5FDXA

Structure of ddr1 receptor tyrosine kinase in complex with d2164 inhibitor at 2.65 angstroms resolution.
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
280
Chain Sequence
DFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epithelial discoidin domain-containing receptor 1
publication title Structure of DDR1 receptor tyrosine kinase in complex with D2164 inhibitor at 2.65 Angstroms resolution.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 280
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fdxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5fdxA01
4C3PA 3P78A 3K5UA 4YJOA 5CWZA 5TT7A 4EBVA 1OKVA 1UU7A 4GIIA 4JQEA 5GJDA 5H8GA 4R7BA 3WE4A 2WMSA 2YJSA 1S9JA 1A9UA 2XA4A 3PY1A 4G31A 2ITVA 3BPRA 1KV1A 3ET7A 3R9OA 5GZ8A 1CDKA 1V0BA 4O0WA 4J52A 4S31A 4TYGA 5IQEA 5EW9A 2XEYA 4C37A 5CS6A 4GFMA 1FBNA 5IA4A 2ETRA 2GMXA 3W33A 5AIRA 3GBZA 3FPQA 3ZBXA 4Y95A 4C2VA 2ZM4A 2YDJA 2F57A 5GIPE 4YP8A 4HYSA 3HGKA 4M69A 5BYYA 3VWAA 4JIAA 5BMMA 2W17A 4MXXA 3LFDA 4FSYA 4CKJA 5J9ZA 4MD8E 3RK7A 4AA0A 4HVHA 1URWA 2IJMA 2XJ0A 4RQKA 3HMNA 4DYMA 5BMSA 3ZSHA 3D14A 4ORKA 3GQLA 2R5TA 1HOWA 5GZ9A 4EOQA 3RGFA 4YSMA 2XH5A 4AGCA 1QL6A 3F3ZA 1QPJA 5CSXA 1Q5KA 4DCEA 3UYTA 3PLAE 3DGKA 5LMAA 4D58A 4I5MA 3ZO4A 4U97A 5AFVA 4V05A 1PW2A 4BC6A 5CX9A 4HCUA 3IQ7A 1IA9A 2XRWA 2YABA 2W1GA 5IEYA 3KK9A 3DJ5A 3GOPA 2PVKA 3QHRA 3Q2JA 3E8NA 4WSYA 2ZV7A 3DK3A 4E7WA 2XCHA 4FL1A 2X8EA 4Z55A 2VTOA 4G3GA 4JRNA 4BF2A 5IH4A 5J7BA 3LXLA 4AZWA 2C6DA 3R7GA 1CSNA 4OBPA 3NWWA 5I0BA 4QMUA 1ZAOA 3NUYA 4XBRA 3VS1A 3D7TB 5L8KA 2X8IA 4F63A 4PL5A 3VRZA 2JKMA 3Q04A 4O6LA 1R39A 3LFQA 4U42A 3R2BA 4FV5A 2EUFB 4RPVA 3UMWA 1MRVA 3PG1A 3BBWA 4EH8A 5EQYA 2H6DA 2W0JA 3PJ8A 1VJYA 1BYGA 3R7UA 1ZOHA 2VX0A 2NRYA 3KK8A 3MWUA 3A61A 2O3PA 5HICA 1JSUA 4ANOA 2QR7A 3KVWA 4XEYA 3RCDA 2ITZA 4GT3A 5C03A 2JKKA 4QPMA 4DC2A 3MSSA 3RK9A 4O7RA 5M4CA 2JEDA 4ZJVA 3RNYA 4JT3A 3P0MA 5KX8A 2CGXA 3IK3A 5C1QB 4BDHA 5FTQA 5HORA 4D2WA 3CTQA 3BBTB 3QD4A 4EYMA 3PA4A 2PVHA 3RM7A 3W10A 3QXPA 3JY9A 3ZZEA 1OM1A 3HA6A 3F3TA 3W55A 1L8TA 1UA2A 4RWIA 5H2UA 3VW6A 4D0XA 4U3ZA 5EYCA 1BL7A 3F69A 4S33A 4X2JA 3E92A 4DEGA 3E8CA 5AWMA 3F3UA 4E5WA 5KBQA 2WTKB 2VTSA 3POOA 4BKZA 4U6RA 4XUFA 3M42A 4O7TA 2OJGA 4EH5A 4FEXA 1FPUA 4JDKA 4I21A 3BLHA 2GFCA 3PXFA 3MFUA 5HEZA 4TXCA 4NFMA 5IQAA 4WUAA 5CLPA 3SGCA 5E9EA 3D15A 4F6SA 5HG9A 3O0GA 5ANIA 4X2NA 2YLEA 5C26A 2CSNA 3UTOA 4APPA 3ORZA 4W4XA 1O6LA 3R8PA 4JI9A 3UOLA 5EH0A 4N4SA 5HU9A 5M4IA 1PXIA 3PP1A 4DCAA 4BDBA 3Q60A 3QLFA 3DK6A 3BQCA 3UPXA 2BZJA 3QRKA 1VYWA 4P90A 2OF4A 2R3HA 1DM2A 4HJOA 5CVGA 2VTTA 1WBWA 3RTPA 2WEVA 4G3DA 5IQIA 4B6LA 4YMJA 3D9VA 1K3AA 2ITYA 4WBOA 5KKRC 2ZAZA 4L3PA 2R4BA 4M12A 3HA8A 4GS6A 5BVWA 1STCE 3H30A 1KE8A 3I60A 4ASXA 2IW6A 1H00A 4IX5A 4NYEA 2ERKA 1PHKA 4QYHA 3ZTXA 3O7LB 1EH4A 2VWIA 2ITTA 3RPYA 3DAJA 5EI6A 2WAJA 3KF4A 2VUWA 5K0XA 3UE4A 4BI2A 3EYGA 4O27B 1XBAA 4D5KA 2ITXA 2BILB 4DE4A 3UNKA 3OBGA 3CC6A 4E8AA 5DH3A 3KULA 2G15A 5AP2A 3JYAA 1YI3A 3LAUA 4BCGA 2ESMA 1PRYA 4IZ5A 1Z5MA 2R3JA 4PWNA 3BHHA 5EM6A 1ATPE 5AM7A 2QURA 3TN8A 3DS6A 4FZ6A 1U54A 3R7OA 4EKKA 4YLLA 4EL9A 4C57A 2C3LA 1E9HA 4LRKA 4XJ0A 3OG7A 2YLFA 4MBIA 4E1ZA 2QOQA 3LVPA 2JFLA 2GSFA 2WHBA 3PJ3A 5EFQA 5M51A 4FR4A 4FC0A 4GRBA 4I0SA 4DFBA 1B38A 4FV2A 5CAOA 5JGBA 2W96B 2ZM1A 1XH8A 1H0WA 3TV7A 4JBPA 4N6YA 3P1AA 2VWWA 4I6BA 4ZSEA 3BYMA 2QO2A 1ZLTA 3B2WA 3GCUA 5AV1A 4CFVA 3BHYA 4ITIA 4KINA 5DT3A 4YUQA 3HAMA 4AE9A 2CPKE 5DGZA 2C0IA 4IAAA 4DGMA 2BKKA 4QP7A 5E8VA 2VO6A 2BIKB 3DNEA 3RPVA 4YU2A 4KUJA 3D7ZA 3GC9A 1OECA 4AXAA 4GUBA 4YZDA 5HNGA 4ZTRA 4U0IA 