5FDXA

Structure of ddr1 receptor tyrosine kinase in complex with d2164 inhibitor at 2.65 angstroms resolution.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
280
Chain Sequence
DFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Epithelial discoidin domain-containing receptor 1
publication title Structure of DDR1 receptor tyrosine kinase in complex with D2164 inhibitor at 2.65 Angstroms resolution.
rcsb
source organism Homo sapiens
total genus 83
structure length 280
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fdxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fdxA01
4FVPA 2XK4A 4FUXA 3HV7A 2OLCA 5ANGA 2P0CA 4GEOA 4JR3A 3D7TA 5M57A 2YWPA 3QKLA 4UN0C 3DDPA 5IUHA 4FC0A 3PJ8A 3S95A 3DBQA 3D2KA 4RLLA 4QTCA 2V62A 5LMAA 4V0GB 3W2OA 3U9CA 3TZ7A 3MVHA 4DEDA 4F4PA 4N0SA 2QOHA 3DY7A 3NUUA 4AZVA 4QMLA 4F6UA 4XOZA 4DEIA 3BV3A 4F1OA 2VTHA 2BRBA 5IQCA 3QD2B 3TNQB 4NT4A 1SVEA 1IAHA 3HVCA 4O7WA 2BRNA 1Z57A 3A99A 4OTGA 4M66A 1YWVA 2WMRA 3QTWA 5BVWA 5KBQA 4OTWA 3DZOA 4EH4A 5EW8A 4ANNA 4IX3A 1UU3A 4A9YA 3HMPA 3C5UA 3TG1A 2HWPA 3BYSA 2BFXA 2UW4A 2UW0A 3PVUA 5CU6A 2QO2A 3GOKA 3VBQA 3V8SA 4RX8A 4L7FA 1F3MC 3OW3A 5A6OA 3SXRA 2YN8A 5JK3A 3BWFA 4E8AA 5IZFA 4ZJIA 3L8PA 2JDVA 3WZUA 2CNVA 2PUNA 4NK9A 3QZIA 4LRKA 3AGMA 2PVYA 5F9EA 1UVRA 5CASA 2O0UA 4AGDA 3Q5ZA 4BFMA 3I79A 2J6MA 2FSMX 3DBFA 2IVUA 4G3EA 4P4CA 5D7VA 3RJCA 5AX9A 3VWAA 4DG2E 1IA9A 3MFRA 5HTCA 2C1BA 4Y72A 3MESA 5DFPA 5CT0A 3R6XA 4O0WA 1ZAOA 3PG1A 4OTHA 4UYAA 2PZYA 3BELA 2BCJA 3G2FA 3WE4A 3HGKA 2VNYA 4O6EA 5BYZA 5ACKA 3MSSA 3ZOSA 3PJ2A 4ZZMA 4WNPA 4RRVA 2JDOA 4QT1A 2C3JA 5FDXA 1NW1A 3UBDA 3LFQA 4O83A 4R6VA 4NJDA 4RX9A 4YPSA 4Z3VA 2VTMA 3Q9WA 1KV1A 3T3UA 5C27A 1L3RE 5ACBC 5AUTA 2B52A 3ZM4A 5JFSA 4R7HA 3EQPA 3NW7A 4NSTA 4O38A 2X8IA 4LMUA 1H27A 4MCVA 1GIJA 2IVSA 2XUUA 2G15A 4PNIA 1IA8A 3F6XA 3EHAA 2WQEA 3IW8A 4MQ1A 3WIKA 1SNXA 2XB7A 2G01A 3M11A 3M2WA 4D9UA 5KKRC 1PMEA 5DA3A 3DKOA 5AV4A 4IW0A 4FUYA 3PTGA 3ZC5A 3FL4A 5HX6A 4GW8A 3HA6A 4W4XA 3OCTA 4Y95A 4L3JA 2HZ0A 2H6DA 3LJ2A 4XLVA 2HZ4A 2P2HA 3CE3A 3UODA 4L6QA 4II5A 3ORIA 1JBPE 3ZSHA 4IACA 3LFDA 3Q04A 2XJ2A 3GVUA 2XK7A 4Q5HA 4MXAA 4ZTLA 3DAKA 3BQCA 2OU7A 4Z55A 4O0YA 5LWNA 4EOLA 2WEVA 3E8DA 1PF8A 4RVLA 1ZZ2A 3CTJA 3EL7A 5CI7A 4DF3A 4J71A 1FMOE 4QP6A 4U44A 3ACKA 4KS7A 3ZBFA 2QONA 3FZSA 3I6WA 3VRZA 3UPZA 4HGTA 3V6RA 3KXNA 3R00A 2IZSA 4XYFA 4G6LA 4DCEA 2IJMA 3WOWA 2QURA 2W17A 5LMKC 3WYXA 1JSTA 4U40A 1I09A 4JLCA 3CJGA 1UNLA 1YKRA 4I94A 4BCQA 1OGUA 3HNGA 5AJQA 2V7OA 3W8LA 3EN6A 1VYWA 1Q8TA 4ONAA 3KULB 4LYNA 5DI1A 3NGAA 1R0EA 1CKPA 1NVSA 2UVXA 3FHIA 3KFAA 5BMMA 4Y46A 3TCPA 3TZ8A 4EWHA 4XJ0A 4H36A 3C5IA 3GCQA 3Q2MA 2QR7A 3PA5A 4JRNA 4XG6A 5FP6A 3R1SA 5HD7A 3PWDA 2OW3A 2VWXA 5C03A 5IA2A 4NIFA 5J7BA 3FZPA 3VUGA 3IOPA 3RK5A 3W2PA 2FYSA 5HVYA 1NXKA 3O8UA 1R1WA 5ETCA 4LGGA 3QQHA 1UKHA 3EQDA 4CCUA 3ORZA 3NPCA 4X6RA 4PP7A 5HESA 3GGFA 4AE6A 2FSOX 4FEWA 1ZOEA 4WOVA 5DEYA 4FSWA 1ZYSA 5AR5A 3U87A 2WTIA 1DS5A 3ORNA 3V5WA 3OXTA 3LCSA 5CEMA 1HOWA 3UP2A 4EOQA 4B8LA 4C61A 2WGJA 2VO3A 4J8MA 4RQVA 2W1ZA 3MDYA 5DN3A 2UW8A 3UO5A 2VNWA 2QKWB 4KABA 3LJ0A 1PYEA 3JUHA 4J52A 4IQ6A 3LJ1A 4PDOA 4QMWA 4RIOA 4JG6A 3EZVA 3OG7A 4CKRA 1WVWA 4FTUA 4O7VA 2JKQA 1URCA 1TQMA 2R3NA 5FXQA 1XWSA 5LCJA 4U43A 4QP8A 3ZO1A 2PYWA 2FVDA 2X4ZA 3BYUA 5LVNA 4BHZA 2ZYBA 2HELA 2X0GA 3FMDA 5L2QA 1TQPA 3IO7A 2PZ5A 3QQGA 3HV5A 4EH2A 2UZTA 4V05A 4L01A 3MA3A 4PY1A 4ALUA 2YITA 2WHBA 3W8QA 3IGOA 3NW6A 4IXPA 4RA4A 2BKKA 1SZMA 3ORXA 5EW3A 2PUIA 2WMTA 4U6RA 3GEQA 4TNDA 3NWWA 4IAKA 4AT5A 1A06A 2FUMA 5KHXA 2VTJA 3FC2A 4WUAA 4OT5A 1PY5A 1U5RA 2CGUA 1K3AA 3SC1A 1P14A 4BCOA 3Q6WA 5AR8A 4AWIA 5CEOA 2QHNA 3ZLWA 3HV3A 4LI5A 5E8WA 4E3CA 4EKLA 4E20A 4BCIA 3WZKA 3WF8A 4DYMA 4F6WA 4MF0A 5IQFA 3E87A 1UWHA 3IDBA 5KMMA 3R8MA 5BQ0A 3IOKA 3HX4A 2VWUA 1CM8A 3E7VA 5ANEA 2H8HA 5M06A 2Y7JA 3HMIA 3ODYX 2CKOA 1OL7A 3ZZWA 4F70A 3NAXA 2FA2A 3LFSA 2W0JA 2XNOA 3R7VA 1ZYJA 2R3LA 4YHJA 4FTAA 3KXMA 3AC8A 4H1MA 1G3NA 4RZWA 2CDZA 4EQMA 2JAVA 2XH5A 4LGHA 3NVMB 3L1SA 3R02A 4D2WA 5EHLA 4BCGA 3DJ5A 5E1SA 4DT8A 4AGWA 2CGXA 1Q8UA 2QOQA 3KU2A 3G0EA 1OB3A 2RFSA 5T68A 4LGDA 1B38A 1PXLA 2ZB1A 4G5PA 4WKQA 2JKMA 4YP8A 5LJJA 3DCVA 3RPRA 4IB5A 3P0MA 3L8XA 3FSFA 4GS6A 4OW8A 2UW5A 4MNEB 3A7FA 4GK3A 4XG4A 3L9NA 3OWJA 1XH7A 3ORLA 1PXKA 4A9UA 2UW6A 3U8WA 4D55A 3ATSA 2QO9A 3R7UA 5IEXA 1U46A 2GCDA 4Z16A 4YPDA 4D5HA 4D5KA 3MH3A 5K4JA 3D5VA 3QC4A 3OROA 3OT3A 4BCFA 4UB7A 4MBLA 3C51A 3DJ6A 3P86A 5F95A 4FSYA 4S31A 4YTHA 3FL5A 3QRJA 4RIWA 3FQHA 4E5WA 4AN9A 1W8CA 4M7IA 3EKKA 2VU3A 2Q83A 4QMPA 2GQRA 2CNQA 4D2PA 5AV1A 5KX8A 4UXLA 4AZSA 3U51A 4KUJA 3LVPA 4EQCA 2ERZE 3W1FA 4AU8A 4A06A 2JDRA 4IX6A 4IFCA 1H8FA 4NW6A 4QMXA 2UZEA 5M44A 4BF2A 3JVSA 2R3IA 4XV1A 1GNGA 4JBVA 5JGAA 5KKRB 3AD4A 4CFXA 1AD5A 4DH3A 3DU8A 3E8CA 4J98A 2Z7QA 4X21A 1ZZLA 3KA0A 3O17A 4H3BA 4OT6A 3NS9A 4JDHA 4CTBA 4KKEA 5I5ZA 5JT2A 2XM8A 5K0XA 4TYEA 5JMSA 4RJ5A 3VJNA 1BI7A 3KC3A 2VWZA 4EKKA 4RZVA 5CENA 2R2PA 4FKLA 4RA5A 2VGPA 4FV7A 3E62A 4IWOA 3KXGA 3BIZA 2QG7A 5AAFA 1LPUA 4Y8DA 5ANDA 3FMNA 3UE4A 5JN2A 4IVDA 