA 2OI4X 3DZQA 3PTGA 5IH5A 2YITA 3OG7A 3VBTA 1IASA 3W8LA 3NYNA 5AMNA 3SRVB 4GJ3A 1RW8A 3SAYA 3GFEA 4RX8A 1E1XA 2R3JA 1JBPE 3REPA 2I6LA 4FTKA 5M51A 1JKSA 2UV2A 2PZIA 3RMFA 2UW5A 4N4SA 4YJPA 2YCRA 4JL9A 4NKSA 4NYEA 1O6YA 5FM2A 4QMOA 2BCJA 5DR6A 4XG2A 1U5QA 5GNKA 4R7BA 4GKIA 2C6DA 2DQ7X 2JFMA 2WMVA 4P2KA 2G15A 2ITNA 3ATSA 1WVXA 2XF0A 4GYIA 4Y73A 2C5XA 1Q99A 3FSKA 4LM5A 3VW8A 4KA3A 4ORKA 1NXKA 5HEZA 4EH8A 4KABA 4ZS0A 5JN2A 4JLCA 3V01A 5JGAA 3CR0A 4RWJA 2A1AB 5EI2A 4ANBA 5FP6A 4IVDA 4XRJA 4UN0C 4GV1A 4J8NA 2ERKA 3G9LX 1URCA 2J0KA 3HGKA 3TN8A 4BBFA 5KNJA 3FKOA 3O50A 3HP5A 4TYIA 4XOZA 4RIWA 3V8TA 2RFSA 4D0WA 3BLRA 4E3CA 2A19B 4OTFA 4S30A 5LCKA 3RP9A 3TZ7A 5EYMA 3U6JA 2FSLX 2YIRA 5CSPA 4ZSGA 4O7WA 4MQ1A 3EQBA 2JDVA 3IG7A 4TRLA 4XG6A 5A3XA 4QMNA 4MQ2A 3QTIA 1Q62A 4J53A 3QZGA 4KKEA 4KWPA 4FSZA 4AGCA 1A9UA 2ITZA 2GHMA 4DAWA 1B39A 2NO3A 2XNBA 4AZWA 3QKLA 3LCDA 3EZRA 3ZHPC 5CU0A 4DG0E 3FBVA 1XBBA 5KKRC 5LVPA 3UNKA 4L00A 4IADA 3ZCLA 3DNDA 5AWMA 3QZFA 5KUPA 4MD8E 5ANIA 1V0BA 3HMIA 5GHVA 3AG9A 4EH7A 3EKKA 3TV7A 2XRUA 3SRVA 3EQFA 5JMSA 4AZEA 2QOFA 3OWKA 3CY2A 2WMRA 4FEUA 4NFNA 4IFCA 4U45A 3ORKA 3R9DA 5CF5A 3QL8A 2VO7A 4V05A 3PLAE 4QMVA 4YC8A 3O8UA 2BDFA 3DKFA 5IKWA 4BN1A 2PVKA 2X1NA 4FV6A 2XNEA 4XP0A 5FBOA 5KE0A 5HCZA 2BVAA 3M42A 4U79A 3KL8A 3QQKA 4A7CA 3VS3A 2CN8A 3D7ZA 2X8DA 5J7BA 3TDVA 3UOLA 4XUFA 2UW3A 4I4EA 4F63A 1UKIA 3FZOA 2O0UA 5IQFA 4QP7A 4QOXA 4L43A 3NUSA 4E1ZA 2HAKA 4LI5A 2VX1A 4HJOA 2OU7A 4DYMA 2J90A 4PMMA 1Q61A 2OH0E 3QF9A 4DT8A 2I1MA 4JBPA 4RG0A 4AX8A 2RG6A 4USDA 2W1ZA 2PZPA 3FYJX 4X21A 3HRBA 3POOA 5GJFA 5CNNA 5IA5A 3RVGA 4NJ3A 1SM2A 5CX9A 3SOCA 4E5BA 2HXQA 3LLAA 4ANOA 4G9RA 3RJCA 4IIRA 3GC9A 2R2PA 5CASA 1CKPA 4WUNA 5DLSA 1SVGA 2IO6A 3R28A 4O7YA 4OTQA 3OUKA 3V5QA 5HNBA 2PWLA 4ZOGA 2PVNA 3B8RA 2ITWA 1YRPA 4FKGA 2OJ9A 1MRVA 3MY5A 1JWHA 4IB1A 4Q5EA 2R9SA 4L3PA 2OXYA 4AUAA 4WG3A 4MNEB 3D2KA 2O5KA 5E7RA 3IK3A 4BR3A 2XIZA 3PLSA 3PSBA 4G3CA 4NTSA 3M11A 4PL4A 3WYYA 5CALA 4I5CA 2YIYA 4MD9E 4DGGA 3L8XA 4EQCA 5DEWA 1H4LA 2NP8A 5F94A 3H9RA 4YGAA 3TV4A 5DYJA 4XG3A 3F3WA 3PXKA 4UBAA 2X8EA 1UNHA 4XH6A 4C33A 5HO7A 1XO2B 4U42A 4D4YA 4FZAB 4ACHA 4E6QA 2HW6A 3FMEA 4XCUA 4FIFA 3N4TA 3R63A 3ZO3A 4FKQA 1KWPA 3SD0A 3E8DA 4KBKA 4YTIA 2BPMA 2ONLA 4YJQA 3T9IA 3TZ9A 5CT7A 3OHTA 3CTJA 1OM1A 3BV3A 3VULA 4HGEA 2GDOA 2WELA 3PJ3A 4DH5A 4L01A 3BGQA 4NKAA 3E64A 4MVFA 3U6IA 4IAAA 1PMEA 2CLQA 4L3JA 4BTFA 2YM8A 1VEBA 5M44A 3LCTA 3C13A 3DA6A 3I7CA 4DN5A 3E7VA 4JQ7A 2C6KA 2UZVA 4UYAA 3R7UA 2G01A 4MD7E 4W4WA 3ULIA 4R1VA 3HV6A 1YXSA 3FMDA 4O0TA 3QD3A 4C35A 1H8FA 3LFBA 3OWJA 2C6IA 1XH8A 4QMXA 4UV0A 4NM3A 4PF4A 5K9IA 1Z57A 3E3PA 4YC6A 2W5HA 4DCEA 3FLQA 4FT0A 2I0EA 4ZZMA 1P4OA 3HUCA 1ZYLA 4J7BA 4YSMA 5BVOA 4FSRA 4FEVA 2QO9A 4F9CA 4ZAUA 2OIBA 1NT2A 2XK3A 5AIKA 3TI1A 3N9XA 4IAYA 3OUNB 4KS7A 4YPSA 4D1ZA 3L8VA 5GJGA 2YCQA 4YC3A 3DCVA 3R0TA 4YO6A 3BWJA 5AAEA 1UWJA 3CKWA 4IB3A 4IZ7A 4MNEA 3OY3A 4QQCA 4OTGA 3JY9A 2BTSA 3IPHA 4BCFA 4J8MA 4ZZNA 4A4LA 3HAMA 3Q53A 4KINA 3COMA 4LG4A 4EH4A 4I21A 5E8ZA 4TW9A 5E8YA 5KMJA 5EHLA 2YDIA 2PMNX 3C5IA 2VTQA 4JRNA 1KOBA 2XCHA 3PZEA 2VTHA 3DK6A 3A99A 4W4VA 5AAFA 4F64A 4G6LA 4AZFA 1Y57A 5FG8A 1YHWA 2VTPA 3FJQE 3KMWA 4PTGA 4H3PA 5E91A 5TF9A 2YM7A 4DFLA 4Q9ZA 3EL7A 3EYHA 4MKCA 1FVTA 5M4FA 2XNMA 3C5UA 1FVVA 1YHSA 1OB3A 4AG8A 2YWVA 2Q0NA 4MK0A 4O38A 2XP2A 3RAWA 3COHA 2EB2A 2IZUA 3I0OA 4N70A 3NIZA 4TWCA 1ZY5A 1PW2A 2O65A 2YHVA 5AR3A 3FPMA 3BHYA 5CVFA 4OT6A 1J3HA 3FE3A 4QQTA 4FODA 5IDPA 3AD4A 4A9RA 3UOJA 5AP2A 4B6LA 2JIUA 1PMUA 4BI0A 2OICA 4ZSEA 2KTYA 3R7YA 2Y0AA 4BDFA 4I5MA 5EQPA 3QGYA 1H27A 3ZFMA 4BCPA 3LQ3A 1KE9A 3VUHA 3I79A 4QYYA 4D4SA 2G9XA 3MTLA 4BTMA 4AN9A 3FEGA 5H2UA 4CFNA 3VUGA 1OL2A 3W1FA 4HW7A 3DAJA 5ANGA 3AMBA 3F5GA 4XS2A 4D5KA 1FMKA 3DT1A 1V1KA 2IVVA 3OD6X 5AV1A 