2I6LA 3MA6A 4FKQA 2YIXA 4FNXA 2ITUA 2UZVA 4CZUA 4DITA 3EQRA 5KNJA 2ACXA 4KB8A 2R3PA 4O21A 1IAJA 4ALVA 3QL8A 2VWXA 3TNHA 3GU4A 3R73A 3AC8A 2W5AA 5D41A 5FWKK 2Z8CA 4QMYA 3RP9A 3MTLA 2VO3A 4L45A 4V01A 5HOAA 3C13A 4O82A 4LFIA 2FUMA 4AWIA 3ZRLA 5K4IA 4Z9LA 2QOCA 1UNHA 4QMWA 2C68A 3DBDA 4YJVA 3RINA 2PVRA 2BZIB 4WNPA 3UYSA 4MXCA 2GPHA 5L8LA 3QQKA 2XM8A 4FOBA 4IWQA 2XIKA 3CBLA 3QTZA 3KN6A 4E5AX 1H8FA 1OIRA 3AD4A 4BB4A 1YHSA 4PMMA 3A8XA 3BGQA 5FDPA 2WO6A 3CP9A 1LEWA 1XH6A 4RLLA 4FT5A 4BI0A 4QMNA 1PMEA 3BYVA 1FINA 3FY2A 3GP0A 4K77A 1L3RE 5HG7A 3ZFYA 4EOIA 2ZB1A 3AC2A 2WOTA 1FGIA 2RG6A 3HYHA 2O65A 3A7FA 4IAIA 1NXKA 2G2FA 4AE6A 4ZY5A 5FUTA 4EJ7A 4XP2A 3Q4CA 3QKMA 4W4YA 3VBWA 3HKOA 4UX9A 4IMYA 2E2BA 5KO1A 4C33A 2R2PA 5AA8A 3H3CA 4G5PA 4PMPA 2NRUA 4IQ6A 3NAXA 4NU1A 5EI2A 5I9UA 2VN9A 4EC9A 4AZVA 3UBDA 3VO3A 2YDIA 3UZTA 4FSQA 3L9LA 3Q32A 4RWLA 3FC1X 1FVRA 5I3RA 3DXQA 4CG9A 5I3OA 3TZ9A 5ETIA 4FKWA 4IEBA 4OTRA 4FKIA 3N51A 3P5KA 5CNNA 3ZSGA 4EK6A 3PVWA 3UG2A 3N4TA 3PIZA 5F1ZA 4I24A 3ITZA 3ZLSA 3G33A 4MH7A 4AACA 4D1ZA 5KMLA 3FZ1A 5LWMA 3AC5A 4FUYA 4QPSA 5JT2A 3EIDA 4F0GA 3HAVA 1BI8A 3FLZA 4XG7A 4L3LA 3Q3BA 3C7QA 3IW5A 3UO5A 3FPMA 4JQ7A 3ZDIA 4AUAA 4TL0A 3BHTA 3EQCA 4DGOA 5KKRB 2ETKA 2SRCA 3T3VA 4EOJA 4JLCA 1ZOEA 5CY3A 4QP9A 3WIGA 3PA5A 2W1FA 3UMXA 4G1WA 2VTIA 1PXKA 4K6ZA 4FYNA 4BCOA 2HZ4A 3FKNA 4EZ3A 2VTPA 3QKKA 3QD0A 4E6CA 2XJ1A 3DCVA 3VS3A 2OICA 3ULIA 3F2NA 4CMUA 2LGCA 1YDSE 4LUDA 3TUDA 3TJCA 2XK6A 4KKHA 2W4OA 4AQCA 4M0ZA 5HLWA 5DPVA 2V7AA 3EQBA 3FJQE 4GVJA 5ANKA 3ZEPA 2YM7A 4QMPA 2A2AA 4ZSLA 4E93A 4PDSA 4I6QA 5LCKA 4UMQA 4EHZA 3AMAA 3CJGA 1G3NA 4FT7A 5CTPA 4I5CA 5FXQA 1U59A 4BCHA 1BX6A 5IUIA 4IHPA 3P7CA 1YWNA 3UP2A 5AP4A 3SHEA 2CNUA 3KRJA 4DH3A 3FLYA 2RGPA 4M69B 4QQJA 3IW4A 2CHLA 2UZDA 2RKUA 4WRSA 4E5BA 4WNOA 3TT0A 4EH4A 3ZU7A 5E90A 4W9XA 2CKQA 5CT7A 4XBUA 4FKLA 3O8TA 2EXCX 3ACJA 4CZYB 1YI6A 3BYSA 4RGJA 5GNKA 3ZFMA 4AW0A 2X8DA 3T3UA 2X6EA 1TVOA 1KE5A 3ZC6A 2Q0BA 4GT4A 4WA9A 3MIYA 4LV8A 5L2WA 4IFCA 3G90X 5CU4A 3PVGA 1XH9A 1B6CB 4L43A 4DEIA 1Q4LA 3NYNA 3WE8A 3ZCLA 4L52A 4AZSA 2GQSA 3KREA 4QPAA 3VUIA 5TO8A 3WZDA 5AP0A 3DDQA 4I5HA 4FYOA 3U9NA 4MXAA 2UW3A 3PPJA 4NCTA 2OFVA 1XR1A 4FSZA 3QTRA 3F82A 5DT0A 1MQBA 4BDFA 1H08A 5J9LA 4EOSA 2HENA 3S3IA 3VW8A 4KKGA 4H3QA 4E3CA 3QYZA 2JDRA 4IM2A 2QOFA 4XG3A 4A07A 4YNEA 1V1KA 2BHEA 2W05A 5J95A 3QZHA 2IVSA 4MNEA 1ZARA 4EC8A 3Q5ZA 4MCVA 5B0XA 3A7GA 4AF3A 3ZO2A 4WBBB 3I0QA 1UWHA 3O7LD 3BE2A 3MY0A 3PDTA 2A4LA 5HO6A 5K5NA 2C5VA 3DBCA 5EKNA 2H34A 4DT8A 3RMFA 2YAKA 2XS0A 2I0VA 3KEXA 3U8WA 4CTBA 3LXNA 3EWHA 4BDKA 4D2RA 4IDVA 3C50A 3R0TA 4F1TA 2W4JA 3CSVA 3MPMA 1GIIA 4P7EA 3VUMA 4O83A 3CQEA 2C69A 4M15A 3MTFA 2O2UA 5ACKA 4C4GA 5BUEA 2PUIA 3KU2A 2CLQA 5HO7A 4FIFA 3UNZA 1ZMUA 2VX1A 4OBQA 2QKRA 2HYYA 2ZV9A 3PLSA 3QF9A 1VZOA 3I6UA 4IWOA 4FG8A 4LMUA 1R0PA 4LMNA 3PFQA 3MA3A 4ZLYA 3L9NA 4KIKA 4ITHA 4L67A 3KMUA 4WT6A 2WKMA 4YJSA 4I4EA 4IW0A 2JBOA 4DN5A 2PZYA 3OHTA 5M06A 4I41A 3LMIA 1JPAA 4BR3A 1SNUA 2XUUA 4HGLA 4V04A 3W8QA 3EQHA 4XLIA 4Q2AA 2JDOA 2GS7A 3R7YA 2B7AA 4X21A 2BDJA 4FEUA 4R7HA 5JGDA 4USDA 3BYOA 1SVHA 1UU9A 3PWDA 1Q24A 5CZIA 4OTIA 1UWJA 2ZOQA 4D4RA 3G15A 4N57A 5H3QA 3FXWA 2UW0A 2OSCA 2JAMA 4WD5A 4Y8DA 3S95A 2ZDUA 5IA3A 4MNFA 3Q9XA 4II5A 3POZA 5AR8A 1LP4A 2Y9QA 4GIHA 4OTPA 3GC8A 2YCRA 4QMOA 2AYPA 3ZM4A 4LL5A 4D2VA 3FYKX 1LPUA 4MYGA 4MXOA 3NVMB 3KXHA 4FEQA 4LQMA 4BCFA 4Y73A 3TG1A 4TTHB 3ORNA 4RX9A 4DH8A 2HZIA 2WGJA 1G5SA 5EYDA 3SX9A 4BBEA 3CXWA 3HMPA 4FV6A 5LMBA 4L3JA 3R1YA 3VF8A 3FXXA 4YSJA 4XV3A 3FZPA 2OG8A 2KULA 2W99B 4U45A 5FRIA 5IF1A 2IVUA 4TT7A 1XWSA 