3CJFA

Crystal structure of vegfr2 in complex with a 3,4,5-trimethoxy aniline containing pyrimidine
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
298
structure length
276
Chain Sequence
CERLPYDASKWEFPRDRLNLGKPLGRGAFGQVIEADAFGIDKTATRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKKDFLTLEHLIYSFQVAKGMEFLASRKIHRDLAARNILLSEKNVVKIDLARDIYKPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery of 5-[[4-[(2,3-dimethyl-2H-indazol-6-yl)methylamino]-2-pyrimidinyl]amino]-2-methyl-benzenesulfonamide (Pazopanib), a novel and potent vascular endothelial growth factor receptor inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 276
sequence length 298
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cjfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cjfA01
4GFOA 3Q4TA 4K1BA 4AT3A 2J4ZA 4JX7A 2O63A 2WTIA 3RP9A 5AFVA 2R9SA 3HUCA 4GJ3A 3LFFA 2X4ZA 4HNIA 5D9HA 1ZARA 4KSQA 3LMGA 3D7TB 4FTKA 4BYIA 4FTQA 5DI1A 4DINA 3VBYA 2C6TA 4XLVA 3TV4A 4IM2A 5A4CA 2PE2A 4YO4A 4RFYA 4FK6A 4UXLA 3R8ZA 4EKLA 4CGAA 4J53A 4U3ZA 3OW3A 2QU6A 3V3VA 3HP2A 4U6RA 4RWIA 2PSQA 3L9LA 4L7FA 5BVEA 4HYUA 3D5XA 4RPVA 5F1ZA 5TO8A 5DNRA 1AGWA 5KMLA 4IM0A 2OJ9A 5DMZA 3NCZA 3WF9A 3O96A 4F4PA 3KMUA 3F5PA 3R1NA 2PVYA 3OT3A 4M0YA 5L3AA 5TF9A 4ACDA 3UIMA 4HVDA 3ENHA 2C3JA 1KE9A 1Q62A 3W2QA 1YXVA 1SMHA 3GOKA 2B9IA 2XIXA 4IX6A 3KMMA 4QPMA 1NW1A 3SXRA 2HY0A 3AC3A 4NM0A 1WVWA 3KK9A 4O0YA 5LMAA 4ASZA 2I0VA 3OXIA 4AX8A 4AXAA 4YUQA 3GNIB 4RGJA 3EN4A 4ANSA 2W99B 2VO3A 3A4OX 3CE3A 3IW7A 3NZ0A 2YDIA 4CFVA 4M0ZA 1UU8A 3VN9A 3MVHA 3EYGA 4FTTA 4IDVA 3FSKA 1JNKA 2XMYA 4QMTA 3OWPA 1SVGA 3FWQA 4R1VA 2CCHA 4F7JA 5JSMA 3FPMA 3CP9A 2YZAA 2QOLA 5FXQA 4JDJA 4L42A 4L46A 3W2OA 2BR1A 4A4OA 3VBQA 2G1TA 3LFQA 4ONAA 5F95A 5BVFA 4NYEA 1KE7A 3FZSA 5C1QB 5IEVA 4JT3A 5HG8A 5DG5A 3VRZA 5JFVA 2H34A 2CCIA 4CFMA 2HAKA 3VS7A 2BUJA 1WBNA 5HESA 3OVVA 1HCKA 2QI8A 2WMVA 3Q6WA 2YJRA 4BBMA 3H0ZA 5HNBA 4HNFA 4IWDA 1U4DA 1H1RA 2UV2A 4WNPA 5EW9A 3HDMA 3VS2A 2FO0A 3TJDA 2BZJA 2R3KA 3DAKA 2Y6OA 2YIYA 3L8XA 4NTSA 4U3YA 3OMVA 2OKRA 3RM7A 5CALA 2OZAA 2OICA 2C0OA 2IZUA 3PSDA 4IADA 5AP3A 2C5OA 2WXVA 4B7TA 3MFRA 5FTGA 5A4QA 3VW6A 1J1CA 3F5GA 2C1AA 4UMPA 4UMTA 2BCJA 3H9OA 3M1SA 5E90A 3VBWA 3IECA 3MVMA 3DBQA 3F3UA 4DFYA 1WMKA 3N51A 4EOJA 4HPUE 4FK3A 5HIBA 2E9NA 1R78A 2WTKB 3EB0A 1WAKA 1XBBA 2VWIA 2XB7A 3B2TA 3G0FA 4WUAA 4UWYA 3ZFYA 1PKDA 1FMKA 4GK3A 3FMHA 4AT4A 2DYLA 2PPQA 1ZOGA 4FVPA 3KF4A 5ETFA 2YLEA 4EYMA 1J7UA 3U54A 3RKBA 2CN5A 3ZXZA 2ZM4A 5BX0A 3TUBA 1H1PA 2CLQA 5LVNA 5DFPA 4OR5A 4ZTNA 4G3DA 4DFLA 5CU0A 4GYGA 2XKDA 4QNAA 5D10A 1FVRA 4FNWA 2C68A 1FMOE 4F9CA 5IDNA 3RI1A 5CEIA 3H3CA 5EG3A 4G9RA 4AS0A 4ZMEA 3JY9A 3P08A 2J7TA 3NUXA 3QYZA 3P4KA 4RVKA 1SM2A 4FSUA 4G6OA 4QMUA 4YBJA 5ETAA 3SX9A 2IPXA 4EH8A 2XKFA 4KIPA 4KUJA 4GUBA 2BIYA 3Q2JA 1Q3WA 2OO8X 3F66A 5A6NA 4YC3A 3R6XA 3HEGA 4EK6A 5FRIA 4DF3A 3ZONA 1XQZA 5J5TA 1REKA 3LFBA 4LRJA 2ZV8A 4G2FA 4QQTA 2Q0NA 4XG6A 5KNJA 4AOTA 3GC7A 2YWVA 2W17A 4DG2E 2CGVA 4IE9A 5AP7A 2WEVA 3RINA 3FI4A 3UDBA 3R63A 2BDJA 1W82A 4QP3A 4PQNA 3VUIA 5I9ZA 2BAQA 3EKKA 2YCSA 1H01A 3TWJA 5A3XA 4I5HA 4FNYA 2QG5A 3NSZA 4HYSA 4YU2A 5KE0A 4C59A 4FKVA 5E1SA 3HV4A 4D1SA 1VYZA 1G8AA 4UWBA 4BCIA 3LXKA 2BILB 2LGCA 4KSPA 4PTGA 2I1MA 3HV3A 4L67A 1B38A 1UNHA 3FKOA 2YCQA 2UW7A 3L8PA 4RA4A 1STCE 2P55A 5IISA 3NUAA 4UN0C 4IVCA 4LGHA 4WOVA 4PPCA 2VTIA 5H8GA 3FY2A 4TYIA 3R7IA 1Q4LA 3SOCA 3FLWA 4Q5EA 1Y91A 5KMMA 5IH4A 3MS9A 5CXHA 3TACA 2J2IB 4FIIA 3PY1A 3VUTA 5JKGA 5AJQA 4RVMA 3C50A 1VYWA 1YDSE 2GNIA 4UXQA 4QYHA 4WG4A 4Y83A 5HG5A 3ZEPA 4ACCA 3LFCA 3AC8A 5C8MA 3HRFA 5IZFA 2WQEA 4OW8A 4E6QA 1I44A 1FVVA 4EBVA 4C4IA 5I9VA 5EI2A 1IG1A 3FZRA 4NW6A 3BU3A 5KKRB 2VRXA 3OCTA 4ANQA 5FDPA 2PZ5A 4BKZA 3CKWA 4D4VA 3PDTA 2VO7A 5AV2A 3EQPA 5DGZA 5I9WA 3V01A 4C4FA 3AGMA 1BI7A 3ID6C 4DFUA 2V0DA 5HD4A 2QHNA 2CJMA 5CAOA 2WOUA 3G51A 3QL8A 3FJQE 2JDVA 2ZB0A 2ZAZA 3QBNA 5F20A 2O65A 4E4LA 4XP2A 3R00A 3BRBA 4GJ2A 4EQUA 2YCRA 3MH1A 4RJ8A 4IFGA 3QTUA 2UZBA 4F09A 2WHBA 1FINA 3AT2A 3EJ1A 4LL0A 3DKOA 4N6ZA 4D2WA 3TTIA 4N4SA 3KRRA 4EOSA 4JI9A 5L6PA 4ANNA 4DGOA 2J9MA 2EB2A 2Z7RA 3VC4A 4DFNA 2XNMA 3NIEA 1O6YA 2FVDA 3H9FA 4D9TA 3PIZA 3NGAA 2CGXA 3ORKA 3QTWA 2IN6A 3MTLA 4YJSA 3F3TA 3W32A 3ZTXA 4DAWA 1PXLA 4UY9A 4A4XA 1GZNA 4IAZA 4ZSLA 3U55A 5CI7A 4Y5QA 3ORIA 1H25A 3UOHA 3MI9A 3R8PA 1Q41A 5AM7A 3DDPA 4GW8A 4FE2A 1FGKA 5BVNA 3MFUA 5JMSA 3E88A 5M07A 3RHKA 3DAJA 5A46A 3DJ6A 3O2MA 4QNYA 1RE8A 4A9YA 4ZY5A 2X2KA 4CTCA 3O8TA 2JKKA 4K0YA 2NNWB 5I5ZA 4XBRA 5HHWA 4C37A 3REPA 3NR9A 4WRSA 1JPAA 2AUHA 3FI2A 1OIRA 2PYWA 2ITPA 3UTOA 3I5NA 1ZYSA 3QZGA 4QMYA 1KV1A 4G3FA 4CYJA 5HE0A 1UKIA 2DS1A 5FEDA 3SKCA 4OTPA 2OIQA 4DLJA 5LJJA 2VTSA 2HIWA 4R3RA 5BUEA 5AIRA 4BTJA 4G3EA 4C02A 2XH5A 3FXZA 2VNYA 3BV2A 3MY5A 2V7AA 3O17A 4MVFA 4O0SA 5AP1A 3QYWA 4QRCA 3ZC6A 4EH5A 5M56A 5IH5A 5DH3A 5L6WL 4ZTSA 1OL5A 3BU5A 4G9CA 1PXKA 4TL0A 2IW6A 3FV8A 4GVJA 4K11A 5D41A 3Q5IA 3E92A 3OXTA 3BZ3A 3PXZA 4CFFA 4F1TA 3BELA 3UC3A 3H10A 2ITUA 3GXLA 3KFAA 4ZXTA 4QMNA 3VIDA 2BAJA 5M57A 3GU6A 3ALNA 3C0GA 3QXPA 1E1XA 4P2KA 3TM0A 2XKEA 