3F2AA 1ZARA 5IQEA 3TV4A 3QXPA 2XYNA 4G3DA 5H3QA 4NM5A 2PY3A 3LXPA 4FI1A 4NM0A 4M13A 1OPKA 4CFWA 5HNIX 1B6CB 2ZOQA 2CCIA 4L52A 4EH5A 3HAMA 3VUIA 2ITZA 4CFFA 4PMMA 3AMBA 3PG3A 3QXOA 1U5QA 4IVAA 4HVDA 4NYEA 3MH2A 4BYJA 3GOPA 4I0TA 4HVSA 2WQMA 2ITWA 4EK3A 5GJGA 2RKUA 4V04A 3FSKA 4L3LA 3R0TA 5L4QA 3E88A 4UY9A 4MD8E 4RFYA 3U4WA 3KK9A 4FF8A 3QD4A 4NM7A 4QYFA 5BMSA 3TUCA 2WEIA 3TI1A 3KB7A 5GZ9A 1M17A 5GJDA 2J5FA 3EFKA 1BUHA 4J8NA 2BIYA 4ZS4A 2XK8A 3CIKA 1SNUA 3F88A 3ODZX 4FKPA 4GIHA 3MPAA 1RJBA 2VO6A 3ORTA 4KBCA 5J87A 4JIKA 5A14A 4E6CA 2C69A 3UYTA 3I0QA 4CZTA 4GMYA 2NRYA 4UZDA 4OR5A 3QQKA 5LOHA 2RFDA 4RT7A 5CU4A 5KMJA 4KIKA 1ZYDA 3PY3A 4HGLA 4IIRA 2BDWA 4FV0A 3QAME 3EJ1A 4DT9A 3OUKA 4HW7A 4O7ZA 4PMTA 3TZ9A 4PTGA 2JIVA 4D1SA 3F2RA 2YZAA 4NTTA 4EZ7A 3COMA 3LZBA 4L9IA 3R7YA 1E9HA 1O6LA 4FTCA 3A4OX 3DKGA 3E64A 4QQCA 5A4QA 4J97A 4YBJA 4ITHA 3PWYA 5AP3A 4N6ZA 3RP9A 4F9BA 3H9OA 4YLKA 3EB0A 2WTJA 3WZDA 4DINA 1JWHA 4C4HA 3LFEA 3UC4A 2B7AA 2UV2A 4YSMA 5JFVA 1P4OA 3TV6A 3TV7A 2XA4A 4P5ZA 2OO8X 3ZFXA 4J95A 3QTQA 4ZK5A 3W2QA 4YLJA 3D7TB 3ZUVA 3ENHA 3FMJA 3V01A 4F0GA 2C6OA 3IS5A 3OHTA 5A4TA 5A9UA 4DLIA 3JXWA 3DXQA 5GIPE 5BUJA 4XS2A 3W2SA 4GU6A 4AFEA 3I5NA 3VRYA 4WSQA 4B9DA 4M0YA 5F4NA 4BTMA 3TDVA 1AQ1A 4GH2A 4NWMA 4UX9A 3T8OA 3IW4A 2PVMA 5HCYA 5AR3A 2YEXA 2C3KA 3KRRA 3QWJA 4PMPA 5M4FA 5J5SA 1ZWSA 4K6ZA 2FH9A 3QD0A 4FEVA 2ZDTA 4PP9A 3NX8A 4I20A 3VS2A 2ITYA 4QD6A 1OL5A 3TKUA 2ESMA 4ANSA 4MBJA 3PDTA 3EQGA 4UEUA 3PIYA 4D4RA 3D7ZA 3AD5A 3FMMA 3LCKA 4G6NA 3RMFA 3OP5A 4C2WA 4R3CA 4C4FA 2W5AA 1IRKA 3JS2A 2P2IA 3BYVA 3NAYA 4FSZA 3UIBA 1ZRZA 2HZIA 4S34A 3UOLA 3QRKA 4APPA 2VX3A 4XP2A 3G9NA 5J5TA 3AXWA 5A46A 4Y85A 1JPAA 2VD5A 3OT8A 3QF9A 4FV2A 5CTPA 5EYMA 2QQ7A 3RAWA 4K1BA 3ZSIA 5E8XA 2JEDA 2UZLA 5AA8A 2ITPA 3VBWA 4FOCA 4I24A 3P78A 4K33A 5EDPA 2I0EA 4HYHA 3V3VA 2QHMA 3SVVA 3QLFA 4GJ2A 4EH7A 2EWAA 5IA5A 4C34A 5G1XA 5H8GA 2CJMA 3PXQA 2J0MB 4RBLA 5BUEA 1U54B 2IZTA 3ZO4A 2YJRA 3OC1A 3ZYAA 2JDTA 3P1AA 4TYGA 2PL0A 1CTPE 4NU1A 4C37A 3WF9A 2AC3A 3OCSA 2OH4A 2VUWA 5AWMA 4R7BA 2GHMA 4W8EA 4ZTRA 3QGYA 5JGDA 4L3PA 3GCUA 4BDHA 3EYGA 2UZOA 3FMLA 2GU8A 2HENA 4IJ9A 4Y5QA 2AC5A 3R63A 3N4TA 4M97A 2ZAZA 4I5PA 4BDDA 3PIZA 4BBMA 5KHWA 5LARA 2YIWA 4K2RA 4GJ3A 1AGWA 2QO7A 5J9LA 3FQEA 1OIQA 3L9PA 4R3RA 5HNGA 4ENYA 4ZOGA 2VGOA 2WOUA 3E3PA 5FM2A 1BL7A 4GFOA 4JRVA 1OUKA 3H0ZA 4D2TA 4AQCA 4KRDA 2B4SB 5DOSA 2NO3A 3FZOA 3MFSA 4MXYA 3KRXA 3Q3BA 3R8ZA 4TPTA 2CPKE 4AFJA 2DQ7X 4HZRA 4XG8A 4KIPA 3PXFA 4JQ8A 4YZDA 4O2ZA 3RWQA 3LIJA 1OITA 4MD9E 4D0WA 4CCBA 5EOLA 4E4LA 3OEZA 4CFUA 3JY0A 3AQVA 3Q5IA 2R3GA 3GCPA 4JBOA 4QNYA 5A4CA 5E8UA 4ACCA 3GT8A 4EUUA 4C4JA 5HLWA 2SRCA 1XH5A 2XK6A 2R9SA 4BDJA 3UG2A 5LVPA 2BHEA 4FG7A 5GIOE 3DBCA 4BDEA 5HU3A 3U55A 4CVAA 3HA8A 3PA4A 4C58A 1PMVA 2YIYA 2OIDA 3VS0A 3UQCA 5BYLA 3D9VA 3PXKA 3OMVA 4C59A 4FKWA 3ULIA 1PXIA 3OW4A 4E6QA 4MX9A 1YVJA 4FE2A 4GSBA 4B6LA 5J79A 4IAYA 2OICA 3A7GA 4WBBB 1JOWB 4XCUA 4FIFA 4BDGA 2AUHA 4XV9A 1GIIA 4IX4A 2YDIA 5D11A 2PULA 3CY2A 2F7EE 5AUVA 4C35A 3OVVA 5IU2A 4O7SA 3QTZA 5A54A 1KE5A 3OFMA 4PV0A 1G5SA 2R3PA 5AUYA 3EL8A 3V8WA 4NIFB 5IUGA 4PL3A 1KV2A 2UVYA 3PXRA 3RNYA 4FT5A 3ZRMA 2V5QA 4O0VA 2XNBA 3COKA 3CKXA 4J7BA 3D5WA 4YZMA 5AV0A 2LAVA 4IX5A 2XIKA 4AACA 4PUZA 4DEAA 2IVVA 2PHKA 4EBWA 3F5GA 2R3FA 2XKCA 1YHVA 5FQDC 4QP7A 1GY3A 1OI9A 4BVUA 1ZYCA 2GFCA 2A1AB 2XP2A 1Q24A 1V0OA 2WB8A 3HV4A 3QRIA 4I92A 1OECA 3ROYA 3LKMA 4I6BA 2IW8A 3W2RA 5D10A 1SMHA 3N4UA 2J7TA 3EN7A 4E6AA 2BAQA 3IG7A 3ZLSA 3FLSA 2XIZA 3P7BA 3PA3A 4G6OA 4ZTNA 3R8LA 4RX5A 3RK9A 4ZZNA 3H0YA 5E8YA 1YW2A 2CLQA 2I0HA 5BVNA 4E4NA 3SRVA 4GRBA 5T3QA 4M0ZA 1CKIA 1ZMVA 4H1JA 4PDSA 4XOYA 3MIYA 4USFA 4GIIA 2C6IA 4BDIA 3MTFA 4IAAA 3U54A 4FSQA 5AUWA 5C01A 3KGAA 2C6LA 3KQ7A 4WRSA 4IM2A 2XCHA 5F94A 5KE0A 3SDJA 4UMTA 3QX2A 4PPAA 5HVKA 1M52A 4IH8A 4JS8A 5GNKA 4DLJA 1O6YA 4RJ4A 5CY3A 2IZUA 3DPKA 4HCVA 3PJ1A 4F08A 4I22A 4X7QA 3U4UA 5HO6A 4OTDA 4QNAA 5D12A 1PW2A 3R9NA 2X8DA 3FQSA 2OJIA 2OG8A 3BHYA 3LFBA 3REPA 4M68A 4YTFA 3FY2A 3C0IA 4IM3A 3A8WA 4DG3E 4UZHA 4NFMA 5JSMA 3TEIA 5AP6A 3HRCA 1YI4A 3IW7A 3MB6A 3MJ2A 4YZBA 3GC0A 2E2BA 4HGEA 1ZOHA 4EOIA 3ZBXA 4YO6A 4WNMA 1SM2A 3WF5A 3UOHA 4NH1A 1EH4A 5KMIA 4BN1A 2NNWB 2HAKA 4RFZA 2R3JA 2BALA 4QTDA 4P7EA 2ZMCA 3DTCA 5IQDA 1KSWA 4ITJA 2CCHA 4BCMA 3QA8A 2BR1A 3UP7A 4HVHA 1O9UA 3ZRLA 4FSMA 5KO1A 4B4LA 4X2NA 2WD1A 3MIAA 4I41A 3VN9A 3ZS5A 5CAVA 5IA3A 5ICPA 3KXHA 3SXSA 5DR6A 4WD5A 3F9NA 1IEPA 4QYHA 4BGHA 2HK5A 1KE7A 3ORMA 4AUAA 1MP8A 3AGLA 2FB8A 1TQIA 1Q62A 1O6KA 2QR8A 2YM8A 4DGLC 1F0QA 2BZHB 2C5NA 2XIXA 2XZSA 3DAEA 3Q4CA 1SYKA 4G31A 1FPUA 3R8VA 3V5QA 3ZLYA 4AN3A 4RIYA 5CSXA 4EH9A 4EHZA 2IWIA 2WAJA 4FTNA 4DBNA 4L68A 3DTWA 4U0IA 5TR6A 4MF1A 4O1OA 4O7YA 2ZM1A 3BBWA 4BDBA 3VBVA 3VIDA 4QP2A 4JDJA 3A7HA 4E5BA 2CHLA 3A62A 4JBPA 4RIWB 2WXVA 4KSPA 3FI4A 3PPKA 4FGRA 3WYYA 1V0BA 3Q96A 4I0RA 4WG4A 5EI6A 5CXZA 2BKZA 2X9EA 3CQWA 2VX1A 1YDSE 2WU7A 3GU7A 1KWPA 5FBNC 3UVQA 3VO3A 4CYIA 4ZZOA 1YXTA 1J91A 3O96A 1BKXA 5A3XA 3D83A 4M12A 4YBKA 2J2IB 5M51A 1FOTA 1KE8A 3DKCA 3IW5A 2CKQA 3AC1A 4DFYA 3G6GA 