4BDCA 4NT4A 4CNHA 3FQHA 4L7FA 4YC6A 4FZAB 4IX4A 1IEPA 4CMTA 2WMQA 4HYUA 2J51A 5ETCA 1OIYA 2XNBA 5CENA 2VAGA 2WQBA 4EOKA 1WAKA 4PUZA 4PL3A 2J4ZA 5LVMA 4ZSJA 1PXNA 4E4XA 5EOBA 4GL9A 5ANDA 3QQFA 5HQ0A 3TDVA 2R3RA 2WMAA 3ZUTA 2W1HA 3TXOA 2Y4IB 3SRVB 3GI3A 2V55A 2BCJA 5JZNA 3C4XA 3EQIA 5FTGA 5T3QA 4RA5A 5EKOA 3BI6A 1R0EA 4P5QA 4R78A 2VRXA 3WF9A 2R3OA 3QFVA 3I1AA 4HOKA 3FXZA 2BRGA 3THBA 2GNJA 3VS4A 3NNVA 3R04A 1Q3DA 3A99A 1CKPA 4G6OA 1JKSA 2OBJA 3FLNC 3FV8A 3R9DA 4X2KA 5M09A 2R3LA 4QMLA 3V5QA 2WU6A 4AOTA 3D5XA 3H10A 3PJCA 3ZC5A 4PP9A 2F7XE 3VBQA 3Q6WA 3R8ZA 3RJCA 4FGBA 3MY1A 2FA2A 2IPXA 3FQEA 2JIVA 1ZYDA 3R22A 4AN3A 4PPBA 3NUUA 4AN2A 3LFBA 5KCVA 4EOLA 2XNOA 4KKEA 5JEBA 1FVTA 3PE2A 3QCYA 2V62A 3DJ7A 3QX4A 4L01A 3VS5A 3R9RA 3BGZA 3H0ZA 3HUBA 3L8XA 5M53A 3DZQA 1H1WA 4EQUA 3KMWA 1OMWA 3ZONA 2OLCA 3C5IA 2VTRA 4WKQA 1J7LA 2ZV8A 1YVJA 2P3GX 4IACA 1KE9A 4ALUA 4FTLA 5CSVA 4ZOGA 5LVLA 2X9FA 5HVKA 2GNGA 2YIYA 5M44A 2IZRA 4QMZA 3MGYA 3BWFA 3VQHA 4P5ZA 3BLQA 4NK9A 2B9FA 1WVYA 3TM0A 4ANLA 1RDQE 5JMSA 2G2HA 4R3CA 2BMCA 4JAIA 4E6DA 3TNIA 3QQHA 5IA2A 3SW7A 3DFCB 5IQBA 5E4HA 2ONLC 2JGZA 2BIYA 4WG4A 2HCKA 5HGIA 3T9TA 4KAOA 4BIDA 2QOKA 4GK4A 4OUCA 3KY2A 4JDIA 4AA5A 4IJ9A 1OBDA 5M4FA 3F5GA 4LI5A 3P86A 2J0LA 1Y91A 1PJKA 2R3NA 3CTHA 1GY3A 4Y72A 3MVJA 4F1OA 3ZYAA 5HIBA 4D4VA 1JVPP 5CSWA 2BFXA 3W8LA 1JKKA 1ZRZA 3VHKA 3F3WA 4IE9A 3WF7A 2J0IA 4LUEA 5FM3A 4ZJIA 4EKLA 3E7OA 5T68A 3R1SA 4QTBA 5BVDA 1OVEA 1QPCA 4KABA 3MYGA 1OL5A 1NVSA 3LFEA 4G2FA 3FZTA 2PPQA 4GFOA 3FMNA 3IW6A 2HK5A 3ZUUA 4HVIA 3UODA 3SG8A 4AZFA 4C02A 2CCIA 5LOHA 2QU5A 5FM2A 4YZCA 3C4EA 3LKMA 5JQ8A 3PSBA 4L7SA 4EZ5A 3R00A 4ITJA 3UZRA 4IC8A 2B4SB 2WZJA 4KBKA 5F94A 2IZUA 3NPCA 3VNTA 3AT2A 3HMIA 4C2WA 3MJ2A 1Y6AA 1DI8A 3LCTA 1UNLA 3QC4A 4QQTA 2QLUA 3G5DA 3NAYA 4RMZA 4RVKA 5D7AA 1YXVA 3IDBA 4NJ3A 2GNFA 3RWPA 1GIHA 4NW5A 2P33A 5DLSA 5AX9A 4Q9ZA 2I7QA 3ALOA 4DG3E 3BQRA 3PPKA 4HGEA 5IZFA 4ZXTA 3KKVA 1S9IA 2VO7A 4FV8A 2BAKA 3EZVA 4RC2A 3BEGA 4BZNA 3LPBA 2XEZA 3P79A 1CM8A 4FTQA 5HIEA 5K5XA 4D9UA 2PSQA 4TYIA 3UGCA 4S30A 2ITPA 3BYUA 3E8DA 3UIUA 3Q9ZA 1MRUA 1YXXA 3L9MA 4QMQA 2PL0A 4RJ7A 3QTSA 4H3PA 3TV4A 5HTBA 3LIJA 2O0UA 4O7VA 3R9HA 2WIHA 3PIYA 3EKNA 4BBMA 2R0UA 2O63A 4GT5A 4GK3A 2ITWA 2C5NA 3DTWA 3DXPA 5HI2A 5CU6A 2PK9A 3DAKA 4MWHA 5L6PA 3DFAA 2Z02A 4BGQA 3G0EA 4NM3A 3ETAA 2HAKA 3F7WA 4GG5A 4C38A 4AGUA 3BHVA 4O0SA 5AAEA 2J0MB 2UUEA 1JLUE 2J5FA 3E3PA 2I0EA 4FODA 4RJ6A 5CXZA 2B53A 2GFSA 3E5AA 4HCTA 5C8KA 4CLJA 2UV2A 2WQOA 3QQUA 5TF9A 3N4UA 4DAWA 4UYAA 4CT1A 4Z16A 1O6YA 4ZTSA 4G5JA 2OWBA 2PZIA 1M2PA 5LMKC 3KXNA 3RPSA 2P4IA 2ZM3A 4RJ5A 3R7EA 4CKIA 4QP8A 2PZ5A 4D4SA 5M08A 4F08A 3V3VA 1F0QA 2BDFA 1H25A 1J91A 2OH4A 3D5VA 4FZFB 2BHHA 2CDZA 2HY0A 1WBSA 3HRBA 4FTNA 4XNEA 3W18A 2J7TA 2CNQA 3UC3A 4RQVA 1U5QA 2B0QA 3MFTA 3F9NA 4IVCA 4RZWA 3K3JA 1BUHA 2CLXA 2XJ2A 5EHOA 3AC4A 1BMKA 3DAEA 3OF0A 2J9MA 3VJNA 3FDNA 2WTCA 4FZDB 4C4IA 4V0GB 1AQ1A 4O1OA 4BYIA 2GU8A 4C34A 5LXMA 3UP7A 2ITQA 5BUJA 3MIAA 5IQFA 1H1RA 4ANSA 3OEZA 4IZYA 4EWQA 3S2PA 4ENYA 5IQDA 2EXMA 1MRYA 4F65A 2GNHA 2VNWA 1YRPA 2OH0E 3NLBA 4QOXA 4XHKB 3VBXA 1UKIA 3TKHA 5FBOA 4TYHA 2C6EA 4UYNA 4FIGA 5CNOA 4D9TA 3C0IA 5LQFA 3LCKA 5HLNA 5DBXA 3CPBA 5EG3A 3QCQA 2HXQA 2EXEA 4IC7A 4PPCA 4LOOA 3NCZA 2WOUA 3KL8A 1OGUA 1U4DA 5J8IA 4FEVA 5E8TA 4BIBA 3F2AA 4LOQA 4G9RA 4ERWA 5IDPA 4KA3A 2VTQA 3MDYA 3EOCA 4FIIA 3ORLA 4JR3A 2P2IA 3AMBA 3AQVA 4D2TA 2PVMA 3BZ3A 2OXXA 3BRBA 3K2LA 5HVJA 1P4FA 3EJ1A 4IWPA 2Z60A 3CGFA 3DA6A 5DR9A 3TWJA 2XMYA 4FNWA 5B2MA 3AC1A 4W4VA 5CSPA 4RIYA 4RSSA 3CQWA 3MS9A 4GJ2A 5A4EA 5HESA 5CU0A 4IZ7A 