4OTQA 4J1RA 2B53A 4MX9A 5FLFA 5J9YA 2QOKA 2Z7QA 2R0IA 3BYUA 4IB1A 5EM7A 3VWAA 1XHAA 3HECA 4Y5HA 4B99A 3R04A 3OCGA 4S31A 3DXNA 1YWRA 4BBEA 4AOIA 2NRUA 4K77A 3A7JA 5AEPA 5GINE 2ZB1A 4YZDA 4DC2A 3WF6A 3RCDA 3Q60A 3HMMA 4Y73A 1R0PA 3RJCA 4QQ5A 4D58A 3PLAE 4RJ4A 5KMIA 1XH4A 4L68A 4FTMA 4C61A 5CEKA 4Z7GA 5I4NA 3PSCA 3T3UA 4D4SA 3AXWA 2OBJA 3KXZA 1BKXA 3HZTA 2FSMX 4L3JA 5DEYA 4C4HA 2WMBA 4AT5A 3SAYA 3ZBXA 4D2SA 2AYPA 3OWLA 4NWMA 3VBXA 5KBQA 4MQ2A 5IA4A 4FTIA 5DPVA 3A60A 5K0KA 1F5QA 5HICA 3TEIA 2V5QA 3ZU7A 4QP2A 2PULA 1Q8TA 1R0EA 3OEZA 4RMZA 4F6WA 3SXSA 4U40A 4LV5A 4L52A 5HE3A 3H30A 3PTGA 3SD0A 3FQHA 3IOPA 4JQ8A 4BI1A 2OF2A 5FDXA 4E4NA 3KREA 5BYLA 3FHRA 2WTJA 4EZ5A 4O0XA 5JK3A 3PZHA 3RMFA 4E4MA 3GOPA 1YVJA 1UU9A 2VTJA 3IQ7A 3PVWA 4FZDB 3GC9A 4GU9A 1JWHA 2W7XA 2GS6A 2VTMA 3OZ6A 3DCVA 4AW1A 3ZCLA 1ZMWA 3V5QA 4AFEA 4R77A 2XIRA 4KNBA 2UVXA 3D5UA 3QXOA 5AX9A 4QMZA 4W4YA 3W1FA 3ACJA 3PY0A 3KB7A 3LCOA 2F49A 3QKKA 5KMNA 3FYKX 3IW8A 3KRLA 4PMTA 3RPSA 3V51A 4FL3A 5ETIA 3R01A 1BYGA 4K2RA 4AN9A 2R3FA 3SRVB 4AOJA 4JRNA 4IC8A 3UVRA 1MRVA 4ZTHA 3NWWA 5J7HA 4N6YA 4QTAA 3NAYA 4GVAA 3BYMA 2WMAA 4A9SA 1FPUA 4LI5A 1JKKA 3NNUA 3M11A 2W4JA 4C2VA 3O50A 1UU7A 1S9JA 4QQJA 4IBMA 4CEGA 5LQFA 4GK2A 2YM4A 4FTNA 1JOWB 4EK3A 4N0SA 2JIIA 3FZTA 4DE4A 2WEIA 1JVPP 3EHAA 4O2PA 2P2HA 1ZRZA 2P2IA 4ANOA 3QRKA 2OFUA 2QKWB 4RX8A 2WGJA 3UC4A 2OJJA 4IJPA 2NPQA 3SDJA 3C1XA 3R2BA 3BHYA 4GH2A 3ZZWA 3UQGA 2WU6A 3EQHA 3DTCA 3A7HA 3E8DA 4RJ5A 3TKUA 3HGKA 4TTHB 5ANJA 3BPRA 4DEEA 3U4WA 4R7IA 4FSQA 4PTEA 2QVSE 3KRWA 5M08A 4CFNA 5GIOE 2XNOA 2JITA 3DKGA 2OZAB 3A61A 3GEQA 2R3RA 4MXXA 4XEYA 4DFXE 1PYEA 2BZKB 2WMTA 4GL9A 5JQ8A 4EH4A 4L3LA 3ELJA 5I9XA 3TTJA 4FV4A 3SG8A 3JR1A 1YOLA 5EM5A 5JGDA 1WCCA 5LXMA 3FLSA 4MH7A 3OEFX 5HCZA 4C3RA 3AMYA 5HIEA 3P79A 2PZRA 2C6DA 2G2HA 2HELA 3PG3A 5FM2A 3GCSA 4F64A 3CTJA 5E8UA 5GZ8A 3IONA 2JDTA 3UQFA 2OH0E 3QWKA 2CGUA 4YTHA 3ANQA 4XX9A 3AC4A 5A4LA 5AP5A 3D9VA 5H9BA 2VTAA 4HVIA 1W98A 2PVHA 3CQEA 1MRUA 3IO7A 4PDPA 5CYIA 3FAAA 2ZMDA 2VGPA 3NX8A 5L8LA 2I0EA 3BYOA 3V8SA 1WZYA 4I92A 2FA2A 2QHMA 4BDEA 3RZBA 3EFKA 4EK4A 3OHTA 3FSFA 3AC1A 3UMXA 4CMUA 1PXIA 3AD5A 4RZWA 4DFBA 1K3AA 3MB6A 4J71A 4PL3A 3EQBA 4O2ZA 3DPKA 2X8IA 5T3QA 3BHTA 3PPJA 3WF7A 2XEYA 2QO7A 4JG6A 4AZWA 1RQQA 3NVMB 4AE9A 3PVGA 3RWPA 4KBKA 2R3MA 2BHEA 4FOCA 3ZH8A 4KINA 3OUNB 3HLLA 3FMLA 4QMMA 5IA1A 4QTDA 1H00A 5EDPA 3G2FA 5HU3A 1J3HA 4D2VA 4RFMA 2YABA 5I0BA 1OI9A 5LWNA 3R71A 4F6SA 4A9RA 2X2MA 3NYXA 4ZMFA 4BR3A 3E5AA 1OB3A 4XJ0A 5DE2A 4BL1A 3CBLA 3LJ0A 2OK1A 4FT7A 4OTFA 4BDDA 3QCXA 4D5KA 5J1VA 3E7OA 4TY1A 5CAPA 3LFNA 4EYJA 1IASA 3QHRA 4WA9A 4ZS0A 4YJUA 5E8VA 3ZO4A 4ANMA 4EWQA 4TNBA 1H1SA 4DTBA 4MXOA 3LMIA 3WF8A 4O7ZA 2R3QA 1LP4A 4NTTA 4HGLA 3ZSGA 2UZDA 3IS5A 4IZ7A 3T9TA 3AD4A 4GT4A 2QG7A 2W9ZB 1GIJA 1U59A 3NEWA 3W16A 5H3QA 1OGUA 2W1ZA 1XBAA 3DU8A 4FR4A 4IZ5A 3F69A 3NS9A 2WKMA 3ACKA 3O51A 4FBXA 4I0RA 4RWLA 5CANA 1PMUA 3WARA 3D0EA 4K33A 2W1IA 1PJKA 4XBUA 3F7WA 4BCFA 3R8LA 4U79A 3RZFA 2FSOX 2ERKA 3VAPA 3IG7A 4OLIA 5HKMA 4D2TA 3GCUA 4EOPA 3RAKA 1PXJA 3BKBA 4BZDA 3PSBA 5E1EA 1ZY5A 4GT5A 1UNGA 4Z7HA 3QQKA 4EOOA 4B4LA 4BCGA 3EIDA 2VTRA 1W84A 3EKNA 2IVUA 2UZLA 5TT7A 4KIKA 3OY3A 2VN9A 2R7IA 2UVYA 3F7ZA 2HXLA 2UW6A 2VX1A 4MHAA 4QP6A 4BIEA 4BY9E 1Q8YA 3QGWA 3WYXA 5CAQA 2X2LA 4USEA 3RM6A 2BVAA 2G2FA 4MXCA 4DA5A 4GU6A 4X3FA 4QTEA 2RIOA 3GU4A 2KULA 4IWQA 4FV7A 3V5JA 3LQ3A 1I09A 5DBXA 2VWYA 5I3OA 2XJ2A 4F9WA 3IDPA 3UPZA 5CAUA 5IQIA 1M7NA 3DBEA 3KULB 2XK4A 2QU5A 3NUSA 2QOBA 4FV5A 4MCVA 1B6CB 3P5KA 3R7UA 4PMPA 1OKVA 3M42A 4NFNA 3OP5A 2HY81 5BVWA 5TR6A 3S95A 4AGUA 4O22A 3LQ5A 3E87A 5B2LA 4U0IA 4L53A 3QTIA 3G33A 4FOBA 4JVGA 3R8VA 2VWVA 4WNMA 4RX5A 3RAWA 2G15A 3MIAA 2IJMA 4EONA 4A4LA 3W8LA 2BZHB 4A7CA 2WMUA 3C4ZA 2V7OA 4ITIA 4XHKB 4XNEA 4IX5A 4BB4A 1IAJA 2GNJA 5L4QA 4BN1A 5C26A 3TIYA 4XRJA 3KVXA 3SOAA 5KX8A 3F3WA 1A9UA 2QCSA 3P0MA 4RT7A 3W2SA 1QMZA 4DN5A 3S00A 3SXFA 1Q3DA 2W1GA 3EQDA 4M3QA 1K2PA 3BBTB 1P14A 1Q8ZA 5AA8A 4DG0E 3LAUA 5IH6A 2B1PA 3IPHA 3FL5A 3QD4A 4FV0A 2OXYA 5KUPA 2GHLA 2EXEA 4Z3VA 2ESMA 1OZ1A 2WTDA 4GIIA 4CV9A 4M68A 1ATPE 4MF0A 3LXPA 2VWUA 4TW9A 4BZOA 4RVTA 3ENMA 4RIWA 5A6OA 2GDOA 4F6UA 5C9CA 5IA2A 3CPBA 5FBNC 1YI3A 3FMDA 4IAIA 5CZHA 4FF8A 4BCJA 3FHIA 1J91A 4HGTA 2VZ6A 4GS6A 3QA0A 5EYCA 1Z5MA 2W1EA 1SNUA 4PTCA 2PVLA 2XJ0A 1JAMA 5CF8A 2JFMA 2ZDUA 5B0XA 3KXNA 3KU2A 3DFAA 2PZPA 3OCSA 4UMRA 2VO6A 4JR3A 3H4JA 3ZYAA 3LMHA 2QOCA 2PL0A 1PHKA 3PXKA 4MD7E 3NUNA 3U9CA 4UX9A 4FZFB 1L3RE 3MB7A 3KF7A 4I0SA 5AMNA 3QRUA 2FB8A 4FT0A 5HO6A 1J7IA 2C6OA 3BWJA 4I21A 1KWPA 3IDBA 4BCHA 3FC2A 4PX6A 4AW2A 4C35A 3JPVA 1DM2A 3MESA 2VX3A 3R8UA 2O2UA 2IG7A 3KCKA 4Q2AA 4X3FC 4OTIA 1KSWA 4ALVA 2C5NA 3R21A 4NK9A 2AC3A 3Q32A 4X6RA 1ZZLA 3BHVA 3QF9A 5AR5A 4BCPA 5AAEA 5CU4A 3OW4A 4C38A 1O6KA 3LE6A 2GQSA 5K4JA 5AIKA 2PMOX 4GIHA 4CRSA 5E4HA 3R9NA 4I20A 4ERKA 1Y6BA 3SG9A 4LMUA 4FODA 3EL8A 4IACA 4BKJA 5JZJA 2R3LA 1YRPA 4DT8A 3QQUA 4L8MA 5EYKA 1OPKA 5C01A 2RL5A 2QONA 2VU3A 3A4PA 3SRVA 4QT1A 4BDAA 2B54A 5LMKC 5DRBA 4FNZA 3CQWA 2C3KA 4QYFA 1LUFA 2OH4A 3PE1A 5DT3A 5AUWA 2YEXA 4DBXA 3UOJA 