4I0RA

Crystal structure of spleen tyrosine kinase complexed with 2-(3,4,5-trimethoxy-phenyl)-5h-pyrrolo[2,3-b]pyrazine-7-carboxylic acid isopropylamide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
277
structure length
264
Chain Sequence
VYLDRKLLTLEDELGSGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Pyrrolopyrazines as selective spleen tyrosine kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 264
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i0rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i0rA01
3HUBA 4O1OA 2XNPA 4CCBA 2F57A 3FKNA 4KB8A 2H96A 4OTFA 1VYZA 4KIQA 2OJGA 3RMFA 3UJGA 4IAYA 1YKRA 2UW5A 3ATTA 1KE5A 5EKNA 4FEWA 2GHGA 3K3IA 5DT0A 3AMYA 3DFAA 3GFWA 3QYWA 4AGDA 5LVMA 4AUAA 4YJSA 5BMSA 2WMXA 5EH0A 4ZZOA 4FKIA 4QYHA 4M3QA 4YC8A 2OJFE 5L6OA 3L9PA 1PXNA 3UPZA 2JKQA 3GEQA 3U51A 1WBWA 4HPUE 3LFAA 5E8ZA 4K6ZA 3W2PA 2YJRA 5LVLA 4WNPA 4BTJA 3WF7A 2WQBA 3TI1A 3CTJA 4U40A 3ORIA 4Q9SA 4YGAA 3QYZA 2X8EA 4ENYA 4RIYB 4X6QC 2QU5A 3ZLYA 1CMKE 1ZAOA 2XNNA 3EQCA 1YHSA 2PPQA 5IDPA 3F7WA 3CPBA 2OG8A 4R3PA 3A61A 3ORMA 2FUMA 3Q96A 2CKOA 3UOLA 4EBWA 4YURA 2WQOA 3AG9A 5JFSA 5AP4A 4MWIA 4FEVA 1ZYJA 4YMJA 3NUPA 5KHWA 3QX4A 2BKZA 2CLXA 4GW8A 4ASZA 2QKWB 4B0GA 4XP3A 5K9IA 4EJ7A 3BWFA 4AZTA 2WOTA 3P79A 2QD9A 3RI1A 2RG6A 1ZOEA 3VRYA 4DTKA 4O7SA 1U5QA 2YISA 2C47A 4O2PA 4DCAA 3EH9A 4PTEA 4R6VA 4RX8A 4FEUA 4XG9A 1OIQA 5KUPA 3F61A 4PNIA 3TNIA 2ITWA 4IAZA 2RG5A 4JDHA 3U6HA 3QHWA 4PP7A 3ORZA 5E4HA 2GNHA 5I0BA 3RNYA 3TEIA 2BKKA 4HYHA 3ZUTA 4N4SA 3ANQA 4A07A 5AIRA 4Y83A 4DGNA 4EQUA 1L3RE 4EZ5A 1UNGA 5HESA 3WIGA 3C0GA 4XJ0A 5BUEA 1JSVA 1IEPA 2C5XA 3LMGA 3MVLA 2PZRA 2VO6A 4JI9A 1W84A 3R1NA 4HCTA 3DFCB 4QPMA 4CNHA 4D2VA 2F9GA 3HA6A 4BDKA 4FKSA 1KUTA 1Y6AA 3KGAA 3IW4A 3NNUA 3DZOA 4PL3A 3F66A 4IFGA 4Y8DA 3I79A 5J79A 3PZHA 3EN6A 4QYEA 1OIUA 3TKHA 1KE9A 4DA5A 5CEIA 2QO7A 2VUWA 4O0TA 4IE9A 4HVGA 4RJ8A 3LE6A 4DTAA 4IB1A 3FLWA 3HDNA 4F9WA 3NUAA 3G0EA 4D4SA 1OIYA 2Y8OA 4G5JA 4ZZMA 2R2PA 5JRQA 5IQBA 2BROA 3F3ZA 3LM5A 4KS8A 4QYYA 1V0OA 3R7UA 3TIYA 4C7TA 3E92A 3Q9ZA 4F7LA 3D7TA 4X2NA 4BDEA 1AGWA 3KXXA 1WAKA 3W2QA 1SVHA 3BLHA 2J90A 4K77A 3K5VA 2I0YA 3F2RA 3WZUA 2IW6A 3PP0A 2C3KA 4BCOA 3CKWA 3KF7A 3UZTA 4TWPA 3WYYA 3UIBA 4BWPA 2UZDA 4TYEA 4JL9A 4CCUA 4MEDA 3HEGA 3L8VA 4FV5A 3SRVA 4UN0C 1MUOA 2GS6A 3CD8A 2W96B 3ZC5A 1XH4A 3F3UA 4JBVA 3SG9A 3MVJA 3KCFA 5JK3A 4TYHB 2W1FA 3QZHA 2O3PA 3OT3A 4P7EA 5ANKA 3EN5A 4FGBA 3QZFA 3K54A 4FIIA 4QTDA 4R7HA 1M7QA 2JDTA 5AV0A 2P33A 5HLWA 2ZM4A 3KC3A 4KIPA 3RM6A 3W33A 5CQWA 4EOSA 4C8BA 3SXRA 3HKOA 1IRKA 2E9VA 5B7VA 4X6RA 3POZA 2X9EA 4E93A 5JFWA 5BVNA 5I5ZA 1SMHA 4OBQA 1JOWB 2OF2A 4ACCA 4M69B 3P0MA 3EKKA 3VC4A 4F6SA 3PTGA 2JDOA 4FNYA 2OZAB 5LCKA 5F20A 3HVCA 5CVHA 2UZEA 2QVSE 4XEYA 2I1MA 4ZJIA 5K5XA 3EFKA 3NIEA 2OKRA 3DGKA 3MB6A 2VWIA 2J0LA 3OTUA 1UNLA 3H0ZA 2ZDUA 4IANA 3UIXA 4FSRA 3VUMA 3L8SA 3WARA 4NJ3A 2XKEA 3NNXA 5AJQA 2QR7A 4EHEA 1AQ1A 4DFBA 1A06A 4MAOA 4KWPA 4AF3A 4KKEA 4XYFA 3A2CA 4S2ZA 5E91A 3OWPA 3RPOA 4DBNA 3MGYA 5CAQA 2CN5A 4R1VA 1B39A 4N70A 2XCHA 3R00A 1CTPE 1JKKA 3EKNA 3R6XA 4JVGA 2A27A 2Y4IB 4YZ9A 3V8TA 3GP0A 4BTFA 4HZRA 3S95A 5AX3A 3ZLSA 5A46A 4IX5A 4QMUA 2Z7QA 4QP1A 5HNBA 3N51A 4WRSA 5JQ8A 5AP3A 3BBTB 4TNBA 4F1TA 1GAGA 3H0YA 4BKYA 1CSNA 4CLIA 5CALA 2JGZA 3P86A 4DGGA 4BCFA 4AT4A 4EHZA 3AT3A 3BLRA 3HMPA 3G6HA 4JIAA 4UYAA 5IQHA 3FKOA 3FZTA 2XIXA 5ACKA 2JD5A 1FVTA 3BPRA 3O17A 3PY3A 5IUHA 3LM0A 5LVOA 4FT9A 4AN2A 1J7LA 3EIDA 3W55A 3UO5A 1R39A 2CJMA 3P5KA 2ONLA 3ZEPA 5C8MA 3FMHA 4XG3A 4IAKA 1LUFA 3DLSA 1YI4A 3BE2A 3Q4UA 4EBVA 4Z3VA 5L3AA 1PMNA 5IEYA 3ZU7A 4AP7A 2V55A 4LGGA 3NUUA 4O0UA 5KE0A 2J6MA 4CRSA 3OWLA 1FMOE 3FL5A 3HL7A 3TJCA 3D94A 3NRMA 4RRVA 4U45A 2YZAA 4I6FA 4ASXA 4YUQA 3S0OA 3NIZA 1FMKA 2VTQA 2XK9A 2R4BA 4V05A 3ZBFA 1URCA 5JSMA 5CY3A 2J7TA 3UOKA 1YOMA 4X2KA 5A54A 2W1CA 5CI6A 2VN9A 4S30A 4Q9ZA 2XIKA 3IGGA 1VR2A 2WPAA 3C0IA 2J4ZA 3R7YA 2ITXA 3E88A 2WEIA 3K2LA 4IC7A 5C03A 1PXIA 3O51A 3NS9A 4PP9A 4AFEA 4D4RA 1PMUA 2B52A 2C6TA 3TV6A 3R7VA 3B2WA 4BI2A 5BVWA 2X7FA 4IVCA 1BUHA 1H1PA 3C4ZA 3E3PA 4AX8A 3MESA 2R3NA 5HU9A 4UWBA 3EQGA 4C3PA 2QOHA 5TE0A 4IWPA 2IJMA 5HO6A 2OW3A 2FB8A 4O1PA 4GG5A 3MI9A 3VS0A 2PMIA 5E1SA 3KMUA 1FOTA 2QHNA 3A4PA 4FODA 4I94A 3VF9A 5DGZA 3E7VA 2IWIA 3IECA 4F09A 3EN7A 3WZEA 4FMQA 3VIDA 5D11A 5HBJA 4G34A 3BGZA 3HECA 1Q97A 4JBOA 3CR0A 3CTHA 4FL2A 2VZ6A 3HV7A 3NPCA 4FG7A 2CNVA 2B4SB 3AC8A 3FQSA 2ZV2A 3R73A 4G31A 4IACA 3R83A 4DEAA 5J5SA 4FV9A 5JGAA 2XYUA 2UVXA 3CGOA 4D0WA 5EM6A 3ITZA 4FGRA 4DT9A 2O8YA 2X6EA 4U80A 4NH1A 2GQRA 3VW6A 3LXKA 4FICA 1M2PA 3FSKA 4O0WA 2FH9A 2PUNA 4I1ZA 4KNBA 4H36A 4TY1A 3GENA 3SC1A 3QQUA 3ZONA 3GB2A 4G3CA 2V5QA 4IAIA 4H58A 4BIDA 5J5TA 4EI4A 3P7BA 4TYIA 3U6IA 4MD9E 4TYGA 3GQIA 3O2MA 3BRBA 2W17A 2X2MA 3ZFYA 1Q8YA 2C1BA 4HYSA 5J9ZA 3PXYA 2FGIA 3FMDA 4MCVA 3G15A 3QF9A 5FUTA 1OKWA 3VS5A 3DXQA 4LRJA 3PLAE 3RKBA 3Q5ZA 3O23A 1LEZA 3UQCA 2O5KA 4YZNA 5EM7A 2Y9QA 3TNWA 5H8BA 2IZTA 4DLIA 1FPUA 1BI7A 4O84A 4EK5A 4QP9A 3KFAA 4NK9A 3K5UA 3COHA 5FXSA 2PVRA 4C59A 2DUVA 1VJYA 3WE8A 3HRCA 