3D14A 3HRBA 3O51A 2PVJA 4I23A 4KS8A 5CSVA 5HE2A 5CAPA 3P9JA 2R0UA 3FI8A 4NTSA 3EQFA 3LOKA 3QTIA 4QQTA 4YUQA 3DA6A 3K3IA 1A9UA 4PRJA 1GAGA 3EFJA 2IG7A 4YC6A 4AW5A 2V0DA 3FI3A 2GNLA 5IISA 3QU0A 2YZLA 4DGGA 2WQNA 2QOBA 2OJFE 1FINA 3I5ZA 3QHWA 5DRDA 4D2SA 4WNOA 4ERKA 4O7TA 1YXUA 1JKSA 4YJTA 3KXZA 2YISA 2A0CX 5HCXA 1UKIA 3UC3A 4CQGA 5CI6A 3BCEA 4ZY5A 4RC3A 2UUEA 1H24A 4NW5A 4W9XA 3LFNA 3GENA 3LLTA 4MTAA 5HHWA 4LL0A 4JVGA 3WARA 3E7OA 3B2TA 2OJGA 3CR0A 3F3TA 2BDFA 3GC7A 4FL2A 4WT6A 4OTIA 3RINA 4E7WA 3R71A 4I6HA 4E6DA 3U6JA 5BNJA 5IH5A 1JSVA 5IDNA 2GPHA 4C57A 2QC6A 3KY2A 3RI1A 3R9DA 3UZTA 5FWKK 2F9GA 4OTQA 5KUPA 3WZJA 3HECA 2Y6MA 3MA6A 1WBPA 3E63A 2WMAA 1GOLA 1XHAA 3QC9A 3VS6A 4KSQA 1VR2A 5EHYA 3F2NA 3KF4A 5FLFA 5FBOA 4RWJA 2Y8OA 5M4CA 2A2AA 4MH7A 4AN2A 4D2RA 4OTPA 5M4UA 3SXFA 2ITNA 3RPVA 3IK3A 3P23A 3ZDIA 2J50A 3FV8A 3F7WA 1DM2A 3FPQA 4MK0A 4BZOA 5FGKA 4EOOA 5C1QB 2QG5A 4RGJA 4EOMA 4FEUA 2LGCA 4ZXTA 2HY0A 3DS6A 4W4VA 4O81A 5FTGA 3TWJA 5AP0A 5CALA 5H8EA 4G3CA 4U81A 4V01A 2W1FA 1PRYA 3FMHA 5I3OA 3F82A 3UJGA 4KIKB 4D0XA 4AF3A 2B53A 4BIDA 5C8KA 1URWA 3AG9A 3EH9A 2UZWE 2XKEA 3WZEA 3LLAA 2YIXA 3FWQA 4BZNA 2OFVA 5HLNA 4F9AA 2BHHA 3FPMA 1S9IA 3V5TA 3QYWA 4IBMA 1UV5A 2ZJWA 2X7OA 3DGKA 3A8XA 3P7AA 4FR4A 3NZ0A 4GCJA 5C9CA 4D4SA 3TUDA 2HY81 4ID7A 3G15A 3QD3A 4BBFA 3ZLXA 2O63A 4ZLOA 5ITAA 4FV8A 4F1MA 4FKSA 5JGBA 2VTRA 4GYGA 3BYMA 2NRUA 5EHOA 1CKJA 5IH6A 1JLUE 2VX0A 4FT3A 3I0OA 3UGCA 3Q4UA 1TKIA 3CPBA 4OTFA 3EFWA 4QP4A 3QFVA 1FVRA 1W0XC 5AEPA 4G1WA 1E1XA 4BCNA 5TO8A 4EOKA 1MRYA 3C4FA 4FNWA 3NNXA 5IG1A 2YM4A 3SW7A 1OIYA 4IB3A 4KB8A 3SKCA 3QCSA 5K0KA 4AW0A 1OKWA 4BL1A 3HP5A 3RAIA 4C4EA 4GK4A 2CKPA 3THBA 4U80A 5CU0A 4J99A 4GT3A 4Z9LA 3EZRA 2IW6A 2O64A 3AOXA 3KN6A 2UW9A 2YM5A 5E8ZA 2R3OA 3LM5A 1OM1A 5EYDA 5L6OA 3AC4A 3BYOA 5AR7A 5HIBA 2BVAA 3ELJA 3ET7A 2OXDA 4BYIA 4H3QA 4JR7A 4E4MA 1K9AA 3FY0A 3R04A 1JVPP 3BEGA 4QTBA 3NIEA 3VS7A 4FVRA 1ZY4A 2JITA 1JQHA 4N57A 3KXXA 3NUYA 4FG8A 4R3PA 5D9HA 4CLIA 4Q5EA 5BX0A 3GBZA 1PYXA 1IASA 2FSLX 3R01A 2F4JA 4HCUA 5CEQA 1Y91A 4GVAA 2Z2WA 3FXXA 4K8AA 1T46A 1WVXA 2O3PA 2WMXA 2J0IA 3BU5A 2X1NA 3OXZA 5GJFA 4EEVA 3F3VA 4M69B 4FZDB 1CMKE 3S2PA 3QUDA 5AMNA 3DK6A 4YNEA 2ZM4A 4DH8A 2HWOA 4F0FA 4D1ZA 4L45A 1XH4A 4AW1A 1QCFA 2OIQA 4IWPA 4QTAA 3ZSGA 4XG3A 3TNWA 2AYPA 1H0VA 3C0HA 2B9JA 3MVMA 3QBNA 5E1EA 4DAWA 2R5TA 2HXQA 4ZTMA 5AP7A 4Q2AA 4O0TA 3PSBA 5EQEA 5AM6A 1R39A 3FE3A 1Q8YA 4DFNA 3BV2A 3CPCA 4NFNA 3VW8A 4AA0A 4UMUA 4F7NA 4MVFA 4MXZA 4MD7E 2X2LA 4WRGA 5AUXA 4ASXA 5HU9A 4FIGA 3BGPA 2YLEA 2A27A 4ITIA 5TE0A 4XBRA 4B0GA 4P90A 3A7IA 3P7CA 1YRPA 2GS2A 2JKOA 4BWPA 5CF6A 5L2IA 4FIIA 5EM7A 4IADA 2YCFA 3FKLA 4AW2A 2BRHA 1QPDA 4KRCA 4J96A 5FEEA 4O7RA 4MQ2A 4LUEA 1PKGA 1UNGA 2H9VA 3K5UA 2PVRA 3E93A 4FSUA 3UMWA 4V0GA 5HG7A 1FGIA 4ANQA 3O0GA 4QYGA 3N51A 2J0JA 3UYSA 3PRFA 3VQUA 4B8MA 4I5CA 5CT7A 5HCZA 4PX6A 2YJSA 3MS9A 5EYCA 4AZTA 3FMEA 3EOCA 4B99A 2Z60A 3OBJA 4XP3A 4EZ3A 3SW4A 3DK3A 3NSZA 3TTIA 3KMMA 3P79A 3CY3A 4D4YA 3G6HA 4F1TA 5ETAA 3CC6A 2CN8A 1QPEA 2P33A 3KVXA 2XK9A 3MY0A 3C4ZA 4JDIA 4KIOA 2XRWA 3RBWA 3T3VA 5IA0A 3RHKA 4QPSA 5KZ0A 3W55A 3R22A 2ITVA 4O0XA 3VAPA 2X39A 3COIA 4FYNA 3ID6C 4A9SA 5HBJA 4UWCA 3CEKA 4FK6A 3SX9A 3R1QA 1WBSA 2GSFA 3ZH8A 3HDMA 2PVNA 2Y4PA 5HOAA 3PUPA 4FIEA 4HVIA 1FBNA 2PMIA 5E8SA 3C9WA 1H00A 3HDNA 5EDRA 2CSNA 3NRMA 4U42A 5M55A 2HW6A 4BB4A 3Q9XA 5BVOA 3ZCLA 2JD5A 4UBAA 5AAGA 4TWOA 5L8JA 2B1PA 2XBAA 3KRLA 5I9UA 4GT4A 5EDQA 1R78A 1STCE 2Z7SA 3GFWA 3HMOA 3KEXA 4F7JA 5B2MA 4UMPA 5CQUA 2QU5A 2ZB0A 4CGAA 4FZAB 3UMXA 2C0TA 3CGFA 3ANQA 4JX3A 5AX3A 3OTUA 2R7IA 3QQFA 3FLWA 3RM6A 1TVOA 2WTKC 2R3KA 2VWBA 3A2CA 3TACA 2YCSA 4WG3A 3NCZA 2EXMA 2GTNA 4JQEA 3OBGA 5AIRA 3I7BA 2C5YA 3F5PA 3POZA 3NNUA 4FMQA 4S33A 5CF4A 4K9YA 1YWNA 4JG8A 5DNRA 2JIUA 4R7IA 3GXLA 5IEVA 3E5AA 3FBVA 2Z7LA 1PXJA 3JY9A 4KWPA 4KAOA 3H30A 4BDFA 1QL6A 4PL5A 4UXQA 3SD0A 1YI6A 2HOGA 4I21A 4TWPA 4DBXA 1UU7A 2CN5A 2GNHA 1YOLA 5DWRA 3PY0A 4YC8A 5CXHA 5DR9A 2WQOA 3ORKA 3QRTA 3R83A 2QOCA 4XG9A 1M2QA 4RJ6A 4U5JA 5CAUA 4HNFA 3LXLA 2PVFA 4EK4A 4QOXA 1M2PA 2R3QA 4A9RA 1YXSA 2VTTA 4FSNA 5ETIA 2REIA 4DFLA 5JQ8A 5EI2A 4OTRA 5TOZA 3R7OA 4ACGA 3EQHA 2OJ9A 2E9NA 4FL3A 3FZ1A 4IVCA 1FVTA 4HCTA 5K3YA 2PMNX 3BLRA 3SRVB 5IKWA 1PXPA 2PMOX 2XF0A 3H3CA 3ZHPC 5E91A 4K0YA 3QWKA 3MN3A 4N4SA 3TJCA 4QP9A 3FEGA 3OY3A 1CDKA 4FKOA 5L2SA 1LEZA 4CRSA 1MUOA 2YDKA 3D94A 3NDMA 4FTMA 4IZ5A 3PRIA 2PUPA 5JZJA 4X2FA 3L9LA 4EORA 3HAVA 3PSDA 3NEWA 3PVWA 2XRUA 5AP5A 3VF9A 2GFSA 4DFZE 2G2FA 3RZFA 3NYXA 4RLKA 5HLPA 2Z7RA 2W06A 3CCNA 5AADA 4L44A 4O91A 3R2YA 4OAVB 3D2IA 2C4GA 4MHAA 3V8TA 2R7BA 3IONA 4QMVA 5DH3A 3HRFA 1H1SA 1XBCA 2UW7A 3H4JA 4ALWA 4TYJA 4F64A 4O7LA 4O7NA 4RWLA 3ZEWA 1WBTA 2I0YA 3W10A 2QOKA 4HNIA 4XRLA 5F20A 3RGFA 4N6YA 4U41A 1HCLA 2J9MA 4DFXE 1GJOA 3D15A 3DB8A 3R1YA 4FV4A 5EK7A 3R9RA 4DFUA 3CGOA 1OPJA 4ZEGA 1GZOA 4GFGA 2VTAA 1H1PA 4PDYA 2EU9A 1PXOA 3PE2A 4PDPA 3ZUTA 4EL9A 4AGUA 4GG7A 1ZMUA 4LQMA 4J1RA 2R64A 2WTWA 1ZMWA 3F3WA 4KA3A 3ZMMA 3CXWA 5CNNA 2OZAA 2WTCA 3A60A 1MRUA 5HGIA 4EQUA 4HJOA 4F9WA 3GU6A 3R9OA 