4S2ZA 4AP7A 2YM8A 3PE2A 5CNOA 3QCSA 5EM6A 5BNJA 4ZS4A 2VAGA 5LCJA 4E6CA 5HO7A 4ZK5A 2O64A 1V1KA 3RPYA 3I1AA 3BQCA 4JDIA 4DH5A 2Y4IC 4UALA 2W1DA 3OFMA 1WVXA 2QURA 4L45A 3OUKA 3QQLA 4ALWA 4F0FA 2BRBA 3U6HA 3LCSA 4O1PA 4U8ZA 3FEGA 4FKOA 3LW0A 4FV8A 4P90A 3U9NA 3C4EA 4EUTA 2VTTA 4BCNA 3CQUA 2G01A 2A0CX 3HA6A 4ANLA 4LRMA 2R5TA 4OUCA 4R7BA 2ITWA 3MWUA 2UW0A 4X2FA 2OIDA 2VV9A 4KD1A 4W4XA 4X3JA 4C2WA 4DEHA 2H8HA 4DCAA 3ORPA 3QHWA 5CSHA 1YOJA 4AN2A 2J0JA 3BGPA 1FQ1B 4OTGA 4XYFA 1OL6A 1REJA 2Z2WA 4CZUA 3B8RA 3NCGA 4K18A 3KL8A 1XH6A 3F9NA 4OBOA 4U43A 4O81A 3ULIA 5E92A 4M15A 1ZOEA 3GBZA 3TCPA 3ZC5A 2OJIA 1V0BA 5AM6A 4YHJA 4BDBA 3D2IA 3F88A 3QWJA 5CSWA 4ZJJA 4AAAA 3EN6A 5CXZA 2WAJA 4FKUA 4IWPA 3PXRA 3QRTA 4J7BA 3DXQA 3RPOA 4YJTA 3V5TA 5EOBA 3FPQA 4ACHA 4DEDA 2PE0A 3FI3A 4QYEA 5EYDA 4LGGA 5ANGA 3NUYA 2PMNX 5J7BA 3CC6A 4LQMA 5AV1A 2OZOA 3FDNA 2YHVA 1BLXA 2W5HA 1M2QA 2RG6A 3MA3A 5F9EA 2PMLX 3R7EA 4FEXA 2PTKA 4O82A 4Y46A 5C03A 3GU5A 3VO3A 1O6LA 4V04A 4ZSEA 4F65A 4R6VA 3CTQA 4EK8A 4KA3A 4S34A 1YQJA 4ZJVA 1U46A 2ZV7A 3EL7A 4FKLA 3DGKA 3U8WA 3MVJA 4BHNA 3Q2MA 4HZSA 4F9AA 5M09A 1XBCA 3CEKA 5EHLA 4FUYA 3CS9A 3OWKA 1Q61A 2B9FA 2FSTX 2IVSA 4J96A 3BGQA 2X9FA 3IOKA 1G3NA 3P23A 4HCTA 2IVVA 4BDJA 2C4GA 3TUCA 4RWKA 1OIQA 1YWNA 3QA8A 3ORLA 4ZTMA 4JAJA 5A4EA 4XG2A 4PY1A 2QR8A 3TV7A 1KE5A 4FV1A 4TYGA 4I6BA 1SNXA 4ZSJA 3T8OA 1PRYA 4JIAA 3E8CA 4ZSGA 2ZV9A 4KS7A 5AX3A 5IKWA 2X39A 4ZZOA 3BI6A 4MXZA 2GNGA 4YHFA 2RSVA 5B2MA 4FV3A 1OVEA 2B52A 4FIJA 2HOGA 3W2CA 3EZRA 1PMEA 1T46A 1FOTA 4WIHA 4BDHA 5HVKA 1JKSA 3QQGA 4GYIA 4U5JA 3T9IA 3DXPA 4O7YA 2PE1A 2O0UA 2YISA 3MH3A 4FSMA 4KWPA 1H4LA 3FUPA 3VRYA 4DEIA 5GZAA 4AA5A 4FEUA 1SVEA 2Z8CA 2B55A 3G15A 4KKHA 3L8VA 1AQ1A 4YLJA 4IMYA 4NW5A 4F70A 4TWPA 3DDQA 2QODA 4U97A 2BFXA 4V0GA 4I4FA 5CEOA 4Y8DA 4YO6A 2YDJA 5EI6A 4CFWA 5IEXA 3AQVA 3R1SA 4NM3A 1GY3A 4XOZA 3OXZA 1CKJA 4WT6A 2GTMA 4YJPA 1M7QA 3BLQA 3PP1A 3VUMA 5JH6A 3D15A 4E1ZA 1H08A 3EZVA 2X6DA 4A9UA 4RZVA 3EYHA 4AA0A 4O38A 4FEVA 1H07A 3EQCA 1KE8A 2F2UA 4O21A 3ZLSA 1IA9A 4AGDA 3NAXA 1OITA 1UNLA 5HCXA 4MAOA 5CSVA 3GP0A 1YW2A 3PYYA 1JSVA 4FKGA 4IB3A 4NU1A 4OTRA 3AGLA 3ZHPC 5ICPA 3KY2A 4H1MA 3FLQA 3DJ7A 4FG8A 4ZIMA 4PMMA 3O23A 2BKZA 4RX7A 4CLIA 4BKYA 3MBLA 4FIFA 3GCVA 2WQMA 4Q9SA 5FP6A 3QFVA 4PRJA 3ZSHA 4CZYB 5A54A 4GSBA 3WOWA 5IQBA 1YHSA 4XLIA 5KO1A 4HGEA 2QO2A 4QD6A 3KULA 4MF1A 4A06A 4JQ7A 1BL7A 4PDOA 4F7LA 3OOGA 3R0TA 3W55A 3OD6X 3PXFA 2J0IA 4Y95A 5HZNA 2YAKA 5AUZA 4EH6A 4GKIA 2CLXA 4M69A 4DH7A 1CM8A 3C13A 4LRKA 5AADA 1H1QA 1NA7A 1QPEA 5EKNA 2O3PA 2JFLA 4JG8A 2PUIA 4EOMA 4RSSA 4R5SA 3S3IA 3SV0A 2E9PA 2PUNA 4RC3A 5EDRA 4XG9A 4GKHA 2BRMA 4IX4A 2HWPA 5C27A 2X4FA 4WBBB 5AP6A 4CKIA 3EFJA 2Y4PA 3QQFA 4FSYA 4GT3A 5ACKA 3Q04A 1H0VA 4ANBA 5HLNA 4I1ZA 5J8IA 2OXDA 3S1HA 4O84A 4FZ6A 4IVBA 2C0TA 1WBPA 4KIKB 2XRWA 5BVOA 2VWXA 4O86A 5BVKA 4LGDA 5G6VA 3IGGA 3HRBA 3W33A 3HP5A 5HO8A 1YDTE 3VW8A 3VS0A 2C5XA 3F3ZA 3LVPA 4X3FB 3FLZA 2VTQA 2F9GA 3OWJA 5CSPA 4F63A 3WZEA 2R4BA 4QMQA 4R7HA 4IWOA 4W8DA 4O91A 4YZNA 2UZVA 2WIHA 3I79A 4X2KA 3NLBA 3PFQA 1CKPA 4EJ7A 4FYOA 4WG3A 2VWBA 3MDYA 2RGPA 4HPTE 4DCEA 5ANIA 5ACBC 4YZCA 3L9MA 4JOAA 3Q52A 5KZ0A 2E9UA 3MVLA 3C0HA 5FBOA 5CU2A 3ZLYA 2ITNA 2R3PA 3MIYA 2A4LA 4FTJA 3A7FA 4IANA 1AD5A 5DWRA 2ITZA 3OF0A 4F9YA 1ERKA 1DI8A 3UIXA 3EN5A 2JD5A 4KS8A 1QL6A 4RJ6A 2DWBA 3OT8A 4EWHA 2B4SB 4TKSA 4D4YA 4U45A 4XCUA 3PPKA 2GSFA 2BHHA 3BLRA 1NVSA 3ATTA 3FQEA 3HRCA 2ZJWA 3I7BA 3FQSA 4EI4A 3E8EA 5KHWA 3TN8A 5T68A 2C6EA 2FGIA 4DT9A 3ZUTA 4P7EA 4F9BA 5M4CA 4G5PA 3UPXA 4MBLA 5LVPA 4XUFA 2X7GA 3EQFA 2Y4IB 2BPMA 5JT2A 4FL2A 2X7FA 3KXXA 5L2SA 4FKRA 3GC8A 1ZOHA 2IWIA 3KMWA 3I4BA 4E93A 2OWBA 3PP0A 4YSMA 4UB7A 1GIHA 1F3MC 2WQBA 3TNHA 4MWIA 3GT8A 5CEMA 4RIWB 3ET7A 3F2NA 5KMOA 1UVRA 3LHJA 3QZFA 3V04A 5M4UA 5DRDA 2JIVA 4C3PA 3COKA 2JBOA 4U81A 1A48A 3C0IA 2J51A 4YJQA 4C33A 1M14A 5E8ZA 4FKTA 2YACA 5J87A 3NYVA 5DR9A 3VJOA 1BMKA 4MNEB 4E20A 4E73A 2VO0A 1Q24A 5FXSA 2ITOA 4ASXA 3HV7A 4RIYB 5K5NA 2I7QA 3QD0A 4CFXA 5EHOA 3ITZA 5L2TA 5CWZA 4K6ZA 2R2PA 4YURA 2UZEA 3C4WA 3AOXA 2WMXA 2E2BA 4JBVA 4V05A 3W2RA 3ETAA 4S30A 3VF8A 1GZKA 1ZWSA 3Q3BA 4QP7A 4RWJA 4A07A 1Y8GA 4H39A 4RIXA 4YJNA 4XS2A 3UG2A 5IQAA 2W1CA 4GMYA 4TWNA 3HV6A 1OL2A 2QOFA 4PWNA 4ZJIA 3VS3A 5FEEA 4U44A 1OM1A 4PMSA 4I5PA 3EN7A 2ONLC 2J5FA 2OJGA 2BRHA 5CQUA 5FWKK 5L8JA 3P86A 1T45A 2E9OA 4FTLA 4QMSA 5ANDA 3OY1A 2CKQA 4HVHA 4YTCA 4I5CA 4RC4A 2VTNA 4C7TA 1U5RA 4EC9A 3LCDA 2A19B 2R3GA 4KABA 3SHEA 4FGRA 1TKIA 2WQNA 2R7BA 4QP8A 4H05A 3MFTA 3Q9XA 2WTCA 4IHPA 4BCOA 4GRBA 4ITHA 4JL9A 5B7VA 3PUPA 2X0GA 2XYNA 3QC9A 2WB8A 2C3LA 3AT4A 3HDNA 4JRVA 4YPDA 3MA6A 2VWZA 1XH7A 1URCA 3QTZA 4BTMA 2JAMA 2H9VA 4MBIA 4GUEA 4PF4A 5C4KA 2QC6A 2YERA 2EUFB 3DTWA 5AR4A 5J1WA 3AMBA 2XM9A 5H8BA 1GZOA 1RDQE 3I6UA 4XMOA 3MW1A 3PWDA 3R8MA 2RFDA 4M7IA 4QMXA 3RK5A 4O7TA 4RIOA 5AA9A 1JBPE 1H24A 4FX3A 3LFDA 4JJRA 2YCFA 2PUUA 4NCTA 4BF2A 4UMUA 3TDVA 2ZM3A 2QD9A 1YI4A 5LVLA 2XS0A 3DBCA 3A8XA 2ZOQA 4IH8A 4G6LA 4YGAA 3FBVA 2WU7A 3DT1A 2R0UA 5HLWA 5BPYA 2XRUA 4EOIA 4ITJA 4Z16A 3K2LA 2QR7A 3QUPA 2ZYBA 5L2IA 5CU3A 4ARKA 