4D58A 3KB7A 5M4UA 3WZUA 5CVHA 2UZDA 4FL1A 3RK7A 3Q5ZA 3VHKA 3LMHA 4G6NA 3MESA 1JVPP 4N57A 3FAAA 5IEVA 4MEDA 5HGIA 4K77A 4U43A 4X3FB 1MQBA 2PVFA 3BLHA 3TG1A 4YZCA 4KBAA 3CTQA 3GP0A 4WRGA 4EC8A 3R7OA 1Q8YA 3H0YA 5HO8A 1APME 4GVAA 2W1GA 3QKKA 4X2GA 3ID6C 1YWNA 3DTCA 5HG8A 3O96A 2WEIA 3MVHA 4BKZA 3ZEPA 3KRJA 5TO8A 4D55A 2CKPA 1HCKA 3BQRA 4UMTA 3VIDA 3VHEA 5JZJA 2XJ2A 4YURA 4OAVB 5HBHA 2W1HA 3QGWA 3EN6A 3NYVA 2O64A 3VS1A 4O7TA 1ZLTA 4F7LA 4CT1A 3MY0A 4M0ZA 3FPQA 4QYHA 2WD1A 2W1DA 4U80A 3LJ2A 4ID7A 2NPQA 4PUZA 1UA2A 3R1YA 4FKSA 4EHEA 3FZ1A 3AQVA 4FA2A 3WF6A 3KRXA 2P2HA 5C4KA 3S1HA 3WZEA 5AUTA 1J7IA 5AR7A 1YQJA 3R02A 1PXPA 4IVBA 4O0XA 4FI1A 1OKWA 3OCBA 4ZJIA 4R77A 2QKRA 3GVUA 4JBVA 4JVGA 2QOQA 4CKRA 5CU2A 2QOOA 2JDOA 4UMQA 4FV8A 4X3FC 3ZSGA 4JBOA 2WXVA 2Q0BA 4DCAA 2BILB 4HZRA 3LFQA 3FY2A 5F20A 3W2SA 4A9YA 3CEKA 4XLVA 4DEEA 4IC7A 3PVGA 4JG7A 4MNFA 1SNUA 1OKZA 5KZ0A 4EH3A 5K0XA 4JG6A 2QOHA 3QTXA 4H58A 4RWLA 3NNVA 4RVKA 4ZJJA 1BX6A 4E26A 2BAJA 2YJRA 3HAVA 4RA4A 2J9MA 3G51A 5M4IA 3G2FA 1SVHA 3FI2A 2UZNA 3ULZA 3FXWA 4MXOA 5E8XA 3DXQA 2GNIA 3AMAA 4BVUA 4I5HA 3F69A 2BDJA 4XV1A 2VX3A 3VBYA 4D2VA 5ETAA 1XQZA 4O0YA 4X3FA 3U4WA 5HX8A 2HOGA 4IDVA 3UE4A 4FKPA 3TUBA 3QHRA 1I09A 3ODZX 5I9UA 3WF5A 5CNOA 3DLSA 3ODYX 4J1RA 3BYUA 3VBXA 5LVOA 3L9NA 3UVQA 4I41A 3V51A 1IA8A 4C62A 2UZLA 3IOKA 3MS9A 3FKNA 4LMUA 2RKUA 3ELJA 1U54B 1M2RA 3PA4A 5FXQA 5AP4A 5AUYA 4GK2A 5GZ8A 3CPBA 1WVYA 2F57A 2RFNA 2GQSA 2EXMA 2HWOA 2WMQA 2OJFE 3OY1A 4K6ZA 4M7IA 3EQGA 1WZYA 2R4BA 4NEUA 2QG7A 5ETCA 1FVRA 1GIHA 3LFFA 3QLGA 1STCE 4YP8A 2WAJA 3OEZA 3G6HA 4ZK5A 4ZY5A 2WPAA 3R9OA 4BCKA 4BIBA 4DTKA 1OZ1A 3MH1A 3P1AA 1QPCA 3DTWA 4RC4A 4BCOA 5GIOE 3DQXA 4FTOA 3G15A 1ZMVA 3C4EA 3KVXA 4H05A 2FUMA 3F5XA 3V5TA 4E4XA 3G9NA 4FSUA 2GS2A 5DNRA 2PVHA 3D5XA 1A48A 3Q9ZA 2VWIA 5KMLA 4FVQA 5FP5A 2J4ZA 1PF8A 3R7EA 2QD9A 5AX3A 2VTJA 3CXWA 3EFJA 4FYOA 1M2QA 4F0GA 3VF8A 4PDOA 5LMKA 4NJDA 3QC4A 4IWPA 2W4JA 5A46A 2XKDA 4H36A 5HOAA 3RCDA 2XK4A 3LZBA 4EWQA 5KX8A 4NIFB 1UNLA 2Q83A 5F95A 5JK3A 4U8ZA 3S4QA 4YU2A 2BZIB 3QQGA 3SQQA 1JAMA 1TQIA 4LGDA 5BMMA 2ITVA 2W1CA 4S34A 3F7ZA 2JAMA 3DK7A 1U46A 3HYHA 4P7EA 2JDTA 1GNGA 4G17A 4BRXA 5DT3A 1OPJA 3HDNA 4WKQA 1P5EA 3NNWA 4Y8DA 5AV3A 3NYOA 3W2QA 5CF6A 1S9JA 3Q5IA 4FKTA 4NM7A 1V0PA 4RA5A 1WVWA 4YZBA 4O0WA 4GMYA 3DLZA 4FZFB 4Q2AA 5M07A 4FGRA 1Y6BA 4EBWA 4FG9A 1QL6A 1I44A 3R21A 4NM0A 4FKJA 4PTEA 3FMMA 5GZ9A 4FOBA 5LXMA 4AQCA 1U54A 4U3ZA 1IA9A 2C0IA 3NGAA 2SRCA 1R39A 3I1AA 4AW0A 2W9ZB 4ZY6A 3EZVA 3RPSA 1NVQA 3MH2A 3HV7A 3OFMA 3NUXA 4YO4A 4UWYA 1UV5A 4IM0A 5E8TA 1WMKA 1ZRZA 2JKMA 4EOSA 4DH7A 5HLWA 3LFAA 4EKLA 4R3CA 3SXFA 5M09A 3LQ5A 2Z2WA 4PX6A 5EOLA 1PXOA 1IEPA 4K11A 1FINA 4F9YA 5I3RA 3PUPA 5A4TA 4FG7A 3BGZA 2HXLA 4FSYA 4PWNA 2BFXA 5AIRA 2UW9A 3HMNA 4L9IA 2B4SB 2C6MA 3D9VA 5DFPA 4I22A 5IPJA 3JVRA 4MX9A 4LQMA 3RAHA 2QQ7A 5ACKA 4BY9E 3A8WA 1LR4A 2PVJA 4ITIA 1GOLA 4BHZA 4OBQA 1LUFA 2W5BA 4FF8A 4NM5A 4U5JA 4BCMA 5CEKA 5AR5A 3SLSA 3VUTA 1MQ4A 5CTPA 4NWMA 1NW1A 3QQFA 2ZJWA 2RF9A 3ZXZA 4LRJA 4EH5A 4GRBA 4NH1A 5IA4A 4FTMA 4I94A 4YTHA 5HZNA 3JXWA 5IF1A 3MFRA 5DIAA 3G5DA 5A4LA 4RSSA 4O0RA 3K2LA 1OITA 3CP9A 3DDPA 4FK3A 4LOOA 4JXFA 3GUBA 2WU7A 4NIFA 4YR8A 3SVVA 5C27A 3UG2A 2C0OA 3HL7A 3I81A 3P08A 4U3YA 4EH2A 1KUTA 3ZSHA 4FKOA 3GOPA 2Y9QA 3EN5A 4RJ8A 4UXQA 4WNKA 4ZTRA 1OGUA 3C0GA 3A62A 3OXTA 5J79A 4PDYA 2WQOA 4FGBA 1W0XC 4L7SA 4EYJA 5BYZA 3E3BX 4UMPA 1P4FA 4ACCA 5C26A 1E9HA 2Y4IB 3QBNA 4XMOA 3EQRA 4IB5A 2XIYA 4ZP5A 4AW2A 1J91A 3TWJA 2UW6A 4TYHB 5EW3A 3R00A 3R22A 5IEXA 2CGUA 5B2LA 4RQVA 1ZWSA 3TL8A 5ANJA 5CEOA 4M67A 4QP4A 3FMNA 4NFMA 3HRCA 4FT3A 1WBPA 4TWNA 2QI8A 1JOWB 1WBVA 1ZXEA 1MRUA 3RNYA 3VVHA 2UZWE 5AA8A 2GCDA 3BU6A 3FQSA 3LOKA 3OXZA 4IM3A 4YBJA 5AM6A 4AZTA 5FUTA 3K3JA 4FNXA 2IW9A 3T3VA 4AZSA 5BX0A 