3RZBA 5CSPA 2UZVA 3R8UA 1YOMA 3D0EA 4I6FA 2YM3A 5DHJA 1U59A 2RG6A 3PP1A 5HG5A 3RM7A 4BDAA 5CF5A 5CSHA 4BC6A 3ZC6A 2WU6A 3O23A 3I81A 3K5VA 3R8PA 4AP7A 2PSQA 4BKYA 1WAKA 3BPRA 1OBDA 3DT1A 4RIYB 4FEQA 4A4LA 4BTJA 3A4PA 2XKFA 3ALOA 2PE1A 3T9TA 2EB3A 4ZP5A 3GQLA 3NMUF 2CLXA 3QHRA 3TL8A 4YNOA 4MAOA 1NVQA 4OBOA 3I60A 4PTCA 3I4BA 2GHGA 2XNEA 1OIRA 4E5AX 3NIZA 3E92A 3KL8A 1XH6A 3OOGA 3LQ3A 4FKGA 2PE0A 4D4VA 2ZV2A 4K18A 2BAJA 4NL0A 3TTJA 4P5QA 3VQHA 5FD2A 3BKBA 3VUDA 4EH3A 4QMQA 4IB0A 3I6UA 4W4YA 3EWHA 3GB2A 3O50A 3UQFA 2ZM3A 4BCKA 3T9IA 2XM9A 3F5XA 4C8BA 4DHFA 4RVMA 2YDJA 3PXZA 1REJA 4AE9A 4FVQA 4C0TA 4CMOA 2YM6A 3MH0A 1KUTA 3CJFA 3O71A 4U7ZA 4JJRA 4RJ7A 1RDQE 4DH7A 2G2IA 3R7GA 4O1PA 4OBQA 4KBAA 4HPUE 4IWQA 2JBOA 5IUIA 4KBKA 2XNMA 4LOOA 4PNKA 2IPXA 2X81A 2ETKA 3POOA 2NP8A 3UIUA 4FKVA 3DOGA 4FTKA 1BYGA 1FGKA 3QUEA 2XIYA 2JDSA 4DTAA 3MV5A 4WHZA 5ETFA 1H08A 2BILB 1XBAA 4PQNA 5J8IA 1J7UA 3JR1A 4GUBA 3VS4A 1OVEA 2R3HA 3R7EA 2P3GX 2GHLA 4C2VA 3OD6X 5CEKA 4GT5A 3N4VA 5J95A 4FEXA 1A48A 1NT2A 2W1HA 4C4GA 2I1MA 4FKJA 2XEZA 4FTRA 4K11A 3RHXA 4JAJA 4TKSA 3L9MA 5CZIA 2QVSE 3VHKA 2H96A 3IGGA 3CP9A 4O84A 5LVOA 3SGCA 3AC2A 3IQ7A 4IM0A 3F3ZA 4Y73A 5CYIA 4DGMA 2BZKB 2GMXA 5I9YA 2C6KA 5D7AA 2WMQA 5J1VA 5HKMA 3BBTB 1ND4A 3ROCA 4G34A 3ZUUA 4EWQA 1QPCA 4YTCA 2DS1A 3O2MA 2PVHA 2VWWA 2W1EA 3D5UA 3FKOA 3F5UA 4UWYA 4X3FA 1ZYLA 2H34A 2WTKB 4XLIA 3HKOA 2UZNA 5KZIA 4YC3A 3PPJA 3UQGA 4PMSA 4ZTSA 1ERKA 1PXMA 1Y8YA 5IQGA 3TT0A 3KVWA 4R1VA 2B9FA 3II5A 2PWLA 4O0SA 5JEBA 5AP1A 5DMZA 2X2MA 3DQXA 4AZFA 5HEZA 3R1NA 3ULZA 4FSTA 4HGSA 3AD6A 5BVEA 3W18A 3DZQA 4JNWA 4EH8A 3V5JA 3TXOA 4ANLA 3M42A 5EI8A 3ZFMA 4G3GA 5CU3A 1JSUA 4HYIA 2GTMA 5HE0A 4GYIA 1GZKA 5CS6A 1WCCA 3P08A 3KK8A 2GNJA 2RFNA 2UW3A 5IDPA 4IC7A 1SVGA 4JQ7A 4ARKA 1PJKA 1Y6AA 5I9ZA 4FYOA 4QQ5A 4RJ3A 4DGOA 3NYOA 2O65A 4XNEA 4ACDA 2JGZA 4G2FA 4DEHA 4RVKA 4FNYA 3DQWA 4LOQA 3VW6A 4BI1A 5L2TA 4UWBA 4FX3A 5JQ5A 4WSYA 3RKBA 1P5EA 5LWMA 4W4WA 4DH5A 5HNBA 2VTQA 3FYKX 5K4IA 5L2WA 4X6QC 1BLXA 4MWHA 4FTJA 4UYNA 4LMNA 4BIEA 3JVRA 3SOCA 4BGGA 4AT3A 4F7SA 3KF7A 4YO4A 5AUZA 4FTTA 4NCTA 3HZTA 5JH6A 2QLQA 5G6VA 3PVBA 5JRSA 3QZFA 4O0RA 1BI8A 2PUUA 5DLSA 3VHEA 4ERWA 2XNPA 4FNXA 4FV9A 4S32A 2RSVA 5CSWA 4HVGA 3F66A 1CSNA 2OBJA 4F09A 2DUVA 2DWBA 3PVGA 2B9IA 4QPMA 4LFIA 5DPVA 5AV3A 4GFMA 5IQHA 5HD4A 2W1CA 4X3JA 2R0IA 1KOAA 5T6KA 5KMOA 4GL9A 2GS6A 4RWKA 1U4DA 3H10A 5KMKA 2V7AA 4EK6A 2FGIA 2PE2A 3G90X 1VYZA 3VVHA 1J7LA 4FZ6A 4Q9ZA 3TKIA 3ENMA 1Y57A 2RFEA 3C4CA 2C0IA 4WA9A 3RCJA 4F63A 3EN4A 3LCOA 2YERA 2W4JA 3RCDA 5HTIA 3GFEA 1NY3A 1YWRA 3D5XA 3DXPA 3CBLA 5EH0A 3RWPA 5ANJA 1Q3DA 3DLSA 2OXXA 1W7HA 2W4KA 4QRCA 2XJ0A 4L42A 5BVDA 2OI4X 3E3BX 2GNIA 3A7JA 3C0GA 3QTXA 3NYVA 2BAKA 2VO0A 1M7NA 3PP0A 5C4LA 4BTKA 3UVPA 3DDQA 3QLGA 2ZV8A 4PL4A 4RX7A 4HPTE 2QI8A 3EQBA 5CVGA 2C6EA 2OWBA 4C62A 2QKRA 4EHGA 5DYJA 4FGBA 1GIHA 5EW9A 3G5DA 1P4FA 3FLZA 4FT9A 5IMXA 1J7IA 5IQAA 4RWIA 2BUJA 5GZ8A 5E4HA 4KNBA 1Q8ZA 3NYNA 5B0XA 3QRUA 5AUUA 1GZNA 4YSJA 1XBBA 3MTLA 1WBNA 3UPXA 3IDPA 5KNJA 2OK1A 4D1XA 1NVRA 2OF2A 4JI9A 3RK7A 3WE8A 4A9TA 4C7TA 3DNEA 4R1YA 3C50A 4IZAA 1M14A 4TY1A 4CG8A 4EJ7A 5LCKA 1PKDA 1IAJA 4GG5A 4BCPA 1H07A 4DEBA 2XYUA 3KRWA 1BMKA 3MGYA 3FJQE 4DEGA 3H9RA 4G3FA 3GNIB 2QOLA 4TT7A 3FHRA 4I0SA 3UNJA 5E90A 5HO8A 4IAIA 5ANKA 4OAUC 4LRJA 3TUBA 4AOIA 3MI9A 3UDBA 2OXYA 2OF4A 1Q99A 4IZYA 4DC2A 4CKIA 5E9EA 1KE6A 5J1WA 4ANMA 4DA5A 4XUFA 2XEYA 4K77A 5E92A 4APCA 4M15A 4TRLA 4JXFA 2YAAA 4H3PA 1MRVA 4XHKB 1R0PA 2ITUA 3IPHA 3VUHA 3SA0A 3HLLA 2XKDA 3FLYA 3QUPA 3TKHA 3R21A 1WMKA 4IHPA 2C68A 2C5OA 1OKZA 3IECA 4YU2A 3L8SA 4I1ZA 5EFQA 2I0VA 2X6EA 2Y4IC 2VWVA 3Q52A 1Q61A 3OY1A 3LMGA 2PPQA 5LXMA 3DLZA 4QMYA 3F69A 4TWNA 4WO5A 5DR2A 3OWLA 5CNOA 3QCYA 3K2LA 5BYYA 3GC8A 3DBDA 4TN6A 2JAMA 1J1BA 3BLQA 5M56A 1DI9A 4ZLZA 2BRMA 2RF9A 3FYJX 3PZHA 3C4EA 4WNKA 4XV3A 5DG5A 3FMKA 5A6NA 2E9UA 5EM5A 1NA7A 4I93A 3EN9A 3CSVA 4BGQA 2X7GA 4XH6A 2E9VA 2XS0A 2JLDA 3V6SA 4CSVA 3LMIA 4QO9A 4HYSA 3O7LB 5L3AA 3AC3A 2OKRA 3NUXA 3G33A 2V22A 4L8MA 5DIAA 3DKFA 4BKZA 4CMTA 2BIKB 4X3FC 4KINA 5HIEA 4NKSA 3FZTA 1ZOGA 1U54A 4FV3A 4YHTA 2Y9QA 3S00A 2C47A 1W83A 2WMVA 2CGVA 4ALVA 5LVLA 4EONA 2EUFB 3GUBA 3LQ8A 2WQBA 3UIMA 5FG8A 5LQFA 4LG4A 3Q4TA 4AA4A 3BHTA 2WMUA 4JBQA 4YURA 5IA4A 3TNPC 3BEAA 1OL2A 3QL8A 2R3RA 3LQ5A 5CX9A 3VUKA 1XKKA 2PMLX 4TYHA 5AIKA 4BWKA 3MPMA 2F49A 2IZRA 3EYHA 1ATPE 1OKYA 4FIHA 4CTCA 2WELA 3B8RA 3VUTA 4FT7A 2VN9A 4XEYA 5B2LA 2QOOA 1T45A 1X8BA 4S2ZA 2V55A 5AR2A 3HMNA 1B39A 4BDCA 2VO7A 4JX7A 5I4NA 3FC1X 4RSSA 4OGRA 5CAOA 3QZHA 1E1VA 3BU3A 3IDCA 4C36A 2J0LA 2YAKA 2WFYA 4CT1A 2YHVA 4ZSEA 2QNJA 4YZCA 1WBWA 4TXCA 4EK5A 1Q5KA 2CMWA 4LL5A 5LVMA 4DFBA 4KKHA 5FTOA 4O21A 3GU5A 3OUNB 4Y83A 3Q4ZA 4CFMA 5FDPA 5B7VA 4FSRA 5C8NA 2W99B 2DYLA 3MBLA 3QALE 3AT2A 3C4WA 1VJYA 4QMSA 1Q41A 3RNIA 4TZRA 5EOBA 2VTLA 3BRBA 5CF8A 3VBXA 4FKUA 3R28A 1YI3A 4FNZA 5CWZA 4NCTC 3VJOA 3PYYA 5M08A 1OIUA 4G16A 2F7XE 4QYEA 1OZ1A 4IVBA 4FTQA 2BMCA 3R30A 1Z9XA 2JIIA 4BIBA 5HI2A 2X7FA 3IW6A 2HW7A 3CTQA 5BVKA 4C38A 4W9WA 4YMJA 2C6DA 2C1AA 4WUNA 3ZEPA 