5C4LA 3LJ1A 5HG7A 3NYOA 4E4XA 2BRNA 4P5ZA 1P5EA 3RPRA 4YC6A 2C30A 2YITA 1U54A 3PXYA 5EH0A 4L6QA 4I4EA 5DT4A 5EW3A 1PY5A 5EYMA 2VTHA 5CTPA 4BGHA 3UODA 4BZNA 4EKKA 4KB8A 3SC1A 4C62A 5IDPA 3KEXA 4HW7A 3ALOA 3EFWA 3MGYA 4MQ1A 4HJOA 3TNQB 1R39A 4IJ9A 4AZVA 3NUPA 4DGGA 4M14A 5CEQA 2Z02A 5DA3A 3QCYA 4HCVA 3TDWA 4HZRA 5CY3A 4DH1A 4C34A 2QOQA 2XYUA 4I6FA 4BC6A 4G17A 1CKIA 2UW5A 1YXUA 3ZZEA 2CNVA 5IUIA 3BYSA 3RVGA 4PP7A 2F4JA 2XEZA 4O1OA 4YHTA 3RNYA 4MBJA 4KRDA 3S0OA 4O6LA 2P0CA 5M06A 3THBA 3P78A 4FTUA 4D4RA 3DAEA 4YZMA 4RQKA 4EH9A 2UW3A 2EU9A 1YDRE 2XK7A 3HMNA 1X8BA 5IUHA 5E8YA 5AR2A 4YTFA 3H9RA 1PMVA 2C5VA 3V6SA 3DZOA 3P7BA 2NO3A 4QOXA 4XG7A 4C3FA 2YM5A 4IB5A 3R7OA 3R9RA 4O7NA 3PA3A 4E5BA 2GMXA 2PVJA 3FMNA 3KA0A 4PNKA 2OG8A 4BI2A 3LKMA 2HWOA 1W83A 3P7CA 2GFCA 4UMQA 4IDTA 4WKQA 2I6LA 4XV9A 1OBGA 3CTHA 4I0TA 4CCBA 4BCMA 5T6KA 3R1YA 1H1WA 2QOOA 3HKOA 1XO2B 3CR0A 4PV0A 2XNPA 2GTNA 1YXXA 4IZAA 4TNDA 3SVVA 3BV3A 3MSSA 3VBVA 5CS6A 3HAVA 2RFSA 4FV9A 4F7NA 5JQ5A 1YKRA 4ZY6A 3OOMA 3DOGA 1ZMVA 2PZYA 1PKGA 2HYYA 5GJDA 4NCTC 3FC1X 4OBPA 1Q8WA 1YXTA 3UP7A 4FYNA 4JIKA 5GJGA 5HIDA 3VUKA 5BYYA 3A7GA 5GHVA 5EW8A 4W9WA 5FTQA 3ZXTA 3E64A 4NEUA 4UYNA 2XK6A 3ODYX 5DR6A 1WBVA 5IG1A 3NMUF 1JQHA 4EEVA 4IFCA 5HOAA 2YIXA 4OTWA 5EI8A 3KXMA 4H3PA 3R7YA 2FYSA 4H3QA 4I3ZA 2HZNA 3ZUVA 3U6JA 2W06A 4X2GA 3FXWA 5IUGA 5JFXA 3UZPA 3ERKA 3OTVA 2LAVA 2AC5A 1G8SA 4AA4A 4ZLZA 4E26A 5TOZA 3QTSA 5LCKA 4BDGA 4BCKA 1TQPA 1NT2A 2HZ0A 4FKQA 3GQLA 3CGOA 4O0UA 4II5A 4EK5A 2JKMA 2BZIB 3BWFA 1W8CA 3DZQA 3E8NA 4QMLA 4APCA 4Q5HA 4V0GB 3ZUUA 2UZOA 3N9XA 4DTKA 4USFA 2B9JA 3KC3A 5A9UA 3R2YA 1R1WA 3ZO1A 4XG8A 1OUKA 2EWAA 3CD8A 4FV6A 4C8BA 3VJNA 5CF6A 2UZNA 3R02A 2QLUA 4LFIA 2REIA 3C9WA 1W0XC 1OPLA 3LCTA 4QYYA 3TL8A 3FLYA 3Q9WA 3FL4A 3KCFA 5IQHA 2UUEA 3KVWA 4FUXA 4XV2A 3V5WA 1TQMA 3E93A 3VQHA 3CY3A 5IQDA 4IAYA 4CT2A 4YNOA 4PDSA 3PG1A 4AG8A 2OIBA 4M66A 3Q9YA 3Q4UA 2C6KA 2YIWA 3KKVA 4RLKA 4BVUA 4D1ZA 3D7ZA 1JSUA 3W2PA 3Q5ZA 3F82A 3BHUA 3KXGA 4YTIA 3WF5A 3PRFA 5KZIA 1XH9A 3Q6UA 2CGWA 2YJSA 4G34A 1Y6AA 3MY1A 1PYXA 3NNVA 5J79A 4QYGA 1VZOA 4AZSA 3H0YA 1OKYA 5HI2A 4YJVA 5M4FA 5J95A 1JKTA 3ZRKA 1M52A 1W7HA 2WMQA 5DR2A 4O0TA 3PPZA 3N4UA 1DS5A 4TYEA 1V0PA 2I0YA 3UQCA 2WZJA 5HU9A 3HYHA 3UGCA 1RJBA 2OXXA 3UO4A 1FBNA 3PY3A 4M69B 4Z55A 5TE0A 3CD3A 4TWOA 3R83A 4D55A 4G6NA 4JBQA 1SYKA 3TNWA 3O0GA 4BIBA 1ZYDA 5IQFA 4XG4A 5LMKA 5IF1A 3QCQA 3UYTA 4ERWA 2JDRA 2W1HA 1BUHA 3L9NA 2CKOA 2GS2A 4FTAA 1KV2A 1UV5A 5EM8A 5AAFA 4EZ3A 5HQ0A 4C4EA 4CNHA 5HEZA 1GOLA 2YZLA 1DI9A 3EQGA 3F5UA 3SW7A 4M97A 4LOOA 1M2PA 2YAAA 1TVOA 4EOLA 2XNNA 4OTHA 5JGBA 3W18A 4F0IA 2GNLA 2XBAA 4J98A 3O8PA 4W8EA 4D28A 4RX9A 3E3PA 3ANRA 1H8FA 3EH9A 4LYNA 4TT7A 3ZFMA 4ASEA 4WNKA 4RLLA 3I6WA 2OGVA 3V5LA 4QPSA 3P7AA 3EN9A 4J97A 1OECA 3FMKA 4NFMA 4PP9A 3ZRLA 3FZ1A 3PRIA 3E63A 3HL7A 4OTDA 5IMXA 5HVYA 5LVMA 5EQPA 3POOA 4FIHA 3EQRA 2PVRA 4QPAA 4QTBA 5DEWA 4H3BA 1YOMA 5AP2A 3W8QA 4AW0A 2WFYA 4P4CA 3TNPC 3COIA 2FH9A 3WE4A 1H27A 3TZMA 4MNEA 5FP5A 2J50A 3DS6A 3LCKA 3ZM9A 4JBOA 1YHWA 3IDCA 3L1SA 4RIYA 4UZHA 4DFZE 3E7VA 1ZAOA 2P33A 4OGRA 5EK7A 1UWJA 4J52A 2X7OA 3QUEA 3D14A 5AUXA 3QD3A 4FEWA 4OAUC 3AD6A 2B7AA 3RPVA 5CVFA 3WIKA 4R1YA 1GIIA 4IAKA 4ENXA 5GJFA 3QKLA 4CRLA 3JVRA 2YM7A 1GAGA 3P1AA 4JR7A 5BUIA 3PWYA 2YM3A 4G31A 5HBEA 4FEQA 3OCBA 4Z9LA 4MTAA 2ITVA 2Y0AA 3TJCA 2YWPA 2PHKA 3BU6A 4EL9A 4JBPA 4JG7A 4RRVA 2W0JA 5CT0A 2PZIA 4ZZNA 3WILA 2YIRA 4O0RA 4LUDA 3EQIA 3LFSA 4F7SA 4ZLOA 4MNFA 4AZFA 4QMOA 2GS7A 4DGLC 3CLYA 2GHMA 4TN6A 3G90X 2BIKB 1CSNA 3PJCA 4GG5A 3DLSA 3LZBA 3MJ1A 3QTXA 4D2PA 4FMQA 4TWCA 1XH5A 1ZXEA 3FKLA 4FSNA 4IVAA 2JKOA 3W10A 3O71A 5CEPA 5IQGA 3UJGA 2DUVA 4BWXA 5J5SA 4EH2A 2XKCA 5AUTA 1A06A 2OF4A 4JQEA 2XJ1A 2GCDA 3FMJA 4AUAA 2O5KA 3DKFA 4IAFA 4EOKA 3EFLA 4YJOA 3BCEA 4CVAA 2J5EA 1Y8YA 2OLCA 2WELA 1NXKA 2BROA 3RAHA 5AUVA 2C6LA 4RIXB 1PW2A 2PVNA 4X21A 1DAWA 4AE6A 2X81A 5CF4A 3BEGA 5AUUA 2C6MA 4JDKA 3LXNA 3NNWA 2RKUA 1CMKE 2HZ4A 3NNXA 3R7GA 3O7LD 4LL5A 4C58A 3EWHA 3UNZA 3F6XA 4FT5A 4JAIA 5J9LA 1P4FA 2G9XA 2EVAA 4ALUA 4CKJA 5AR8A 5FQDC 4TPTA 4CZTA 3DBDA 2HENA 2Z60A 3SA0A 2XM8A 3LOKA 2IW9A 5DVRA 1IR3A 4NJDA 4O7WA 3DQWA 3GFWA 3QGYA 5CVGA 3QZIA 4EHEA 3TZ8A 4I5MA 3II5A 2CHLA 1WBSA 4G3GA 4XP3A 3D2KA 4AQCA 3RK9A 1SZMA 3DLZA 4H1JA 3RK7A 3JYAA 4BIDA 4WD5A 3ZSIA 3BGZA 3ATSA 4YLLA 5IA0A 2VTLA 3JVSA 4L9IA 3G6HA 3LQ8A 4EHVA 4O0WA 3S2PA 2JDOA 5AWMA 4ENYA 5A14A 4ZEGA 4L7SA 2QOIA 4GFMA 2XNEA 1OPJA 2X1NA 1IAHA 4GFGA 5HNGA 5HBHA 1ZZ2A 4DITA 4YSJA 4WO5A 5D12A 3UZTA 4K8AA 3AC5A 2B0QA 3GQIA 3QD2B 4FI1A 3RHXA 4EQCA 1YWVA 2VD5A 3UIBA 1ZMUA 2X9EA 3MFSA 3M2WA 4WG5A 3COMA 1NY3A 3Q96A 4UWCA 4D9UA 4TYHB 5IA5A 3Q9ZA 4NIFA 4I24A 2C5YA 3G9LX 4OT5A 2CMWA 3BLHA 4U9AA 4FIEA 2OI4X 5CF5A 1NVQA 5EQEA 4EHGA 3AT3A 3DFCB 4NM5A 3LFAA 3HA8A 2WO6A 4PNIA 2BMCA 3CJGA 1XH8A 3BQRA 3VULA 1U54B 3AMAA 5CQWA 4FSTA 4CQEA 3MH2A 3NW6A 3DV3A 4MEDA 4NT4A 5I9YA 2WMWA 3DBFA 3FLNC 2BDWA 3FYJX 5LARA 3WIGA 4KRCA 4B9DA 5TKDA 4MXAA 3IW4A 3LLTA 4ZLYA 5GIPE 3FY0A 2R64A 3GGFA 2A27A 3BEAA 3PZEA 4K9YA 4AGWA 2BFYA 2GU8A 3E3BX 4FSRA 4YPSA 3P9JA 4U7ZA 3D4QA 