1U5RA 1SNUA 1VZOA 3L8XA 4FZDB 4BFMA 5HI2A 5AP1A 4O91A 3HRFA 4O21A 3GT8A 3OUNB 4E5BA 5CAPA 3AGMA 4CXAA 4J1RA 4TWCA 4D4YA 5DH3A 5LQFA 3CCNA 2QODA 5HICA 3VUKA 5DWRA 5AUZA 2X4ZA 1ZZ2A 2X7GA 5JRSA 1GOLA 3FDNA 2WU7A 4USDA 5HCYA 4XUFA 3FMMA 1PYXA 4AA0A 4QMLA 4EL9A 2V0DA 3EZRA 3MH3A 4UMQA 1FINA 3BU5A 3RAIA 2IVUA 4M84A 4RBLA 4AA4A 3SW7A 3ZRLA 3OW3A 2P2IA 3W2CA 5EQPA 4E5WA 2OZOA 4YC3A 1OL5A 2PZYA 3ZOSA 4CT2A 3FC2A 2WAJA 3ANRA 3UYSA 4EH4A 2YITA 3LMHA 4JBPA 4RWIA 5AP7A 4QMYA 1OZ1A 2R3HA 1NT2A 4DH1A 5AR5A 4I5HA 5L8KA 2X8IA 2XK8A 1UU7A 4FKUA 4ZY6A 2GQSA 4D2SA 5M07A 4IC8A 2Y4IC 2O63A 3LFBA 4LRMA 5EI8A 4EK3A 2R3QA 4LOPA 3QLFA 3JYAA 3GU5A 1VYWA 5CVFA 4I4EA 4HVHA 4DEDA 3ODYX 5DVRA 3FJQE 2F49A 1KWPA 1Q8TA 4QO9A 4C33A 4DFLA 2AUHA 2WTWA 3OBJA 2Z7LA 4S34A 5DE2A 4ERWA 4R78A 3EB0A 3W2RA 4YNEA 4E73A 4MD7E 1BL6A 4QMOA 3PA3A 1JSUA 3JVRA 3OBGA 4LRKA 4QMQA 4ZTQA 4FE2A 4HGEA 1JQHA 2UUEA 3UOHA 3I5NA 4BZDA 2R3RA 3AC2A 3BQCA 5IH6A 3H10A 4A9SA 5HVKA 2XVDA 1ZARA 4E1ZA 2Z02A 5L2WA 3AXWA 4FC0A 1W7HA 1PXLA 3DK3A 2JITA 2B9FA 3FPMA 3SLSA 4GIHA 2BALA 4CEGA 4ZOGA 5CEPA 3NSZA 3ZC6A 5CENA 5FTGA 4AW2A 5TF9A 1Z57A 1M2QA 1QPCA 3MSSA 5AV4A 3COIA 2WMWA 4FSQA 5CSHA 2A2AA 3NUNA 4DH8A 4EH3A 3HX4A 5LOHA 2QOBA 2YA9A 5K3YA 5CI7A 3NAYA 4HGSA 4QP6A 3RVGA 3TCPA 3BHYA 4CZTA 5AA8A 2EB3A 4NZWB 3AMBA 3I0OA 1ERKA 3GU7A 3SRVB 2WB8A 5DIAA 4MYGA 2YIXA 1F5QA 3KRLA 2BZKB 3RWQA 3F7ZA 4FT5A 5EK7A 3QBNA 5IA4A 1PKGA 5CT0A 4ZTLA 2BVAA 2YM5A 3FZPA 4NM5A 5M06A 4NKAA 3RK5A 2YLEA 3R01A 5JH6A 4O96A 4GYIA 3R8MA 4NFNA 5EM5A 3F3TA 3V8WA 4D4VA 3TT0A 5LJJA 1XBAA 2VGPA 3P1AA 3FLYA 3UNJA 1H1QA 5IU2A 3OVVA 3BV2A 4C4EA 3C5UA 5AAGA 4YBKA 5TT7A 4QMXA 4RA4A 4W9XA 4TZRA 4ZSAA 2PHKA 4H1JA 4FIGA 1M17A 3VQUA 4ZTHA 4XBUA 2WTIA 1JNKA 1XKKA 3ORNA 3VBVA 3D9VA 3P4KA 3IOKA 1IASA 5IEXA 2Q0BA 2YAKA 2RFDA 1A9UA 4PDPA 4U97A 3E8NA 1K9AA 3M11A 4J71A 5EFQA 3UVPA 3ZTXA 4I5MA 5CSPA 3KRJA 5E8TA 4FNXA 4BRXA 2WTJA 3D5VA 5HIDA 4X2JA 4BDHA 5E8YA 2WTDA 4EH2A 3NVKI 4D58A 4QQJA 3D5UA 4D1ZA 4UMPA 1OUKA 3UC3A 3VHEA 4G3FA 4E4XA 4QQ5A 1J3HA 3G0FA 2ZV8A 3DKGA 2JAVA 3MY5A 3QTUA 2VTPA 4IZ5A 4DG2E 4ZS4A 4GKHA 3EFWA 3FQEA 4EQMA 4F6UA 5E8WA 4EH7A 4JQ8A 3RJCA 2HZ0A 4UX9A 4DH5A 1J1CA 2GNLA 3QZGA 3TZMA 4FTCA 2X7OA 2UW9A 2OICA 2PVLA 3LFNA 2UZVA 2QOCA 4FKGA 4X3FA 5DYJA 5CQUA 2P2HA 3U9NA 3UZRA 2VTRA 3BYVA 3UMXA 4CQEA 5JN2A 4YJPA 2GS2A 3QA0A 5JFVA 5GNKA 5IMXA 4EK8A 4CFXA 1OI9A 3BLQA 4DN5A 4F65A 2GS7A 3E8EA 2ETMA 1U46A 4GJ3A 3LXLA 4QMNA 3OC1A 5IEVA 1EH4A 3SOAA 4J98A 2JLDA 4M66A 3MA6A 4BKZA 4EEVA 5CF4A 3CC6A 4HYIA 2YM8A 2WMBA 4PDYA 4GU9A 5C4KA 5J7HA 4S33A 4XV9A 5IQIA 1U54B 2R7IA 2HELA 3QCYA 4G6LA 2J5FA 3B8QA 1V0BA 5AP6A 5KZ0A 5M4IA 3LQ8A 3FLNC 3RNIA 3LKMA 5DEWA 4YJNA 4H3BA 3PPJA 2VV9A 4YZMA 3KMMA 4ANNA 3NLBA 4H39A 2BTSA 4CZUA 4OTGA 1ZYCA 4ZEGA 4O81A 4QP8A 3UIUA 1UWHA 3W8QA 4BCQA 1NA7A 3DAKA 2R3PA 3DY7A 5BYZA 3FZSA 4BIBA 5HBEA 4O7ZA 3KQ7A 5J1VA 2BILB 5ETAA 3C13A 3O71A 4P5QA 2YIYA 5ETIA 4AA5A 2VWZA 3OD6X 1WBOA 3LFQA 4FKPA 5IA1A 2XRUA 1FQ1B 2BHHA 3FXXA 1XH5A 4L45A 2ZM1A 1WCCA 4D5KA 3PA5A 4BCNA 4C4HA 1CKIA 1K3AA 3FWQA 4GK3A 4JX3A 3VHKA 1OGUA 4MXAA 2QO2A 3VS2A 4C3RA 1KOAA 2HIWA 4LOOA 3RK7A 4JS8A 4MVFA 1NVSA 5J87A 4CQGA 4Q5EA 3LIJA 5HD7A 2WEVA 5F4NA 2HZNA 3RAWA 2C6EA 5C8NA 5JFXA 4FTTA 4EK4A 4ZY5A 4RT7A 3DQXA 3QA8A 4I92A 4JG7A 5AA9A 4ALUA 3OTVA 5BYYA 2C30A 3PXFA 3VF8A 2V7AA 4NJDA 4B99A 3ROCA 4C3FA 4FYOA 2C3IB 4KSPA 1YWNA 4FSWA 4MHAA 2YWPA 2PULA 3LHJA 4E8AA 2PVHA 4W4YA 4PMTA 3PXZA 2VWBA 1H26A 3GGFA 3VUDA 3WZKA 3MH2A 4GU6A 5CNOA 3QRUA 3VBXA 4B6LA 3EJ1A 5FTOA 4BDAA 1XBBA 3W1FA 5CYIA 4NM3A 4EYMA 4DF3A 1WBNA 4GSBA 3LAUA 5M51A 4FK3A 1OITA 5HTCA 5HE1A 3GBZA 4OTRA 5FXQA 2BDWA 1LP4A 3O8TA 2BDJA 4JIKA 3P7CA 4GK4A 3RPRA 2GTMA 3KRRA 4ZLZA 4C37A 4IVAA 4K2RA 5HE2A 4FTNA 2OI4X 4IM3A 4W4XA 4DH7A 2RFSA 3LCSA 3S1HA 4ACDA 3DXPA 4WA9A 3EQIA 3PXKA 4G5PA 4RG0A 5CASA 5AUWA 4WD5A 4CMTA 3FKLA 5E92A 3QQJA 5ANEA 1Q8UA 3QC4A 3HLLA 4ACGA 2PZ5A 5EW9A 3RAHA 4PY1A 4TT7A 4FKRA 4O0XA 4CSVA 1VEBA 3N9XA 5DRDA 5AX9A 2PVKA 2PVJA 4QNYA 3GUBA 4U44A 4RX5A 4DFUA 2VRXA 4L44A 4IJPA 4EYJA 3TZ8A 2XZSA 1HCKA 1WVWA 3IW7A 1QL6A 4OBPA 3WILA 4NYEA 2OJIA 5AAEA 5HLNA 4BCHA 4DGMA 1OMWA 2W4KA 5BX0A 5HU3A 4JXFA 5AFVA 2XEZA 1NW1A 3WYXA 4O0RA 4HVDA 4LOQA 2ERKA 3REPA 2VTLA 5HD4A 3R04A 3PDTA 2XK6A 5CU4A 4ZXTA 3QQLA 1XH8A 2I0VA 2VTSA 4CD0A 4NWMA 4KSQA 5BVEA 4EONA 2PYWA 3ZO4A 1ZXEA 3I4BA 3FSFA 4TWOA 4BWKA 1QPDA 5EDQA 3R63A 3HV3A 4OUCA 4ITJA 2XNMA 3V6SA 1O9UA 2OBJA 2OGVA 2WMTA 5B0XA 4FSUA 4DFXE 1H0VA 2ITZA 3QL8A 4I20A 3T9IA 3PSBA 5KKRC 3VBQA 1SYKA 4QP2A 4RLKA 1P4FA 2Y7JA 3BHVA 5E7RA 3LCKA 5EYDA 5KNJA 3A62A 3DBFA 4RVTA 3QD2B 4KS7A 4C4JA 4RJ6A 3A60A 4NKSA 5BUJA 4F9YA 4F1MA 2CCHA 4CFMA 3AD4A 3MYGA 2BCJA 5AADA 2GNGA 4NT4A 2WMRA 2ERZE 3HV5A 3OEZA 5AP2A 2ZOQA 5FEQA 4ACMA 5IPJA 1PY5A 4FA2A 1L8TA 4YU2A 3C5IA 4FKJA 4FTAA 2X81A 5E90A 1JVPP 4U7ZA 2ESMA 3GC0A 1WVYA 4U3ZA 4L46A 5D9HA 3R2YA 3DKCA 2ZM3A 4L7SA 1ZWSA 1B38A 4O0SA 4KINA 4AZWA 1YOLA 3E8CA 5HTIA 3ULZA 2W9ZB 2F4JA 2PZPA 3N4TA 3QGYA 4MNEA 3ENHA 4YJUA 2BPMA 4EOLA 4DE4A 3NMUF 5CLPA 2NRUA 3T3VA 