1SM2A 4EQCA 5TOZA 3NMUF 2X4FA 3PXZA 4RX7A 2HXLA 2O5KA 4JOAA 4LGGA 3UOHA 3ZMMA 2PTKA 2XBAA 3HECA 4U41A 4C4HA 4NKSA 4QTEA 5H8BA 4KIKB 3R02A 5HO8A 1WVWA 1UKHA 1OB3A 4MD9E 4C36A 1BLXA 3NUAA 2XRUA 1XJDA 3A4OX 5TR6A 4QP4A 4RWJA 1QMZA 2GTMA 2W1EA 2CMWA 3WZEA 5AEPA 1VYZA 3A7IA 3BLRA 3VS0A 1GZNA 4L46A 3OMVA 3PJ2A 1JKLA 4IWDA 3VIDA 3K54A 3Q53A 3Q4TA 5DN3A 4IZAA 4CV9A 5A46A 1XBBA 2EU9A 3G6HA 2E9VA 3OEFX 4AP7A 3VVHA 3NRMA 2VV9A 3II5A 4CFWA 2BRBA 2Z2WA 2ZMCA 3OS3A 5EQPA 1RE8A 2ZJWA 2YWVA 4FTTA 4TRLA 2IN6A 2P0CA 4X3FA 3OWKA 4GKHA 4IDTA 3QUEA 5EM5A 3TJDA 1XQZA 3BWJA 3OUNB 5LVNA 1O9UA 3DXNA 4XMOA 3KGAA 3F2RA 4PDOA 1JWHA 3QRUA 1PYXA 1YHVA 3CS9A 3R2YA 4MAOA 4RIWB 4WOVA 2G01A 3U55A 4UXQA 1W82A 1HCLA 2WFYA 3F6XA 3GCSA 4DLIA 2XK8A 1X8BA 4RIXA 1J1CA 5A4CA 4J71A 5KBRA 2YCFA 2C4GA 2CJMA 4YC3A 3TI1A 1RW8A 1YW2A 4CLIA 3UOJA 1WBVA 3UPZA 4HVSA 4EZ7A 2NNWB 2JFMA 3MFRA 4LGDA 4DEEA 1OZ1A 2V0DA 3H4JA 4AW1A 1J7IA 2JITA 3I6WA 3KCFA 1PXJA 4ARKA 3QC9A 4CV8A 4ID7A 3K5VA 4CVAA 3FSKA 4O6EA 3SOAA 1QPDA 1AD5A 3KFAA 3MY5A 2Q83A 3OCBA 4XV9A 4DLJA 4N6ZA 5CZHA 5DG5A 2B54A 4QNAA 2UZNA 4UV0A 3TUBA 4RWKA 4F6UA 4HGTA 5A9UA 3CD8A 4G16A 4NUSA 5FEDA 2W4KA 4FTKA 5ETFA 3FMDA 1OKYA 3NZ0A 3GU5A 4ZTMA 5CI7A 4H1MA 3QBNA 4CQGA 5AX3A 4IVDA 4CCUA 4D55A 4EK5A 5HIDA 3E3BX 4YTIA 5EDRA 2HWPA 1BI7A 3GT8A 3UVRA 3LFFA 3ZLWA 5IA0A 5LWNA 1ND4A 2BUJA 1Q8TA 3F5PA 5KMMA 3RAHA 3OBJA 5JGAA 4DTAA 5EI8A 3GCVA 4G6NA 3QRJA 4MF1A 4EH2A 4JBOA 4GVAA 2RL5A 4K2RA 3WI6A 4ZAUA 5CEKA 3HEGA 5BVOA 3ORIA 1ZZLA 2ZB0A 5CU3A 4A9SA 3Q9YA 2JAVA 5L2TA 3FC2A 3DBEA 1YKRA 3FL5A 5L8JA 3RWQA 4PRJA 4QTCA 4RFYA 5DOSA 3NCGA 3ZBFA 3G9LX 3V01A 1K9AA 2DYLA 5HKMA 1Q8ZA 3D2IA 3ZZWA 2UW4A 2UZTA 3VC4A 3DKOA 2WMBA 3CIKA 3L8VA 4I4FA 4FIHA 5DVRA 5HBJA 2QVSE 4IAKA 3QCSA 2OZAB 2WMRA 4DGLC 3PRIA 2ITOA 4BZOA 3OTVA 1SVEA 2H8HA 2A1AB 2OW3A 4BN1A 3G0FA 2C6IA 5TE0A 2P2HA 3WF8A 4C0TA 3GNIB 2F7ZE 5BQ0A 3LCDA 3VUHA 4I3ZA 4C8BA 3A8WA 2AC5A 3F5UA 4HZRA 5J7HA 4APCA 4USFA 3QTXA 2PYWA 4H36A 4ONAA 2XKCA 4D4YA 5IQGA 3B2TA 3LLTA 5CEQA 3GVUA 5DHJA 2RG5A 4NTTA 3GENA 4FIEA 1JKTA 4U40A 3P4KA 2PHKA 4BRXA 5D7VA 3I5ZA 4MHAA 4TWCA 4FKRA 2QG7A 3PXKA 2YHVA 4PDPA 4LGHA 3E62A 3DLZA 4WNMA 3C5UA 4LL0A 3AD5A 3NSZA 3QHWA 4UALA 3ZHPC 4PNKA 3LHJA 5JQ5A 1R78A 2VWVA 4XG8A 3Q4UA 4XYFA 3U87A 3TDWA 4NL0A 1GAGA 5I5ZA 3WIKA 5E8XA 3U4UA 2HELA 2BRNA 5JFSA 4FG9A 4KS8A 2XNMA 1YHWA 2BTRA 5HBHA 3WZJA 4DH5A 4O7WA 1FQ1B 1IAHA 3U4WA 2OJ9A 3NGAA 2WNTA 3FL4A 4O2ZA 3LM0A 4J95A 3LQ3A 1UU3A 4GJ3A 2BFYA 2GS6A 2QHMA 2REIA 4G3CA 5HE2A 2JLDA 3QX2A 4DTKA 4H05A 3DZOA 3FMHA 2C5YA 4PDYA 3KXGA 3GFWA 5BYLA 2R7IA 4U9AA 1DS5A 1OL1A 5FEQA 3TV6A 5DIAA 3WZKA 3CY3A 4IANA 4ZP5A 3U54A 5J5SA 3V51A 4FEWA 1FMKA 1Y8GA 2PMIA 2YIQA 2XB7A 4ZTNA 2O8YA 1H1SA 3ZO1A 5HE1A 2R9SA 3P23A 4R8QA 3PXYA 3Q96A 3ORMA 4PPAA 1M14A 3AG9A 1XHAA 3HMOA 5DRBA 4BYJA 4BWPA 4TYEA 3ACKA 3IPHA 4PY1A 3DQWA 3TIYA 2J90A 2HOGA 2IWIA 1OITA 3DPKA 3Q5IA 4R5YA 3W1FA 4EOMA 3NUNA 4R6VA 2FO0A 2G1TA 3DK7A 4C4FA 1NVQA 3FHIA 4E26A 5A4QA 5KMJA 2BZHB 2UVYA 4PL4A 3VS6A 4ENXA 2YEXA 4OT6A 2CKOA 2CN5A 3IS5A 4FSTA 4JBQA 4CYJA 4AG8A 4QMXA 1Y57A 2PE2A 1LUFA 3I79A 4JRVA 2Y4IC 3U9CA 3W32A 3ZRMA 4MXYA 3IKAA 4G3FA 5HE3A 3ID6C 3HX4A 3MH3A 3PA3A 1J1BA 3WARA 5IUHA 4C4JA 3T8OA 3VULA 3FYJX 4ZY6A 1NA7A 1BL6A 1XH4A 4MQ1A 4E4MA 5HZNA 1TQPA 3C4ZA 3MB7A 4O38A 3V5WA 2PVYA 2UW8A 3FMKA 3CGOA 5AR4A 4F7JA 3D5UA 3NYOA 2C47A 3R71A 2PUNA 4E6QA 4GSBA 4LG4A 5GIOE 3A60A 4G3EA 2QOHA 4AZTA 2X81A 4FT9A 3DTCA 4CGAA 1P4OA 3NW5A 4FG7A 3A7JA 1K2PA 3QWKA 5T6KA 3CKWA 4L68A 5AP7A 2UZBA 4C61A 1DI9A 4TPTA 4CMOA 4FMQA 4F09A 3KMMA 4YJRA 2OIDA 4M0YA 