3JUHA 3LM0A 3O8UA 1MQ4A 5GNKA 5KMKA 3ORZA 4DHFA 3G6GA 5HG9A 3UOKA 3IGOA 3GENA 2ZM1A 4YLKA 2J0LA 3K5VA 4WUNA 2W4KA 4XOYA 4BTKA 1H0WA 4B8MA 4O96A 4O7RA 2C6IA 4FKWA 3UOLA 3TI1A 4AW5A 5J9ZA 2PVMA 4DH8A 4IZYA 2UZUE 4O27B 4MK0A 3UNKA 2XNGA 5CZIA 4EUUA 4LM5A 4EH7A 3QTRA 4D0XA 2EXMA 4FICA 1R3CA 5JGAA 4NUSA 2EXCX 2JGZA 3PJ8A 2W96B 3WYYA 4ZY4A 5HORA 4CTBA 1URWA 2W05A 3FXXA 2ITYA 1LEZA 3DB6A 3MYGA 4NSTA 4O83A 3NIZA 4EQMA 3DA6A 4BBFA 3RALA 3QAME 1JKLA 5CASA 3K54A 4FZAB 4UV0A 3DNEA 3R22A 3R9HA 2V55A 3VS5A 4EH3A 4N57A 1G5SA 3R30A 4CMOA 4BDKA 4G1WA 3Q53A 4HCUA 3OBJA 2CPKE 3GI3A 4EJNA 1OMWA 2VWWA 5F94A 3WE8A 4OBQA 5M44A 3DJ5A 3TUDA 4AN3A 2JKQA 5BYZA 4AF3A 3V8WA 2Q83A 4YNEA 4UBAA 4E3CA 4I23A 3VS1A 2QQ7A 3PJ2A 3TZ9A 4NKAA 4BHZA 3ZMMA 4F1OA 3PA5A 3QQJA 4USDA 4MKCA 5D1JA 2Z7LA 1KE6A 3D94A 4ZP5A 2PUPA 2SRCA 5L8KA 4O7LA 4CG9A 2A1AB 3CPCA 3MPAA 4FA2A 5EQYA 2RF9A 2QKRA 4WBOA 3NUUA 2OFVA 1MRYA 4GV1A 3NRMA 5DT0A 2BALA 2RFNA 1OIUA 4KKEA 1QPDA 3PXQA 4G5JA 1Q99A 4NM7A 4QMPA 2PVFA 3UBDA 4E6AA 5D7AA 4E8AA 4BGGA 1LPUA 4R3PA 4ZAUA 3AC2A 4QTCA 1KUTA 3ZFXA 1CTPE 2I0HA 4C4GA 2WNTA 4DBNA 4FKIA 3WZUA 4M84A 4ORKA 5HGIA 3U51A 5DYJA 4E7WA 1APME 4D1XA 3VHKA 2IZRA 3JS2A 1H26A 4E5WA 1WBOA 4BDIA 4W4WA 1UU3A 4HGSA 3VBTA 1OL1A 4KIOA 1OBDA 3HUBA 3PA4A 3L8SA 3QC4A 4IX3A 4CLJA 5ETCA 1BX6A 1VJYA 4TXCA 4JXFA 3DNDA 4YBKA 1OKWA 1UKHA 4S33A 3N4TA 4DYMA 2QOHA 4KAOA 2UW8A 5E8WA 5CSXA 2F7ZE 3SW4A 4LMNA 3VNTA 4Q9ZA 4C0TA 2V22A 2YM6A 5AUYA 4G16A 3VUDA 5H2UA 2ONLA 2FUMA 5BMSA 3KGAA 2OJFE 4GK4A 3HMPA 3KRXA 2XP2A 5FXRA 2J90A 5FM3A 1L8TA 1ND4A 4XRLA 4FVRA 3WZKA 5ITAA 5FEQA 2GQRA 4QP9A 4BDFA 3ZOSA 3RCJA 3F2RA 2IO6A 4FKPA 3SGCA 1M17A 3A8WA 2C47A 3IW6A 4RVLA 2FSLX 2WQOA 2UW4A 3MJ2A 3OG7A 4RQVA 4CD0A 5HX6A 2CDZA 5HD7A 4O0VA 5I9UA 4HVSA 4FT9A 4NKSA 3KQ7A 3UO5A 2ERZE 2BKKA 1YXSA 4RFZA 3C5IA 3F61A 3OC1A 2Y6MA 3C7QA 4CMTA 5FUTA 2GQGA 3ZDUA 5M53A 4WRGA 4IQ6A 5AAGA 3DKCA 4RJ3A 1NVRA 4X2NA 4BFMA 2DQ7X 4RJ7A 3ZEWA 4DLIA 2IW8A 1OUYA 3C4XA 5FTOA 1XR1A 4PPBA 4FC0A 2ETKA 5JN2A 5IU2A 2YLFA 3EOCA 3A2CA 4I93A 1EH4A 1K9AA 1SVHA 3A62A 3BYVA 4FSWA 5LWMA 4KBAA 4YZ9A 1OKZA 3D7TA 4FTRA 5L2QA 2IVTA 4LV8A 3MH0A 1PF8A 2V62A 3LFEA 5BVDA 3Q4ZA 4DH3A 2XK3A 4UYAA 3B2WA 2R3JA 3VHEA 2RFEA 3QTQA 1VEBA 4I94A 5HTBA 3MV5A 4F0GA 4UZDA 1WFCA 1ZY4A 5HX8A 5IPJA 1XKKA 4CT1A 4FT3A 1KOAA 5L2WA 4HYIA 4J95A 3QLGA 2A2AA 5CT7A 5CAVA 4D2RA 4EORA 4PDYA 4EHZA 2YIQA 4FZ7A 3D5WA 3QX4A 3ZO3A 4KKGA 4QMWA 2IZTA 5DHJA 2ITTA 2VUWA 1GNGA 4DG3E 3PJ3A 5FG8A 2JLDA 4NJ3A 4DEGA 2C3IB 2B9HA 4RA5A 4ACMA 4CSVA 5HCYA 5LMBA 2F7XE 3V8TA 3FZPA 3LLAA 1U5QA 1B39A 4QQCA 4X0MA 1XWSA 1YHVA 2IZSA 2OSCA 3A7IA 3BE9A 5CLPA 2E9VA 4F1MA 1F0QA 1WBTA 3ORNA 4I6HA 4O6EA 2XVDA 4U41A 1UA2A 3EMGA 3LIJA 4I6QA 4BRXA 2CKPA 4HYHA 2BAKA 3QRJA 3BE2A 1YI6A 3TV6A 4ASDA 2ETMA 2BTRA 4GCJA 3ZS5A 4BDCA 4L43A 4Y72A 5E8TA 4NL0A 5IQCA 1MQBA 3D83A 3I0QA 4RC2A 1VR2A 3F3VA 3KRJA 3NW5A 3ZM4A 3R9OA 5I3RA 5JEBA 4O7SA 3PIYA 3ZRMA 4L01A 2VX0A 4J8MA 1DAYA 1IA8A 3LJ2A 4X6QC 4YMJA 4EBWA 3BIZA 5CENA 5DLSA 4AGCA 2F2CB 4DEAA 4BCQA 4IW0A 2EB3A 5K3YA 3TT0A 1OL7A 4IAAA 5EDQA 2GNFA 3AG9A 3U87A 2YFXA 5HVJA 2C0IA 1Z9XA 3VUHA 2X8EA 4R78A 5CX9A 2W9FB 4IVDA 3RAIA 4M12A 3VUGA 4CXAA 2W1FA 3CY2A 4F99A 3LM5A 5IEYA 3MPTA 4RG0A 4V01A 1Z57A 1BI8A 1HOWA 2CNUA 4UEUA 1PXOA 4YC8A 4QMVA 2BTSA 4CYIA 2J0KA 3DK6A 1UWHA 2Y9QA 3HMOA 3HX4A 1RW8A 3FE3A 4FG7A 3GVUA 4R3CA 4XH6A 3S4QA 5BQ0A 3ULZA 5BUJA 3MN3A 1ZYLA 1KOBA 3KN6A 3SLSA 2Z7SA 1BL6A 1OIYA 3C51A 4FNXA 3DK3A 4TYHA 3UZRA 3QRIA 3BHHA 4BYJA 4BWPA 3IK3A 5K4IA 4JLCA 4ZTQA 3V5PA 4IB0A 4N70A 2H96A 5HTIA 5KHXA 2WMRA 4M8TA 5E7RA 5JZNA 3R7VA 3TIZA 3TG1A 2GPHA 3UIUA 4IXPA 3N4VA 2VNWA 3D5VA 4OT6A 2XCKA 4AACA 4BICA 2Y8OA 3KXHA 3PVUA 3HMIA 3WI6A 3WZDA 4D0WA 3G0EA 4MWHA 3POZA 3CXWA 2ITQA 2R3OA 2ZMCA 2GNHA 4TZRA 4ZTRA 3GCPA 3ODZX 3TKHA 3RBWA 2GFSA 5JFWA 3PJ1A 3KK8A 5E91A 5AV4A 5JFSA 3PVBA 4LUEA 4FKJA 4XP0A 4XV1A 3VVHA 5AP0A 5HNIX 5BMMA 3MTFA 2XA4A 4DTAA 5M51A 1MUOA 4RBLA 3I60A 3G9NA 3OTUA 4FKSA 3UG1A 3I7CA 3U6IA 3K3JA 4U80A 2R3NA 2PU8A 3F5XA 3BX5A 4E6DA 1QCFA 1Y57A 3GFEA 4H58A 4PUZA 4MD9E 3CKXA 2GHGA 5E8SA 4BI0A 1IEPA 3QKMA 4WSYA 3B8QA 2J6MA 1ZYJA 3DB8A 4YZBA 2OU7A 5E8XA 5M4IA 4B0GA 4MD8E 1Q97A 3CSVA 2NP8A 4C4JA 4O7VA 3NVKI 5AV0A 4JNWA 2XK8A 4NIFB 5FGKA 2Y7JA 1H28A 1WBWA 3UYSA 2I40A 4R5YA 5EFQA 5KBRA 2XBJA 2PMIA 3GU7A 5EHYA 4JX3A 3I5ZA 4YJRA 3UNJA 4A9TA 3GB2A 2NRYA 3TXOA 3KN5A 1JLUE 2J0MB 3ROCA 5HBJA 1WVYA 1LR4A 3ZDIA 2XUUA 4PL5A 4W4VA 3GC0A 2Q0BA 4FTOA 5ANEA 1PXMA 3T3VA 3WBLA 5DN3A 1JSTA 3OS3A 1E1VA 2QO9A 3NDMA 4JDHA 3ROYA 3UVQA 4HVGA 3R28A 1O9UA 3DK7A 4CQGA 2JAVA 2F57A 4H36A 4PL4A 1Q5KA 2JIUA 4S32A 5AP4A 4AFJA 4FGBA 4DGNA 4F08A 5C8KA 5C8NA 4QO9A 2P3GX 4L3PA 3A99A 4Y85A 5IMEA 5JRQA 2P4IA 3FMEA 5JRSA 4DEBA 1GJOA 2O8YA 3LXLA 4EOQA 4PPAA 5EKOA 3TKIA 4B6LA 4HOKA 4CG8A 4R8QA 1E9HA 1FVTA 4ZTLA 4OAVB 2WIPA 4X2JA 5AR7A 2X6EA 2XCHA 1ZLTA 2XIKA 4ZZMA 1PXPA 1P4OA 3R9DA 2WTKC 1LEWA 2WTVA 2OW3A 1IRKA 2HCKA 5F4NA 2BRGA 3UMWA 2X8DA 4AWIA 5B2KA 5D7VA 4L00A 2XZSA 4GG7A 4EC8A 4LOPA 3C4CA 3CGFA 4CCUA 5GZ9A 4P5QA 4FVQA 3CJFA 1XJDA 3I0OA 2R3IA 5CNNA 