1X8BA 3NMUF 1FQ1B 2ZV8A 2X39A 4HYHA 3HA8A 4BDHA 4D9TA 1H01A 2X7OA 1P14A 4P5ZA 5E92A 3Q32A 3W2RA 5E1EA 3HV3A 5CEMA 4FTAA 4WG5A 3C9WA 5CS6A 4RPVA 3KF4A 4L6QA 3BYVA 1NVRA 4KSPA 5KMIA 3LXPA 3BPRA 3OCGA 3V5WA 4D4VA 4YTFA 4USEA 2WOTA 2E9OA 2C1AA 2ITQA 3EN9A 4FTJA 3N4VA 1CTPE 3VQHA 4B4LA 4I0SA 1GJOA 2P3GX 2Y4IC 4E8AA 3E5AA 4C02A 2XNGA 4FT5A 5HVJA 2NRUA 2WU6A 3RM6A 3EIDA 3CE3A 3FHRA 3NX8A 4S32A 3TNWA 1YDRE 4ITHA 4X2JA 5HG5A 4EJ7A 4IDTA 4UX9A 3GNIB 4EONA 4LL0A 1SMHA 4WT6A 3EWHA 1Q41A 4R78A 4KSQA 4ENYA 4Z3VA 1Q8ZA 4DFYA 2WTKB 4ZEGA 2Z8CA 5DA3A 1RDQE 3E87A 5G1XA 5A4EA 3DFCB 5JH6A 2OIQA 3QUDA 3VAPA 5CY3A 2B7AA 3K5UA 1FPUA 3HP2A 3PSDA 4K2RA 4MYGA 5DEYA 2C69A 3P9JA 3UGCA 2QVSE 5J9LA 1PXJA 2IJMA 3ET7A 3ZU7A 3OWLA 1Y8GA 3GENA 3OT3A 1LEZA 4DG3E 3OT8A 3UNJA 4UALA 4O6EA 4TYHA 2V22A 2GU8A 5ANKA 3VUIA 4D2WA 5F9EA 3A7GA 3DV3A 4OBOA 2OK1A 5CEIA 4F7JA 5AV4A 3FZRA 3LAUA 5F1ZA 2BR1A 4JAIA 1U59A 2JDSA 2C6EA 3QRJA 4RFZA 3DAKA 2XBJA 5EHOA 2WQNA 2VU3A 2FA2A 2QONA 2C5VA 5BPYA 2JEDA 4HVIA 4H39A 5E8SA 5C01A 3EYGA 3PXQA 4IWQA 4DF3A 2W9FB 2OW3A 4PPAA 3I5ZA 1M7NA 4TKSA 4C36A 2YIQA 1Q4LA 2QLUA 2UUEA 4WOVA 5JFWA 3PIZA 4M12A 4ZTQA 4ZTMA 1WBTA 3BHUA 5LARA 2CKOA 4QP1A 5ACBC 3VJNA 2XM8A 2WTKC 2I40A 4FBXA 4QTCA 3ANQA 3LJ1A 5D11A 4E6DA 3CGOA 4F0FA 3SKCA 3FMKA 4R3RA 2QCSA 1O9UA 4U7ZA 3ZC5A 3GU4A 4EYMA 2X8IA 4AFJA 3DPKA 2E2BA 4JIKA 2XB7A 3UIUA 3WYXA 5KHWA 2WTVA 2GQGA 3FLNC 4I0RA 1CM8A 4D2SA 4EH6A 4FV0A 3FL4A 1J7LA 3ZONA 5KKRB 1REKA 2A2AA 4R3PA 4FSMA 2VWYA 5CYIA 3CC6A 4S31A 4BF2A 3PA5A 4WG4A 4GJ2A 2YACA 3A4PA 1KE5A 3B2WA 4HCUA 4O86A 3T8OA 1RE8A 3BIZA 4YHFA 2CKEA 3GGFA 4FSWA 3WF9A 3KA0A 4GSBA 5LJJA 4ZS4A 5CSVA 5LVLA 3O71A 5HTIA 4L53A 4ZZOA 1PXIA 4RWIA 5K0KA 4YJTA 3DK3A 3IS5A 4WA9A 3VS5A 1QPEA 4JDKA 2WMWA 2XYUA 3QYWA 5IQIA 3S2PA 4CVAA 2YFXA 3B2TA 4OW8A 3QQUA 3PP1A 4BKYA 2UZEA 3QWJA 3ZMMA 4ZLOA 3ATTA 4IW0A 1NA7A 2PPQA 4DE4A 4G5PA 3R6XA 3QXOA 4O7LA 3E8NA 3R8VA 4CCBA 2V62A 4C37A 3UC4A 3IDCA 3QZHA 4RC2A 4RIYB 1SVEA 3P7CA 3QX4A 2O3PA 3A7IA 3D2IA 3F5PA 3KFAA 4ZMFA 3Q9YA 1YWVA 2DS1A 3CD3A 4EOJA 3R8MA 3WF8A 3DNEA 5JEBA 5BVKA 3PIXA 2AC5A 2R3KA 3MA3A 3VRYA 3AD5A 3PPJA 2JD5A 4OGRA 4CG9A 2F7XE 5L8KA 3DKOA 2RGPA 5B7VA 4RX7A 4FZDB 4ONAA 4D2PA 3IDBA 2VD5A 4E20A 3VN9A 3RWQA 5EM6A 3MFTA 3MJ1A 4B7TA 3MFUA 3HNGA 3MBLA 3D5WA 2VTOA 3UIMA 3UMWA 1GIJA 4MAOA 5H3QA 4X0MA 4J96A 4BDEA 5HG7A 2X81A 4IBMA 4A9UA 3WBLA 3SW7A 3V3VA 2R3QA 4PPBA 2UW7A 4PNIA 4E4MA 4Z55A 4FSQA 2WMBA 4FVPA 3BX5A 4A4OA 2BRNA 2VNYA 3BWFA 2Y6MA 4GT5A 3UYTA 5KZIA 3Q96A 3MDYA 5IH6A 4TYEA 5CU3A 4ASZA 3KU2A 3CJGA 3TDWA 5DHJA 4JR7A 5FRIA 5HG9A 5K3YA 3EMGA 5EH0A 2JKQA 2R3OA 2W7XA 2R7IA 3NWWA 3UYSA 4EK3A 5M08A 2GFSA 1H24A 3DBQA 5CLPA 4FV3A 4I4FA 5M06A 4WRSA 5A6NA 4FEWA 4PDPA 3E92A 3EHAA 1M14A 5EDPA 4GUEA 4Y83A 3LXLA 3OCTA 3I6UA 3NUUA 5JFXA 1OIRA 4BGGA 3F2NA 4FKRA 4BTJA 5L8LA 5FXRA 2VTRA 1Q8TA 1YOMA 3IW6A 2OJGA 2QOCA 2IW6A 4FL2A 4WD5A 4AW5A 3BZ3A 5BYYA 1PKDA 5IA1A 4U81A 5HD7A 3TKHA 4QTDA 4GU9A 3WILA 4I5PA 2I0HA 2ZOQA 4B99A 5E8WA 3PIYA 3CCNA 5AX9A 1BI7A 1A06A 1WBSA 4UB7A 4YZMA 4ZLYA 3S0OA 3ZM9A 1KV1A 2VO0A 3QRUA 3LFCA 3VS0A 4RIYA 3TEIA 4O7SA 3C4XA 3MB7A 4XV9A 1AD5A 4H1MA 2GPHA 3NUNA 5CXZA 3RINA 1YXUA 1U4DA 2ZV9A 5IQEA 2ZYBA 3NUPA 5C1QB 2O2UA 2XCKA 4YJOA 3VJOA 4BCJA 2BHHA 2YZAA 4D28A 2Y6OA 5GIPE 3Q4ZA 1ZYDA 2CN5A 1BLXA 4RIOA 2YEXA 3KC3A 3PG3A 4C34A 4DFUA 5IQGA 3G0EA 4ITJA 4QYEA 4HCTA 4CLJA 1KSWA 2G2FA 3ZUVA 2XJ1A 4BDCA 4L67A 2C47A 4TY1A 3WOWA 1Q3WA 5DRBA 2CCIA 3L8PA 4O91A 4DBXA 3ZDIA 2QU5A 3HECA 4FTCA 3RCJA 3QTRA 5EG3A 1NVSA 5BVNA 3HEGA 3LE6A 5FTOA 5D41A 4QO9A 3GU7A 4W8DA 1QPDA 3BCEA 5H8GA 1YOJA 4CMOA 2RFEA 2Z60A 3ORTA 4DA5A 4E5AX 4FNYA 3L8SA 3KREA 4QMWA 1K9AA 5EDRA 3GU5A 4TT7A 2PUIA 3AOXA 4IXPA 4EQUA 2Z7RA 3TNIA 3KMMA 4LUDA 4AS0A 4QMQA 3NVKI 4ASDA 3HMOA 