2W1EA 4PL4A 4FTJA 4FSZA 1MRUA 2WU6A 1XR1A 2QO9A 3BU6A 4J96A 2AC5A 2W1GA 3BGQA 4IZYA 3HV4A 3R1QA 4BGGA 3NUSA 2R3JA 4RFYA 5ITAA 3HZTA 3L9NA 2QC6A 2YDIA 4CLJA 4RWJA 3WZDA 3GU8A 4GVAA 5L6WL 2YCFA 3OT8A 3EWHA 2I7QA 1RE8A 5GJDA 3EOCA 2ACXA 3Q6WA 2QG7A 2RKUA 3CS9A 4A4XA 5GINE 2VWYA 5CZIA 3ET7A 5BVKA 1XBCA 4L3LA 3KEXA 1PYEA 4R7IA 3CJFA 3TUBA 2ITUA 4J8MA 3IOPA 1FVRA 2AC3A 5CSXA 4GEOA 4YPSA 4A9TA 1S9JA 1YWRA 1YXXA 4A9UA 1WBVA 2PTKA 5AUXA 5CSVA 5HORA 3PG3A 4FV4A 1R3CA 1OBGA 2GHMA 4YP8A 4FKOA 2UW7A 3ORTA 4EC8A 2JDVA 4OT6A 4WRGA 3TTJA 3UBDA 1YWVA 4C61A 3PJ1A 4YLKA 4EWHA 3THBA 4ZJVA 5FQDC 4QP7A 2Z2WA 5HX6A 4PL5A 2C6MA 3VBYA 4YO4A 3Q9YA 5F9EA 1PHKA 4LGDA 4V0GA 3RAKA 4DCEA 1P4OA 2VU3A 1BX6A 3IDCA 3OP5A 4L68A 4UEUA 4DINA 4E20A 5LCJA 2GU8A 4MH7A 3R9DA 4BB4A 5CEKA 4FV8A 3W32A 2XJ1A 4KBCA 2X6DA 4J52A 4D2RA 3DAEA 4LG4A 1Q62A 1M2RA 5HG7A 4CMOA 1WVXA 3UIMA 3BYSA 2JKMA 4W9WA 1NXKA 2F7EE 3WE4A 4C58A 1G8SA 3SX9A 5CNNA 3RCJA 2QI8A 2XNGA 2XS0A 1YXSA 2A19B 2G01A 3BHUA 2CGVA 2ZV7A 4FZAB 4J97A 4YLJA 1FBNA 5BUIA 2ETKA 2QOIA 2XKDA 3PWDA 4EQCA 3IONA 4XCUA 2XP2A 3ETAA 2UW3A 4DYMA 4H3QA 2JDRA 3KVXA 5AP0A 3NNWA 3QRKA 1SM2A 3OFMA 3I60A 3O0GA 5AUVA 4FT0A 5K4IA 3B2TA 2EB2A 2PY3A 2JDSA 3FHRA 3PPKA 3AMAA 1OB3A 3O8PA 1P14A 3R1SA 2G15A 4QMVA 5AR2A 4QQTA 3OCBA 4LM5A 3QALE 4RFMA 3DNDA 3QQKA 4FTKA 4A4OA 4C2WA 3F82A 3C50A 2HXQA 2WO6A 3C4XA 4I23A 4U41A 5ETFA 3QTZA 4ZY4A 3QGWA 4IEBA 1HCLA 2PVFA 2ITNA 1CKJA 4OBOA 3TDWA 3WI6A 3VBWA 2FSLX 1GZNA 3OROA 1PXPA 4UMTA 5EG3A 5FXRA 3MJ2A 4YTCA 3MFRA 2HZIA 3AC1A 3EFJA 5DN3A 4MF0A 3VS7A 4FKTA 2P0CA 4BL1A 3LJ1A 2IG7A 4AN3A 3HRBA 1GZ8A 4AW0A 5KMKA 1GIJA 3LFDA 4TKSA 3QLGA 1YOJA 5HNGA 2JBOA 4NCTC 3GC9A 4AZEA 5K0KA 2UVYA 3KVWA 4JG6A 2DYLA 3SOCA 3II5A 4EHGA 2XIZA 3HMIA 3JUHA 3M2WA 2IVVA 1DI9A 3TV7A 1Q3WA 1IA8A 2XYNA 3I7BA 5HCXA 3M42A 2GTNA 3MV5A 4RIXA 4EOMA 2C3JA 3A7IA 2C6OA 3OOMA 2Y6MA 3MWUA 4FTUA 4NFMA 5ETCA 3AC5A 4QYFA 4YJRA 1OBDA 2YACA 5IQGA 4FV1A 5CZHA 3R9RA 3S00A 2ZMDA 4QMMA 4F9AA 1XJDA 3BGPA 2CDZA 4OAVB 3D2KA 2R7BA 3SD0A 2J0IA 2OF4A 5BMMA 3QTIA 3UVQA 2CKQA 2CLQA 5DMZA 3F5XA 4TW9A 5L2TA 1PRYA 4P2KA 2W4JA 4Z7HA 4MXZA 3LOKA 2IN6A 4HCUA 3DOGA 3A99A 4QOXA 2P4IA 2YEXA 3TM0A 4LFIA 1MQBA 2UV2A 4GFGA 2C69A 4TN6A 3RPVA 3UP2A 2YFXA 4BDGA 2YERA 2HW7A 2OIDA 3AD6A 4C4GA 5GZAA 2EUFB 3PE1A 4IADA 4A9RA 1ZMWA 3FMLA 4JBQA 1KV2A 4YBJA 3U4UA 2J50A 3MY1A 4A4LA 4C4IA 2VX3A 4FIFA 4IB0A 4NEUA 5DG5A 4F6WA 4GG7A 2B9HA 3DQWA 4OW8A 4CFVA 3E3BX 3PA4A 4HCVA 3R1YA 1H08A 2RL5A 2XNOA 4L67A 2B9JA 2QNJA 4IDTA 5KMOA 4DFZE 4YHJA 5E1EA 1PF8A 2C4GA 4CKJA 3NNVA 1OKYA 3CQWA 2PSQA 3FV8A 4RVMA 2RFEA 3EQDA 3ZBXA 1WFCA 2Z7RA 4AOIA 1Z9XA 3ALNA 5FP6A 4ANOA 5KMIA 2BIYA 3FXWA 2XNEA 3SW4A 2HWPA 4JG8A 5D10A 4RJ4A 5F1ZA 4CRLA 3Q2JA 3UVRA 4M13A 4CV9A 3R0TA 2X4FA 4L8MA 3TZ9A 4EUTA 2YLFA 3GFEA 4HOKA 5ANOA 3IW5A 2IZSA 2KULA 1Q8WA 4RJ5A 4H3PA 1H01A 1ZYLA 5A4QA 3VN9A 1YQJA 4Y73A 4TTHB 4PPBA 2W0JA 5HHWA 3LFSA 4KIKB 3KN5A 2B0QA 5CWZA 2PU8A 3UODA 2XEYA 4YJVA 2O65A 4D2WA 3TL8A 3DJ7A 1F3MC 3R28A 2XH5A 4ZP5A 4BDJA 5CEMA 4JOAA 5A3XA 2V62A 4F0IA 5H9BA 1ND4A 4IAAA 3K3JA 2XK7A 3SHEA 3ZM4A 4H05A 2XCKA 3LVPA 4HPTE 4YTIA 4Y5HA 2GFSA 4PTCA 2W5AA 4E6QA 4F0FA 2UVZA 3C4EA 2R3MA 5FG8A 4DITA 3ORKA 3TUCA 3NX8A 4MBIA 3O96A 2YIWA 4KBAA 3HA8A 3ZDIA 3KULA 1PXKA 1YDRE 3R9OA 2UZLA 4I93A 2J0MB 2VWUA 2G9XA 3R8LA 4BCGA 4BBFA 3WF6A 3DXNA 4BBMA 5J9LA 2JKOA 3SVVA 3EFLA 4S31A 5H8EA 2X1NA 4ITIA 2J0JA 3LXPA 4F99A 1JBPE 2R0UA 3V5PA 1Q61A 5AM6A 3BYOA 4R77A 2CCIA 4CT1A 4ID7A 1E9HA 3F9NA 3PVUA 2E9PA 1TQMA 3G6GA 4DAWA 5CXHA 2BZIB 3CKXA 4PX6A 2XK4A 1OPJA 2H9VA 1ZMVA 1KE8A 3FHIA 3OY3A 4FK6A 3TN8A 3UPXA 4ZSEA 4BGHA 4ZMFA 4ZTSA 2P3GX 4RJ3A 4CG8A 2WMQA 3H3CA 4IBMA 4AFJA 3C7QA 5DFPA 3UOJA 2ZVAA 2C6IA 3A7GA 2WZJA 3KCKA 3UMWA 4D55A 2BAKA 3F6XA 1UKIA 3IO7A 4M8TA 3FQHA 2W1ZA 5E8XA 3TTIA 3RM7A 3OUKA 4GV1A 4U42A 4X0MA 3UTOA 4FNZA 2HENA 3C9WA 3PXRA 4FZ6A 3QU0A 3V8SA 1ZMUA 4A06A 2B55A 3IQ7A 1Y91A 3CEKA 3H30A 2XKFA 2CGUA 3S4QA 3BZ3A 3DB8A 3KY2A 5IQEA 4O0VA 2C6DA 2R9SA 4I0RA 1H1RA 5BVDA 3C4WA 2PWLA 2VAGA 3DV3A 3GCPA 1V1KA 3B8RA 4YZDA 4CFFA 3QXOA 2HCKA 5HE0A 2XMYA 2G2IA 4OLIA 3BCEA 3SQQA 5C01A 5ANDA 4LL0A 4YHTA 3U9CA 3PUPA 5AUYA 3EL7A 3HV6A 3PYYA 5HGIA 3RK9A 1STCE 4AU8A 3NW6A 4ANSA 4RX9A 2WTKB 5T3QA 4FOBA 5IUGA 1MRYA 1UVRA 4UALA 4RIYA 4YO6A 2JEDA 3NYVA 5I9WA 1JKTA 1GY3A 5AR3A 4ZJJA 3U87A 4AAAA 4EH6A 4X2FA 2BHEA 4RGJA 1V0PA 2FYSA 1YW2A 4YZBA 3HAVA 3LPBA 2QU6A 3PRFA 3V3VA 2DS1A 4GCJA 3VAPA 3ZSGA 2NO3A 2CMWA 5M4CA 4KABA 5C4LA 4EOOA 3TV4A 5I9ZA 5CT7A 4GS6A 4ZLYA 4FX3A 2B9IA 2XJ0A 4PRJA 2H34A 1U59A 2IW9A 5AV2A 3D7TB 1Y6BA 4I3ZA 3KXNA 5LMBA 5IQAA 4X7QA 4EH8A 3R8PA 2PK9A 4J7BA 2Z60A 3UQFA 1XH9A 1ATPE 1I09A 1KE6A 3FZRA 2GDOA 1CM8A 2YCQA 5ICPA 4K9YA 3FI3A 5EW8A 1W0XC 4TNDA 4I24A 4JDJA 5HVYA 5HX8A 1J1BA 1YDSE 4YTHA 3UYTA 5KBQA 4GMYA 5H2UA 2WIHA 3W10A 5I9YA 3HDMA 5LMKC 3DK6A 1P5EA 3HMNA 2BMCA 4QMZA 5HKMA 3UNZA 4ONAA 3AT4A 4M15A 4UBAA 5M09A 4AW5A 5FM3A 3U6JA 3DDPA 2EXEA 3BKBA 3ALOA 3FLZA 3OOGA 4AG8A 3QTWA 2VTJA 3PJCA 1DAWA 4K1BA 3QD3A 4QMSA 1T45A 3HMOA 3JS2A 2C5OA 2RIOA 