3G5DA 3L9PA 5AR3A 4CFUA 3F2AA 4J8NA 1ZYCA 2PWLA 2R3HA 2ZVAA 4ID7A 3DY7A 3UO6A 4CKRA 2WMSA 3ZLXA 4BWKA 2ITXA 4FTCA 4ZOGA 2W5BA 3FKNA 4IEBA 2QLQA 3RTPA 3U4UA 3OROA 2H6DA 5HE2A 4APPA 1GZ8A 2CKEA 4KIQA 2W5AA 3PIXA 5E9EA 2PK9A 4M13A 3JXWA 5M55A 1CDKA 3GUBA 2W4OA 5H8EA 3SQQA 4XG3A 4M67A 3ZBFA 5K0XA 2HK5A 3QLFA 2XNBA 3QX2A 3RGFA 3GCQA 5ANKA 2HZIA 4MXYA 2ETRA 4E5AX 4G3CA 2ZV2A 3C4FA 5KCVA 2WD1A 2C69A 4U42A 4I41A 2VTPA 2C1BA 5D11A 2XF0A 2YN8A 3CCNA 4YR8A 4AU8A 2YDKA 4NH1A 3CIKA 3LPBA 4ACGA 2JEDA 4GEOA 2G2IA 2F7EE 5FD2A 2YA9A 4QP4A 4BTFA 4FL1A 5LOHA 3DQXA 2CNQA 1FGIA 5DIAA 3WZJA 3O7LB 1P2AA 4FV2A 5DOSA 4YP8A 5EOLA 3VQUA 4C57A 3NYNA 3HNGA 2CN8A 3Q4CA 4CV8A 2CSNA 1V0OA 3JY0A 4EZ7A 2JBPA 3NW7A 3FZOA 3TZ7A 3HVCA 3QZHA 3PLSA 4JS8A 4I22A 4D5HA 2HW7A 3MPMA 5CU6A 4J99A 3VF9A 2HW6A 5KMJA 3FI8A 1HCLA 2ACXA 3MY0A 3FMMA 4C36A 3RNIA 4KBCA 3VS6A 2UVZA 5CI6A 5IQEA 1MP8A 1TQIA 4WHZA 5HE1A 1M2RA 4FG9A 4B8LA 3HV5A 2JDSA 2PVKA 3UE4A 3HAMA 3ORXA 4NZWB 4X7QA 4IM3A 2KTYA 5G1XA 3ORTA 5KKRC 5LVOA 4IIRA 4DGMA 3GU8A 3ZLWA 2UZTA 3QU0A 4IC7A 2UZWE 3NPCA 5K9IA 4XV3A 3ORMA 3IKAA 2QNJA 4BGQA 4ZSAA 2WTWA 2HXQA 4AZEA 2UW9A 3R1QA 4L44A 4W9XA 2JC6A 3QQHA 3K5UA 4QP1A 2PY3A 4MYGA 4TYJA 1PMNA 1PXNA 3VS4A 3K3IA 3E62A 3UP2A 2VTOA 1QPCA 4WSQA 3IW5A 3UVPA 2ZDTA 2WPAA 3TNIA 4LOQA 1J7LA 1Q8UA 2XIYA 2XIZA 3BBWA 3QUDA 3R73A 2VGOA 4FSZA 5AV3A 5A4TA 3I81A 5CVHA 2XK9A 1J1BA 2RG5A 5HLPA 3COHA 3OBGA 3QALE 3V6RA 1S9IA 3ZO2A 1QPJA 4FIGA 2BDFA 4WNOA 2WOTA 3C5UA 5ANOA 5IA3A 5K5XA 4LG4A 4TRLA 5L6OA 3RWQA 4AZTA 5HTCA
chains in the Genus database with same CATH superfamily
4GFOA 3Q4TA 4K1BA 4AT3A 2J4ZA 4JX7A 2O63A 2WTIA 3RP9A 5AFVA 2R9SA 3HUCA 4GJ3A 3LFFA 2X4ZA 4HNIA 5D9HA 1ZARA 4KSQA 3LMGA 3D7TB 4FTKA 4BYIA 4FTQA 5DI1A 4DINA 3VBYA 2C6TA 4XLVA 3TV4A 4IM2A 5A4CA 2PE2A 4YO4A 4RFYA 4FK6A 4UXLA 3R8ZA 4EKLA 4CGAA 4J53A 4U3ZA 3OW3A 2QU6A 3V3VA 3HP2A 4U6RA 4RWIA 2PSQA 3L9LA 4L7FA 5BVEA 4HYUA 3D5XA 2XALA 4RPVA 5F1ZA 5TO8A 5DNRA 1AGWA 5KMLA 4IM0A 2OJ9A 5DMZA 3NCZA 3WF9A 4O4DA 3O96A 4F4PA 3KMUA 3F5PA 1TZDA 1TFFA 3R1NA 2PVYA 3OT3A 4M0YA 5L3AA 5TF9A 4ACDA 3UIMA 4HVDA 3ENHA 2C3JA 1KE9A 1Q62A 3W2QA 1YXVA 1SMHA 3GOKA 2B9IA 2XIXA 4IX6A 3KMMA 4QPMA 1NW1A 3SXRA 2HY0A 3AC3A 4NM0A 1WVWA 3KK9A 4O0YA 5LMAA 4ASZA 2I0VA 3OXIA 4AX8A 4AXAA 4YUQA 3GNIB 4RGJA 3EN4A 4ANSA 2W99B 2VO3A 3A4OX 3CE3A 3IW7A 3NZ0A 2YDIA 4CFVA 4M0ZA 1UU8A 3VN9A 3MVHA 3EYGA 4FTTA 4IDVA 3FSKA 1JNKA 2XMYA 4QMTA 3OWPA 1SVGA 3FWQA 4R1VA 2CCHA 4F7JA 5JSMA 3FPMA 3CP9A 2YZAA 2QOLA 5FXQA 4JDJA 4L42A 4L46A 3W2OA 2BR1A 4A4OA 3VBQA 2G1TA 3LFQA 4ONAA 5F95A 5BVFA 4NYEA 1KE7A 3FZSA 5C1QB 5IEVA 4JT3A 5HG8A 5DG5A 3VRZA 5JFVA 2H34A 2CCIA 4CFMA 2HAKA 3VS7A 2BUJA 1WBNA 5HESA 3OVVA 1HCKA 2QI8A 2WMVA 3Q6WA 2YJRA 4BBMA 3H0ZA 5HNBA 4HNFA 4IWDA 1U4DA 1H1RA 2UV2A 4WNPA 5EW9A 3HDMA 3VS2A 2FO0A 3TJDA 2BZJA 2R3KA 3DAKA 2Y6OA 2YIYA 3L8XA 4NTSA 4U3YA 3OMVA 2OKRA 1W2DA 3RM7A 5CALA 2OZAA 2OICA 2C0OA 2IZUA 3PSDA 4IADA 5AP3A 2C5OA 2WXVA 4B7TA 3MFRA 4QDEA 5FTGA 5A4QA 3VW6A 1J1CA 3F5GA 2C1AA 4UMPA 4UMTA 2BCJA 3H9OA 3M1SA 5E90A 3VBWA 3UDTA 3IECA 3MVMA 3DBQA 3F3UA 4DFYA 1WMKA 3N51A 4EOJA 4HPUE 4FK3A 5HIBA 2E9NA 1R78A 2WTKB 3EB0A 1WAKA 1XBBA 2VWIA 2XB7A 3B2TA 3G0FA 4WUAA 4UWYA 3ZFYA 1PKDA 1FMKA 4GK3A 3NFGB 3FMHA 4AT4A 2DYLA 2PPQA 1ZOGA 3P5JC 4FVPA 3KF4A 5ETFA 2YLEA 4EYMA 1J7UA 3U54A 3RKBA 4DHZA 2CN5A 3ZXZA 2ZM4A 5BX0A 3TUBA 1H1PA 2CLQA 5LVNA 5DFPA 4OR5A 4ZTNA 4G3DA 4DFLA 5CU0A 4GYGA 2XKDA 4QNAA 5D10A 1FVRA 4FNWA 2C68A 1FMOE 4F9CA 5IDNA 3RI1A 5CEIA 3H3CA 5EG3A 4G9RA 4AS0A 4ZMEA 3JY9A 3P08A 2J7TA 3NUXA 3QYZA 3P4KA 4RVKA 1SM2A 4FSUA 4G6OA 4QMUA 4YBJA 5ETAA 3SX9A 2IPXA 4EH8A 2XKFA 4KIPA 4KUJA 4GUBA 2BIYA 3Q2JA 1Q3WA 2OO8X 3F66A 5A6NA 4YC3A 3R6XA 3HEGA 4EK6A 5FRIA 4DF3A 3ZONA 1XQZA 5J5TA 1REKA 3LFBA 4LRJA 2ZV8A 4G2FA 4QQTA 2Q0NA 4XG6A 5KNJA 4AOTA 3GC7A 2YWVA 2W17A 4DG2E 2CGVA 4IE9A 5AP7A 2WEVA 3RINA 3FI4A 3UDBA 3R63A 2BDJA 1W82A 4QP3A 4PQNA 3VUIA 5I9ZA 2BAQA 3EKKA 2YCSA 1H01A 3TWJA 5A3XA 4I5HA 4FNYA 2QG5A 3NSZA 4HYSA 4YU2A 5KE0A 4C59A 4FKVA 5E1SA 3HV4A 4D1SA 1VYZA 1G8AA 4UWBA 4BCIA 3LXKA 2BILB 2LGCA 4KSPA 4PTGA 2I1MA 3HV3A 4L67A 1B38A 1UNHA 3FKOA 2YCQA 2UW7A 3L8PA 4RA4A 1STCE 2P55A 5IISA 3NUAA 4UN0C 4IVCA 4LGHA 4WOVA 4PPCA 2VTIA 5H8GA 3FY2A 4TYIA 3R7IA 1Q4LA 3SOCA 3FLWA 4Q5EA 1Y91A 5KMMA 5IH4A 3MS9A 5CXHA 3TACA 3KIOC 2J2IB 4FIIA 3PY1A 3VUTA 5JKGA 5AJQA 4RVMA 3C50A 1VYWA 1YDSE 2GNIA 4UXQA 4QYHA 4WG4A 4Y83A 5HG5A 3ZEPA 4ACCA 3LFCA 3AC8A 5C8MA 3HRFA 5IZFA 2WQEA 4OW8A 4E6QA 1I44A 1FVVA 4EBVA 4C4IA 5I9VA 5EI2A 1IG1A 3FZRA 4NW6A 3BU3A 5KKRB 2VRXA 3OCTA 4ANQA 5FDPA 2PZ5A 4BKZA 3CKWA 4D4VA 3PDTA 2VO7A 5AV2A 3EQPA 5DGZA 5I9WA 3V01A 4C4FA 3AGMA 1BI7A 3ID6C 4DFUA 2V0DA 5HD4A 2QHNA 2CJMA 5CAOA 2WOUA 3G51A 3QL8A 3FJQE 2JDVA 2ZB0A 2ZAZA 3QBNA 5F20A 2O65A 4E4LA 4XP2A 3R00A 3BRBA 4GJ2A 4EQUA 2YCRA 3MH1A 4RJ8A 4IFGA 3QTUA 2UZBA 4F09A 2WHBA 1FINA 3AT2A 3EJ1A 4LL0A 3DKOA 4N6ZA 4D2WA 3TTIA 4N4SA 3KRRA 4EOSA 4JI9A 5L6PA 4ANNA 4DGOA 2J9MA 2EB2A 2Z7RA 3VC4A 4DFNA 2XNMA 3NIEA 1O6YA 2FVDA 3H9FA 4D9TA 3PIZA 3NGAA 2CGXA 3ORKA 3QTWA 2IN6A 3MTLA 4YJSA 3F3TA 