4HGTA 2F2UA 2PZYA 3FL5A 1BI8A 3IW4A 5FM3A 3GU8A 4R5SA 4DEBA 4G3DA 2I0VA 3PE2A 3KCKA 3LXNA 4A06A 4EUUA 3GC0A 4BC6A 2X6EA 2PVMA 3EFLA 4WBOA 1UU3A 3ZLSA 3BE2A 3FZSA 4EK4A 3M1SA 4J71A 2BALA 2W4KA 2RIOA 2IZRA 4IC8A 1OL1A 2EXCX 2W96B 5DR2A 3UO4A 5HU9A 3L9MA 4E4LA 4GFOA 4YPDA 3VBVA 5IUGA 2PZRA 3UMXA 3AC2A 2Z7SA 3M2WA 1PY5A 1Y6AA 5LQFA 1CSNA 5AM7A 5E90A 1BYGA 4GW8A 3UVRA 4EK5A 4EZ3A 2AYPA 3F2AA 5CAPA 3OW4A 4E7WA 2B52A 5L2SA 2XNNA 2XKEA 4V0GB 3EQIA 4BHNA 4ZTSA 3LKMA 3DU8A 5AAGA 2YDKA 3E88A 2B9FA 2VTLA 3UDBA 3PRFA 5ANDA 4PMSA 4BKJA 4M13A 5EM5A 1GZ8A 2RFDA 2XMYA 1F0QA 4QYFA 4AAAA 2ZM4A 4EOOA 2HWPA 2GTMA 5JRQA 4FZ6A 5HQ0A 5TT7A 3FXZA 4JAJA 3R7IA 3P86A 3KN5A 4NU1A 5IA3A 3BHHA 3JS2A 5ETFA 2HZ0A 2A4LA 4BL1A 2HW7A 2YISA 1SZMA 1QPJA 2GNLA 2XKCA 4RVTA 4UYNA 1OPKA 3VS7A 3VS6A 5CAQA 5AFVA 2BIYA 3OZ6A 2VN9A 4L8MA 4D1SA 4N6ZA 2REIA 4ANQA 3FLSA 3HVCA 3C4WA 1DS5A 3R8LA 1BMKA 5M56A 4DC2A 3SDJA 4DLIA 2PY3A 4LFIA 3WE4A 4O22A 3QWKA 4FKLA 1MRYA 3FI3A 3OEFX 2BHEA 1B38A 4ZSLA 4DEHA 4Z7HA 5BVDA 2VTAA 5CEPA 3SG9A 2YLEA 2YWPA 4YJNA 3RNIA 3KRRA 3DOGA 5EYKA 3E93A 4M84A 4YLJA 3KXNA 4ZTLA 3F3TA 4RMZA 3NRMA 1DI9A 5DMZA 5DGZA 3P5KA 3EQDA 3ORZA 3EQPA 5L4QA 4HYIA 3N51A 2HY0A 3BI6A 1XBAA 4F6WA 5CSWA 5CVGA 2Z02A 2ZMCA 2R3HA 4OAUC 2PVRA 3MTFA 4YBKA 2CNUA 4ZY4A 3EN4A 1CKJA 4IJPA 2YM6A 3DKGA 4FNWA 3THBA 4HVDA 2F2CB 4JDHA 5CWZA 2V7AA 2YIXA 4QMLA 2W0JA 1GZOA 1OUKA 3QUPA 4W4XA 3W55A 2OH4A 4UY9A 1JNKA 1P2AA 3QXPA 3H9OA 4QP9A 5FQDC 3UP7A 2ETRA 3QQHA 4C58A 4JJRA 4TWPA 2W4OA 1E1VA 1AGWA 5DOSA 2BAKA 3V8WA 2JFLA 3NCGA 2P33A 3JUHA 1R1WA 5AUZA 1R3CA 3Q3BA 4V0GA 4CFMA 1T45A 3BYMA 3JR1A 2BDWA 2E9NA 4CV9A 4XP3A 2JITA 2OZOA 3BHVA 2VAGA 4FR4A 4ACMA 1KE6A 4D9UA 4F9AA 2GTNA 5HX6A 3LM5A 5C4LA 4RWKA 1V0OA 3O8TA 3BV2A 1PYXA 3AGLA 1FBNA 2GS6A 4IVAA 5IDNA 3OW3A 3CD8A 4Y5HA 5BYLA 4QTEA 3PY0A 4BGHA 4FTTA 2YA9A 3BU5A 4WUAA 4EH9A 4K33A 3PJ1A 3Q9XA 2QNJA 2B54A 2WZJA 2W1IA 3ORMA 4IEBA 4EEVA 1OBGA 4O81A 1OKVA 3GCUA 3TTIA 3KN6A 1H1QA 4FV5A 2IPXA 2WQMA 2F4JA 3OP5A 3U8WA 4QNAA 3HZTA 3Q2JA 4NZWB 4FV2A 4R7HA 4RZVA 5L2QA 3OVVA 1J7UA 4CSVA 3CBLA 4ENXA 5CSHA 2C6TA 1FOTA 4RBLA 3QRTA 5HE1A 4DT9A 4B8MA 3LXKA 4I6FA 2R64A 3K54A 2ITYA 4GT4A 2QG5A 2B53A 4IE9A 2ITPA 3RM7A 4DINA 4JQEA 2JIVA 5EFQA 4OR5A 3MB6A 3R1NA 5CXHA 4CQEA 3SOAA 2BRGA 2JC6A 4FTQA 4MWIA 4BI2A 2R3FA 2XK8A 2E9PA 2W05A 3CIKA 2C3LA 1W82A 4MBIA 3I60A 1YI4A 1K2PA 5L2IA 3HKOA 3AC8A 5FLFA 3Q4TA 4I6BA 3FI8A 3LM0A 1FGKA 3E62A 3KEXA 2VWZA 3AGMA 3QAME 4JBQA 4MTAA 3ZZEA 4GK3A 3TJCA 4AT5A 4EBVA 1ZOHA 1YI3A 4QMUA 5HBEA 3QCYA 4HVSA 2E9UA 3OXIA 3MWUA 4G3GA 2BMCA 2W99B 3QD2B 4QQ5A 4EOIA 3FYKX 4FKUA 3G90X 3MVMA 4G16A 5AR8A 5JRSA 1VZOA 2C68A 4D2RA 4EI4A 2XRWA 1JSTA 3EKNA 4FG8A 4U44A 3DXNA 2Y7JA 4NK9A 3UOHA 3D0EA 2AC3A 3ZEWA 4AA4A 4CKJA 3BRBA 2CGVA 5DT0A 2DYLA 2R3PA 3EFKA 3V8SA 3VBQA 3U87A 2YABA 3DY7A 3ZRLA 3FQEA 4FZ7A 3U51A 3E63A 4FIEA 1S9IA 3QQJA 4WNOA 5AUWA 2VGOA 3PRIA 3QZIA 4ALUA 3U54A 1OMWA 1KE7A 3PFQA 4C3PA 2HCKA 2VWVA 3RHKA 2JIIA 4QRCA 1HCLA 4JDIA 2X7GA 4RIXB 2CJMA 4RRVA 3ZYAA 3JPVA 4BBMA 3ORLA 3KRLA 3NDMA 5FD2A 3W2CA 3QRKA 2P4IA 4IAZA 5ETIA 2ITOA 3RBWA 4TYJA 2B9JA 4J98A 3SXSA 5I9ZA 4TL0A 4UMRA 2R3GA 2ESMA 2B1PA 3BQCA 4HGSA 4GG5A 4NUSA 3GB2A 2BZHB 1JKTA 5D1JA 3C1XA 3OF0A 4N6YA 4MXCA 4O7NA 4QPAA 3C0IA 2BRBA 4RJ3A 3RAIA 2OZAB 5KCVA 2IVSA 3IQ7A 3QHWA 5C9CA 2WQEA 2YN8A 2ZMDA 3D5UA 2VO3A 2ITXA 2UVZA 3AC1A 3NLBA 4R8QA 4X2KA 2C3JA 2ZV7A 4I3ZA 4D1XA 4F0IA 5HKMA 1CKIA 1YDTE 3A7FA 3DJ5A 3OMVA 3QKMA 2X7FA 4LMNA 5AJQA 3MW1A 2QHNA 4C0TA 5AP5A 1R0EA 1KV2A 4WHZA 3E8CA 3R8UA 4HGLA 3HMPA 4FEQA 5C03A 4BDBA 5CI6A 2XH5A 4K18A 3F82A 4BFMA 4FE2A 5C8NA 4EWHA 4TWOA 3ZBXA 3NUAA 1K3AA 4C2VA 1WCCA 2X4ZA 5FTGA 4QYGA 1PMNA 4XG8A 5E9EA 2CMWA 3C0HA 2XBAA 3C4CA 3D4QA 3Q2MA 4MXAA 3SA0A 2VRXA 3GU6A 3TM0A 2WTIA 3LVPA 