3Q9XA 3Q52A 4RIWA 1M7NA 4OT5A 4HNIA 4QTBA 2R3FA 4BICA 4L01A 1NVQA 5D1JA 4WSQA 4O0YA 5I9UA 1UU3A 3A8WA 4FG8A 1DI8A 4FBXA 1PXMA 4IDVA 3FC1X 1XQZA 1UA2A 5CEOA 2R3GA 5M4UA 1WBPA 1WBTA 3LCDA 5CU6A 3R2BA 5CU0A 3VUGA 5C9CA 2C0IA 2YM4A 3QD4A 3PXQA 1REJA 2XIRA 2OLCA 5HO8A 1KE7A 3OWJA 4KKHA 3QFVA 3KREA 3MW1A 3MFSA 4WHZA 4CFNA 3VUTA 3MVMA 3PY1A 4BTKA 4YSJA 2GCDA 3DPKA 3AC4A 4IMYA 4PTGA 2B7AA 5T68A 4MXYA 4U9AA 1GIHA 1UKHA 4EKLA 4RC3A 3CPCA 4BYIA 4IXPA 3ZS5A 2PZIA 1AD5A 2GFCA 2WHBA 4KRDA 5T6KA 3D7ZA 3R7IA 4FL1A 4G6NA 4RVLA 2FSMX 3ZRKA 1PKDA 4R3RA 4CTCA 4CZYB 4EZ7A 5KO1A 3F5PA 3TKUA 3PPZA 3NGAA 4U0IA 4BBEA 3UDBA 2GHLA 4R1YA 3GU6A 5FM2A 3VS6A 2CN8A 2OFUA 5J7BA 3GVUA 5A4LA 1JAMA 5LVNA 3IS5A 4NL0A 5TO8A 2W1HA 3GXLA 1OPKA 4TYHA 1XWSA 4AZSA 3NDMA 2XM9A 4A7CA 3HP2A 5IH5A 2YAAA 3MH1A 2YM7A 1H1WA 3F5UA 4PPAA 4L9IA 3G9NA 2O2UA 3QCQA 4ALVA 4GIIA 2V7OA 4HGLA 4F08A 3FY0A 2NPQA 3BU3A 5M56A 4FZFB 2XBAA 3P7AA 4NSTA 1XHAA 4CMUA 3QD0A 2XF0A 4ERKA 3PSCA 3D83A 3OHTA 4KKGA 4O7VA 3U8WA 5GZ9A 5GIPE 4I5PA 1GZKA 5BVOA 4Y72A 1BLXA 4PQNA 1PXJA 2JKKA 3COMA 4BWXA 2VTAA 3QRJA 4P5ZA 2Y0AA 5E8UA 3DS6A 4DG3E 5L8LA 4GKIA 4KD1A 2JAMA 4BCIA 1O6KA 2XRWA 3TWJA 5AR4A 5CF8A 5A9UA 3D14A 4CVAA 3RINA 5HO7A 3PJ8A 3EQFA 4JDKA 4D9TA 3VWAA 4IJ9A 5DRBA 1G8AA 1RW8A 1O6YA 4JR3A 4PMMA 1Y8YA 3G90X 4RFZA 4EOKA 2OU7A 3FY2A 3NCGA 1YVJA 2QOQA 2E2BA 4QTCA 4AWIA 4BCKA 4D2PA 4FIEA 4BI0A 2XB7A 3QQFA 5CAVA 4O86A 4USEA 5FP5A 3VJNA 4ZMEA 5HCZA 4IQ6A 2PVMA 4WUNA 1SVGA 4FG9A 4C35A 4O7LA 4GUBA 3SGCA 4ZS0A 4DHFA 3MA3A 3QHRA 3QZIA 4G3DA 4YR8A 4JJRA 4E3CA 3BWJA 4TYJA 3BEGA 3TNPC 2YDJA 3C4FA 5E8VA 4QMPA 2RGPA 5B2KA 3KXMA 4WSYA 4DFNA 4UMRA 4XV2A 4DFYA 4ANLA 3HAMA 3RGFA 2AYPA 3H9RA 4FT7A 1J7IA 3E7OA 2BUJA 2Q0NA 2WTKC 4QT1A 2BRHA 3HYHA 1PJKA 4JAJA 5DBXA 3R9HA 4O7TA 3LZBA 2ITVA 3KMWA 4EHVA 3V5LA 5D7AA 4ALWA 4XP2A 2FSTX 4QMTA 5FBOA 4K11A 2CGXA 5AP5A 4I6HA 3KRXA 3PVGA 1PMEA 1RDQE 2OWBA 4D1XA 3IW8A 4PF4A 4M12A 4AT3A 3QTSA 4XX9A 1PMVA 1W83A 2IO6A 4C4FA 3H4JA 4G3GA 3AT2A 2R5TA 4FOCA 5D41A 4U5JA 5KMNA 4ASDA 2J9MA 3NCZA 3LJ0A 3KK9A 4DEEA 2RFNA 4JRNA 5B2MA 3GQLA 3QRIA 3LFFA 5EYMA 2NRYA 5DNRA 3BI6A 4O7NA 3W2SA 3WF9A 3Q3BA 2YDKA 4F9CA 4BY9E 1B6CB 1J7UA 3WOWA 5IDNA 5DPVA 4ANBA 4NTSA 4FVQA 3VJOA 3R71A 3TACA 1QPEA 4A9YA 4B8MA 3E93A 5FDPA 2W4OA 2BDFA 3SDJA 1ZRZA 2GSFA 3MVHA 2EXCX 4IWQA 1OL1A 4G9RA 5CU2A 4UV0A 5GJGA 1OKVA 5AIKA 3WF8A 3WIKA 1YHVA 3AQVA 4AQCA 4BIEA 4Z16A 2BAJA 3OZ6A 4WO5A 4FIJA 5KHXA 2BTRA 2W1IA 3H9OA 3BHHA 3DJ5A 4U43A 4UXLA 3NUYA 3KULB 2C5VA 3PE2A 1BL7A 5LWMA 3PRIA 4BI1A 3NWWA 4MX9A 2LGCA 4LMUA 3ZLWA 5KCVA 2XK3A 3ACKA 3EQHA 4XP0A 4L43A 4C57A 1IG1A 4IW0A 4MWHA 3DT1A 1KSWA 4FSTA 1E1VA 4II5A 1YHWA 4MKCA 2BRNA 4FKWA 4U81A 4FIHA 4ZZNA 1A48A 2QOFA 3MTLA 1WZYA 5EYCA 3QWKA 4F9BA 4FUYA 4FVRA 4L7FA 5E9EA 3EZVA 4IWDA 4FKLA 1OPLA 4NU1A 4ASEA 3R7OA 2Z7SA 2EWAA 3FYKX 2KTYA 3ULIA 3VUHA 4FNWA 4EH9A 3L9MA 5JZNA 3ZO3A 3KXGA 3MIYA 3FMJA 2C5YA 2CSNA 3Q6UA 4WUAA 4Y5QA 3JVSA 4BCJA 4BCMA 3Q4TA 4O6EA 4UB7A 2YM6A 1JKLA 3ACJA 3QXPA 3RWPA 4CG9A 1OIRA 1UU8A 2WTVA 4U79A 3TDVA 1ZZLA 2ITPA 3FL4A 2YCSA 3Q2MA 2ITYA 4ZTMA 1IAHA 3VUIA 2Q83A 4IVDA 4WG5A 2RF9A 2YIRA 4F70A 3SG8A 2PMOX 5IA5A 2F7ZE 3EYGA 1H28A 3L9LA 4N0SA 1XO2B 3ZEWA 5KX8A 3F69A 2ZB0A 3ZCLA 2BRMA 4TRLA 1JPAA 4F63A 3QCSA 5LXMA 1U4DA 5CF5A 4BHZA 2VO3A 3CJGA 1NVRA 3ZRMA 4BN1A 4PMPA 4D5HA 3JY0A 4XLVA 3FXZA 2UZUE 1ZOHA 1Y57A 3PZEA 4I22A 3IW6A 4EZ3A 4BF2A 4OTPA 2WELA 3FMKA 2W05A 3JPVA 3MPTA 5IG1A 4BHNA 2ONLC 2I0HA 3GI3A 3GCSA 1NY3A 1UNHA 5KBRA 2SRCA 4EUUA 2BFXA 1GZOA 3CY3A 3G5DA 5A4CA 3O7LD 4IVBA 4R3CA 1H27A 5B2LA 3ZHPC 4XS2A 3ENMA 1WMKA 4IX4A 4QMWA 2FO0A 3GC8A 2UW4A 3PY0A 3QUPA 2HK5A 3PG1A 2QHMA 3OEFX 1IA9A 4W4WA 3G33A 3VRZA 2Z8CA 2OH0E 2PMLX 4E4LA 2OIBA 4APCA 2VX0A 3OF0A 4GT4A 4I21A 4BC6A 4CKRA 4DTBA 3FPQA 2E9OA 3HNGA 1RJBA 4ZK5A 4AXAA 5AR7A 2J51A 5FDXA 4F7JA 3ZFXA 4CV8A 4EH5A 2QR8A 4OTQA 1BKXA 2VTTA 3Q60A 4LYNA 1IAJA 3L1SA 3Q9WA 3TG1A 3DDQA 2HOGA 4HW7A 2W5BA 3ZFMA 3MFTA 3NYOA 4QPSA 4XG6A 1DM2A 2ITQA 3F3VA 4USFA 3BQRA 4FV2A 4XBRA 5FTQA 3SV0A 4BDBA 4TL0A 4L3JA 3EYHA 1H1SA 4AW1A 5DI1A 5JMSA 3R7EA 2NNWB 2FSOX 3NEWA 3NVMB 4Y85A 4QPAA 4MTAA 5FRIA 1APME 3E63A 3QX2A 4RIWB 3G51A 2PVYA 4TPTA 1Q5KA 3KXZA 4XG2A 3CGFA 3MPAA 2UZNA 5GZ8A 2X9FA 4FF8A 3GOPA 5J1WA 4C0TA 4IZ7A 4FTIA 4RJ7A 4MNFA 5AWMA 2YHVA 5G1XA 4AGWA 4F7SA 5HTBA 4O83A 3EN9A 2UZTA 1H8FA 3F2AA 2R3IA 4FSYA 4D1SA 5BQ0A 3W8LA 4EOJA 3UO6A 3LQ5A 3W16A 4YJTA 2IVSA 2C6KA 2DQ7X 3H9FA 4G3EA 3V5WA 4JLCA 4XLIA 4AOJA 3QQHA 3VW8A 1UV5A 4EOPA 4O7WA 4JR7A 4FTLA 4D9UA 3PFQA 4HVSA 4LV8A 3Q53A 3LJ2A 3T8OA 1R0EA 4ORKA 4MBJA 5FD2A 5ANJA 4G17A 2WGJA 2O0UA 3UGCA 4X3JA 4YSMA 3V5JA 4M7IA 3BYUA 4KBKA 4U8ZA 4RZWA 2WQEA 5EHYA 5LMAA 1MRVA 3LXNA 4I5CA 4PPCA 5GHVA 3EN4A 3KXHA 4AS0A 1OL2A 2WQNA 5ANGA 4DH3A 4M68A 5I9XA 4BCPA 3OW4A 2CNQA 4XG8A 4X3FB 4B9DA 4CGAA 1Q41A 3A7JA 3SAYA 3L8PA 4FKQA 5FWKK 2EU9A 3DLZA 3GNIB 4IHPA 4JRVA 4LI5A 3C1XA 3LFCA 4NIFA 4WNOA 4FEXA 4JQEA 3AC3A 3TNHA 1ZY5A 2BFYA 4N6YA 3RP9A 3MY0A 3OMVA 4UZHA 1DAYA 2X2LA 4XOZA 5M53A 1FVVA 5AM7A 3G2FA 3W2OA 5DR9A 3U55A 