3P4KA 4A07A 3ZU7A 5L8LA 4RVTA 4DEEA 5LMBA 3VUMA 3NR9A 4EHEA 1JNKA 2F2UA 1OBGA 4IFGA 4JG7A 3OXIA 4ZMFA 2W5BA 1IR3A 5AP2A 4ANBA 5HQ0A 4PTEA 3TN8A 2E9PA 2WPAA 3LFFA 5FP5A 2R3MA 4EK8A 1XQZA 3DBEA 1I44A 4IZ7A 3BHVA 4QTEA 1XR1A 2W1IA 3CD8A 2PVLA 5FRIA 4XP0A 3RAKA 3BE9A 5EKNA 1S9JA 2B54A 2YIQA 5FEDA 3LE6A 4CFNA 5EQYA 4U79A 4CG9A 4RIXA 3MY5A 4CXAA 4ZJJA 5KMLA 2W9ZB 4DH1A 3MWUA 3OS3A 2JKKA 3UO6A 4AZWA 2UZDA 4AT4A 2OZAB 2WMSA 4MXCA 4F9YA 4D58A 4O86A 5GINE 1H1RA 1Y8GA 4FA2A 5EKOA 3VS3A 4F99A 4YJRA 5DVRA 3UVRA 4YTIA 2VTIA 3F61A 2PZRA 3QA0A 4Q9SA 3EQCA 5A4EA 3R7IA 2P4IA 4I6QA 5CU2A 1XH9A 3TNIA 5H9BA 5BPYA 2BTSA 5M4IA 3EFLA 2G9XA 2F7ZE 4R77A 2FO0A 4ENXA 5HX8A 1F5QA 3Q9YA 5KBRA 1W98A 2ZV9A 3PY1A 5AR4A 2FSTX 4D2VA 1P2AA 5DT0A 4ZY4A 1UNHA 3HV6A 4HZSA 4NZWB 3BZ3A 3RAHA 4ZJVA 3LXKA 2XMYA 4U8ZA 2W4OA 3LHJA 4FV5A 3OWKA 5ANOA 2XJ1A 4XG7A 2VRXA 5ANIA 3RPYA 2W1GA 3EN5A 4ASDA 5J9YA 2EVAA 3H9FA 4EHVA 2OJJA 5CEPA 4CYJA 1YXVA 4I5HA 5FTQA 4TW9A 2ITXA 3DAJA 3CLYA 3I1AA 4ZIMA 3R9HA 5K9IA 1M2RA 4J53A 3QTRA 4NKAA 5IQIA 1OUYA 4NJ3A 3KKVA 4KD1A 4MNFA 4DGNA 3MJ1A 3LMHA 4C02A 3AT4A 3CS9A 3QX4A 5HBEA 3GQIA 4ZTHA 4L7SA 5C26A 2QOFA 5DT4A 1WZYA 5CEIA 2WTDA 4R5SA 5HG9A 1WFCA 2R4BA 3NNVA 2CKEA 4P2KA 4R8QA 5DRBA 3Q32A 4L67A 4XV2A 3UNZA 4QMTA 4L53A 3DFCB 4GU9A 2X2KA 3V5LA 3ZTXA 4C3FA 4H05A 1Y6BA 4E4XA 2I40A 5CLPA 1UU9A 2GNFA 2BDJA 3ACJA 2UZBA 1FVVA 4FT0A 4RC2A 4FG9A 4QYYA 4GV1A 3Q6UA 3TIYA 2HZNA 2WKMA 5FXRA 3DK7A 1G8SA 2Y4IB 4GKIA 4LRMA 5AP4A 5FEQA 1R3CA 2P55A 4IWDA 2WTVA 2YM7A 4H39A 3K3JA 2O8YA 3I7CA 4DG0E 3QQJA 4YJOA 2WIHA 4IANA 4MXXA 4YJPA 3VC4A 3SOAA 2IO6A 3BE2A 4KIQA 4USDA 3ZFYA 3S4QA 4I5MA 3KREA 1UWJA 4GK2A 5DBXA 4CV9A 1XH8A 4FKIA 2EXCX 4TL0A 3QQLA 4BTFA 3UZRA 2HYYA 4FK3A 1UU8A 3PPZA 3GU4A 3RVGA 3GCVA 4FBXA 4U3YA 1H28A 2BFYA 3KMUA 1JAMA 4R5YA 3D4QA 4RQKA 2GQGA 2IVTA 4QMNA 4M8TA 1H26A 3FXWA 4RPVA 4XBUA 4CLJA 2QD9A 4MBIA 1Q3WA 4Z7GA 2BROA 3C7QA 3W16A 3O7LD 4BWXA 4X3FB 2C5VA 3WBLA 3MVLA 2PK9A 3MFUA 2IN6A 4BI2A 3ZZEA 3UIXA 3NUSA 3BHHA 2RIOA 4YJQA 5IH4A 3C4XA 3ZO2A 3PE1A 4KKGA 3PJCA 3DB6A 5EG3A 4O2PA 5EM8A 3RTPA 1JKKA 1M7QA 3UZPA 3ERKA 2GQSA 4U3ZA 3Q60A 4FL1A 2VAGA 4YJSA 3QTSA 4HOKA 3FAAA 5CVFA 2YA9A 3SV0A 4CEGA 3COHA 5IA1A 3HUBA 4FODA 3ATTA 3GP0A 4Z7HA 3C13A 3SG9A 4CQEA 3LFAA 3DFAA 1FMKA 1ZLTA 2GS7A 5C4KA 2A19B 4YHFA 4DCAA 4QMMA 3ORPA 4FIJA 5BVFA 5TF9A 5E7RA 3LFCA 1YXXA 4IDTA 4JIAA 3FXZA 3GU8A 2YCQA 4C3RA 3HP2A 5EQPA 4ZSLA 5CAQA 5CQWA 5TT7A 4HYUA 2ETMA 2QLUA 4DTKA 2BZJA 4UV0A 4QQJA 4ZS0A 2X9FA 4BHNA 3JPVA 4GKHA 3OCBA 2XNGA 1QMZA 3PZEA 4YJUA 4I4EA 5JRQA 4EI4A 3SG8A 3WIGA 4EBVA 3G9LX 3QCXA 5FUTA 1Z5MA 4BR3A 3DXNA 2Q0BA 4I3ZA 3FZRA 2C6MA 2OIBA 4M67A 5HIDA 4CZYB 3KCKA 4CNHA 4EOPA 3V51A 2QOIA 5FM3A 2WZJA 5J9ZA 2RG5A 4OLIA 4G9CA 3BI6A 2VTNA 3UO4A 1DI8A 3B2WA 4FTIA 4A7CA 5HE1A 4D9TA 5HO7A 3MPTA 2XVDA 4RJ8A 4QMOA 2OGVA 2ITQA 3QKKA 3A61A 5IF1A 4FV1A 4JT3A 4YLLA 4IB1A 5M53A 1RQQA 1OL1A 4L46A 4M3QA 2ITOA 4CV8A 1ZXEA 5K5XA 4D28A 4O22A 4BCJA 5HTBA 3HUCA 2C30A 4XG2A 3MW1A 4DITA 2ONLA 3ALNA 3JYAA 5HZNA 3SAYA 3WF7A 5A4LA 1V0PA 3Q2JA 4IE9A 5F1ZA 1RW8A 3LPBA 4OUCA 2W96B 5IMEA 5EYKA 1WBOA 2UVZA 1G8AA 4C3PA 3UG1A 2YCRA 4S30A 4BCHA 3VNTA 3CTHA 3NLBA 5CVHA 3BX5A 4BZDA 4YJNA 4E26A 3RALA 5DEWA 1VZOA 3EIDA 5JFXA 2YWVA 3B8QA 1W84A 3KULA 4F9CA 1V1KA 3CKWA 4I4FA 4E1ZA 4YR8A 4RG0A 2ZDUA 2KTYA 2QODA 3BWJA 5D1JA 3RPSA 2W05A 4G17A 3ZRKA 4A4OA 3ZM9A 2YFXA 3BGQA 3ITZA 4YZ9A 4LV8A 3LXNA 4PPCA 2ITTA 4CRLA 2OH0E 4AA5A 2WNTA 4ORKA 5L8KA 3EQIA 3AT3A 3IKAA 2CNUA 4RC4A 2UZUE 3UOKA 3RPOA 4C4IA 3OTVA 1HCKA 4E73A 1LUFA 2OZOA 2Q0NA 4QMZA 5E8TA 4E93A 2WO6A 5M09A 3HYHA 4ZTQA 2C0OA 3AMAA 5AA9A 3E8EA 4G5JA 4IMYA 2VV9A 1J1CA 4JDKA 4GVJA 4ZSJA 3HEGA 1XO2B 1MQBA 3BLHA 3QZGA 2VTSA 2YLFA 4QMUA 1YHWA 3G51A 3C1XA 1H25A 3MH1A 4N70A 4B7TA 2BTRA 4AGCA 1REKA 1OMWA 3Q53A 3NCGA 4ACHA 2PVKA 2XIRA 2ZVAA 4CKJA 2W9FB 4LM5A 4CMUA 3W33A 2WMBA 1SVHA 4IJPA 3OZ6A 2J5EA 2BZIB 3R2BA 2G1TA 2J0KA 2XCKA 4X2JA 3Q9ZA 2Z02A 4U97A 4XMOA 3CD3A 4Y5HA 4EJNA 4EC8A 4WIHA 5HORA 4QP3A 5AFVA 1K2PA 4O96A 3ZXZA 3ZXTA 3OOMA 3TNHA 3UNKA 4FOBA 3FI2A 2B55A 4O6LA 3W2CA 1H4LA 3ANRA 5HBHA 5I9XA 4ZSGA 5JFWA 4NEUA 2C5XA 4EC9A 3S1HA 4WG5A 4M69A 4NUSA 2O5KA 3VBTA 4YJVA 3QQUA 4L00A 2I7QA 4MEDA 2ACXA 4FKRA 1H01A 1YQJA 3MYGA 4CZUA 1OPLA 4FV6A 3VBYA 2QU6A 3AMYA 3V04A 5DT3A 4BDKA 5I0BA 4MWIA 1Q8WA 2VTPA 3LM0A 3UTOA 3QKMA 3HL7A 4PWNA 4IAZA 1ZY5A 4ZLYA 5HVJA 3TZMA 1YOJA 4DTBA 3GI3A 2C3IB 2PTKA 2W5HA 4TWCA 1YHSA 3WF6A 5IEYA 4QP1A 1Q97A 2VTOA 2GNGA 3PXYA 5M07A 4RFMA 4MKCA 4RMZA 2OFUA 4R78A 3O8TA 3VS1A 4WBOA 3DJ7A 3LW0A 4TYHB 1LR4A 3GCSA 4BRXA 3EKNA 4UALA 3PIXA 4FTLA 3PJ3A 4JOAA 1KOBA 2X4FA 4ASZA 2GDOA 3VS5A 2YABA 1WBVA 4MXOA 4AX8A 5H8BA 1JKTA 2B9HA 4H58A 4MNEA 4UMQA 4C33A 4CD0A 2JC6A 5DGZA 1BL6A 3CQUA 3MB7A 3BU6A 1DAWA 1KE9A 4PF4A 4F65A 1H1QA 4F7LA 2VWYA 2CGWA 4ZAUA 3K54A 1UA2A 2NPQA 4U9AA 5D41A 1PHKA 4FTOA 4X2KA 1BX6A 4EUTA 5GZAA 3UOJA 3EQRA 3TDWA 5KMNA 2BRGA 5H2UA 2Y6OA 3MFTA 5E8VA 3GC9A 4USEA 3NNWA 4FZ7A 3E8NA 3ETAA 4YZNA 3O8PA 3CQEA 3QGWA 3SHEA 2PU8A 4EYMA 1LP4A 4IDVA 3PSCA 5JKGA 5IQBA 