4IMYA 5HI2A 1Q5KA 4PRJA 4ACGA 5BUJA 1Z5MA 3UO5A 3WF7A 1OL6A 4KS8A 4RJ6A 3R71A 1J1CA 3ZS5A 4H1JA 4YHJA 3VQUA 1XJDA 3NNXA 3L1SA 4TTHB 3BEAA 4IX4A 4LRKA 4L68A 1ZAOA 5AUVA 4IH8A 1VYZA 4YJVA 2QURA 4DH1A 4TNDA 3RHXA 2ERZE 3ACKA 4RX9A 3UZPA 4RIXA 3P78A 4RVLA 3CJFA 1ZYJA 4GIIA 3P4KA 4FOCA 2EVAA 4CFWA 2IZTA 1GIIA 4OTIA 5A6OA 3PVWA 3VC4A 3RPYA 4YJUA 3LHJA 3FZTA 3UQFA 4GK4A 2BUJA 1FMOE 3H0ZA 3LLTA 4CZYB 3R7VA 2PMOX 1MP8A 4IAIA 4A9SA 3ZFYA 4WBBB 4DTAA 3R9HA 2G1TA 3FLWA 4YLKA 5IQDA 4BTKA 3IW5A 3R04A 4BWXA 5HIEA 3ORXA 2WTDA 4DFNA 3KXZA 5T3QA 4AACA 2UW4A 2OZAA 4CFXA 5F4NA 3O8PA 3ZLYA 3NCZA 4X6RA 3HDMA 3UC3A 4AGWA 4MXXA 2C0TA 2UZTA 4CEGA 3IO7A 2GQRA 5TR6A 2H6DA 3AT4A 3SG8A 4AE6A 1Q97A 2OF2A 3ZO2A 3G6GA 4C38A 5AV0A 3LCOA 5LVNA 4XHKB 4IFGA 5FXSA 5BUIA 3KK9A 4DGNA 4FEXA 1ZY4A 4X6QC 4GFMA 2WMUA 2FVDA 4YNEA 1NY3A 1VYWA 3BE9A 3LFNA 4Y5QA 5HNGA 4ANSA 4MH7A 3GCPA 3F3ZA 4I6QA 1W98A 4RT7A 5CQUA 2XJ0A 4HYSA 3EN7A 4M66A 4O2ZA 2HK5A 2BRHA 5HE3A 1ZARA 3I4BA 4FKWA 2YJSA 3WZDA 3ZC6A 2Z7QA 2BIKB 5LMAA 3V6SA 2PYWA 4UWBA 3WI6A 4FIIA 2IN6A 4L44A 3SC1A 4JG8A 5B2KA 3UG1A 1R78A 2CNQA 4FTNA 4ZTNA 4CXAA 3PJCA 4RQKA 3DDQA 5CQWA 3DS6A 1G8AA 4Q5HA 4EUTA 1WAKA 1YI6A 2J5FA 1ERKA 2HIWA 4U0IA 3EJ1A 1YVJA 3ZO4A 4OTPA 5DG5A 4C57A 1OIUA 3BGPA 4QPSA 3F6XA 2H9VA 3ERKA 1G3NA 5D12A 4RX5A 4GG7A 2JGZA 4U97A 4KKHA 3F66A 3H4JA 1PJKA 4FMQA 1XH7A 4M3QA 4NW6A 1IAJA 4I24A 4C8BA 3WIGA 2J51A 2X2KA 3FLZA 3HMMA 4ZXTA 5IA0A 2UVYA 3OCSA 5HICA 2VWWA 2RSVA 3OTVA 4GFGA 4RFYA 3ENMA 3VO3A
chains in the Genus database with same CATH superfamily
2X4FA 5EKOA 4EHVA 3R83A 4AOTA 1WFCA 4IQ6A 1MUOA 3R2BA 1J1BA 3CS9A 3FLYA 4C3RA 5HD4A 4HCVA 5HTCA 5I4NA 4MCVA 4BZDA 5IZFA 3F9NA 5G6VA 3R8PA 4O84A 1ND4A 4RFMA 3IOPA 2VTSA 2OBJA 4D2TA 3R73A 4LYNA 3Q6WA 4F09A 5KMKA 2XEYA 3JY0A 5E8UA 3TIYA 4CTCA 4O7ZA 2UZBA 3W18A 4AW1A 4PPCA 5HVKA 4S2ZA 1UWHA 5JGDA 5J5SA 2G2HA 5BUEA 4O1PA 5BQ0A 3GQLA 2WKMA 4O21A 5EHYA 4PTCA 3KF7A 4U6RA 3PPKA 4C61A 4IWDA 3DAEA 2C5OA 4MXZA 5LWMA 4EL9A 3LCKA 4B9DA 2F9GA 2XA4A 4Z9LA 3PY3A 1U5RA 2W1FA 3DBEA 4C3FA 3QCXA 2VWBA 3DBCA 4O7RA 2CGWA 4RVMA 5EM7A 4ZTHA 3EH9A 3PVUA 5IUIA 4DEIA 2VTNA 3CY3A 3MVJA 5DI1A 3LMGA 3FMJA 3GCQA 2H8HA 5CZIA 5I3OA 3ZUTA 4HPTE 1YW2A 5FBNC 4G3FA 5J9ZA 4DH3A 2YM4A 2R0UA 2JKOA 3BEGA 4BCIA 3ORIA 4O0VA 4CRLA 3NW6A 3A7JA 1UNGA 3B8QA 2YDJA 3UIBA 5IEYA 4G2FA 4WSQA 4BWPA 5K5XA 3ORNA 1F3MC 2WMSA 2KULA 2PE1A 1ATPE 2DWBA 1JSVA 5HHWA 4APCA 5HE0A 3V04A 4BDDA 3BBTB 4C59A 1YHVA 3Q9WA 4BWKA 3NR9A 3CQWA 5AP6A 2VUWA 2YIWA 4K9YA 3VUDA 3F2RA 4XV2A 1M52A 3QTZA 3T3UA 3OC1A 5HIDA 4C4FA 1OI9A 3LFEA 5FEEA 2YZLA 3V6RA 2HZ4A 4QD6A 3AC3A 5I5ZA 4J52A 5A14A 5DRDA 2X0PA 4LRMA 3PXZA 4QMYA 4WNPA 5C8MA 4GUBA 2GFCA 3NYXA 4DEGA 3ZDUA 2GNJA 2J6MA 5CI7A 3U4UA 4AFEA 1O6LA 1LP4A 4YUQA 3IECA 5KMNA 3DJ6A 4HVHA 4UMUA 5L3AA 4RGJA 3TJDA 1OKYA 3QC9A 2OF4A 4GIHA 4FUYA 5AA9A 3A7HA 3W32A 4FV7A 5EI8A 3D14A 3TTJA 3D94A 3MIAA 1YXTA 2GNFA 3L9LA 5E8VA 3ZXTA 4AWIA 3BYSA 4L45A 5BVWA 1WBOA 4FSTA 4N0SA 5LOHA 5LVMA 3R7GA 1YWRA 5AR4A 1IRKA 2O8YA 3ZM4A 4M97A 3LJ0A 5DPVA 4OT5A 5HLPA 4L52A 3HA6A 3KVWA 2OSCA 1EH4A 1JKLA 3W2PA 2BAQA 4EHGA 2W5AA 1AQ1A 3LPBA 5JZNA 3OBGA 5AR2A 5HU3A 5JQ5A 1H1RA 3UPZA 3ANRA 3Q4UA 4XX9A 3BKBA 5DH3A 4E93A 4ANMA 5AUUA 4CMUA 2GMXA 4O1OA 3P0MA 3PWDA 2RG5A 2HZIA 4CFVA 4AU8A 1TQPA 3TNPC 4IVCA 4CV8A 2PSQA 2QOKA 3POZA 3OBJA 4QNYA 2UVXA 2W1EA 2ZM3A 5AEPA 3GEQA 5I9VA 2ITUA 3RPOA 5L6OA 2R7BA 5EYCA 3ZLWA 3ALOA 5GJDA 3W0OA 2J0MB 4GT3A 2C30A 3GC7A 1G8KA 3VS4A 4ACDA 4R6VA 5IQCA 2IVUA 1H28A 4HPUE 3ALNA 3TKUA 3VNTA 4ASEA 2PULA 2QR7A 3Q04A 2WQBA 4O6LA 2VZ6A 3S95A 5ITAA 4KB8A 3PXFA 3ZTXA 3DFAA 3UOKA 4ZMEA 3IW8A 2W06A 3DGKA 3RAKA 1H1WA 3QTUA 1XWSA 1VJYA 1PKGA 3GC8A 1UU9A 4ARKA 2VTMA 1XH5A 3GFWA 2PE0A 3PPZA 3IGOA 4HNIA 4IANA 4TN6A 4IACA 4AOJA 4MUQA 2R5TA 