1SVEA 4KRCA 3P78A 2QOLA 1YI3A 4QP4A 5KMLA 4QQCA 3ZSIA 4J8NA 5CANA 5HIEA 3DB6A 4U6RA 4R8QA 1UU9A 4V01A 3CD3A 4O2ZA 5H8GA 1JSTA 1LPUA 5IA2A 4V04A 2BAQA 3IGOA 3KN6A 2ZYBA 3F88A 3JXWA 1JWHA 4PDSA 5HE3A 4KA3A 4M97A 2IW8A 3V04A 4D2TA 5J95A 3FE3A 4MD8E 3PWYA 4FTOA 3SXSA 2IPXA 5IH4A 1ZYDA 2PE1A 2WOUA 4RSSA 4BTMA 3NZ0A 4IAFA 3MJ1A 4Z55A 5EKOA 3DBCA 1G5SA 1H0WA 4AZVA 3BELA 2J0KA 1Q99A 2VX1A 4GT5A 2BZHB 3DU8A 3KF4A 4Z9LA 5A14A 3I81A 2WQMA 3TZ7A 1OUYA 5TR6A 2BIKB 3D5WA 3TIZA 3PP1A 3GC7A 3IG7A 4FEQA 5EYKA 4U3YA 5EM8A 2OXXA 5K0XA 3JY9A 4F0GA 5M55A 2XKCA 5F95A 3OWKA 2RSVA 3R22A 3ZXZA 4QYGA 4AZFA 4UXQA 2VWVA 2WTCA 4MXCA 4DEBA 5I3OA 4FVPA 5HZNA 4EOIA 4MQ2A 2QLUA 2HAKA 5AUUA 2QCSA 1XH7A 4DEGA 3POOA 1OM1A 3E87A 3GU4A 3WBLA 1SZMA 3KA0A 2QONA 4O22A 5ANIA 1U54A 3PJ2A 3ZDUA 4ZLOA 3AOXA 1I44A 3O7LB 4MK0A 4XG4A 4IX6A 2R64A 3FYJX 1M52A 5EDPA 4I0SA 4ZIMA 3DBEA 4RZVA 2W06A 1YXVA 5J9YA 4D28A 3E8DA 5I4NA 4I6BA 3TJDA 3BYMA 3V01A 3OXIA 5KMMA 3IKAA 3I6WA 5K5NA 2HYYA 3ZO1A 1TQIA 4IFCA 5CXZA 3ID6C 3W18A 1Q24A 3F3WA 2FVDA 3DA6A 4L6QA 4ZAUA 2R3OA 1OL7A 3OXTA 5C26A 1Z5MA 2HWOA 2IZUA 3M1SA 2GNIA 4NW5A 2G2FA 4YZCA 3V5QA 5EW3A 4F64A 3R30A 3UP7A 4ANQA 2E9NA 2C0OA 3ZUUA 4QNAA 3BX5A 5LWNA 2OK1A 3DK7A 4E6DA 3A7FA 2R0IA 2PMNX 3FUPA 4I4FA 4AOTA 5L2QA 2C1AA 1YI6A 4C34A 3VS4A 2DWBA 4ZSGA 3RPSA 3DTCA 4R5SA 4BR3A 5CSWA 1P2AA 3A4OX 5A4EA 4XV1A 3HUCA 1F0QA 2JC6A 4GH2A 4L52A 5HG9A 1OKZA 4E6AA 4G16A 2J2IB 2A0CX 4H1MA 4HVIA 3HP5A 4WBOA 4Q2AA 4ZTRA 4GFMA 4X21A 2ZAZA 4FL3A 4FUXA 1LR4A 4XG7A 5EDRA 4UZDA 2QLQA 3BIZA 4K18A 1GIIA 4O6LA 3QCXA 4KIOA 3NUXA 4FV3A 5FEDA 3UG1A 1OVEA 3ZMMA 5HNIX 1KOBA 2VTIA 3FMEA 4IB5A 5LARA 3ZYAA 5CAUA 3MB7A 5JKGA 1E1XA 1UWJA 2JIUA 3MFUA 2H6DA 3PIXA 4WIHA 4WNKA 5AMNA 3VBTA 4L00A 5E8SA 4O82A 2QG5A 3QTXA 4L3PA 4EORA 2OJJA 4GYGA 3RHXA 3EHAA 4YNOA 2PUPA 4RX7A 5IUIA 3NR9A 2BR1A 3RHKA 4FSNA 4AE9A 3CQUA 3RTPA 4FTQA 3C51A 4FV0A 5AR8A 4E5AX 5CVGA 3QKLA 3F5GA 2WMVA 4FTMA 2UW6A 4CFUA 4ENXA 4BZNA 1HOWA 2A4LA 1JKSA 2JIIA 2W9FB 5HQ0A 2OH4A 5L4QA 3HGKA 4TWNA 1SNXA 2WIPA 3QKMA 4Y95A 2YABA 4XH6A 3PVWA 4WT6A 4O38A 3BE9A 2QURA 4K0YA 3LFEA 4MQ1A 2B54A 3PIYA 4EKKA 2OXDA 1FGKA 3CQEA 3DCVA 2VO7A 3ORLA 3PSDA 2ETRA 4QP3A 4RWKA 3R9NA 5EI6A 4BDDA 3MBLA 4BGQA 5IA0A 2EVAA 3FBVA 4PUZA 4X3FC 4BYJA 2YWVA 3VS3A 5EHOA 4MXOA 1ZOGA 1TQPA 4IX3A 3O8UA 5HLPA 1MP8A 3ZZWA 4CKIA 4YHFA 5AEPA 5HBHA 2HY81 3D2IA 2C6LA 4EJNA 4RLLA 3F2NA 1O6LA 4RQKA 5GJFA 3V6RA 3NW5A 1S9IA 5JEBA 4DBXA 1IR3A 2YCRA 4OAUC 4WG3A 2E9UA 3I6UA 3Q5IA 3FLSA 3E5AA 3TXOA 2Y6OA 3GCUA 3MDYA 4LV5A 4M0YA 2XIYA 3R8ZA 4PNKA 1R0PA 4NUSA 3UZPA 3VO3A 4GRBA 5L8JA 4MNEB 2PVNA 2WMAA 2UZOA 4YJOA 4NCTA 1QCFA 4YLLA 4J99A 2ITOA 5BPYA 4G9CA 5C27A 5I3RA 5I9VA 3ZUVA 2REIA 3OY1A 2GNJA 3AGLA 3WF5A 4GVJA 4ZTNA 2CPKE 3QQGA 2QKRA 3Q04A 4N6ZA 3RZBA 5JZJA 2BZJA 3FI4A 5IA3A 2H8HA 5DOSA 4FTRA 4FV6A 4JAIA 3TKIA 3U4WA 1YRPA 4CYIA 2CNUA 2QOKA 4C38A 3N4VA 4IB3A 5BYLA 3CP9A 3NW7A 5CX9A 3CY2A 3LCOA 3RZFA 4OGRA 2CHLA 5DHJA 2FA2A 3LQ3A 4MXXA 1YDTE 4LUEA 2WNTA 5D7VA 2ZV9A 5IF1A 5DT4A 2XJ2A 5CU3A 4AGUA 4F4PA 3Q4CA 3C0HA 4XNEA 1H24A 1OECA 3D4QA 5J8IA 4E26A 3LW0A 4WBBB 3QTRA 5IZFA 4NM0A 1KV1A 2F2UA 2W5HA 2VO0A 5A6NA 1YXTA 3IDPA 3KK8A 4O7YA 3PLSA 4Y46A 4YJQA 3LLAA 5IQCA 2J5EA 3CXWA 4NM7A 5LVPA 4FYNA 1ZY4A 2O64A 1DS5A 4FKVA 3D0EA 5HVJA 4JT3A 2HXLA 2I6LA 3LLTA 4J95A 3G9LX 4FI1A 5EHLA 4V0GB 4HNFA 3BBWA 5KZIA 3IPHA 3FZOA 5IKWA 4B7TA 4FSMA 2C0TA 2OO8X 3DKFA 4RC2A 5C1QB 3BV3A 5L2IA 5M57A 2XM8A 3OCTA 2VD5A 4G6OA 1MQ4A 2GMXA 3I7CA 2JBPA 4IWOA 5EI2A 5HOAA 2CKEA 3ERKA 1RQQA 4JX7A 4BKJA 3DBDA 4DT8A 2G2HA 5CEQA 2PUIA 3OCSA 1H25A 4QRCA 5CAOA 4ACHA 3QAME 3GCVA 5C8KA 2X2KA 1OL6A 1W8CA 2X8DA 3P23A 3UE4A 4W8DA 3PIZA 5HG8A 2IZRA 2W99B 2X39A 3OS3A 5DLSA 4NW6A 5A6OA 4DGOA 4OTDA 4BZOA 3BEAA 3QUDA 4LMNA 4L42A 4B8LA 5JQ5A 2XBJA 2QOOA 1Q4LA 3FAAA 5DR6A 4BDCA 2X0GA 5HIBA 4O7RA 4Q5HA 3T9TA 4QD6A 3I5ZA 2PE0A 4FZ7A 4KAOA 3MTFA 3A7HA 4WNMA 4ZSJA 1FGIA 3QWJA 1T46A 3CTQA 4G1WA 4S32A 4UY9A 4NIFB 5FEEA 2VTHA 3SKCA 5EQEA 5CS6A 3OCGA 3FI8A 2F7XE 3ELJA 4DLJA 3A8XA 4RPVA 1G3NA 4JNWA 2W1DA 3UQGA 1H07A 4PDOA 4MF1A 1H00A 3KKVA 2BRGA 4YPDA 3VNTA 2OFVA 3ZLXA 1WBSA 4APPA 4HYUA 3BHTA 3ODZX 2UW8A 3I1AA 3E64A 4EK6A 5M08A 3DZQA 3PJ3A 4OTWA 4UYNA 1H4LA 2YJSA 4DG0E 4XMOA 5H3QA 4CTBA 3QC9A 5ACBC 1PW2A 1R78A 4L53A 5DT3A 3DNEA 3UC4A 3KU2A 3Q4ZA 1W82A 2C5NA 2OJ9A 3CLYA 5AV3A 3ZH8A 3E62A 5L2SA 3VVHA 4LUDA 2PUUA 4Z7GA 5M4FA 2JFMA 2CKPA 2GPHA 3RALA 3NAXA 3COKA 3ZXTA 3Q32A 4J53A 4RVKA 5F94A 3MPMA 3WZJA 4I6QA 3HMMA 4M69A 3LCTA 3EQRA 1PXOA 2HW6A 3UO4A 4QTAA 4DGLC 2OZAA 2YZLA 4M0ZA 1K2PA 4ITHA 4LL5A 4PWNA 4ARKA 2C68A 4IH8A 3AD5A 4RIXB 4C36A 1Q3DA 5BNJA 5KKRB 1JLUE 3P08A 3N4UA 3ORPA 4K8AA 5DA3A 3CBLA 3FZ1A 4NTTA 2JFLA 3IK3A 4X2GA 2I0EA 2ZB1A 4E6CA 5DR2A 1GJOA 3D15A 2XA4A 4LQMA 2WMUA 2P55A 3UG2A 1REKA 2VWWA 2WD1A 4GK2A 4GL9A 4MBLA 3R8UA 3ZSHA 3DBQA 2B53A 3VULA 4LGHA 2YN8A 4HZSA 4R5YA 2W7XA 4G2FA 3QUEA 2CGWA 2IVTA 2C3LA 2OIQA 5HG5A 4C62A 5BVFA 4UWYA 3ROYA 4AGCA 3VQHA 3EQBA 1LEWA 2Y4PA 3FI2A 4OR5A 2OXYA 4E7WA 5D12A 4CFWA 3CSVA 3FEGA 4GFOA 4DC2A 