4JNWA 4W8EA 5A4TA 3I7BA 3L8SA 3KXXA 2OXDA 2XYNA 4J98A 4JDHA 5HG8A 4ZS4A 4MQ2A 2PULA 4BFMA 2IG7A 4UMTA 2XM9A 3BEAA 3IECA 4UMUA 1SMHA 2PMLX 1OUKA 3KQ7A 4YGAA 1Q41A 2XIZA 3KRXA 4H3BA 5F9EA 5JRSA 3Q6UA 4XG9A 4O84A 2CKEA 2XIRA 4CD0A 3EQFA 2B55A 2VO0A 3GU8A 4BHNA 2QI8A 3EL7A 3NNXA 3W2QA 4CFFA 3VQUA 4UMRA 4HVGA 2OXYA 4O7SA 1UU8A 4TYHB 3OOMA 4O7NA 4JAJA 3I0OA 4HVDA 3W16A 4JL9A 4XLVA 5DE2A 2LAVA 1OUYA 3D7TA 2IO6A 3PE1A 3FI3A 3ORPA 3QTQA 4UBAA 1U46A 5E8WA 4FT3A 4ZIMA 4NW6A 4EK8A 3K3IA 4PP7A 1TKIA 4MX9A 4IIRA 4CRLA 5J79A 4PF4A 4GU9A 3QWJA 2C3JA 1Q8UA 2YAAA 2IW9A 2NPQA 5FXRA 2JIUA 3VAPA 4TWNA 3V5JA 5BUIA 1PXPA 1UV5A 1F3MC 2XBJA 5L2IA 1NY3A 2PVNA 2YERA 3DB8A 3W2PA 4UZDA 3EL8A 4A9RA 2W5BA 4PMTA 5AUWA 3ZFXA 5FD2A 3RNIA 1YOJA 4CTCA 4DINA 3UQCA 4FTJA 4U44A 1LEZA 4IM0A 4KIQA 2W9ZB 1O6KA 4M8TA 3U6HA 3AD6A 4PTCA 4EOPA 3OXZA 1REKA 4BWXA 3F66A 1M52A 3LJ0A 1KV2A 3SKCA 3D94A 3FKOA 2RFNA 4XG4A 3FHRA 5HU3A 2UVXA 4L53A 5M4UA 3SDJA 4QP1A 4RX8A 4FNYA 3GOKA 4F70A 3Q2MA 1MQ4A 5IQCA 5M57A 5FXSA 1GZ8A 1OKZA 1OKWA 2QNJA 3AT4A 3R63A 4LOPA 4AT3A 2DS1A 2BPMA 3ORXA 4M68A 1J7UA 3LXPA 1A48A 3H0YA 3ZXZA 5C4LA 3PP0A 4XV2A 4BDEA 5DI1A 3H9FA 2FYSA 4DHFA 1IA8A 2XKFA 5HTIA 5C01A 1NVRA 2GS2A 4YHFA 3B8RA 3RVGA 4H1JA 5CVFA 4JQ8A 5KMOA 1H27A 1TQIA 2XVDA 5HCXA 4CKRA 2WMWA 2BKZA 4W4WA 3OUKA 1URCA 2YM3A 5DR6A 5J1VA 3GU7A 1KE7A 4CFMA 3PY0A 3R83A 3AC3A 3FWQA 4ACMA 1YDTE 2CN8A 3O8PA 3V8WA 2OGVA 5GJFA 2QO9A 2UW7A 1GJOA 2AUHA 3EHAA 5IH6A 2X0GA 2CNVA 3PSDA 1RJBA 4RVMA 3DKFA 4AT4A 5JFWA 3HL7A 2QOLA 4GG7A 4PQNA 4XCUA 4ZK5A 2YWPA 3COHA 2VTAA 5A6NA 3QU0A 3EN5A 4B8MA 4DT9A 3OT3A 5AV4A 5GZAA 2B52A 1P2AA 4IAYA 4OLIA 2F9GA 5DRDA 4C59A 4EYJA 1H0VA 1W7HA 4RIXB 3KULB 3BELA 3JS2A 4RLKA 1W0XC 5H9BA 2RF9A 5BYZA 1PMUA 3PVUA 2R3GA 2GQRA 3V6RA 2ZVAA 4U3YA 5AUYA 5KZ0A 3DDPA 1ZY5A 1U54B 3A62A 4TWPA 3TNWA 4I6FA 3KXZA 4O7LA 1BKXA 4G9CA 2WTVA 5CEOA 3EKKA 5EYMA 5KE0A 5CF5A 5CVHA 5BVEA 4L8MA 3DT1A 4X6RA 4CXAA 3R8MA 1GZOA 3TUCA 3OFMA 3E88A 3L1SA 3BHUA 4WG3A 4CFUA 1KOBA 4NJDA 3AOXA 4IXPA 4UMPA 3KRWA 4EUUA 3VS2A 2V22A 3HV7A 4C3RA 4D1SA 5J9YA 2C6LA 3KC3A 4YPSA 5ANJA 3ORTA 3V8TA 4FKGA 1M7NA 2PU8A 3S0OA 2QLQA 4DFZE 2J2IB 2DUVA 3UJGA 4DG2E 2QCSA 5C9CA 2F2UA 2O64A 3RPOA 4FOCA 1KOAA 5DA3A 3ALNA 4BCQA 3EYHA 3DB6A 4AW5A 3TCPA 3QZFA 4NCTC 3VHEA 2PMOX 5JFXA 5JZJA 4NIFA 3JUHA 5AP6A 3GU6A 5CAUA 3R8UA 1QCFA 3TEIA 5ICPA 4BDDA 2BZKB 3V5PA 2YDKA 3E64A 3F5XA 3RHXA 4F1MA 2VTMA 3EZRA 2QC6A 4K8AA 3PXQA 4PNIA 2VD5A 4YTCA 5A6OA 2PUPA 2VTJA 3QALE 3PZHA 2X7FA 2UW5A 3PWYA 4U81A 2W1CA 4QD6A 3TZ7A 4I5PA 3OW3A 2GHLA 2X9EA 3CD3A 5J5TA 5D12A 4WNKA 3FQSA 4ZS0A 4CYIA 3KN5A 4R7IA 4TYJA 4QMTA 1A06A 4OT5A 5M55A 4BTMA 3QYWA 5IEVA 5KUPA 2RFSA 3EN6A 4OBOA 2OIBA 5FQDC 1DAWA 1FGKA 2YIWA 3MH0A 4HZSA 3C0GA 4OW8A 1KSWA 4BL1A 3DLSA 3FKLA 3KXMA 3W2SA 3W2OA 4AOIA 3KB7A 2VU3A 4FV9A 1WBOA 1QPEA 3EQGA 4L6QA 3KRRA 4J96A 3NDMA 4KBAA 1FVVA 3IGGA 3BU3A 3CKXA 3FMMA 4IBMA 1Q97A 5IUGA 3EFKA 2OK1A 3CPCA 5E1EA 2YZAA 5CYIA 3UO4A 4YBJA 3G51A 1YDRE 3GQIA 3ZDUA 3MN3A 5AP3A 4OTQA 1KUTA 4F4PA 4A4XA 4DGNA 3RKBA 3MI9A 5A4LA 4FKUA 4IX3A 5D11A 4G34A 5A3XA 5BNJA 4DFUA 3IGOA 3FLQA 4H39A 1REJA 4NZWB 4D2SA 3GCQA 1YWRA 2ERZE 2VGOA 4ZEGA 4ASZA 4EJNA 4F7NA 2OF2A 2V5QA 4D1XA 2WQNA 4EHVA 4Y46A 1PMVA 2AC3A 3NW6A 5D1JA 5IA5A 5IKWA 3FMLA 1GOLA 2C30A 3A4PA 5IU2A 4O0XA 3OCTA 2VTHA 2V7OA 3MFSA 4GFGA 4QO9A 4YZ9A 4B9DA 2C3IB 2C5XA 3ANRA 4CT2A 5C4KA 5CF4A 2QOIA 3FZOA 4TNBA 4KIPA 4FZ7A 4O2PA 3SXSA 4BGHA 3ODYX 3QA8A 3SVVA 4J7BA 3S1HA 4YHTA 4FV1A 4AGDA 5JSMA 4BTJA 3NUXA 3QZGA 2WMTA 2PVLA 4DEBA 4TWOA 2FGIA 4FKJA 5EDQA 4K9YA 4Z7HA 2CGWA 