5CF8A 1Z9XA 2C5NA 4R5YA 2CPKE 5D9HA 1YKRA 2V7OA 3FQHA 2OFVA 3NNUA 2HYYA 4QMPA 4G9CA 4XBUA 3FXXA 1RJBA 1F5QA 5J87A 2HELA 1XH6A 2A27A 4TPTA 2ZB1A 4KIPA 2VTTA 4O83A 4QP8A 3MVLA 5I0BA 1DM2A 2ZM1A 3KK8A 3SV0A 3TKIA 4MBJA 3FSFA 3UQCA 2XIKA 2EWAA 5ANOA 3ROYA 4E6CA 1BL6A 1GY3A 4YZNA 5BMSA 4Y46A 4FTIA 4EOLA 3MV5A 1TZDA 1DAWA 4U40A 1LEWA 4ZIMA 4AXCA 1JKKA 2WTCA 3FV8A 5D7AA 3P7AA 2OXXA 5CF4A 3UIXA 4DITA 3QCSA 4EJNA 1PYEA 1UVRA 2BZKB 3FC1X 3TXOA 4X2NA 4AXDA 3FZPA 4FV9A 3W10A 4GL9A 3ROCA 2CKQA 4Y95A 3ENHA 4L42A 4DFZE 3EQCA 5IH4A 4XG7A 4AE9A 4KAOA 3NZ0A 2WIHA 3LMIA 3PFYA 4CT2A 4KRCA 3PA3A 3O7LB 2OKRA 3VBWA 4ZLZA 1PHKA 4C4IA 2ONLC 2PK9A 4O2PA 3NAXA 5TOZA 4DLJA 3R1QA 1ZMUA 4L7FA 4Y85A 5L6PA 5EM8A 4K1BA 1VR2A 3IGGA 4H3QA 3I6WA 5EYDA 2PE2A 5I9YA 2F7ZE 4BCHA 4JQ8A 3UDTA 3RZFA 5JFVA 4O4CA 4R1YA 4AZVA 4XG9A 3DZOA 3F61A 4EKKA 5D10A 2CHLA 2X9FA 2J2IB 2JBOA 3DBDA 5DWRA 4LOPA 5HCYA 2RL5A 2PVYA 3QQLA 3OWPA 2J5EA 4O0SA 3GXLA 3KCFA 3BBWA 5M4CA 1H00A 2JDRA 3H10A 2WMAA 4WO5A 3UQGA 4ASXA 4E4NA 2G2IA 2XEZA 2IVTA 5H9BA 5CENA 2BZJA 4PL5A 4LL5A 5ANEA 2PVLA 4F70A 2XYNA 2ACXA 2ZAZA 1XHAA 3TNQB 4CGAA 4L46A 4LV5A 4BDJA 3FDNA 5IMEA 4FSNA 3CTHA 5LCJA 4FL3A 2WTWA 4YTCA 2C6OA 2XS0A 3QA0A 3O2MA 2PU8A 3H30A 4YSJA 3GI3A 5J95A 4BBEA 4JR3A 2C6LA 4V01A 5IU2A 2B0QA 4KBCA 2V5QA 2FO0A 3W16A 4KIQA 2GNGA 2UZUE 4I0TA 4ERKA 4IWOA 2HENA 4EOPA 5M55A 1OECA 3ORPA 1DI8A 2B9HA 5EQEA 5CSXA 5KHXA 1XH9A 3QD4A 1YXXA 4JS8A 4HZSA 3P79A 1PRYA 2H96A 4PY1A 5FDPA 4NT4A 3MFSA 5H8BA 3EB0A 4LV8A 4AT3A 2BTRA 3HV4A 4CRSA 4BI1A 3JVSA 2EUFB 3UPXA 3CLYA 4FIHA 4QPMA 2X6DA 5D7VA 4DEAA 3EL8A 5HO6A 4G1WA 3PVBA 3HX4A 5CT0A 1FGIA 2P2IA 4MHAA 3GOKA 2FH9A 4RZWA 1GZKA 4PNKA 4BJJB 4GEOA 4AOIA 5EW8A 3KGAA 4FT7A 4MBLA 3ZH8A 4ANLA 3H3CA 4F1TA 5AADA 2ITTA 2XUUA 2OLCA 1XBCA 4DGLC 4FV1A 1ST4A 1UU7A 5JFSA 1PXLA 1R0PA 4Y72A 4CTBA 4C4JA 4IZAA 4FKIA 4F1OA 4FRFA 5HTBA 5J7HA 2J0JA 3MJ2A 3WZKA 2YAAA 4XJ0A 3UJGA 2FB8A 1HOWA 3MN3A 3NEWA 5I9XA 5ICPA 1H0WA 1W84A 3BHTA 2C1BA 1PXNA 2Z7LA 3FY0A 4LUEA 4PDSA 5DE2A 3ZZWA 2XK6A 4C4HA 4F4PA 3HV5A 3O0GA 5CU4A 3ZSIA 3AT2A 4M14A 2EU9A 2ZV2A 3W8QA 5AP0A 1OVEA 4ANNA 4CMTA 2PUUA 3G33A 3TT0A 2XAMA 3NVMB 3RI1A 4F65A 2OFUA 2OJJA 2YLFA 3DJ7A 2V0DA 5J8IA 5EK7A 2QO7A 4LGGA 3O23A 2XNPA 2ZVAA 4I92A 4CQGA 4E6AA 5IQBA 1OIQA 5EI6A 4PP9A 4G31A 5FDXA 1OL5A 5FTQA 4D4RA 3NW5A 4X2FA 3G0FA 4DHFA 3H9FA 4CNHA 2EB3A 4FKVA 4GH2A 4EK8A 2JBPA 2BKKA 5AP7A 4YNOA 3A60A 2R3LA 4ZJVA 4DBNA 4QMZA 1ZOEA 3PYYA 3SHEA 4DTBA 3W2OA 3ZUUA 4DGMA 4G6OA 4IAFA 4C2WA 4FK6A 4FYNA 3UODA 2QOLA 4R7IA 1YXVA 4PQNA 1OUYA 3IDPA 2B9IA 2WOUA 3O51A 1G8SA 2XIXA 3ZRMA 4XEYA 2F49A 2J0LA 4BB4A 4NW5A 2QO2A 4G3EA 5AV2A 3W33A 3UZTA 4DH8A 2OXDA 4LGHA 3VUMA 4DFXE 5JSMA 4TZRA 3AT3A 3COIA 1PXMA 3FI4A 5KBQA 2VV9A 4U41A 4YZDA 3D15A 4D5HA 4GKHA 3WZJA 2IWIA 1IG1A 4CCUA 2C4GA 3RALA 3LQ8A 3QUEA 4BIEA 4EZ7A 1TKIA 5C8KA 4MF0A 3ZBFA 5K4JA 3EOCA 4XRLA 4CKIA 1XR1A 2XNOA 2HZNA 2YM5A 3MIYA 3RZBA 4QEBA 4I20A 4GS6A 4IX6A 4B8LA 5J9YA 4EOKA 3GCSA 4O4FA 5TKDA 2C3IB 3R2YA 1Q3DA 3UP2A 5IUHA 4CD0A 3I5NA 2J0IA 4BZOA 3QA8A 3D5VA 4KNBA 3VS2A 4F08A 5B0XA 4CYJA 1JSUA 3OOGA 3Q4CA 3OOMA 4M15A 4OTHA 1BKXA 4BZNA 1DAYA 4FT9A 4CZTA 1B6CB 3FKLA 5CAVA 3P7BA 4BICA 4V04A 3CPCA 2XAOA 2FGIA 3PXRA 2ZB0A 5TE0A 4F6UA 2PTKA 2UW8A 1H1PA 1O6KA 3RPVA 5HNIX 4BCGA 2VNWA 2O63A 4CG8A 2BKZA 3PXYA 4LOQA 3V5JA 5CAOA 5EKNA 3MPTA 4L3LA 2NNWB 4FUXA 2R0IA 4IAKA 5DR9A 3SXRA 4C7TA 3U55A 3PJ8A 3UO6A 4FIJA 3UZRA 2B55A 5L2WA 2QOBA 4X3JA 2LGCA 2P55A 4H3BA 4JIAA 5DN3A 3C7QA 3AKKA 1BL7A 4NL0A 4DHZA 2PUNA 3FMLA 5FEQA 1GAGA 5A4CA 1SNXA 2I0YA 3BLQA 2WGJA 3MSSA 4AA0A 3QTWA 4XG4A 3LCSA 3VUKA 3DB8A 4EQMA 1W83A 3RGFA 4A9TA 3DXPA 3R1SA 5KO1A 3MA6A 3F3UA 1W8CA 3AC4A 4DFBA 2PL0A 4YZ9A 4QMMA 3S00A 5L2TA 2XK7A 3EQHA 4QT1A 3RWPA 1IR3A 4NSTA 1Q24A 5L8JA 