3OG7A 3IDBA 2A1AB 1W98A 4W4VA 4K33A 3NYXA 3TNQB 1TKIA 3T3UA 4C02A 4WKQA 4QTEA 4XOYA 3O50A 3D5XA 1Y8GA 3EQPA 1R1WA 3KL8A 3ORXA 4FV7A 3QTQA 1CDKA 2VGOA 3RCDA 4PMSA 3MS9A 4XRLA 3R21A 5JGDA 4R7BA 5GIOE 4AE6A 2R3KA 3DJ6A 4AACA 3KB7A 3PVBA 1X8BA 2WXVA 3S3IA 1QMZA 2VNWA 3GOKA 4XRJA 3RBWA 3SA0A 4GUEA 3ATSA 2BRBA 2VTNA 5EOBA 1YXUA 5KMJA 2GNFA 2XNBA 2I40A 5JGBA 1QPJA 2VWXA 3R02A 2V22A 1XH6A 4EC9A 1CKPA 4N57A 3GCQA 3C4CA 3DAJA 3ZM9A 4OTIA 3LMIA 4FR4A 3S2PA 5EOLA 4F1OA 5TKDA 5CF6A 5IQFA 5TOZA 4HJOA 4IIRA 4O27B 2ZDTA 3OXZA 2VTMA 2ITTA 4HGTA 4DEHA 3RPYA 3P9JA 1BYGA 4I0TA 5DEYA 5K4JA 2LAVA 5HEZA 2VNYA 2EXMA 4IZAA 3UNKA 3EMGA 4WG4A 4FT3A 2HY0A 4JDIA 4JQ7A 4M67A 4PV0A 3MIAA 1BI8A 4M14A 1J91A 4RC4A 4OTHA 4XHKB 5IISA 4P90A 5LMKA 1ZYSA 2UZWE 1M14A 4ANMA 4TXCA 4IM0A 2F2CB 3U54A 2OSCA 3V51A 5IMEA 4BDFA 4UMUA 2WKMA 5M44A 2YM3A 5AAFA 3CIKA 3KRWA 3NYNA 2UZBA 5FLFA 1GNGA 2WMSA 4EOQA 1BMKA 4IM2A 4XV3A 4YC6A 4F7NA 4GT3A 2XUUA 5CTPA 4P4CA 3FLQA 5AV1A 2WFYA 3ZZEA 4DEIA 3JR1A 2PL0A 4KUJA 2B1PA 4D0XA 3SXFA 2ZMCA 2NP8A 4RMZA 5AUTA 3V5TA 4YTFA 2GQGA 3QKKA 2HZ4A 5IQDA 2YIQA 5FGKA 3MH0A 4RIOA 2PE2A 1URWA 4W8EA 3EL8A 4BVUA 3ZO2A 3R7GA 4CYJA 3DKOA 2JIVA 2ZJWA 5JT2A 5FBNC 3I0QA 4GJ2A 2VTOA 4EWQA 1ZLTA 3DTWA 5EQYA 1Q8ZA 4I41A 3CE3A 5L6PA 3MN3A 3R8VA 4UWCA 4RQVA 5G6VA 3FMNA 4B4LA 4C2VA 2QQ7A 4AN9A 3QRTA 1TVOA 4RA5A 4WOVA 4E4MA 5A4TA 3TUDA 4ZSLA 3VS1A 4AT5A 4RWLA 2R3LA 2UW0A 4BDIA 4KIKA 4E4NA 2G1TA
chains in the Genus database with same CATH superfamily
3HUBA 4O1OA 2XNPA 4CCBA 2F57A 3FKNA 4KB8A 2H96A 4OTFA 1VYZA 4KIQA 2OJGA 3RMFA 3UJGA 4IAYA 1YKRA 2UW5A 3ATTA 1KE5A 5EKNA 4FEWA 2GHGA 3K3IA 5DT0A 3AMYA 3DFAA 3GFWA 3QYWA 4AGDA 5LVMA 4AUAA 4YJSA 5BMSA 2WMXA 5EH0A 4ZZOA 4FKIA 4QYHA 4M3QA 4YC8A 2OJFE 5L6OA 3L9PA 1PXNA 3UDSA 3UPZA 2JKQA 3GEQA 3U51A 1WBWA 4HPUE 3LFAA 5E8ZA 4K6ZA 3W2PA 2YJRA 5LVLA 4WNPA 4BTJA 3WF7A 2WQBA 3TI1A 3CTJA 4U40A 3ORIA 4Q9SA 4YGAA 3QYZA 2X8EA 4ENYA 4RIYB 4X6QC 2QU5A 3ZLYA 1CMKE 1ZAOA 2XNNA 3EQCA 1YHSA 2PPQA 5IDPA 3F7WA 3CPBA 2OG8A 4R3PA 3A61A 3ORMA 2FUMA 3Q96A 2CKOA 3UOLA 4EBWA 4YURA 2WQOA 3AG9A 5JFSA 5AP4A 4MWIA 4FEVA 1ZYJA 4YMJA 3NUPA 5KHWA 3QX4A 2BKZA 2CLXA 4GW8A 4ASZA 2QKWB 4B0GA 4XP3A 5K9IA 4EJ7A 3BWFA 4AZTA 2WOTA 3P79A 2QD9A 3RI1A 2RG6A 1ZOEA 3VRYA 4DTKA 4O7SA 1U5QA 2YISA 2C47A 4O2PA 4DCAA 3EH9A 4PTEA 4R6VA 4RX8A 4FEUA 4XG9A 1OIQA 5KUPA 3F61A 4PNIA 3TNIA 2ITWA 4IAZA 2RG5A 4JDHA 3U6HA 3QHWA 4PP7A 1W2CA 3ORZA 5E4HA 2GNHA 5I0BA 3RNYA 3TEIA 2BKKA 4HYHA 3ZUTA 4N4SA 3ANQA 4A07A 5AIRA 4Y83A 4DGNA 4EQUA 1L3RE 4EZ5A 1UNGA 5HESA 3WIGA 3C0GA 4XJ0A 5BUEA 1JSVA 1IEPA 2C5XA 3LMGA 3MVLA 2PZRA 2VO6A 4JI9A 1W84A 3R1NA 4HCTA 3DFCB 4QPMA 4CNHA 4D2VA 2F9GA 3BL7A 3HA6A 4BDKA 4FKSA 1KUTA 1Y6AA 3KGAA 3IW4A 3NNUA 3DZOA 4PL3A 3F66A 4IFGA 4Y8DA 3I79A 5J79A 3PZHA 3EN6A 4QYEA 1OIUA 3TKHA 1KE9A 4DA5A 5CEIA 2QO7A 2VUWA 4O0TA 4IE9A 4HVGA 4RJ8A 3LE6A 4DTAA 4IB1A 3FLWA 3HDNA 4F9WA 3NUAA 3G0EA 4D4SA 1OIYA 2Y8OA 4G5JA 4ZZMA 2R2PA 5JRQA 5IQBA 2BROA 3F3ZA 3LM5A 4KS8A 4QYYA 1V0OA 3R7UA 3TIYA 4C7TA 3E92A 3Q9ZA 4F7LA 3D7TA 4LV7A 4X2NA 4BDEA 1AGWA 3KXXA 1WAKA 3W2QA 1SVHA 3BLHA 2J90A 4K77A 3K5VA 2I0YA 3F2RA 3WZUA 2IW6A 3PP0A 2C3KA 4BCOA 3CKWA 3KF7A 3UZTA 4TWPA 3WYYA 3UIBA 4BWPA 2UZDA 4TYEA 4JL9A 4CCUA 4MEDA 3HEGA 3L8VA 4FV5A 3SRVA 3NFFB 4UN0C 1MUOA 2GS6A 3CD8A 2W96B 3ZC5A 1XH4A 3F3UA 4JBVA 3SG9A 3MVJA 3KCFA 5JK3A 4TYHB 2W1FA 3QZHA 2O3PA 3OT3A 4P7EA 5ANKA 3EN5A 4FGBA 3QZFA 3K54A 4FIIA 4QTDA 4R7HA 1M7QA 2JDTA 5AV0A 2P33A 5HLWA 2ZM4A 3KC3A 4KIPA 3RM6A 3W33A 5CQWA 4EOSA 4C8BA 3SXRA 3HKOA 3AKJA 1IRKA 2E9VA 5B7VA 4X6RA 3POZA 2X9EA 4E93A 5JFWA 5BVNA 5I5ZA 1SMHA 4OBQA 1JOWB 2OF2A 4ACCA 4M69B 3P0MA 3EKKA 3VC4A 4F6SA 3PTGA 2JDOA 4FNYA 2OZAB 5LCKA 5F20A 3HVCA 5CVHA 2UZEA 2QVSE 4XEYA 2I1MA 4ZJIA 5K5XA 3EFKA 3NIEA 2OKRA 3DGKA 3MB6A 2VWIA 2J0LA 3OTUA 1UNLA 3H0ZA 2ZDUA 4IANA 3UIXA 4FSRA 3VUMA 3L8SA 3WARA 4NJ3A 2XKEA 1TZDA 3NNXA 5AJQA 2QR7A 4EHEA 1AQ1A 4DFBA 1A06A 4MAOA 4KWPA 4AF3A 4KKEA 4XYFA 3A2CA 4S2ZA 5E91A 3OWPA 3RPOA 4DBNA 3MGYA 5CAQA 2CN5A 4R1VA 1B39A 4N70A 2XCHA 3R00A 1CTPE 1JKKA 3EKNA 3R6XA 4JVGA 2A27A 2Y4IB 4YZ9A 3V8TA 3GP0A 4BTFA 4O4BB 4HZRA 3S95A 5AX3A 3ZLSA 5A46A 4IX5A 4QMUA 2Z7QA 4QP1A 5HNBA 3N51A 4WRSA 5JQ8A 4O4EA 3BBTB 4TNBA 5AP3A 4F1TA 1GAGA 3H0YA 4BKYA 1CSNA 4CLIA 5CALA 2JGZA 3P86A 4DGGA 4BCFA 4AT4A 4EHZA 3AT3A 3BLRA 3HMPA 3G6HA 3AKKA 4JIAA 4UYAA 5IQHA 3FKOA 3FZTA 2XIXA 5ACKA 2JD5A 1FVTA 3BPRA 3O17A 3PY3A 5IUHA 3LM0A 5LVOA 4FT9A 4AN2A 1J7LA 3EIDA 3W55A 3UO5A 1R39A 2CJMA 3P5KA 2ONLA 3ZEPA 5C8MA 3FMHA 4XG3A 4IAKA 1LUFA 3DLSA 1YI4A 3BE2A 3Q4UA 4EBVA 4Z3VA 5L3AA 1PMNA 5IEYA 3ZU7A 4AP7A 2V55A 4LGGA 3NUUA 4O0UA 5KE0A 2J6MA 4CRSA 3OWLA 1FMOE 3FL5A 3HL7A 3TJCA 3D94A 3NRMA 4RRVA 4U45A 2YZAA 4I6FA 4ASXA 4YUQA 3S0OA 3NIZA 1FMKA 2VTQA 2XK9A 2R4BA 4V05A 3ZBFA 1URCA 5JSMA 5CY3A 2J7TA 3UOKA 1YOMA 4X2KA 5A54A 2W1CA 5CI6A 2VN9A 4S30A 4Q9ZA 2XIKA 3IGGA 1VR2A 2WPAA 3C0IA 2J4ZA 3R7YA 2ITXA 3E88A 2WEIA 3K2LA 4IC7A 5C03A 1PXIA 3O51A 3NS9A 4PP9A 4AFEA 4D4RA 1PMUA 2B52A 2C6TA 3KIOC 3TV6A 3R7VA 3B2WA 4BI2A 5BVWA 2X7FA 