4RBLA 5AR7A 5B2LA 2YM6A 2ZV2A 3AXWA 4RJ4A 1YI4A 3LFNA 2PUUA 4F99A 3TZ8A 4K1BA 4YO6A 1WZYA 1JBPE 5BVKA 2C5OA 4FV3A 4WRGA 4BZDA 1ZOGA 3LFCA 5AUVA 2OFUA 5CAQA 3SA0A 1SZMA 1VEBA 3OY3A 3EN7A 4YTHA 3GUBA 2PWLA 3ZS5A 4O96A 4CCBA 4K0YA 3QXOA 5AR5A 4ASDA 2YITA 2WD1A 4YZMA 4ZZNA 5CAVA 3ATSA 2XKEA 2JDSA 4O7ZA 2JD5A 3QQGA 5FP6A 4ZMEA 1YXTA 3SAYA 3HMMA 4EH3A 5LARA 2XNPA 3I4BA 3O8UA 3EN4A 1PY5A 2ZMDA 4RVLA 3VS7A 5L4QA 3ZXTA 1JNKA 4ERKA 4EH6A 3ANQA 3DQXA 3CEKA 3FBVA 4HCVA 5HCZA 5ANOA 5E8ZA 3IW8A 2JBPA 3VJOA 2E9PA 1WCCA 2I0HA 3UIMA 3V5LA 4ANQA 4ASEA 4TW9A 1JAMA 3F61A 3ULZA 3UVPA 1V0PA 4XOZA 1W84A 4IFGA 2VWYA 3SG9A 5I9XA 3LXKA 4KD1A 4ACHA 5IEXA 1RQQA 2C6TA 3WF5A 3HV3A 4R77A 3QLGA 4QYGA 4JDJA 2Z7RA 3GC0A 3UDBA 3M1SA 4X3JA 2X2MA 4MVFA 2C6OA 5K4JA 3IG7A 2Z7QA 3PVBA 2UZUE 4DH7A 4JG8A 3A2CA 3R8VA 3LJ2A 1XH5A 4HYIA 5DEWA 4I94A 3COMA 4FL3A 4A9TA 3SC1A 2XIXA 4D28A 3NUPA 4GKIA 5AR2A 5AA9A 4FSNA 3ENHA 4FTRA 3JVSA 3ENMA 4JIKA 3Q4ZA 5IG1A 1OBGA 3N4VA 1HCKA 2OI4X 3COIA 2F4JA 4XRLA 4FSRA 3LJ1A 4QT1A 4O86A 1CKIA 2VWBA 3RM6A 2WU7A 4O0VA 4DEDA 5CAPA 2IW8A 5EDPA 3LFAA 2X6DA 3G2FA 5L2SA 3REPA 3MB6A 1YWVA 4O22A 2XK7A 2BVAA 2IVTA 2Y8OA 2RFEA 3E8EA 4FTUA 4MNEB 4F0IA 3TIZA 5KMIA 3NUSA 5DNRA 3FY0A 4ZY4A 4FIJA 4OTFA 4RRVA 5F4NA 3RK5A 4AA4A 4JS8A 4IAZA 4OTGA 4L44A 3WBLA 3F7ZA 1CTPE 4BBFA 2X7OA 3FI8A 1ERKA 4EK3A 1OL6A 4HPUE 2X1NA 4A9UA 5EW3A 4GU6A 5FBNC 2OKRA 3HDMA 3MPAA 4Z3VA 4J53A 2W1IA 4C62A 1J3HA 4Z7GA 3BX5A 5DR2A 2C6KA 3V04A 2QR8A 2A27A 4KRCA 5IH5A 4IX6A 4FTIA 4FVRA 3SV0A 3R1NA 2R7BA 3KCKA 4Q9SA 3VBVA 3V5TA 2W06A 5AUTA 5CSHA 5HBEA 4OTDA 2QQ7A 4MBJA 2BR1A 2Z7SA 4A7CA 4E73A 5HTCA 5EM7A 4QMVA 5CI6A 2Z7LA 4GCJA 3MESA 2QG5A 3HLLA 4EORA 4IB3A 4IB1A 3T9IA 4DG0E 4FUXA 4BCIA 1Q62A 4QP6A 4NEUA 3FE3A 4E4NA 3EN9A 3UOKA 2UVZA 5IDNA 2HZ0A 4KBCA 3HDNA 3D2KA 3H9OA 4LV5A 4QP2A 5KMKA 3DU8A 2XP2A 2GHMA 1H1PA 2IVVA 1WVXA 1H28A 3D0EA 4PV0A 4R3RA 3GCPA 4B0GA 2FSLX 2YJRA 2JC6A 4EH7A 2EWAA 3BKBA 4S34A 4FTCA 1WBPA 4ZZOA 4O81A 4DF3A 2H96A 5CASA 1JOWB 3L8PA 3CQUA 4C35A 3BU6A 3E7VA 2WTWA 3EB0A 2HIWA 3PG3A 2KTYA 2X7GA 3BCEA 3FMJA 4N0SA 4BWKA 1T45A 3Q9WA 4X7QA 1FMOE 4IADA 4IVBA 5DT4A 3RCJA 1YXSA 2YIRA 4IJPA 3SLSA 4EI4A 2VTLA 4WHZA 4DEHA 4OR5A 3QTIA 1H4LA 1JSVA 3LE6A 1KE6A 1Q3WA 4Q5EA 3D83A 3TTIA 3OCGA 4N70A 5L3AA 4AGWA 1YXUA 3HRFA 5D9HA 2GDOA 4XOYA 4K33A 1ZMVA 1P5EA 4M67A 4R1YA 4UXLA 3TL8A 2Y7JA 4EHGA 4F9CA 3GC7A 3QQLA 2YCSA 5BVNA 3OWLA 5CU2A 3R1QA 4A06A 3E87A 4TNDA 4FA2A 2X2LA 3NYVA 4HYHA 2XYUA 3NVKI 4FT0A 4AU8A 3OC1A 3PXRA 4BKJA 5AADA 2BAQA 4MD7E 1WBNA 3C51A 4AAAA 5FDXA 5HX6A 3HV5A 2I40A 2PVFA 3WILA 2PE0A 2YA9A 2ZYBA 3CR0A 1M17A 3LQ8A 2XZSA 3SXFA 2H9VA 3AGLA 2BROA 5ACBC 5L6OA 5JN2A 1H07A 3ZLYA 4L9IA 3COKA 4BCJA 4F7LA 3ZLXA 2J0KA 2YCQA 3MBLA 4FK3A 4I6HA 4DA5A 2VNYA 3P7AA 4JX3A 4MBLA 3D4QA 4GK2A 2EVAA 2F2CB 2XNNA 2YFXA 3DBQA 4HNIA 2WB8A 3C4WA 1H26A 3GGFA 4FNZA 3FAAA 3SRVA 5AAGA 1W83A 2ZDTA 4RFZA 3LFSA 4DGGA 5EM8A 3QZIA 2UZLA 2HWOA 1XKKA 4YJNA 1FOTA 5LJJA 4AX8A 2OJFE 3CLYA 3CY2A 4W9WA 4YBKA 2UW9A 2VWZA 5AUXA 4QTAA 3RAIA 3MW1A 1OL2A 1Z9XA 2OJJA 3HV6A 3SW4A 1ZWSA 3R28A 4AZEA 4FTAA 5L6WL 3VN9A 4DTBA 2GQGA 1OIUA 3FZSA 4CRSA 4LRJA 4BCKA 2OO8X 4QRCA 5HNBA 2I0YA 4DFLA 3MJ1A 4FSUA 2W5HA 4NIFB 4GYGA 5DEYA 3C4CA 4BHZA 3UNJA 3BGPA 5AIKA 3DBFA 3FZRA 5IISA 2R0IA 2DQ7X 4I22A 3H9RA 1UVRA 1XH7A 1ZYLA 4LRMA 3UIXA 4FV7A 4UEUA 4ZZMA 5IPJA 5L2QA 2A0CX 2BRMA 2EB3A 2WIPA 2A19B 2B9JA 3LMGA 4FVPA 3ZUVA 1R3CA 5FLFA 4FKOA 4J8NA 4TN6A 3PY3A 2PY3A 3EFLA 2EB2A 5KMNA 1Z57A 3EQDA 3ZO3A 1W8CA 1XBCA 5K0KA 2PVJA 2WTJA 4X6QC 1Q8YA 5HE0A 3WF6A 3U6JA 5D10A 3QRIA 3UVQA 3IOPA 