3W32A 3AKLA 3ZTXA 4DAWA 1PXLA 4UY9A 4A4XA 1GZNA 4IAZA 4ZSLA 3U55A 5CI7A 4Y5QA 3ORIA 1H25A 3UOHA 4F78A 3MI9A 3R8PA 1Q41A 5AM7A 3DDPA 4GW8A 4FE2A 1FGKA 5BVNA 3MFUA 5JMSA 3E88A 5M07A 3RHKA 3DAJA 5A46A 3DJ6A 3O2MA 4QNYA 1RE8A 4A9YA 4ZY5A 2X2KA 4CTCA 3O8TA 2JKKA 3W0MA 4K0YA 2NNWB 5I5ZA 4XBRA 5HHWA 4C37A 3REPA 3NR9A 4WRSA 1JPAA 2AUHA 3FI2A 1OIRA 2PYWA 2ITPA 3UTOA 3I5NA 1ZYSA 3QZGA 4QMYA 1KV1A 4G3FA 4CYJA 5HE0A 1UKIA 2DS1A 5FEDA 3SKCA 4OTPA 2OIQA 4DLJA 5LJJA 2VTSA 2HIWA 4R3RA 5BUEA 5AIRA 4BTJA 4G3EA 4C02A 2XH5A 3FXZA 2VNYA 3BV2A 3MY5A 2V7AA 3O17A 4MVFA 4O0SA 5AP1A 3QYWA 4QRCA 3ZC6A 4EH5A 5M56A 5IH5A 1G8KA 5DH3A 5L6WL 4ZTSA 1OL5A 3BU5A 4G9CA 1PXKA 4TL0A 2IW6A 3FV8A 4GVJA 4K11A 5D41A 3Q5IA 3E92A 3OXTA 3BZ3A 3PXZA 4CFFA 4F1TA 3BELA 3UC3A 3H10A 2ITUA 3GXLA 3KFAA 4ZXTA 4QMNA 3VIDA 2BAJA 5M57A 3GU6A 3ALNA 3C0GA 3QXPA 1E1XA 4P2KA 3TM0A 2XKEA 4OTQA 4J1RA 2B53A 4MX9A 5FLFA 5J9YA 2QOKA 2Z7QA 2R0IA 3BYUA 4IB1A 5EM7A 3VWAA 1XHAA 3HECA 4Y5HA 4B99A 3R04A 3OCGA 4S31A 3DXNA 1YWRA 4BBEA 4AOIA 2NRUA 4K77A 3A7JA 5AEPA 5GINE 2ZB1A 4YZDA 4DC2A 3WF6A 3RCDA 3Q60A 3HMMA 2NYAA 4Y73A 1R0PA 3RJCA 4QQ5A 4D58A 3PLAE 4RJ4A 5KMIA 1XH4A 4L68A 4FTMA 4C61A 5CEKA 4Z7GA 5I4NA 3PSCA 3T3UA 4D4SA 3AXWA 2OBJA 3KXZA 1BKXA 3HZTA 2FSMX 4L3JA 5DEYA 3O5AA 4C4HA 2WMBA 4AT5A 3SAYA 3ZBXA 4D2SA 2AYPA 3OWLA 4NWMA 3VBXA 5KBQA 4MQ2A 5IA4A 4FTIA 5DPVA 3A60A 5K0KA 1F5QA 5HICA 3TEIA 2V5QA 3ZU7A 4QP2A 2PULA 1Q8TA 1R0EA 3OEZA 4RMZA 4F6WA 3SXSA 4U40A 4LV5A 4L52A 5HE3A 3H30A 3PTGA 3SD0A 3FQHA 3IOPA 4JQ8A 4BI1A 2OF2A 5FDXA 4E4NA 3KREA 5BYLA 3FHRA 2WTJA 4EZ5A 4O0XA 5JK3A 3PZHA 3RMFA 4E4MA 3GOPA 1YVJA 1UU9A 2VTJA 3IQ7A 3PVWA 4FZDB 3GC9A 4GU9A 1JWHA 2W7XA 2GS6A 2VTMA 3OZ6A 3DCVA 4AW1A 3ZCLA 1ZMWA 3V5QA 4AFEA 4R77A 2XIRA 4KNBA 2UVXA 3D5UA 3QXOA 5AX9A 4QMZA 4W4YA 3W1FA 3ACJA 3PY0A 3KB7A 3LCOA 2F49A 3QKKA 5KMNA 3FYKX 3IW8A 3KRLA 4PMTA 3RPSA 3V51A 4FL3A 5ETIA 3R01A 1BYGA 4K2RA 4AN9A 2R3FA 3SRVB 4AOJA 4JRNA 4IC8A 3UVRA 1MRVA 4ZTHA 3NWWA 5J7HA 4N6YA 4QTAA 3NAYA 4GVAA 4O4EA 3BYMA 2WMAA 4A9SA 1FPUA 4LI5A 1JKKA 3NNUA 3M11A 2W4JA 4C2VA 3O50A 1UU7A 1S9JA 4QQJA 4IBMA 4CEGA 5LQFA 4GK2A 2YM4A 4FTNA 1JOWB 4EK3A 4N0SA 2JIIA 3FZTA 4DE4A 2WEIA 1JVPP 3EHAA 4O2PA 2P2HA 1ZRZA 2P2IA 4ANOA 3QRKA 2OFUA 2QKWB 4RX8A 2WGJA 3UC4A 2OJJA 4IJPA 2NPQA 3SDJA 3C1XA 3R2BA 3BHYA 4GH2A 3ZZWA 3UQGA 2WU6A 3EQHA 3DTCA 3A7HA 3E8DA 4RJ5A 3TKUA 3HGKA 4TTHB 5ANJA 3BPRA 4DEEA 3U4WA 4R7IA 4FSQA 4PTEA 2QVSE 3KRWA 5M08A 4CFNA 5GIOE 2XNOA 2JITA 3DKGA 2OZAB 3A61A 3GEQA 2R3RA 4MXXA 4XEYA 4DFXE 1PYEA 2BZKB 2WMTA 4GL9A 5JQ8A 4EH4A 4L3LA 3ELJA 2IF8A 3TTJA 4FV4A 5I9XA 3SG8A 3JR1A 1YOLA 5EM5A 5JGDA 1WCCA 5LXMA 1W2FA 3FLSA 4MH7A 3OEFX 2XANA 2XARA 5HCZA 4C3RA 3AMYA 5HIEA 3P79A 2PZRA 2C6DA 2G2HA 2HELA 3PG3A 5FM2A 3GCSA 4F64A 3CTJA 5E8UA 5GZ8A 3IONA 2JDTA 3UQFA 2OH0E 3QWKA 2CGUA 4YTHA 3ANQA 4XX9A 3AC4A 5A4LA 5AP5A 3D9VA 5H9BA 2VTAA 4HVIA 1W98A 2PVHA 3CQEA 1MRUA 3IO7A 4PDPA 5CYIA 3FAAA 2ZMDA 2VGPA 3NX8A 5L8LA 2I0EA 3BYOA 3V8SA 1WZYA 4I92A 2FA2A 2QHMA 4BDEA 3RZBA 3EFKA 4EK4A 3OHTA 3FSFA 3AC1A 3UMXA 4CMUA 1PXIA 3AD5A 4RZWA 4DFBA 1K3AA 3MB6A 4J71A 4PL3A 3EQBA 4O2ZA 3DPKA 2X8IA 5T3QA 3BHTA 3PPJA 3WF7A 2XEYA 2QO7A 4JG6A 4AZWA 1RQQA 3NVMB 4AE9A 3PVGA 3RWPA 4KBKA 4O4CA 2R3MA 2BHEA 4FOCA 3ZH8A 4KINA 3OUNB 3HLLA 3FMLA 4QMMA 5IA1A 4QTDA 1H00A 5EDPA 3G2FA 5HU3A 1J3HA 4D2VA 4RFMA 2YABA 5I0BA 1OI9A 5LWNA 3R71A 4F6SA 4A9RA 2X2MA 3NYXA 4ZMFA 4BR3A 3E5AA 4FJVA 1OB3A 4XJ0A 5DE2A 4BL1A 3CBLA 5BV3A 3LJ0A 2OK1A 4FT7A 4OTFA 4BDDA 3QCXA 4D5KA 5J1VA 3E7OA 4TY1A 5CAPA 3LFNA 4EYJA 1IASA 3QHRA 4WA9A 4ZS0A 4YJUA 5E8VA 3ZO4A 4ANMA 4EWQA 4TNBA 1H1SA 4DTBA 4MXOA 3LMIA 3WF8A 4O7ZA 2R3QA 1LP4A 4NTTA 3TYKA 4HGLA 3ZSGA 2UZDA 3IS5A 4IZ7A 3T9TA 3AD4A 4GT4A 2QG7A 2W9ZB 1GIJA 1U59A 3NEWA 3W16A 5H3QA 1OGUA 2W1ZA 1XBAA 3DU8A 4FR4A 4IZ5A 3F69A 3NS9A 2WKMA 3ACKA 3O51A 4FBXA 4I0RA 4RWLA 5CANA 1PMUA 3WARA 3D0EA 4K33A 2W1IA 1PJKA 4XBUA 3F7WA 4BCFA 3R8LA 4U79A 3RZFA 2FSOX 2ERKA 3VAPA 3IG7A 4OLIA 5HKMA 4D2TA 3GCUA 4EOPA 3RAKA 1PXJA 3BKBA 4BZDA 3PSBA 5E1EA 1ZY5A 4GT5A 1UNGA 4Z7HA 3QQKA 4EOOA 4B4LA 4BCGA 3EIDA 2VTRA 1W84A 3EKNA 2IVUA 2UZLA 5TT7A 4KIKA 3OY3A 2VN9A 2R7IA 2UVYA 3F7ZA 2HXLA 2UW6A 2VX1A 4MHAA 4QP6A 4BIEA 4BY9E 1Q8YA 3QGWA 3WYXA 5CAQA 2X2LA 4USEA 3RM6A 2BVAA 2G2FA 4MXCA 4DA5A 4GU6A 4X3FA 4QTEA 2RIOA 3GU4A 2KULA 4IWQA 4FV7A 3V5JA 2XAMA 1I09A 3LQ3A 5DBXA 2VWYA 5I3OA 2XJ2A 4F9WA 3IDPA 3UPZA 5CAUA 5IQIA 1M7NA 3DBEA 3KULB 2XK4A 2QU5A 3NUSA 2QOBA 4FV5A 4MCVA 1B6CB 3P5KA 3R7UA 4PMPA 1OKVA 3M42A 4NFNA 4AXDA 3OP5A 2HY81 5BVWA 5TR6A 3S95A 4AGUA 4O22A 3LQ5A 3E87A 5B2LA 4U0IA 4L53A 3QTIA 3G33A 4FOBA 4JVGA 3R8VA 2VWVA 4WNMA 4RX5A 3RAWA 2G15A 3MIAA 2IJMA 4EONA 4A4LA 3W8LA 2BZHB 4A7CA 2WMUA 3C4ZA 2V7OA 4ITIA 4XHKB 4XNEA 4IX5A 3BL7A 4BB4A 1IAJA 2GNJA 5L4QA 4BN1A 5C26A 3TIYA 4XRJA 3KVXA 3SOAA 5KX8A 3F3WA 1A9UA 2QCSA 3P0MA 4RT7A 3W2SA 1QMZA 4DN5A 3S00A 3SXFA 1Q3DA 2W1GA 3EQDA 4M3QA 1K2PA 3BBTB 3UDZA 1P14A 1Q8ZA 5AA8A 4DG0E 3LAUA 5IH6A 2B1PA 3IPHA 3FL5A 3QD4A 4FV0A 2OXYA 5KUPA 2GHLA 2EXEA 4Z3VA 2ESMA 1OZ1A 2WTDA 4GIIA 4CV9A 4M68A 1ATPE 4MF0A 3LXPA 