4IVCA 1BUHA 1H1PA 3C4ZA 3E3PA 4AX8A 3MESA 2R3NA 5HU9A 4UWBA 3EQGA 4C3PA 2QOHA 5TE0A 4IWPA 2IJMA 5HO6A 2OW3A 2FB8A 4O1PA 4GG5A 3MI9A 3VS0A 2PMIA 5E1SA 3KMUA 1FOTA 2QHNA 3A4PA 4FODA 3ML1A 4I94A 3VF9A 5DGZA 3E7VA 2IWIA 3IECA 4F09A 3EN7A 3WZEA 4FMQA 3VIDA 5D11A 5HBJA 4G34A 3BGZA 3HECA 1Q97A 4JBOA 3CR0A 3CTHA 4FL2A 2VZ6A 3HV7A 3NPCA 4FG7A 2CNVA 2B4SB 3AC8A 3FQSA 2ZV2A 3R73A 4G31A 4IACA 3R83A 4DEAA 5J5SA 3UDZA 4FV9A 5JGAA 2XYUA 2UVXA 3CGOA 4D0WA 5EM6A 3ITZA 4FGRA 4DT9A 2O8YA 2X6EA 4U80A 4NH1A 2GQRA 3VW6A 3LXKA 4FICA 1M2PA 3FSKA 4O0WA 2FH9A 2PUNA 4BJJB 4I1ZA 4KNBA 4H36A 4TY1A 3GENA 3SC1A 3QQUA 3ZONA 3GB2A 4G3CA 2V5QA 4IAIA 4H58A 4BIDA 5J5TA 4EI4A 3P7BA 4TYIA 3U6IA 4MD9E 4TYGA 3GQIA 3O2MA 3BRBA 2W17A 2X2MA 3ZFYA 1Q8YA 2C1BA 4I6LA 3AKLA 4HYSA 5J9ZA 3PXYA 2FGIA 3FMDA 4MCVA 3G15A 3QF9A 5FUTA 1OKWA 3VS5A 3DXQA 4LRJA 3PLAE 3RKBA 3Q5ZA 3O23A 1LEZA 3UQCA 2O5KA 4YZNA 5EM7A 2Y9QA 3TNWA 5H8BA 2IZTA 4DLIA 1FPUA 1BI7A 4O84A 4EK5A 4QP9A 3KFAA 4NK9A 3K5UA 3COHA 5FXSA 2PVRA 4C59A 2DUVA 1VJYA 3WE8A 3HRCA 1U5RA 1SNUA 1VZOA 3L8XA 4FZDB 4BFMA 5HI2A 5AP1A 4O91A 3HRFA 4O21A 3GT8A 3OUNB 4E5BA 5CAPA 3AGMA 4CXAA 4J1RA 4TWCA 4D4YA 5DH3A 5LQFA 3CCNA 2QODA 5HICA 3VUKA 5DWRA 5AUZA 2X4ZA 1ZZ2A 2X7GA 5JRSA 1GOLA 3FDNA 2WU7A 4USDA 5HCYA 4XUFA 3FMMA 1PYXA 4AA0A 4QMLA 4EL9A 2V0DA 3EZRA 3MH3A 4UMQA 1FINA 3BU5A 3RAIA 2IVUA 4M84A 4RBLA 4AA4A 3SW7A 3ZRLA 3OW3A 2P2IA 3W2CA 5EQPA 4E5WA 2OZOA 4YC3A 1OL5A 2PZYA 3ZOSA 4CT2A 3FC2A 2WAJA 3ANRA 3UYSA 4EH4A 2YITA 3LMHA 4JBPA 4RWIA 5AP7A 4QMYA 1OZ1A 2R3HA 1NT2A 4DH1A 5AR5A 4I5HA 5L8KA 2X8IA 2XK8A 1UU7A 4FKUA 4ZY6A 2GQSA 4D2SA 5M07A 4IC8A 2Y4IC 2O63A 3LFBA 4LRMA 5EI8A 4EK3A 2R3QA 4LOPA 3QLFA 3JYAA 3GU5A 1VYWA 5CVFA 4I4EA 4HVHA 4DEDA 3ODYX 5DVRA 3FJQE 2F49A 1KWPA 1Q8TA 4QO9A 4C33A 4DFLA 2AUHA 2WTWA 3OBJA 2Z7LA 4S34A 5DE2A 4ERWA 4R78A 3EB0A 3W2RA 4YNEA 4E73A 4MD7E 1BL6A 4QMOA 3PA3A 1XMMA 1JSUA 4FRFA 3JVRA 3OBGA 4LRKA 4QMQA 4ZTQA 4FE2A 4HGEA 4AXCA 1JQHA 2UUEA 3UOHA 3I5NA 4BZDA 2R3RA 3AC2A 3BQCA 5IH6A 3H10A 4A9SA 5HVKA 2XVDA 1ZARA 4E1ZA 2Z02A 5L2WA 3AXWA 4FC0A 1W7HA 1PXLA 3DK3A 2JITA 2B9FA 3FPMA 3SLSA 4GIHA 2BALA 4CEGA 4ZOGA 5CEPA 3NSZA 3ZC6A 2IEWA 5CENA 5FTGA 4AW2A 5TF9A 1Z57A 1M2QA 1QPCA 2ZFYA 3MSSA 5AV4A 3COIA 2WMWA 4FSQA 5CSHA 2A2AA 3NUNA 4DH8A 4EH3A 3HX4A 5LOHA 2QOBA 2YA9A 5K3YA 5CI7A 3NAYA 4HGSA 4QP6A 3RVGA 3TCPA 3BHYA 4CZTA 5AA8A 2EB3A 4NZWB 3AMBA 3I0OA 1ERKA 3GU7A 3SRVB 2WB8A 5DIAA 4MYGA 2YIXA 1F5QA 3KRLA 2BZKB 3RWQA 3F7ZA 4FT5A 5EK7A 3QBNA 5IA4A 1PKGA 5CT0A 4ZTLA 2BVAA 2YM5A 3FZPA 4NM5A 5M06A 4NKAA 3RK5A 2YLEA 3R01A 5JH6A 4O96A 4GYIA 3R8MA 4NFNA 5EM5A 3F3TA 3V8WA 4D4VA 3TT0A 5LJJA 1XBAA 2VGPA 3P1AA 3FLYA 3UNJA 1H1QA 5IU2A 3OVVA 3BV2A 4C4EA 3C5UA 5AAGA 4YBKA 5TT7A 4QMXA 4RA4A 4W9XA 4TZRA 4ZSAA 2PHKA 4DHIB 4H1JA 4FIGA 1M17A 3VQUA 4ZTHA 4XBUA 2WTIA 1JNKA 1XKKA 3ORNA 3VBVA 3D9VA 3P4KA 3IOKA 1IASA 5IEXA 2Q0BA 2YAKA 2RFDA 1A9UA 4PDPA 4U97A 3E8NA 1K9AA 3M11A 4J71A 5EFQA 3UVPA 3ZTXA 4I5MA 5CSPA 3KRJA 5E8TA 4FNXA 4BRXA 2WTJA 3D5VA 5HIDA 4X2JA 4BDHA 5E8YA 2WTDA 4EH2A 3NVKI 4D58A 4QQJA 3D5UA 4D1ZA 4UMPA 1OUKA 3UC3A 3VHEA 4G3FA 4E4XA 4QQ5A 1J3HA 3G0FA 2ZV8A 3DKGA 2JAVA 3MY5A 3QTUA 2A98A 2VTPA 4IZ5A 4DG2E 4ZS4A 4GKHA 3EFWA 3FQEA 4EQMA 4F6UA 5E8WA 4EH7A 4JQ8A 3RJCA 2HZ0A 4UX9A 4DH5A 1J1CA 2GNLA 3QZGA 3TZMA 4FTCA 2X7OA 2UW9A 2OICA 2PVLA 3LFNA 2UZVA 2QOCA 4FKGA 4X3FA 5DYJA 5CQUA 2P2HA 3U9NA 3UZRA 2VTRA 3BYVA 3UMXA 4CQEA 5JN2A 4YJPA 2GS2A 3QA0A 5JFVA 5GNKA 5IMXA 4EK8A 4CFXA 1OI9A 3BLQA 4DN5A 4F65A 2GS7A 3E8EA 2ETMA 2X0QA 1U46A 4GJ3A 3LXLA 4QMNA 3OC1A 5IEVA 1EH4A 3SOAA 4J98A 2JLDA 4M66A 3MA6A 4BKZA 4EEVA 5CF4A 3CC6A 4HYIA 2YM8A 2WMBA 4PDYA 4GU9A 5C4KA 5J7HA 4S33A 4XV9A 5IQIA 1U54B 2R7IA 2HELA 3QCYA 4G6LA 2J5FA 3B8QA 1V0BA 5AP6A 5KZ0A 5M4IA 3LQ8A 3FLNC 3RNIA 3LKMA 5DEWA 3W0PA 4YJNA 4H3BA 3PPJA 2VV9A 4YZMA 3KMMA 4ANNA 3NLBA 4H39A 2BTSA 4CZUA 4OTGA 1ZYCA 4ZEGA 4O81A 4QP8A 3UIUA 1UWHA 3W8QA 4BCQA 1NA7A 3DAKA 2R3PA 3DY7A 5BYZA 3FZSA 4BIBA 5HBEA 4O7ZA 3KQ7A 5J1VA 2BILB 5ETAA 3C13A 3O71A 4P5QA 2YIYA 5ETIA 4AA5A 2VWZA 3OD6X 1WBOA 3LFQA 4FKPA 5IA1A 2XRUA 1FQ1B 2BHHA 3FXXA 1XH5A 4L45A 2ZM1A 1WCCA 4D5KA 3PA5A 4BCNA 4C4HA 1CKIA 1K3AA 3FWQA 4GK3A 4JX3A 3VHKA 1OGUA 4MXAA 2QO2A 3VS2A 4C3RA 1KOAA 2HIWA 4LOOA 3RK7A 4JS8A 4MVFA 1NVSA 5J87A 4CQGA 4Q5EA 3LIJA 5HD7A 2WEVA 5F4NA 2HZNA 3RAWA 2C6EA 5C8NA 5JFXA 4FTTA 4EK4A 4ZY5A 4RT7A 3DQXA 3QA8A 4I92A 4JG7A 5AA9A 4ALUA 3OTVA 5BYYA 2C30A 3PXFA 3VF8A 2V7AA 4NJDA 4B99A 3ROCA 4C3FA 4FYOA 2C3IB 4KSPA 1YWNA 4FSWA 4MHAA 2YWPA 2PULA 3LHJA 4E8AA 2PVHA 4W4YA 4PMTA 3PXZA 2VWBA 1H26A 3GGFA 3VUDA 3WZKA 3MH2A 4GU6A 5CNOA 3QRUA 3VBXA 4B6LA 3EJ1A 5FTOA 4BDAA 1XBBA 3W1FA 5CYIA 4NM3A 4EYMA 4DF3A 1WBNA 4GSBA 3LAUA 5M51A 4FK3A 1OITA 5HTCA 5HE1A 3GBZA 4OTRA 5FXQA 2BDWA 1LP4A 3O8TA 2BDJA 4JIKA 3P7CA 4GK4A 3RPRA 2GTMA 3KRRA 4ZLZA 4C37A 4IVAA 4K2RA 5HE2A 4FTNA 2OI4X 4IM3A 4W4XA 4DH7A 2RFSA 3LCSA 3S1HA 4ACDA 3DXPA 4WA9A 3EQIA 3PXKA 4G5PA 4RG0A 5CASA 5AUWA 4WD5A 4CMTA 3FKLA 5E92A 3QQJA 5ANEA 1Q8UA 3QC4A 3HLLA 4ACGA 2PZ5A 5EW9A 3RAHA 4PY1A 4TT7A 4FKRA 