2JFMA 3TJDA 2JBPA 5I3RA 3ZONA 2HCKA 2G2HA 3S3IA 4ASEA 4EYJA 3PLAE 2F2CB 4U45A 4OBPA 5AV2A 5GHVA 3G0FA 3OWPA 2Y0AA 1H1WA 3QCQA 2HIWA 4LUDA 4MYGA 4AOTA 3V5PA 4BICA 4EH6A 3NW5A 3MVJA 5EM6A 3WILA 5J7HA 1RE8A 4BY9E 5L6PA 2I6LA 1FQ1B 4CT2A 3TM0A 3SLSA 5DE2A 4DE4A 3ZDUA 3EMGA 2E9OA 5TKDA 5I9VA 2Z8CA 4LV5A 4ANOA 5IPJA 5CZHA 2WMWA 3M1SA 4AOJA 3OEFX 3DV3A 3OCGA 4EZ5A 3BHUA 2PZPA 3FKNA 2ONLC 1LEWA 1PXNA 2OSCA 3PLSA 3R73A 2B0QA 3W32A 1WVYA 2X6DA 2HXLA 2XK3A 4PPBA 3NUAA 5I9WA 2J4ZA 5C8MA 2A4LA 2KULA 2ZMDA 1VEBA 3VULA 2VWIA 1OL6A 2W1DA 4O27B 3VF8A 5HICA 3FDNA 4RIXB 4CFVA 3U6HA 3FUPA 3U9NA 3KMWA 5K5NA 1H0WA 1APME 4AZEA 2EB2A 3KN5A 4AXAA 2W7XA 2VZ6A 4FKTA 4O0UA 2X8EA 5B2KA 5L6WL 4XRJA 5BUIA 4AAAA 4W8DA 3DNDA 5JZNA 3L8VA 4BKJA 4DN5A 5AM7A 5LMKA 4X2GA 3HMMA 4O82A 1J3HA 2XBJA 3F3UA 2ZV7A 2WIPA 1JKLA 4NM3A 3WI6A 5AAEA 3FLQA 3S0OA 4F6SA 4BBEA 3NVKI 3QYZA 3BQRA 4TTHB 4UMRA 3AC5A 3N9XA 3LAUA 1DAYA 4M14A 4XX9A 4A4XA 2RL5A 2BPMA 4FKQA 2QCSA 4GUEA 2ERKA 3U6IA 2J90A 4IAFA 2C3LA 1PMNA 3P5KA 1GZ8A 4X0MA 3ZO3A 2EXEA 1W82A 4AS0A 4JL9A 5CANA 4M84A 3LCTA 4TYIA 1MQ4A 2IW9A 4ACMA 1OKVA 1IG1A 2WOTA 2YACA 1XJDA 5HE3A 1Q4LA 3MY1A 4G9RA 3KRJA 4EOSA 4IEBA 3KCFA 4YGAA 3BGZA 3QTUA 4FICA 5FXSA 4L43A 2O2UA 4TNBA 2ETRA 4ZMEA 2JFLA 3PFQA 2YIRA 1QPJA 3FLNC 4LOPA 4EOJA 3NUNA 1YDTE 3OF0A 4FZFB 4QPAA 4ZSAA 4BI0A 2C6TA 2RGPA 3NUPA 4AG8A 1PMUA 5KCVA 3TIZA 2F57A 4F0IA 4IC8A 4JAIA 2XNNA 1L8TA 3F7ZA 4ZY6A 3LCDA 3SQQA 2PZIA 1YDRE 2J51A 5HG8A
chains in the Genus database with same CATH superfamily
4FVPA 2XK4A 4FUXA 3HV7A 2OLCA 5ANGA 2P0CA 4GEOA 4JR3A 3D7TA 5M57A 2YWPA 3QKLA 4UN0C 3DDPA 5IUHA 4FC0A 3PJ8A 3S95A 3DBQA 3D2KA 4RLLA 4QTCA 2V62A 5LMAA 4V0GB 3W2OA 3U9CA 3TZ7A 3MVHA 4DEDA 4F4PA 4N0SA 2QOHA 3DY7A 3NUUA 4AZVA 4QMLA 4F6UA 4XOZA 4DEIA 3BV3A 4F1OA 2VTHA 2BRBA 5IQCA 3QD2B 3TNQB 4NT4A 1SVEA 1IAHA 3HVCA 4O7WA 2BRNA 1Z57A 3A99A 4OTGA 4M66A 1YWVA 2WMRA 3QTWA 5BVWA 5KBQA 4OTWA 3DZOA 4EH4A 5EW8A 4ANNA 4IX3A 1UU3A 4A9YA 3HMPA 3C5UA 3TG1A 2HWPA 3BYSA 2BFXA 2UW4A 2UW0A 3PVUA 5CU6A 2QO2A 3GOKA 3VBQA 3V8SA 4RX8A 4L7FA 1F3MC 3OW3A 5A6OA 3SXRA 2YN8A 5JK3A 3BWFA 4E8AA 5IZFA 4ZJIA 3L8PA 2JDVA 3WZUA 2CNVA 2PUNA 4NK9A 3QZIA 4LRKA 3AGMA 2PVYA 5F9EA 1UVRA 5CASA 2O0UA 4AGDA 3Q5ZA 4BFMA 3I79A 2J6MA 2FSMX 3DBFA 2IVUA 4G3EA 4P4CA 5D7VA 3RJCA 5AX9A 3VWAA 4DG2E 1IA9A 3MFRA 5HTCA 2C1BA 4Y72A 3MESA 5DFPA 5CT0A 3R6XA 4O0WA 1ZAOA 3PG1A 4OTHA 4UYAA 2PZYA 3BELA 2BCJA 3G2FA 3WE4A 3HGKA 2VNYA 4O6EA 5BYZA 5ACKA 3MSSA 3ZOSA 3PJ2A 4ZZMA 4WNPA 4RRVA 2JDOA 4QT1A 2C3JA 5FDXA 1NW1A 3UBDA 3LFQA 4O83A 4R6VA 4NJDA 4RX9A 4YPSA 4Z3VA 2VTMA 3Q9WA 1KV1A 3T3UA 5C27A 1L3RE 5ACBC 5AUTA 2B52A 3ZM4A 5JFSA 4R7HA 3EQPA 3NW7A 4NSTA 4O38A 2X8IA 4LMUA 1H27A 4MCVA 1GIJA 2IVSA 2XUUA 2G15A 4PNIA 1IA8A 3F6XA 3EHAA 2WQEA 3IW8A 4MQ1A 3WIKA 1SNXA 2XB7A 2G01A 3M11A 3M2WA 4D9UA 5KKRC 1PMEA 5DA3A 3DKOA 5AV4A 4IW0A 4FUYA 3PTGA 3ZC5A 3FL4A 5HX6A 4GW8A 3HA6A 4W4XA 3OCTA 4Y95A 4L3JA 2HZ0A 2H6DA 3LJ2A 4XLVA 2HZ4A 2P2HA 3CE3A 3UODA 4L6QA 4II5A 3ORIA 3UDSA 1JBPE 3ZSHA 4IACA 3LFDA 3Q04A 2XJ2A 3GVUA 2XK7A 4Q5HA 4MXAA 4ZTLA 3DAKA 3BQCA 2OU7A 4Z55A 4O0YA 5LWNA 4EOLA 2WEVA 3E8DA 1PF8A 4RVLA 1ZZ2A 3CTJA 3EL7A 5CI7A 4DF3A 4J71A 1FMOE 4QP6A 4U44A 3ACKA 4KS7A 3ZBFA 2QONA 3FZSA 3I6WA 3VRZA 3UPZA 4HGTA 3V6RA 3KXNA 3R00A 2IZSA 4XYFA 4G6LA 4DCEA 2IJMA 3WOWA 2QURA 2W17A 5LMKC 3WYXA 1JSTA 4U40A 1I09A 4JLCA 3CJGA 1UNLA 1YKRA 4I94A 4BCQA 1OGUA 3HNGA 5AJQA 2V7OA 3W8LA 1G8JA 3EN6A 1VYWA 1Q8TA 2NYAA 4ONAA 3KULB 4LYNA 5DI1A 3NGAA 1R0EA 1CKPA 1NVSA 2UVXA 3FHIA 3KFAA 5BMMA 4Y46A 3TCPA 3TZ8A 4EWHA 4XJ0A 4H36A 3C5IA 3GCQA 3Q2MA 2QR7A 3PA5A 4JRNA 4XG6A 5FP6A 3R1SA 5HD7A 3PWDA 2OW3A 2VWXA 5C03A 5IA2A 4NIFA 5J7BA 3FZPA 3VUGA 3IOPA 3RK5A 3W2PA 2FYSA 5HVYA 1NXKA 3O8UA 1R1WA 5ETCA 3W0MA 4LGGA 3W0NA 3QQHA 1UKHA 3EQDA 4CCUA 3ORZA 3NPCA 4X6RA 4PP7A 5HESA 3GGFA 4AE6A 2FSOX 4FEWA 1ZOEA 4WOVA 5DEYA 4FSWA 1ZYSA 5AR5A 3U87A 2WTIA 1XMMA 1DS5A 3ORNA 3TYKA 3V5WA 3OXTA 3LCSA 5CEMA 1HOWA 3UP2A 4EOQA 4B8LA 4C61A 2WGJA 2VO3A 4J8MA 4RQVA 2W1ZA 3MDYA 5DN3A 2UW8A 3UO5A 2VNWA 2QKWB 4KABA 3LJ0A 1PYEA 3JUHA 4J52A 4IQ6A 3LJ1A 4PDOA 4QMWA 4RIOA 4JG6A 4AXCA 3EZVA 3OG7A 4CKRA 1WVWA 4FTUA 4O7VA 2JKQA 1URCA 1TQMA 2R3NA 5FXQA 1XWSA 5LCJA 4U43A 4QP8A 3ZO1A 2PYWA 2FVDA 2X4ZA 3BYUA 5LVNA 4BHZA 2ZYBA 2HELA 2X0GA 3FMDA 5L2QA 1TQPA 3IO7A 2PZ5A 3QQGA 3HV5A 2IF8A 4EH2A 2UZTA 4V05A 4L01A 3MA3A 4PY1A 4ALUA 2YITA 2WHBA 3W8QA 3IGOA 3NW6A 4IXPA 4RA4A 2BKKA 1SZMA 3ORXA 5EW3A 2PUIA 2WMTA 4U6RA 3GEQA 4TNDA 2XAOA 3NWWA 4IAKA 4AT5A 1A06A 2FUMA 5KHXA 2VTJA 3FC2A 4WUAA 4OT5A 1PY5A 1U5RA 2CGUA 1K3AA 3SC1A 1P14A 4BCOA 3Q6WA 5AR8A 4AWIA 5CEOA 2QHNA 3W0RA 3ZLWA 3HV3A 4LI5A 5E8WA 4E3CA 4EKLA 4E20A 4BCIA 3WZKA 3WF8A 4DYMA 4F6WA 4MF0A 5IQFA 3E87A 1UWHA 3IDBA 5KMMA 3R8MA 5BQ0A 3IOKA 3HX4A 2VWUA 1CM8A 3E7VA 5ANEA 2H8HA 5M06A 2Y7JA 3HMIA 3ODYX 2CKOA 1OL7A 3ZZWA 4F70A 3NAXA 2FA2A 3LFSA 2W0JA 2XNOA 3R7VA 1ZYJA 2R3LA 4YHJA 4FTAA 3KXMA 3AC8A 4H1MA 1G3NA 4RZWA 2CDZA 4EQMA 2JAVA 2XH5A 4LGHA 3NVMB 3L1SA 3R02A 4D2WA 5EHLA 4BCGA 3DJ5A 5E1SA 4DT8A 4AGWA 2CGXA 1Q8UA 