4FTUA 3UBDA 3FUPA 3QYZA 2NRYA 5BNJA 3C4ZA 4GCJA 3QD0A 4XP2A 4F7SA 5IG1A 4K0YA 4WNMA 5DT4A 5I9WA 3GBZA 3PG1A 1H1SA 4QTBA 1ZOGA 3QCQA 2GS7A 1SYKA 4I93A 2YCFA 3Q52A 4JNWA 5J1WA 3K5VA 4IZYA 5HORA 2QKWB 4S33A 4AF3A 1LPUA 5IQHA 3ZRKA 3QU0A 4D0XA 3TZ8A 4DGOA 4BIDA 4HYUA 3RK9A 2WFYA 3PWYA 2PZ5A 2JAVA 3A2CA 4W8EA 3TZMA 3U9NA 5JQ8A 5LMKC 3MH3A 4RLKA 5LWNA 4KUJA 2QR8A 2X9EA 1ZZ2A 4BDGA 4OTRA 1JQHA 2HY81 2Y4PA 5A54A 4IJ9A 1GZNA 4QMSA 4BCNA 5HBJA 4IZ5A 4GVJA 4OTWA 2VWUA 3NS9A 1ZZLA 5T6KA 3IW7A 4G34A 3OROA 3TV6A 3DB6A 4APPA 4YLLA 3ACJA 2XVDA 4IM2A 5A4QA 3NW7A 1URWA 4JT3A 2WO6A 4M0YA 4CLIA 3VWAA 3QRIA 4M69B 4K8AA 4AXAA 4G5JA 3DQWA 3PY1A 4JDJA 4FV4A 4TNBA 4YHTA 2A98A 2Y8OA 3BELA 4M68A 1Q8UA 3SGCA 4WSYA 3DBFA 3KULB 4QQJA 3PZHA 2BFYA 3PDTA 4HVGA 3AD6A 1KE8A 4BCQA 5GZAA 4QMTA 4BDAA 1XKKA 5CAUA 5CZHA 4BGQA 3QALE 2XKFA 1Q8WA 3SW4A 5KBRA 3FHIA 5HCXA 2JKKA 1IAHA 3AC5A 2VO6A 4USFA 1OL7A 1CMKE 4J97A 4QP3A 4J95A 5K4IA 2EXEA 3FMHA 2CLXA 1JLUE 4XLIA 3O7LD 2LAVA 3ZFXA 4F1MA 3E8EA 3LFSA 4I6HA 3VF9A 2E9VA 4JI9A 3UNZA 5FGKA 3A61A 3KQ7A 4WIHA 3CQEA 3R01A 1ZYCA 4ALWA 2PHKA 2X2MA 4UZDA 5CU6A 4C4GA 3TNHA 4ERWA 3LW0A 2W17A 4UXLA 1Y8YA 2ETMA 4QP2A 2OJIA 2VTIA 4KKGA 2BROA 3MPAA 2C3KA 3TACA 4PP7A 4A4XA 1W2DA 2IW8A 4MWHA 2WTJA 2ZDUA 3U9CA 1M7QA 1WBWA 4W4YA 1YOLA 3UTOA 5EQYA 3R30A 3NSZA 2X0GA 3OS3A 3QTQA 5IISA 5M53A 3CQUA 3KY2A 4ALVA 3MPMA 1UKHA 4CFUA 3Q6UA 4MF1A 4RJ4A 5DVRA 4AN2A 2PMLX 4F99A 2CNVA 3RPRA 3TIZA 3SX9A 2OIDA 3UVPA 4W9XA 4EHZA 5K5NA 2XM9A 4AGDA 3AXWA 5HIBA 4DG2E 4FICA 2FSOX 3F3VA 4HNFA 1L8TA 4RLLA 5HE2A 2R3MA 1KOAA 3I0QA 4IB0A 4EORA 4O0UA 4NTTA 4OUCA 5JT2A 4BDKA 2QLQA 3MYGA 4UWCA 4PL3A 2I7QA 2A0CX 4OTDA 1TVOA 3QFVA 3PP0A 4E5WA 1CDKA 2X2LA 4PMTA 2H34A 4XOYA 3K3IA 4XV3A 4DEDA 3U6HA 4KD1A 3COKA 3KXGA 5J1VA 4ZSJA 4M69A 1M2PA 1YDSE 3DKCA 3QLFA 4W9WA 4F78A 3EFWA 4C4EA 2GSFA 3ETAA 4O7VA 3A4OX 1RQQA 4YJSA 3P23A 4B0GA 4E73A 5H8EA 4XNEA 2VWXA 3KULA 3OTUA 3ZO1A 4EZ5A 2WMXA 4F7NA 1Y91A 4PMPA 5EDQA 3L9PA 1BUHA 3C51A 3PJ2A 4NCTC 4P5QA 4BYIA 4JOAA 5J5TA 4KIOA 2F7EE 2XIRA 2X0OA 2UW0A 2ZDTA 4J99A 3R8ZA 3P5JC 5FWKK 4GYGA 5KMMA 1M17A 3CGFA 3JYAA 3MGYA 5CEQA 4Z16A 3VONA 4Z7GA 1H25A 2J50A 3Q60A 2DUVA 4RJ7A 3HLLA 4KRDA 5JGBA 3TYKA 4JX7A 4ZSAA 3KMUA 4RJ5A 3NFFB 4CFFA 5IQAA 3E7OA 4FVRA 4PV0A 2P0CA 3IKAA 3C4FA 4KIKB 4U9AA 2GHGA 3LFDA 2QOIA 4I1ZA 4IX3A 3N4UA 1TQMA 2PMIA 4FC0A 4AGUA 2QODA 3V5PA 3NAYA 3D7TB 4RC3A 3F5UA 3MY1A 2FYSA 2WB8A 4GU6A 5CANA 5FEDA 4NCTA 3V5LA 4O82A 3ZOSA 4AN3A 3ZLXA 4P4CA 3RK5A 2WNTA 4XYFA 3LIJA 3AMYA 3ITZA 5JKGA 3FC2A 3VRZA 2WEVA 3A8XA 5B2MA 1H07A 1PMVA 5AUXA 3CSVA 5AP3A 3KRWA 3NPCA 1G5SA 3HRFA 5T68A 4EK6A 2OO8X 2IZSA 2XK9A 4XBRA 3GT8A 1H0VA 1L3RE 2QC6A 4QTAA 1REJA 3KKVA 4OLIA 1OBDA 4UZHA 1H08A 4TXCA 3NIEA 4O96A 4A07A 4P90A 2CGXA 2QHMA 3S3IA 4BDIA 5AP1A 2FSMX 3PE1A 5M57A 3NUYA 2AUHA 1ZMWA 4HOKA 2OGVA 5L6WL 1T46A 3R9NA 4OBPA 2YM3A 5LMBA 5HESA 4EOMA 5A9UA 5EW9A 5EOBA 2VGPA 3F88A 1JPAA 1XH4A 5IMXA 3II5A 1OPLA 2FSTX 2UZOA 4DDGA 4AT4A 4YMJA 3GQIA 2WHBA 1QCFA 3GCVA 4I23A 3MH0A 2C5YA 1UU8A 2BRMA 2YERA 3I7BA 4M8TA 2ETKA 3C50A 2XANA 4FNZA 3QTSA 4F9WA 2OWBA 2WMTA 3WARA 3KXMA 1OIYA 3BU3A 4MXYA 2IG7A 2CSNA 2J7TA 3IONA 2R3NA 5KMOA 5IA2A 2CDZA 4QP6A 4AP7A 3D83A 1W7HA 3W0PA 5BVEA 3KXXA 4X7QA 3WIKA 4Q9SA 4AA5A 3TCPA 1QMZA 4CYIA 3TUCA 4RIWB 2CCHA 2R3RA 4CZUA 5DBXA 2VX0A 4IX5A 3QX2A 4FX3A 2V55A 4EOQA 2OG8A 2YCSA 4II5A 4KIKA 5E4HA 5HLNA 3CKXA 3PSCA 4F6SA 4YJRA 4F9BA 5GINE 3RTPA 4TYGA 3F7WA 3D7TA 4JRVA 2QU6A 3VW6A 3FWQA 2YAKA 3RKBA 4O27B 2XZSA 3BYOA 1WBNA 4BYJA 1H26A 4FIGA 4IHPA 4JX3A 5BVFA 4FTLA 3R9RA 3TUDA 2JLDA 3WE8A 3HUBA 3MI9A 3T9TA 3O17A 2PUPA 2GNHA 5E1SA 3KXHA 2R3IA 1PXKA 5HVYA 4UEUA 4EC9A 2GHLA 4FTRA 1ZYSA 2WIPA 2OI4X 3DZQA 3PTGA 5IH5A 2YITA 3OG7A 3VBTA 1IASA 3W8LA 3NYNA 5AMNA 3SRVB 4GJ3A 