2VWUA 4TW9A 4BZOA 4RVTA 3ENMA 4RIWA 5A6OA 2GDOA 4F6UA 5C9CA 5IA2A 3CPBA 5FBNC 1YI3A 3FMDA 4IAIA 5CZHA 4FF8A 4BCJA 3FHIA 1J91A 4HGTA 2VZ6A 4GS6A 3QA0A 5EYCA 1Z5MA 2W1EA 1SNUA 4PTCA 2PVLA 2XJ0A 1JAMA 5CF8A 2JFMA 2ZDUA 5B0XA 3KXNA 3KU2A 3DFAA 2PZPA 3OCSA 1W2CA 4UMRA 2VO6A 4JR3A 3H4JA 3ZYAA 3LMHA 2QOCA 2PL0A 1PHKA 3PXKA 4MD7E 3NUNA 3U9CA 4UX9A 4FZFB 1L3RE 3MB7A 3KF7A 4I0SA 5AMNA 3QRUA 2FB8A 4FT0A 5HO6A 1J7IA 2C6OA 3BWJA 4I21A 1KWPA 3IDBA 4BCHA 3FC2A 4PX6A 4AW2A 4C35A 3JPVA 1DM2A 3MESA 2VX3A 3R8UA 2O2UA 2IG7A 3KCKA 4Q2AA 4X3FC 4OTIA 1KSWA 4ALVA 2C5NA 3R21A 4NK9A 2AC3A 3Q32A 4X6RA 1ZZLA 3BHVA 3QF9A 5AR5A 4BCPA 5AAEA 5CU4A 3OW4A 4C38A 1O6KA 3LE6A 2GQSA 5K4JA 5AIKA 2PMOX 4GIHA 4CRSA 5E4HA 3R9NA 4I20A 4ERKA 1Y6BA 3SG9A 4LMUA 4FODA 3W0QA 3EL8A 4IACA 4BKJA 5JZJA 2R3LA 1YRPA 4DT8A 3QQUA 4L8MA 5EYKA 1OPKA 5C01A 2AEGA 2RL5A 2QONA 2VU3A 3A4PA 3SRVA 4QT1A 4BDAA 2B54A 5LMKC 5DRBA 4FNZA 3CQWA 2C3KA 4QYFA 1LUFA 2OH4A 3PE1A 5DT3A 5AUWA 2YEXA 4DBXA 3UOJA 4S2ZA 4AP7A 2YM8A 3PE2A 5CNOA 3QCSA 5EM6A 5BNJA 4ZS4A 2VAGA 5LCJA 4E6CA 5HO7A 4ZK5A 2O64A 1V1KA 3RPYA 3I1AA 3BQCA 4JDIA 4AXCA 4DH5A 2Y4IC 4UALA 2W1DA 3OFMA 1WVXA 2QURA 4L45A 3OUKA 3QQLA 4ALWA 4F0FA 2BRBA 3U6HA 3LCSA 4O1PA 4U8ZA 3FEGA 4FKOA 3LW0A 4FV8A 4P90A 3U9NA 3C4EA 4EUTA 2VTTA 4BCNA 3CQUA 2G01A 2A0CX 3HA6A 4ANLA 4LRMA 2R5TA 4OUCA 4R7BA 2ITWA 3MWUA 2UW0A 4X2FA 2OIDA 2VV9A 4KD1A 4W4XA 4X3JA 4C2WA 4DEHA 2H8HA 4DCAA 3ORPA 3QHWA 5CSHA 1YOJA 4AN2A 2J0JA 3BGPA 1FQ1B 4OTGA 4XYFA 1OL6A 1REJA 2Z2WA 4CZUA 3B8RA 3NCGA 4K18A 3KL8A 1XH6A 3F9NA 1ST4A 4OBOA 4U43A 4O81A 3ULIA 5E92A 4M15A 1ZOEA 3GBZA 3TCPA 3ZC5A 2OJIA 1V0BA 5AM6A 4YHJA 4BDBA 3D2IA 3F88A 3QWJA 5CSWA 4ZJJA 4AAAA 3EN6A 5CXZA 2WAJA 4FKUA 4IWPA 3PXRA 3QRTA 4LV7A 4J7BA 3DXQA 3RPOA 4YJTA 3V5TA 5EOBA 3FPQA 4ACHA 4DEDA 2PE0A 3FI3A 4QYEA 5EYDA 4LGGA 5ANGA 3NUYA 2PMNX 5J7BA 3CC6A 4LQMA 5AV1A 2OZOA 3FDNA 2YHVA 1BLXA 2W5HA 1M2QA 2RG6A 3MA3A 5F9EA 2PMLX 3R7EA 4FEXA 3VONA 2PTKA 4O82A 4Y46A 5C03A 3GU5A 3VO3A 1O6LA 4V04A 4ZSEA 4F65A 4R6VA 3CTQA 4EK8A 4KA3A 4S34A 1YQJA 4ZJVA 1U46A 2ZV7A 3EL7A 4FKLA 3DGKA 3U8WA 3MVJA 4BHNA 3Q2MA 3W0RA 4HZSA 4F9AA 5M09A 1XBCA 3CEKA 5EHLA 4FUYA 3CS9A 3OWKA 1Q61A 2B9FA 2FSTX 2IVSA 4J96A 3BGQA 2X9FA 3IOKA 1G3NA 3P23A 4HCTA 2IVVA 4BDJA 2C4GA 3TUCA 4RWKA 1OIQA 1YWNA 3QA8A 3ORLA 4ZTMA 4JAJA 3ML1A 5A4EA 4XG2A 4PY1A 2AQXA 2QR8A 3TV7A 1KE5A 4FV1A 4TYGA 4I6BA 1SNXA 4ZSJA 3T8OA 1PRYA 4JIAA 3E8CA 4ZSGA 2ZV9A 4KS7A 5AX3A 5IKWA 2X39A 4ZZOA 3BI6A 4MXZA 2GNGA 4YHFA 2RSVA 5B2MA 4FV3A 1OVEA 2B52A 4FIJA 2HOGA 3W2CA 3EZRA 1PMEA 1T46A 1FOTA 4WIHA 4BDHA 5HVKA 1JKSA 3QQGA 4GYIA 4U5JA 3T9IA 3DXPA 4O7YA 2PE1A 2O0UA 2YISA 3MH3A 4FSMA 4KWPA 1H4LA 3FUPA 3VRYA 4DEIA 5GZAA 4AA5A 4FEUA 1SVEA 3W0PA 2Z8CA 2B55A 3G15A 4AXEA 4KKHA 3L8VA 1AQ1A 4YLJA 4IMYA 4NW5A 4F70A 4TWPA 3DDQA 2QODA 4U97A 2BFXA 4V0GA 4I4FA 5CEOA 4Y8DA 4YO6A 2YDJA 5EI6A 4CFWA 5IEXA 3AQVA 3R1SA 4NM3A 1GY3A 4XOZA 3OXZA 1CKJA 4WT6A 2GTMA 4YJPA 1M7QA 3BLQA 3PP1A 3VUMA 5JH6A 3D15A 4E1ZA 1H08A 3EZVA 2X6DA 4A9UA 4RZVA 3EYHA 4AA0A 4O38A 4FEVA 1H07A 3EQCA 1KE8A 2F2UA 4O21A 3ZLSA 1IA9A 4AGDA 3NAXA 1OITA 1UNLA 5HCXA 4MAOA 5CSVA 3GP0A 1YW2A 3PYYA 1JSVA 4FKGA 4IB3A 4NU1A 4OTRA 3AGLA 3ZHPC 5ICPA 3KY2A 4H1MA 3FLQA 3DJ7A 4FG8A 4ZIMA 4PMMA 3O23A 2BKZA 4RX7A 4CLIA 4BKYA 3MBLA 4FIFA 3GCVA 2WQMA 4Q9SA 5FP6A 3QFVA 4PRJA 3ZSHA 4CZYB 5A54A 4GSBA 3WOWA 5IQBA 1YHSA 4XLIA 5KO1A 4HGEA 2QO2A 4QD6A 3KULA 4MF1A 4A06A 4JQ7A 1BL7A 4PDOA 4F7LA 3OOGA 3R0TA 3W55A 3OD6X 3PXFA 2J0IA 4Y95A 5HZNA 2YAKA 5AUZA 4EH6A 4GKIA 2CLXA 4M69A 4DH7A 1CM8A 3C13A 4LRKA 5AADA 1H1QA 1NA7A 1QPEA 5EKNA 2O3PA 2JFLA 4JG8A 2PUIA 4EOMA 4RSSA 4R5SA 3S3IA 3SV0A 2E9PA 1OGYA 4RC3A 5EDRA 2PUNA 4XG9A 4GKHA 2BRMA 4IX4A 2HWPA 5C27A 2X4FA 4WBBB 5AP6A 4CKIA 3EFJA 2Y4PA 3QQFA 4FSYA 4GT3A 5ACKA 3Q04A 1H0VA 4ANBA 5HLNA 4I1ZA 5J8IA 2OXDA 3S1HA 4O84A 4FZ6A 4IVBA 2C0TA 1WBPA 4KIKB 3UDSA 2XRWA 5BVOA 2VWXA 4O86A 5BVKA 4LGDA 5G6VA 3IGGA 3HRBA 3W33A 3HP5A 5HO8A 1YDTE 3VW8A 3VS0A 2C5XA 3F3ZA 3LVPA 4X3FB 3FLZA 2VTQA 2F9GA 3OWJA 5CSPA 4F63A 3WZEA 2R4BA 4QMQA 4R7HA 4IWOA 4W8DA 4O91A 4YZNA 2UZVA 2WIHA 3I79A 4X2KA 3NLBA 3PFQA 1CKPA 4EJ7A 4FYOA 4WG3A 2VWBA 3MDYA 2RGPA 4HPTE 4DCEA 5ANIA 5ACBC 4YZCA 3L9MA 4JOAA 3Q52A 5KZ0A 2E9UA 3MVLA 3C0HA 5FBOA 5CU2A 3ZLYA 3W0SA 2ITNA 2R3PA 3MIYA 2A4LA 4FTJA 3A7FA 4IANA 1AD5A 5DWRA 2ITZA 3OF0A 4F9YA 1ERKA 1DI8A 4BJJA 3UIXA 3EN5A 2JD5A 4KS8A 1QL6A 4RJ6A 2DWBA 3OT8A 4EWHA 2B4SB 4TKSA 4D4YA 4U45A 4XCUA 2XAOA 3PPKA 2GSFA 2BHHA 3BLRA 1NVSA 3ATTA 3FQEA 3HRCA 2ZJWA 3I7BA 3FQSA 4EI4A 3E8EA 5KHWA 3TN8A 5T68A 2C6EA 2FGIA 4DT9A 3ZUTA 4P7EA 4F9BA 5M4CA 4G5PA 3UPXA 4MBLA 5LVPA 4XUFA 2X7GA 3EQFA 2Y4IB 2BPMA 5JT2A 4FL2A 2X7FA 3KXXA 5L2SA 4FKRA 3GC8A 1ZOHA 2IWIA 3KMWA 3I4BA 4E93A 2OWBA 3PP0A 4YSMA 4UB7A 1GIHA 1F3MC 2WQBA 3TNHA 4MWIA 3GT8A 5CEMA 4RIWB 3ET7A 3F2NA 5KMOA 1UVRA 3LHJA 3QZFA 3V04A 5M4UA 5DRDA 2JIVA 4C3PA 3COKA 2JBOA 4U81A 1A48A 3C0IA 2J51A 4YJQA 4C33A 1M14A 5E8ZA 4FKTA 2YACA 5J87A 3NYVA 5DR9A 3VJOA 1BMKA 4MNEB 4E20A 4E73A 2VO0A 1Q24A 5FXSA 2ITOA 4ASXA 3HV7A 4RIYB 5K5NA 2I7QA 3QD0A 4CFXA 5EHOA