2QOQA 3KU2A 3G0EA 1OB3A 2RFSA 5T68A 4LGDA 1B38A 1PXLA 2ZB1A 4G5PA 4WKQA 2JKMA 4YP8A 5LJJA 3DCVA 3RPRA 4IB5A 3P0MA 3L8XA 3FSFA 4GS6A 4OW8A 2UW5A 4MNEB 3A7FA 4GK3A 4XG4A 3L9NA 3OWJA 3W0OA 1XH7A 3ORLA 1PXKA 4A9UA 2UW6A 3U8WA 4D55A 3ATSA 2QO9A 3R7UA 5IEXA 1U46A 2GCDA 4Z16A 4BJJB 4YPDA 4D5HA 4D5KA 3MH3A 5K4JA 3D5VA 3QC4A 3OROA 3OT3A 4BCFA 4UB7A 4MBLA 3C51A 3DJ6A 3P86A 5F95A 4FSYA 4S31A 4YTHA 3FL5A 3QRJA 4RIWA 3FQHA 4E5WA 4AN9A 3W0SA 1W8CA 4M7IA 3EKKA 2VU3A 2Q83A 4QMPA 2GQRA 2CNQA 4D2PA 5AV1A 5KX8A 4UXLA 4AZSA 3U51A 4KUJA 3LVPA 4EQCA 2ERZE 3W1FA 4AU8A 4A06A 2JDRA 4IX6A 4IFCA 1H8FA 4NW6A 4QMXA 2UZEA 5M44A 4BF2A 3JVSA 2R3IA 4XV1A 1GNGA 4JBVA 5JGAA 5KKRB 3AD4A 4CFXA 1AD5A 4DH3A 3DU8A 3E8CA 4J98A 2Z7QA 4X21A 1ZZLA 3KA0A 3O17A 4H3BA 4OT6A 3NS9A 4JDHA 4CTBA 4KKEA 5I5ZA 5JT2A 2XM8A 5K0XA 4TYEA 5JMSA 4RJ5A 3VJNA 1BI7A 3KC3A 2VWZA 4EKKA 4RZVA 5CENA 2R2PA 4FKLA 4RA5A 2VGPA 4FV7A 3E62A 4IWOA 3KXGA 3BIZA 2QG7A 5AAFA 1LPUA 4Y8DA 2XAMA 5ANDA 3FMNA 3UE4A 5JN2A 4IVDA 3F2AA 1ZARA 4AXDA 5IQEA 3TV4A 3QXPA 2XYNA 4G3DA 5H3QA 4NM5A 2PY3A 3LXPA 4FI1A 4NM0A 4M13A 1OPKA 4CFWA 5HNIX 1B6CB 2ZOQA 2CCIA 4L52A 4EH5A 3HAMA 3VUIA 2ITZA 4CFFA 3UDZA 4PMMA 3AMBA 3PG3A 3QXOA 1U5QA 4IVAA 4HVDA 4NYEA 3MH2A 4BYJA 3GOPA 4I0TA 4HVSA 2WQMA 2ITWA 4EK3A 5GJGA 2RKUA 4V04A 3FSKA 4L3LA 3R0TA 5L4QA 3E88A 4UY9A 4MD8E 4RFYA 3U4WA 3KK9A 4FF8A 3QD4A 4NM7A 4QYFA 5BMSA 3TUCA 2WEIA 3TI1A 3KB7A 5GZ9A 1M17A 5GJDA 2J5FA 4O4FA 3EFKA 2IEWA 1BUHA 4J8NA 2BIYA 4ZS4A 2XK8A 3CIKA 1SNUA 3F88A 3ODZX 4FKPA 4GIHA 3MPAA 1RJBA 2VO6A 3ORTA 4KBCA 5J87A 4JIKA 5A14A 4E6CA 2C69A 3UYTA 3I0QA 4CZTA 4GMYA 2NRYA 4UZDA 4OR5A 3QQKA 5LOHA 2RFDA 4RT7A 5CU4A 5KMJA 4KIKA 1ZYDA 3PY3A 4HGLA 4IIRA 2BDWA 4FV0A 3QAME 3EJ1A 4DT9A 3OUKA 4HW7A 4O7ZA 4PMTA 3TZ9A 4PTGA 2JIVA 4D1SA 3F2RA 2YZAA 4NTTA 4EZ7A 3COMA 3LZBA 4L9IA 3R7YA 1E9HA 1O6LA 4FTCA 3A4OX 3DKGA 3E64A 4QQCA 5A4QA 4J97A 4YBJA 4ITHA 3PWYA 5AP3A 4N6ZA 3RP9A 4F9BA 3H9OA 4YLKA 3EB0A 2WTJA 3WZDA 4DINA 1JWHA 4C4HA 3LFEA 3UC4A 2B7AA 2UV2A 4YSMA 5JFVA 1P4OA 3TV6A 3TV7A 2XA4A 4P5ZA 2OO8X 3ZFXA 4J95A 3QTQA 4ZK5A 3W2QA 4YLJA 3D7TB 3ZUVA 3ENHA 3FMJA 3V01A 4F0GA 2C6OA 3IS5A 3OHTA 5A4TA 5A9UA 4DLIA 3JXWA 3DXQA 5GIPE 5BUJA 4XS2A 3W2SA 4GU6A 4AFEA 3I5NA 3VRYA 4WSQA 4B9DA 4M0YA 5F4NA 4BTMA 3TDVA 1AQ1A 4GH2A 4NWMA 4UX9A 2XALA 3T8OA 3IW4A 2PVMA 5HCYA 5AR3A 2YEXA 2C3KA 3KRRA 3QWJA 4PMPA 5M4FA 5J5SA 1ZWSA 4K6ZA 2FH9A 3QD0A 4FEVA 2ZDTA 4PP9A 3NX8A 4I20A 3VS2A 2X0PA 2ITYA 4QD6A 1OL5A 3TKUA 2ESMA 4ANSA 4MBJA 3PDTA 3EQGA 4UEUA 3PIYA 4D4RA 3D7ZA 3AD5A 3FMMA 3LCKA 4G6NA 3RMFA 3OP5A 4C2WA 4R3CA 4C4FA 2W5AA 1IRKA 3JS2A 2P2IA 3BYVA 3NAYA 4FSZA 3UIBA 1ZRZA 2HZIA 4S34A 3UOLA 3QRKA 4APPA 2VX3A 4XP2A 3G9NA 5J5TA 3AXWA 5A46A 4Y85A 1JPAA 2VD5A 3OT8A 3QF9A 4FV2A 5CTPA 5EYMA 2QQ7A 3RAWA 4K1BA 3ZSIA 5E8XA 2JEDA 2UZLA 5AA8A 2ITPA 3VBWA 4FOCA 4I24A 3P78A 4K33A 5EDPA 2I0EA 4HYHA 1OGYA 3V3VA 2QHMA 3SVVA 3QLFA 4GJ2A 4EH7A 2EWAA 5IA5A 4C34A 5G1XA 2A98A 5H8GA 2CJMA 3PXQA 2J0MB 4RBLA 5BUEA 1U54B 2IZTA 3ZO4A 2YJRA 3OC1A 3ZYAA 2JDTA 3P1AA 4TYGA 2PL0A 1CTPE 4NU1A 4C37A 3WF9A 2AC3A 3VONA 3OCSA 2OH4A 2VUWA 5AWMA 4R7BA 2GHMA 4DHZA 4W8EA 4ZTRA 3QGYA 5JGDA 4L3PA 3GCUA 4BDHA 3EYGA 2UZOA 3FMLA 2GU8A 2HENA 4IJ9A 4Y5QA 2AC5A 3R63A 3N4TA 4M97A 2ZAZA 4I5PA 4BDDA 3PIZA 4BBMA 5KHWA 5LARA 2YIWA 4K2RA 4GJ3A 1AGWA 2QO7A 5J9LA 3FQEA 1OIQA 3L9PA 4R3RA 5HNGA 4ENYA 4ZOGA 2VGOA 2WOUA 3E3PA 5FM2A 1BL7A 4GFOA 4JRVA 1OUKA 3H0ZA 4D2TA 4AQCA 4KRDA 2B4SB 5DOSA 2NO3A 3FZOA 3MFSA 4MXYA 3KRXA 3Q3BA 3R8ZA 4TPTA 2CPKE 4AFJA 2DQ7X 4HZRA 4XG8A 4KIPA 3PXFA 4JQ8A 4YZDA 4O2ZA 3RWQA 3LIJA 1OITA 4MD9E 4D0WA 4CCBA 5EOLA 4E4LA 3OEZA 4CFUA 3JY0A 3AQVA 3Q5IA 2R3GA 3GCPA 4JBOA 4QNYA 5A4CA 5E8UA 4ACCA 3NFGB 3GT8A 4EUUA 4C4JA 5HLWA 2SRCA 1XH5A 2XK6A 2R9SA 4BDJA 3UG2A 5LVPA 2BHEA 4FG7A 5GIOE 3DBCA 4BDEA 5HU3A 3U55A 4CVAA 3HA8A 3PA4A 4C58A 1PMVA 2YIYA 2OIDA 3VS0A 3UQCA 5BYLA 3D9VA 3PXKA 3OMVA 4C59A 4FKWA 3ULIA 1PXIA 3OW4A 4E6QA 4MX9A 1YVJA 4FE2A 4GSBA 4B6LA 5J79A 4IAYA 2OICA 3A7GA 4WBBB 1JOWB 4XCUA 4FIFA 4BDGA 2AUHA 4XV9A 1GIIA 4IX4A 2YDIA 5D11A 2PULA 3CY2A 2F7EE 5AUVA 4C35A 3OVVA 5IU2A 4O7SA 3QTZA 5A54A 1KE5A 3OFMA 4PV0A 1G5SA 2R3PA 5AUYA 3EL8A 3V8WA 4NIFB 5IUGA 4PL3A 1KV2A 2UVYA 3PXRA 3RNYA 4FT5A 3ZRMA 2V5QA 4O0VA 2XNBA 3COKA 3CKXA 4J7BA 3D5WA 4YZMA 5AV0A 2LAVA 4IX5A 2XIKA 4AACA 4PUZA 4DEAA 2IVVA 2PHKA 4EBWA 3F5GA 2R3FA 2XKCA 1YHVA 5FQDC 4QP7A 1GY3A 1OI9A 4BVUA 1ZYCA 2GFCA 2A1AB 2XP2A 1Q24A 1V0OA 2WB8A 3HV4A 3QRIA 4I92A 1OECA 3ROYA 3LKMA 4I6BA 2IW8A 3W2RA 5D10A 1SMHA 3N4UA 2J7TA 3EN7A 4E6AA 2BAQA 3IG7A 3ZLSA 3FLSA 2XIZA 3P7BA 3PA3A 4G6OA 4ZTNA 3R8LA 4RX5A 3RK9A 4ZZNA 3H0YA 5E8YA 1YW2A 2CLQA 2I0HA 5BVNA 4E4NA 3SRVA 4GRBA 5T3QA 4M0ZA 1CKIA 4AAYA 1ZMVA 4H1JA 4PDSA 4XOYA 3MIYA 4USFA 4GIIA 2C6IA 4BDIA 3MTFA 4IAAA 3U54A 1VLRA 4FSQA 5AUWA 5C01A 3KGAA 2C6LA 3KQ7A 4WRSA 4IM2A 2XCHA 5F94A 5KE0A 3SDJA 4UMTA 3QX2A 4PPAA 5HVKA 1M52A 4IH8A 4JS8A 5GNKA 4DLJA 1O6YA 1ST4A 4RJ4A 5CY3A 2IZUA 3DPKA 4HCVA 3PJ1A 4F08A 4I22A 4X7QA 3U4UA 5HO6A 4OTDA 4QNAA 5D12A 1PW2A 3R9NA 2X8DA 3FQSA 2OJIA 2OG8A 3BHYA 