1RW8A 3SAYA 3GFEA 4RX8A 1E1XA 2R3JA 1JBPE 3REPA 2I6LA 4FTKA 3AKLA 5M51A 5BV3A 1JKSA 2UV2A 2PZIA 3RMFA 2UW5A 4N4SA 4YJPA 2YCRA 4JL9A 4NKSA 4NYEA 1O6YA 5FM2A 4QMOA 2BCJA 5DR6A 4XG2A 1U5QA 5GNKA 4R7BA 4GKIA 2C6DA 2DQ7X 2JFMA 2WMVA 4P2KA 2G15A 2ITNA 3ATSA 1WVXA 2XF0A 4GYIA 4Y73A 2C5XA 1Q99A 3FSKA 4LM5A 3VW8A 4KA3A 4ORKA 1NXKA 5HEZA 4EH8A 4KABA 4ZS0A 5JN2A 4JLCA 3V01A 5JGAA 3CR0A 4RWJA 2A1AB 5EI2A 4ANBA 5FP6A 4IVDA 4XRJA 4UN0C 4GV1A 4J8NA 2ERKA 3G9LX 1URCA 2J0KA 3HGKA 3TN8A 4BBFA 5KNJA 3FKOA 3O50A 3HP5A 4TYIA 4XOZA 4RIWA 4O4EA 3V8TA 2RFSA 4D0WA 3BLRA 4E3CA 2A19B 4OTFA 4S30A 5LCKA 3RP9A 3TZ7A 5EYMA 3U6JA 2FSLX 2YIRA 5CSPA 4ZSGA 4O7WA 4MQ1A 3EQBA 2JDVA 3IG7A 4TRLA 4XG6A 5A3XA 4QMNA 4MQ2A 3QTIA 1Q62A 4J53A 3QZGA 4KKEA 4KWPA 4FSZA 4AGCA 1A9UA 2ITZA 2GHMA 4DAWA 1B39A 2NO3A 2XNBA 4AZWA 3QKLA 3LCDA 3EZRA 3ZHPC 5CU0A 4DG0E 3FBVA 1XBBA 5KKRC 5LVPA 3UNKA 4L00A 4IADA 3ZCLA 3DNDA 5AWMA 3QZFA 5KUPA 4MD8E 5ANIA 1V0BA 3HMIA 5GHVA 3AG9A 4EH7A 3EKKA 3TV7A 2XRUA 3SRVA 3EQFA 5JMSA 4AZEA 2QOFA 3OWKA 3CY2A 2WMRA 4FEUA 4NFNA 4IFCA 4U45A 3ORKA 3R9DA 5CF5A 3QL8A 2VO7A 4V05A 3PLAE 4QMVA 4YC8A 3O8UA 2BDFA 3DKFA 5IKWA 4BN1A 2PVKA 2X1NA 4FV6A 2XNEA 4XP0A 5FBOA 5KE0A 5HCZA 2BVAA 3M42A 4U79A 3KL8A 3QQKA 4A7CA 3VS3A 2CN8A 3D7ZA 2X8DA 5J7BA 3TDVA 3UOLA 4XUFA 2UW3A 4I4EA 4F63A 1UKIA 3FZOA 2O0UA 5IQFA 4QP7A 4QOXA 4L43A 3NUSA 4E1ZA 2HAKA 4LI5A 2VX1A 4HJOA 2OU7A 4DYMA 2J90A 4PMMA 1Q61A 2OH0E 3QF9A 4DT8A 2I1MA 4JBPA 4RG0A 4AX8A 2RG6A 4USDA 2W1ZA 2PZPA 3FYJX 4X21A 3HRBA 3POOA 5GJFA 5CNNA 5IA5A 3RVGA 4NJ3A 1SM2A 5CX9A 3SOCA 4E5BA 2HXQA 3LLAA 4ANOA 4G9RA 3RJCA 4IIRA 3GC9A 2R2PA 5CASA 1CKPA 4WUNA 5DLSA 1SVGA 2IO6A 3R28A 4O7YA 4OTQA 3OUKA 3V5QA 5HNBA 2PWLA 4ZOGA 2PVNA 3B8RA 2ITWA 1YRPA 4FKGA 2OJ9A 1MRVA 3MY5A 1JWHA 4IB1A 4Q5EA 2R9SA 4L3PA 2OXYA 4AUAA 4WG3A 4MNEB 3D2KA 2O5KA 5E7RA 3IK3A 4BR3A 2XIZA 3PLSA 3PSBA 4G3CA 2XARA 4NTSA 3M11A 4PL4A 3WYYA 5CALA 4I5CA 2YIYA 4MD9E 4DGGA 4JMQA 3L8XA 4EQCA 5DEWA 1H4LA 2NP8A 5F94A 3H9RA 4YGAA 3TV4A 5DYJA 4XG3A 3F3WA 3PXKA 4UBAA 2X8EA 1UNHA 4XH6A 4C33A 5HO7A 1XO2B 4U42A 4D4YA 4FZAB 4ACHA 4E6QA 2HW6A 2AQXA 3FMEA 4FIFA 4XCUA 3N4TA 3R63A 3ZO3A 4FKQA 3UDSA 1KWPA 3SD0A 3E8DA 4KBKA 4YTIA 2BPMA 2ONLA 4YJQA 3T9IA 3TZ9A 5CT7A 3OHTA 3CTJA 1OM1A 3BV3A 3VULA 4HGEA 2GDOA 2WELA 3PJ3A 4DH5A 4L01A 3BGQA 4NKAA 3E64A 4MVFA 3U6IA 4IAAA 1PMEA 2CLQA 4L3JA 4BTFA 2YM8A 1VEBA 5M44A 3LCTA 3C13A 3DA6A 3I7CA 4DN5A 3E7VA 4JQ7A 2C6KA 2UZVA 4UYAA 3R7UA 2G01A 4MD7E 4W4WA 3ULIA 4R1VA 3HV6A 1YXSA 3FMDA 4O0TA 3QD3A 4C35A 1H8FA 3LFBA 3OWJA 2C6IA 1XH8A 4QMXA 4UV0A 4NM3A 4PF4A 5K9IA 4BJJA 1Z57A 3E3PA 4YC6A 2W5HA 4DCEA 3FLQA 4FT0A 2I0EA 4ZZMA 1P4OA 3HUCA 1ZYLA 4J7BA 4YSMA 5BVOA 4FSRA 4FEVA 2QO9A 4F9CA 4ZAUA 2OIBA 1NT2A 2XK3A 5AIKA 3TI1A 3N9XA 4IAYA 3OUNB 4KS7A 4YPSA 4D1ZA 3L8VA 5GJGA 2YCQA 4YC3A 3DCVA 3R0TA 4YO6A 3BWJA 5AAEA 1UWJA 3CKWA 4IB3A 4IZ7A 4MNEA 3OY3A 4QQCA 4OTGA 3JY9A 2BTSA 3IPHA 4BCFA 4J8MA 4ZZNA 4A4LA 3HAMA 3Q53A 4KINA 3COMA 4LG4A 4EH4A 4I21A 5E8ZA 4TW9A 5E8YA 5KMJA 5EHLA 1ST0A 2YDIA 2PMNX 3C5IA 2ZFYA 2VTQA 4JRNA 1KOBA 2XCHA 3PZEA 2VTHA 3DK6A 3A99A 4W4VA 5AAFA 4F64A 4G6LA 4AZFA 1Y57A 5FG8A 1YHWA 2VTPA 3FJQE 3KMWA 4PTGA 4H3PA 5E91A 5TF9A 2YM7A 4DFLA 4Q9ZA 3EL7A 3EYHA 4MKCA 1FVTA 5M4FA 2XNMA 3C5UA 1FVVA 1YHSA 1OB3A 4AG8A 2YWVA 2Q0NA 4MK0A 4O38A 2XP2A 3RAWA 3COHA 2EB2A 2IZUA 3I0OA 4N70A 3NIZA 4TWCA 1ZY5A 1PW2A 2O65A 2YHVA 5AR3A 3FPMA 3BHYA 5CVFA 4OT6A 1J3HA 3FE3A 4QQTA 4FODA 5IDPA 3AD4A 4A9RA 3UOJA 4AXFA 5AP2A 4B6LA 2JIUA 1PMUA 4BI0A 2OICA 4ZSEA 2KTYA 3R7YA 2Y0AA 4BDFA 4I5MA 5EQPA 3QGYA 1H27A 3ZFMA 4BCPA 3LQ3A 1KE9A 3VUHA 3I79A 4QYYA 4D4SA 2G9XA 3MTLA 4BTMA 4AN9A 3FEGA 5H2UA 4CFNA 2XALA 3VUGA 1OL2A 3W1FA 4HW7A 1OGYA 3DAJA 5ANGA 3AMBA 3F5GA 4XS2A 4D5KA 1FMKA 3DT1A 1V1KA 2IVVA 3OD6X 5AV1A