5CT0A 4WSQA 4YR8A 2XCKA 4EHEA 5CEPA 2W1DA 5HX8A 4NFNA 4FTOA 1I09A 2X2KA 3LQ5A 3S00A 2YZLA 4RT7A 4X2FA 3NS9A 3HV4A 5KHXA 4U79A 2FB8A 2FSOX 2VTNA 4BCNA 3F88A 4B99A 5B7VA 3QGYA 2HY81 4FSWA 3IDCA 4I0TA 5AM6A 4BI1A 3WYYA 4GMYA 3LMHA 2YN8A 4BKYA 4QTDA 3NNUA 4RA4A 2PMNX 4RJ8A 4U80A 4WO5A 2OZOA 5LCJA 3TKIA 2WTIA 5IMEA 3OTUA 2YACA 3GXLA 4YPDA 3M11A 3V6SA 1GZKA 2WMVA 4YZNA 2XIYA 3WYXA 3EQPA 4FVQA 3V8SA 1SYKA 3TNPC 4PMSA 4FKPA 4EONA 2QODA 1Y8YA 2E9NA 3PRFA 4OAVB 1Q8WA 5AP1A 1E1VA 1M2RA 4M7IA 5G1XA 1I44A 3C0HA 5GJGA 3EH9A 2CGUA 3RPRA 2PZRA 3PZEA 3QQJA 4U5JA 1IRKA 4PTEA 4UWYA 4EQMA 4O0RA 3ELJA 4WIHA 4X3FC 5I9ZA 3R01A 4R1VA 1PKGA 2QOBA 2WTDA 2R3MA 3QCXA 3E93A 1B39A 3PTGA 3OXIA 4I20A 1ZYSA 4MK0A 5ETAA 5JRQA 3QUPA 3SD0A 4JXFA 3I7CA 4GUEA 4TY1A 4S2ZA 1KWPA 5IQHA 2QONA 4PTGA 2F49A 3WOWA 3FUPA 1YOMA 2VGPA 2Y6MA 1JSTA 2PE1A 2YM8A 3DV3A 4YJUA 3HUCA 4CFXA 5JK3A 3ZEWA 3ORKA 4BICA 4O0TA 3IDPA 1ZYJA 2Y4PA 4F9YA 4FV0A 4BTKA 3ERKA 4M14A 2WMUA 3Q52A 3RAKA 5B2KA 4FBXA 5GHVA 3VRYA 2B9HA 3RBWA 1WFCA 4AOJA 5EHYA 3R8LA 4J1RA 3UQFA 2PZPA 4FSMA 4CSVA 3MVMA 4M13A 4UN0C 2WEIA 2R3QA 2FVDA 5JFVA 5AV0A 2FSTX 2R64A 4L42A 4K11A 3BV2A 3KVXA 4XG2A 1ZY4A 4BDJA 4JG7A 2NP8A 3OY1A 3P7BA 4JR7A 4NKAA 5FEEA 3U6IA 3RI1A 3TKUA 4J99A 2C0OA 1WMKA 2J6MA 2OJIA 3JPVA 3PUPA 4QYFA 4M97A 3JVRA 2I1MA 1LR4A 5K3YA 3I81A 4XG6A 3KRLA 4KNBA 4F9AA 4E20A 3BV3A 2B9IA 2WQMA 4S32A 4YJQA 4YJPA 4DH1A 5CEMA 1AGWA 3OVVA 3KF7A 2XK3A 4MXZA 5AV3A 3UZPA 5CQUA 3VBTA 2JKOA 3CTJA 4IB5A 5CANA 4FE2A 3VF9A 4BTFA 1PMNA 5HLPA 5IA1A 1Q61A 1ZXEA 4XS2A 4ANMA 4FKTA 5TKDA 3O51A 4QMMA 2YISA 3RZFA 1R1WA 4ACGA 3R9NA 4Y5HA 5C27A 3UQGA 3QRTA 4FKVA 4EBWA 5CF6A 1P14A 2XNEA 4EK4A 2UZEA 4M84A 3MVLA 4XRJA 1H01A 3CCNA 4V0GA 5ANGA 4YZBA 1OL7A 1GNGA 2X4ZA 2Y6OA 4O0YA 3O23A 4M66A 5DFPA 3LLAA 1PF8A 3NR9A 1SNXA 5M56A 3QAME 3ZOSA 4XP0A 4YNOA 2J5EA 2RFDA 4IH8A 3OCSA 5E1SA 3IW7A 5C8MA 1SVGA 2W7XA 3EMGA 5KZIA 2R3FA 5F95A 2P55A 5A54A 3MH1A 3QA0A 4FKSA 5AP5A 3ODZX 2ITNA 5I4NA 5I9YA 5M07A 4Y83A 3NNWA 4QNYA 4O0UA 4D2PA 3LM5A 4YHJA 1NW1A 3UO6A 4BIEA 4ZTQA 3GEQA 3C9WA 1VR2A 4RVTA 3ROCA 4EWHA 4BCPA 4ZLOA 3LOKA 1NT2A 5FP5A 5AV2A 2R3KA 2UW6A 4RIYB 4XP3A 4CEGA 4B4LA 4E6AA 4NWMA 2ONLA 2QO7A 3CJFA 5EW8A 4NTSA 3R7IA 4ANNA 4F9BA 5BVFA 3DY7A 3F3VA 5DWRA 5EK7A 2JKQA 5FGKA 4ZTHA 4YO4A 3UC4A 1W98A 4W8DA 2NO3A 4C4EA 1U5RA 3ZH8A 4FI1A 3GFEA 3OWJA 3NIZA 4OTHA 5E91A 1OPLA 1JQHA 1IASA 2VX3A 5C8NA 2HZNA 1V0OA 4RC3A 4QYYA 4D0WA 1ZMWA 3NYXA 4GEOA 5AMNA 5EOLA 4DFYA 2GTNA 4O91A 3P08A 2BTSA 3LZBA 3NX8A 4AT5A 4BCMA 2C6MA 5HNIX 5HHWA 4YTFA 4MWIA 3QUDA 3DKCA 5AJQA 4LYNA 4ZSAA 2FSMX 2DWBA 4ACDA 3IO7A 3PJ1A 5HG5A 3FEGA 1M2QA 2E9UA 4DFNA 2IZTA 4IM3A 4HPTE 5I9WA 3FI2A 3WZUA 3W2CA 3NEWA 3D5WA 2CGVA 4IVAA 4C3FA 4BDAA 4JG6A 1ZZ2A 5BX0A 4MKCA 4RIOA 3QTWA 4K18A 4UY9A 2QHNA 4RZVA 4F0FA 5FTOA 4JVGA 2W9FB 3FSFA 2ETMA 2GHGA 5EQEA 5DYJA 3OROA 4X3FB 5F20A 3TZMA 4I1ZA 5J1WA 4O1PA 3DKGA 3SOCA 4AFJA 4EOOA 4QP3A 5LVPA 4UZHA 5E7RA 4P2KA 1GIJA 4I0RA 3OZ6A 4U8ZA 5ANEA 3BU5A 4G6LA 4X0MA 4XX9A 4CQEA 3ZM9A 1APME 3AGMA 3GB2A 2YM5A 2XKDA 2RSVA 4LM5A 4G17A 1IR3A 3HP5A 3O96A 4DBNA 4JJRA 3R6XA 3NIEA 2JDVA 3N9XA 4R3PA 4EUTA 4HGSA 2C0TA 2UZWE 4ALWA 5AAFA 4BY9E 3OOGA 4RIWA 4F9WA 2WXVA 3R30A 3QKLA 2VZ6A 3MVHA 3U51A 3I5NA 4WG5A 2QKWB 3VUDA 3ATTA 2RIOA 4XV1A 1OPJA 4DEAA 5BPYA 1F5QA 4C58A 5A14A 4F6WA 5EYKA 3C1XA 4ANBA 4BVUA 2QU6A 3AT3A 4FF8A 4FICA 2QD9A 4Y5QA 4NSTA 4USEA 3VBYA 4KS7A 4TKSA 4OAUC 4I93A 4F7SA 4B8LA 1E1XA 1DAYA 2BRHA 3IOKA 4FX3A 3O17A 4I23A 3PSCA 3LW0A 4AFEA 5LVOA 2BALA 4RG0A 1PKDA 3LCOA 3P9JA 3M2WA 4IAFA 4KIOA 3O71A 3E63A 4RX5A 