3LFBA 3REPA 4M68A 4YTFA 3FY2A 3C0IA 4IM3A 3A8WA 4DG3E 4UZHA 4NFMA 5JSMA 3TEIA 5AP6A 3HRCA 1YI4A 3IW7A 3MB6A 3MJ2A 4YZBA 3GC0A 2E2BA 4HGEA 1ZOHA 4EOIA 3ZBXA 4YO6A 4WNMA 1SM2A 3WF5A 3UOHA 4NH1A 1EH4A 5KMIA 4BN1A 2NNWB 2HAKA 4RFZA 2R3JA 2BALA 4FRFA 4P7EA 2ZMCA 3DTCA 4QTDA 3PFYA 1KSWA 5IQDA 4ITJA 2CCHA 4BCMA 3QA8A 2BR1A 3UP7A 4HVHA 1O9UA 3ZRLA 4FSMA 5KO1A 4B4LA 4X2NA 2WD1A 3MIAA 4I41A 3VN9A 3ZS5A 5CAVA 5IA3A 5ICPA 3KXHA 3SXSA 5DR6A 4WD5A 3F9NA 1IEPA 4QYHA 4BGHA 2HK5A 1KE7A 3ORMA 4AUAA 1MP8A 3AGLA 2FB8A 1TQIA 1Q62A 1O6KA 2QR8A 2YM8A 4DGLC 1F0QA 2BZHB 2C5NA 2XIXA 2XZSA 3DAEA 3Q4CA 1SYKA 4G31A 1FPUA 3R8VA 3V5QA 3ZLYA 4AN3A 1ST0A 4RIYA 5CSXA 4EH9A 4EHZA 2IWIA 2WAJA 4FTNA 4DBNA 4L68A 3DTWA 4U0IA 5TR6A 4MF1A 4O1OA 4O7YA 2ZM1A 3BBWA 4BDBA 2X0QA 3VBVA 3VIDA 4QP2A 4JDJA 3A7HA 4E5BA 2CHLA 3A62A 4JBPA 4RIWB 2WXVA 4KSPA 3FI4A 3PPKA 4FGRA 3WYYA 1V0BA 3Q96A 4I0RA 4WG4A 5EI6A 5CXZA 2BKZA 2X9EA 3CQWA 2VX1A 1YDSE 2WU7A 3GU7A 1KWPA 5FBNC 3UVQA 3VO3A 4CYIA 4ZZOA 1YXTA 1J91A 3O96A 1BKXA 5A3XA 3D83A 4M12A 3AKKA 4YBKA 2J2IB 5M51A 1FOTA 1KE8A 3DKCA 3IW5A 2CKQA 3AC1A 4DFYA 3G6GA 3D14A 3HRBA 3O51A 2PVJA 4I23A 4KS8A 5CSVA 5HE2A 5CAPA 3P9JA 2R0UA 3FI8A 4NTSA 3EQFA 3LOKA 3QTIA 4QQTA 4YUQA 3DA6A 3K3IA 1A9UA 4PRJA 1GAGA 3EFJA 2IG7A 4YC6A 4AW5A 2V0DA 3FI3A 2GNLA 5IISA 3QU0A 2YZLA 4DGGA 2WQNA 2QOBA 2OJFE 1FINA 3I5ZA 3QHWA 5DRDA 4D2SA 4WNOA 4ERKA 4O7TA 1YXUA 1JKSA 3P5JC 4YJTA 3KXZA 2YISA 2A0CX 5HCXA 1UKIA 3UC3A 4CQGA 5CI6A 3BCEA 4ZY5A 4RC3A 2UUEA 1H24A 4NW5A 4W9XA 3LFNA 3GENA 3LLTA 4MTAA 5HHWA 4LL0A 4JVGA 3WARA 3E7OA 3B2TA 2OJGA 3CR0A 3F3TA 2BDFA 3GC7A 4FL2A 4WT6A 4OTIA 3RINA 4E7WA 3R71A 4I6HA 4E6DA 3U6JA 5BNJA 5IH5A 1JSVA 5IDNA 2GPHA 4C57A 2QC6A 3KY2A 3RI1A 3R9DA 3UZTA 5FWKK 2F9GA 4OTQA 5KUPA 3WZJA 3HECA 2Y6MA 3MA6A 1WBPA 3E63A 2WMAA 1GOLA 1XHAA 3QC9A 3VS6A 4KSQA 1VR2A 5EHYA 3F2NA 3KF4A 5FLFA 5FBOA 4RWJA 2Y8OA 5M4CA 2A2AA 4MH7A 4AN2A 4D2RA 4OTPA 5M4UA 3SXFA 2ITNA 3RPVA 3IK3A 3P23A 3ZDIA 2J50A 3FV8A 3F7WA 1DM2A 3FPQA 4MK0A 4BZOA 5FGKA 4EOOA 5C1QB 2QG5A 4RGJA 4EOMA 4FEUA 2LGCA 4ZXTA 2HY0A 3DS6A 4W4VA 4O81A 5FTGA 3TWJA 5AP0A 5CALA 5H8EA 4G3CA 4U81A 4V01A 2W1FA 1PRYA 3FMHA 5I3OA 3F82A 3UJGA 4KIKB 4D0XA 4AF3A 2B53A 4BIDA 5C8KA 1URWA 3AG9A 3EH9A 2UZWE 2XKEA 3WZEA 3LLAA 2YIXA 3FWQA 4BZNA 2OFVA 5HLNA 4F9AA 2BHHA 3FPMA 1S9IA 3V5TA 3QYWA 4O4DA 4IBMA 1UV5A 2ZJWA 2X7OA 3DGKA 3A8XA 3P7AA 4FR4A 3NZ0A 4GCJA 5C9CA 4D4SA 4AXEA 3TUDA 2HY81 4ID7A 3G15A 3QD3A 4BBFA 3ZLXA 2O63A 4ZLOA 5ITAA 4FV8A 4F1MA 4FKSA 5JGBA 2VTRA 4GYGA 3BYMA 2NRUA 5EHOA 1CKJA 5IH6A 1JLUE 2VX0A 4FT3A 3I0OA 3UGCA 3Q4UA 1TKIA 3CPBA 4OTFA 3EFWA 4QP4A 3QFVA 1FVRA 1W0XC 5AEPA 4G1WA 1E1XA 4BCNA 5TO8A 4EOKA 1MRYA 3C4FA 4FNWA 3NNXA 5IG1A 2YM4A 3SW7A 1OIYA 4IB3A 4KB8A 3SKCA 3QCSA 5K0KA 4AW0A 1OKWA 4BL1A 3HP5A 3RAIA 4C4EA 4GK4A 2CKPA 3THBA 4U80A 5CU0A 4J99A 4GT3A 4Z9LA 3EZRA 2IW6A 2O64A 3AOXA 3KN6A 2UW9A 2YM5A 5E8ZA 2R3OA 3LM5A 1OM1A 5EYDA 5L6OA 3AC4A 3BYOA 5AR7A 3BL9A 5HIBA 2BVAA 3ELJA 3ET7A 2OXDA 4BYIA 4H3QA 4JR7A 4E4MA 1K9AA 3FY0A 3R04A 1JVPP 3BEGA 4QTBA 3NIEA 3VS7A 4FVRA 3PUFC 1ZY4A 2JITA 1JQHA 4N57A 3KXXA 3NUYA 4FG8A 4R3PA 5D9HA 4CLIA 4Q5EA 5BX0A 3GBZA 1PYXA 1IASA 2FSLX 3R01A 2F4JA 4HCUA 5CEQA 1Y91A 4GVAA 2Z2WA 3FXXA 4K8AA 1T46A 1WVXA 2O3PA 2WMXA 2J0IA 3BU5A 2X1NA 3OXZA 5GJFA 4EEVA 3F3VA 4M69B 4FZDB 1CMKE 3S2PA 3QUDA 5AMNA 3DK6A 4YNEA 2ZM4A 4DH8A 2HWOA 4F0FA 4D1ZA 4L45A 1XH4A 4AW1A 1QCFA 2OIQA 4IWPA 4QTAA 3ZSGA 4XG3A 3TNWA 2AYPA 1H0VA 3C0HA 2B9JA 3MVMA 3QBNA 5E1EA 4DAWA 3KIOC 2R5TA 2HXQA 4ZTMA 5AP7A 4Q2AA 4O0TA 3PSBA 5EQEA 5AM6A 1R39A 3FE3A 1Q8YA 4DFNA 3BV2A 3CPCA 4NFNA 3VW8A 4AA0A 4UMUA 4F7NA 4MVFA 4MXZA 4MD7E 2X2LA 4WRGA 5AUXA 4ASXA 5HU9A 4FIGA 3BGPA 2YLEA 2A27A 4ITIA 5TE0A 4XBRA 4B0GA 4P90A 3A7IA 3P7CA 1YRPA 2GS2A 2JKOA 4BWPA 5CF6A 5L2IA 4FIIA 5EM7A 4IADA 2YCFA 3FKLA 4AW2A 2BRHA 1QPDA 4KRCA 4J96A 5FEEA 4O7RA 4MQ2A 4LUEA 1PKGA 1UNGA 2H9VA 3K5UA 2PVRA 3E93A 4FSUA 3UMWA 4V0GA 5HG7A 1FGIA 4ANQA 3O0GA 4QYGA 3N51A 2J0JA 3UYSA 3PRFA 3VQUA 4B8MA 2XARA 4I5CA 5CT7A 5HCZA 4PX6A 2YJSA 3MS9A 5EYCA 4AZTA 3FMEA 3EOCA 4B99A 2Z60A 3OBJA 4XP3A 4EZ3A 3SW4A 3DK3A 3NSZA 3TTIA 3KMMA 3P79A 3CY3A 4D4YA 3G6HA 4F1TA 5ETAA 3CC6A 2CN8A 1QPEA 2P33A 3KVXA 2XK9A 3MY0A 3C4ZA 4JDIA 4KIOA 2XRWA 3RBWA 3T3VA 5IA0A 3RHKA 4QPSA 5KZ0A 3W55A 3R22A 2ITVA 4O0XA 3VAPA 2X39A 3COIA 4FYNA 3ID6C 4A9SA 5HBJA 4UWCA 3CEKA 4FK6A 3SX9A 3R1QA 1WBSA 2GSFA 3ZH8A 3HDMA 2PVNA 2Y4PA 5HOAA 3PUPA 4FIEA 4HVIA 1FBNA 2PMIA 5E8SA 3C9WA 1H00A 3HDNA 5EDRA 2CSNA 3NRMA 4U42A 5M55A 2HW6A 4BB4A 3Q9XA 5BVOA 3ZCLA 2JD5A 4UBAA 5AAGA 4TWOA 5L8JA 2B1PA 2XBAA 3KRLA 5I9UA 4GT4A 5EDQA 1R78A 1STCE 2Z7SA 3GFWA 3HMOA 3KEXA 4F7JA 5B2MA 4UMPA 5CQUA 2QU5A 2ZB0A 4CGAA 4FZAB 3UMXA 2C0TA 3CGFA 3ANQA 4JX3A 5AX3A 3OTUA 2R7IA 3QQFA 3FLWA 3RM6A 1TVOA 2WTKC 2R3KA 2VWBA 3A2CA 3TACA 2YCSA 4WG3A 3NCZA 4QDEA 2EXMA 2GTNA 4JQEA 3OBGA 5AIRA 3I7BA 2C5YA 3F5PA 3POZA 3NNUA 4FMQA 4S33A 5CF4A 4K9YA 1YWNA 4JG8A 5DNRA 2JIUA 4R7IA 3GXLA 5IEVA 3E5AA 3FBVA 2Z7LA 1PXJA 4AXFA 3JY9A 4KWPA 4KAOA 3H30A 4BDFA 1QL6A 4PL5A 4UXQA 3SD0A 4O4BB