4O0XA 4CSVA 1VEBA 3N9XA 5DRDA 5AX9A 2PVKA 2PVJA 4QNYA 3GUBA 4U44A 4RX5A 4DFUA 2VRXA 4L44A 4IJPA 4EYJA 3TZ8A 2XZSA 1HCKA 1WVWA 3IW7A 1QL6A 4OBPA 3WILA 4NYEA 2OJIA 5AAEA 5HLNA 4BCHA 4DGMA 1OMWA 2W4KA 5BX0A 5HU3A 4JXFA 5AFVA 2XEZA 1NW1A 3WYXA 4O0RA 4HVDA 4LOQA 2ERKA 3REPA 2VTLA 5HD4A 3R04A 3PDTA 2XK6A 5CU4A 4ZXTA 3QQLA 1XH8A 2I0VA 4O4DA 2VTSA 4CD0A 4NWMA 4KSQA 5BVEA 4EONA 2PYWA 3ZO4A 3W0RA 1ZXEA 3I4BA 3FSFA 4TWOA 4BWKA 1QPDA 5EDQA 2XALA 3R63A 3HV3A 4OUCA 4ITJA 2XNMA 3V6SA 1O9UA 2OBJA 2OGVA 2WMTA 5B0XA 4FSUA 4DFXE 1H0VA 2ITZA 3QL8A 4I20A 3T9IA 3PSBA 5KKRC 3VBQA 1SYKA 4QP2A 4RLKA 1P4FA 2Y7JA 3BHVA 5E7RA 3LCKA 5EYDA 5KNJA 3A62A 3DBFA 4RVTA 3QD2B 4KS7A 4C4JA 4RJ6A 3A60A 4NKSA 5BUJA 4F9YA 4F1MA 2CCHA 4CFMA 3AD4A 3MYGA 2BCJA 5AADA 2GNGA 4NT4A 2WMRA 2ERZE 3HV5A 3OEZA 5AP2A 2ZOQA 5FEQA 4ACMA 5IPJA 1PY5A 4FA2A 1L8TA 4YU2A 3C5IA 4FKJA 4FTAA 2X81A 5E90A 1JVPP 4U7ZA 2ESMA 3GC0A 1WVYA 4U3ZA 4L46A 5D9HA 3R2YA 3DKCA 2ZM3A 4L7SA 1ZWSA 1B38A 4O0SA 4KINA 4AZWA 1YOLA 3E8CA 5HTIA 3ULZA 2W9ZB 2F4JA 2PZPA 3N4TA 3QGYA 4MNEA 3ENHA 4YJUA 2BPMA 4EOLA 3PUFC 4DE4A 3NMUF 5CLPA 2NRUA 3T3VA 2W1EA 4PL4A 4FTJA 4FSZA 1MRUA 2WU6A 1XR1A 2QO9A 3BU6A 4J96A 2AC5A 2W1GA 3BGQA 4IZYA 3HV4A 3R1QA 4BGGA 3NUSA 2R3JA 4RFYA 5ITAA 3HZTA 3L9NA 2QC6A 2YDIA 4CLJA 4RWJA 3WZDA 3GU8A 4GVAA 5L6WL 2YCFA 3OT8A 3EWHA 2I7QA 1RE8A 5GJDA 3EOCA 2ACXA 3Q6WA 2QG7A 2RKUA 3CS9A 4A4XA 5GINE 2VWYA 5CZIA 3ET7A 5BVKA 1XBCA 4L3LA 3W0NA 3KEXA 1PYEA 4R7IA 3CJFA 3TUBA 2ITUA 4J8MA 3IOPA 1FVRA 2AC3A 5CSXA 4GEOA 4YPSA 4A9TA 1S9JA 1YWRA 1YXXA 4A9UA 1WBVA 2PTKA 5AUXA 5CSVA 5HORA 3PG3A 4FV4A 1R3CA 1OBGA 2GHMA 4YP8A 4FKOA 2UW7A 3ORTA 4EC8A 2JDVA 4OT6A 4WRGA 3TTJA 3UBDA 1YWVA 4C61A 3PJ1A 4YLKA 4EWHA 3THBA 4ZJVA 5FQDC 4QP7A 2Z2WA 5HX6A 4PL5A 2C6MA 3VBYA 4YO4A 3Q9YA 5F9EA 1PHKA 4LGDA 4V0GA 3RAKA 4DCEA 1P4OA 2VU3A 1BX6A 3IDCA 3OP5A 4L68A 4UEUA 4DINA 4E20A 5LCJA 2GU8A 4MH7A 3R9DA 4BB4A 5CEKA 4FV8A 3W32A 2XJ1A 4KBCA 2X6DA 4J52A 4D2RA 3DAEA 4LG4A 1Q62A 1M2RA 5HG7A 4CMOA 1WVXA 3UIMA 3BYSA 2JKMA 4W9WA 1NXKA 2F7EE 3WE4A 4C58A 1G8SA 3SX9A 5CNNA 3RCJA 2QI8A 2XNGA 2XS0A 1YXSA 2A19B 2G01A 3BHUA 2CGVA 2ZV7A 4FZAB 4J97A 4YLJA 1FBNA 5BUIA 2ETKA 2QOIA 2XKDA 3PWDA 4EQCA 3IONA 4XCUA 2XP2A 3ETAA 2UW3A 4DYMA 4H3QA 1G8JA 2JDRA 3KVXA 5AP0A 3NNWA 3QRKA 1SM2A 3OFMA 3I60A 3O0GA 5AUVA 4FT0A 5K4IA 3B2TA 2EB2A 2PY3A 2JDSA 3FHRA 3PPKA 3AMAA 4QEBA 1OB3A 3O8PA 1P14A 3R1SA 2G15A 4QMVA 5AR2A 4QQTA 3OCBA 4LM5A 3QALE 4RFMA 3DNDA 3QQKA 4FTKA 4A4OA 4C2WA 3F82A 3C50A 2HXQA 2WO6A 3C4XA 4I23A 4U41A 5ETFA 3QTZA 4ZY4A 3QGWA 4IEBA 1HCLA 2PVFA 2ITNA 1CKJA 4OBOA 3TDWA 3WI6A 3VBWA 2FSLX 1GZNA 3OROA 1PXPA 4UMTA 5EG3A 5FXRA 3MJ2A 4YTCA 3MFRA 2HZIA 3AC1A 3EFJA 5DN3A 4MF0A 3VS7A 4FKTA 2P0CA 4BL1A 3LJ1A 2IG7A 4AN3A 3HRBA 1GZ8A 4AW0A 5KMKA 1GIJA 3LFDA 4TKSA 3QLGA 1YOJA 5HNGA 2JBOA 4NCTC 3GC9A 4AZEA 5K0KA 2UVYA 3KVWA 4JG6A 2DYLA 3SOCA 3II5A 4EHGA 2XIZA 3HMIA 3JUHA 3M2WA 2IVVA 1DI9A 3TV7A 3W0QA 1Q3WA 1IA8A 2XYNA 3I7BA 5HCXA 3M42A 2GTNA 3MV5A 4RIXA 4EOMA 2C3JA 3A7IA 2C6OA 3OOMA 2Y6MA 3MWUA 4FTUA 4NFMA 5ETCA 3AC5A 4QYFA 4YJRA 1OBDA 2YACA 5IQGA 4FV1A 5CZHA 3R9RA 3S00A 2ZMDA 4QMMA 4F9AA 1XJDA 3BGPA 2CDZA 4OAVB 3D2KA 2R7BA 3SD0A 2J0IA 2OF4A 5BMMA 3QTIA 3UVQA 2CKQA 2CLQA 5DMZA 3F5XA 4TW9A 5L2TA 1PRYA 4P2KA 2W4JA 4Z7HA 4MXZA 3LOKA 2IN6A 4HCUA 3DOGA 3A99A 4QOXA 2P4IA 2YEXA 3TM0A 4LFIA 1MQBA 2UV2A 4GFGA 2C69A 4TN6A 3RPVA 3UP2A 2YFXA 4BDGA 2YERA 2HW7A 2OIDA 3AD6A 4C4GA 5GZAA 2AQXA 2EUFB 3PE1A 4IADA 4A9RA 1ZMWA 1XMLA 4AXEA 3FMLA 4JBQA 1KV2A 4YBJA 3U4UA 2J50A 3MY1A 4A4LA 4C4IA 2VX3A 4FIFA 4IB0A 4NEUA 5DG5A 4F6WA 4GG7A 2B9HA 3DQWA 4OW8A 4CFVA 3E3BX 3PA4A 4HCVA 3R1YA 1H08A 2RL5A 2XNOA 4L67A 2B9JA 2QNJA 4IDTA 5KMOA 4DFZE 2XANA 4YHJA 5E1EA 1PF8A 2C4GA 4CKJA 3NNVA 1OKYA 3CQWA 2PSQA 3FV8A 4RVMA 2RFEA 3EQDA 3ZBXA 4MUQA 1WFCA 2Z7RA 4AOIA 1Z9XA 3ALNA 5FP6A 4ANOA 5KMIA 2BIYA 3FXWA 2XNEA 3SW4A 2HWPA 4JG8A 5D10A 4RJ4A 5F1ZA 4CRLA 3Q2JA 3UVRA 4M13A 4CV9A 3R0TA 2X4FA 4L8MA 3TZ9A 4EUTA 2YLFA 3GFEA 4HOKA 5ANOA 3IW5A 2IZSA 2KULA 1Q8WA 4RJ5A 4H3PA 1H01A 1ZYLA 5A4QA 3VN9A 1YQJA 4Y73A 4TTHB 4PPBA 2W0JA 5HHWA 3LFSA 4KIKB 3KN5A 2B0QA 5CWZA 2PU8A 3UODA 2XEYA 4YJVA 2O65A 4D2WA 3TL8A 3DJ7A 1F3MC 3R28A 2XH5A 4ZP5A 4BDJA 5CEMA 4JOAA 5A3XA 2V62A 4F0IA 5H9BA 1ND4A 4IAAA 3K3JA 2XK7A 3SHEA 3ZM4A 4H05A 2XCKA 3LVPA 4HPTE 4YTIA 4Y5HA 2GFSA 4PTCA 2W5AA 4E6QA 4F0FA 2UVZA 3C4EA 2R3MA 5FG8A 4DITA 3ORKA 3TUCA 3NX8A 4MBIA 3O96A 2YIWA 4KBAA 3HA8A 3ZDIA 3KULA 1PXKA 1YDRE 3R9OA 2UZLA 4I93A 2J0MB 2VWUA 2G9XA 3R8LA 4BCGA 4BBFA 3WF6A 3DXNA 4BBMA 5J9LA 2JKOA 3SVVA 3EFLA 4S31A 5H8EA 2X1NA 4ITIA 2J0JA 3LXPA 4F99A 1JBPE 2R0UA 3V5PA 1Q61A 5AM6A 3BYOA 4R77A 2CCIA 4CT1A 4ID7A 1E9HA 3F9NA 3PVUA 2E9PA 1TQMA 3G6GA 4DAWA 5CXHA 2BZIB 3CKXA 4PX6A 2XK4A 1OPJA 2H9VA 1ZMVA 1KE8A 3FHIA 3OY3A 4FK6A 3TN8A 3UPXA 4ZSEA 4BGHA 4ZMFA 4ZTSA 2P3GX 4RJ3A 4CG8A 2WMQA 3H3CA 4IBMA 4AFJA 3C7QA 5DFPA 3UOJA 2ZVAA 2C6IA 3A7GA 2WZJA 3KCKA 3UMWA 4D55A 2BAKA 3F6XA 1UKIA 3IO7A 4M8TA 3FQHA 2W1ZA 5E8XA 3TTIA 3RM7A 3OUKA 4GV1A 4U42A 4X0MA 3UTOA 4FNZA 2HENA 3C9WA 3PXRA