3VUKA 4X2GA 4UB7A 4ZJJA 4AS0A 1CMKE 5LMKA 3DNDA 4DFXE 2G9XA 3A7HA 3RAWA 1XO2B 4QMSA 4R5SA 3DJ6A 3SXRA 5AR3A 3R7VA 5E8YA 5HCYA 3OD6X 3OP5A 4MF0A 5JKGA 3FLWA 1IG1A 2HW6A 3HP2A 3JXWA 4M3QA 4U7ZA 5E92A 2FH9A 3HZTA 4WUNA 3UIBA 4B7TA 3EFWA 5AUZA 4O7YA 2B1PA 2OU7A 4MTAA 1M7QA 2WPAA 1WBTA 5E8SA 3TNQB 5CALA 2R3IA 2C1BA 4Y85A 2VWUA 3ROYA 4CFNA 3C4FA 3RZBA 4BDIA 4NM7A 2Q0NA 3RALA 5IMXA 4KSPA 3FI4A 1H24A 3QTUA 4YC8A 4QQCA 4ZLZA 4ZSGA 1H1QA 4BGGA 4PX6A 3IONA 4FGRA 4GW8A 4NM0A 3L9PA 3ZRKA 4ACCA 4JX7A 2GCDA 4D5HA 2C1AA 3O2MA 4L00A 2BAJA 2Y0AA 2G2IA 2YM4A 4P4CA 3TACA 4H58A 3W2RA 2OZAA 4CG8A 4GYIA 3KA0A 4FTMA 1G8SA 3JY0A 5EHLA 2J0JA 4FK6A 1OPKA 4HNFA 2X39A 2QOOA 4F64A 4HW7A 5E8UA 2OIQA 4UWBA 3FMEA 4FL2A 4FV4A 3HNGA 3CE3A 2GNLA 5CXHA 4IB0A 4NM5A 3OWPA 2W1ZA 2WQEA 3EFJA 1OIQA 5G6VA 3VUTA 4YURA 5I9VA 4Q5HA 3ZSIA 2HW7A 4AN9A 5K9IA 1PYEA 2JDTA 3PPZA 3QD3A 4I92A 4MEDA 2CCHA 3UG1A 2XF0A 3MPTA 1CKJA 3OT8A 4ZTLA 5CEIA 4J8MA 4EH9A 5CQWA 4JBVA 2XNGA 1PXMA 3B8QA 4J97A 3QD2B 3HVCA 3PYYA 1Y6BA 4RFMA 5HD4A 1Q99A 2E9OA 2WTKC 4YLKA 1MP8A 1G8AA 4U43A 2IZSA 4AW2A 5ITAA 3S4QA 4KWPA 4YLJA 3JR1A 2UZOA 2BDWA 5AUUA 3OXTA 3BE9A 1OI9A 5KHWA 1PXOA 2XK4A 3BIZA 2XK9A 4E4LA 3LCSA 4A9YA 4A4LA 4BDGA 4CZTA 4KRDA 4RC4A 3SQQA 4C7TA 4XH6A 3O50A 2C3KA 3HRCA 4GH2A 3MV5A 4GV1A 5HVYA 4DBXA 1T46A 2WMXA 5J87A 2GNIA 3NW7A 2F7EE 5H8EA 1YQJA 3DOGA 3VUGA 5GINE 4OGRA 3MH2A 4KSQA 4NH1A 5FG8A 3G9NA 4RJ3A 3FLSA 5DMZA 4OTWA 4QQ5A 3TTJA 1YOLA 3R21A 1TQMA 1MUOA 4EEVA 5CF8A 3PIXA 5JH6A 2CKPA 4TZRA 2JIIA 4UWCA 3OW4A 4A4OA 3QGWA 1UNGA 3AMYA 4YJTA 5HD7A 4ZMFA 3RHKA 1PXLA 3G6GA 4QYEA 2J50A 2WELA 1ZYCA
chains in the Genus database with same CATH superfamily
4C3PA 3P78A 3K5UA 4YJOA 5CWZA 5TT7A 4EBVA 1OKVA 1UU7A 4GIIA 4JQEA 5GJDA 5H8GA 4R7BA 3WE4A 2WMSA 2YJSA 1S9JA 1A9UA 2XA4A 3PY1A 4G31A 2ITVA 3BPRA 1KV1A 3ET7A 3R9OA 5GZ8A 1CDKA 1V0BA 4O0WA 4J52A 4S31A 4TYGA 5IQEA 5EW9A 2XEYA 4C37A 5CS6A 4GFMA 4QDVA 1FBNA 5IA4A 2ETRA 2GMXA 3W33A 5AIRA 3GBZA 3FPQA 3ZBXA 4Y95A 4C2VA 2ZM4A 2YDJA 2F57A 5GIPE 4YP8A 4HYSA 3HGKA 4M69A 5BYYA 3VWAA 4JIAA 5BMMA 2W17A 4MXXA 3LFDA 4FSYA 4CKJA 5J9ZA 4MD8E 3RK7A 4AA0A 4HVHA 1URWA 2IJMA 2XJ0A 4RQKA 3HMNA 4DYMA 5BMSA 3ZSHA 3D14A 4ORKA 3GQLA 2R5TA 1HOWA 5GZ9A 4EOQA 3RGFA 4YSMA 2XH5A 4AGCA 1QL6A 3F3ZA 1QPJA 5CSXA 1Q5KA 4DCEA 3UYTA 4DHZA 3PLAE 3DGKA 5LMAA 4D58A 4I5MA 3ZO4A 4U97A 5AFVA 4V05A 1PW2A 4BC6A 5CX9A 4HCUA 3IQ7A 1IA9A 2XRWA 2YABA 2W1GA 5IEYA 3KK9A 3DJ5A 3GOPA 2PVKA 3QHRA 3Q2JA 3E8NA 4WSYA 2ZV7A 3DK3A 4E7WA 2XCHA 4FL1A 2X8EA 4Z55A 2VTOA 4G3GA 4JRNA 4BF2A 5IH4A 5J7BA 3LXLA 4AZWA 2C6DA 3R7GA 1CSNA 4OBPA 3NWWA 5I0BA 4QMUA 1ZAOA 3NUYA 4XBRA 3VS1A 3D7TB 5L8KA 2X8IA 4F63A 4PL5A 3VRZA 2JKMA 3Q04A 4O6LA 1R39A 3LFQA 4U42A 3R2BA 4FV5A 2EUFB 4RPVA 3UMWA 1MRVA 3PG1A 3BBWA 4EH8A 3NFGB 5EQYA 2H6DA 2W0JA 3PJ8A 1VJYA 1BYGA 3NFFB 3R7UA 3AKLA 1ZOHA 2VX0A 2NRYA 3KK8A 3MWUA 3A61A 2O3PA 5HICA 1JSUA 4ANOA 2QR7A 3KVWA 4XEYA 3RCDA 3W0QA 2ITZA 4GT3A 5C03A 2JKKA 4QPMA 4DC2A 3MSSA 3RK9A 4O7RA 5M4CA 2JEDA 4ZJVA 3RNYA 4JT3A 3P0MA 5KX8A 2CGXA 3IK3A 5C1QB 4BDHA 5FTQA 5HORA 4D2WA 3CTQA 3BBTB 3QD4A 4EYMA 3PA4A 2PVHA 3RM7A 3W10A 3QXPA 3JY9A 3ZZEA 1OM1A 3HA6A 3F3TA 3W55A 1G8KA 1L8TA 1UA2A 4RWIA 5H2UA 3VW6A 4D0XA 4U3ZA 5EYCA 1BL7A 3F69A 4S33A 4X2JA 3E92A 4DEGA 3E8CA 5AWMA 3F3UA 4E5WA 5KBQA 2WTKB 2VTSA 3POOA 4BKZA 4U6RA 4XUFA 3M42A 4O7TA 2OJGA 4EH5A 4FEXA 1FPUA 4JDKA 4I21A 3BLHA 2GFCA 3PXFA 3MFUA 5HEZA 4TXCA 4NFMA 5IQAA 4WUAA 5CLPA 3SGCA 5E9EA 3D15A 4F6SA 5HG9A 3O0GA 5ANIA 4X2NA 2YLEA 5C26A 2CSNA 3UTOA 4APPA 3ORZA 4W4XA 1O6LA 3R8PA 4JI9A 3UOLA 5EH0A 4N4SA 5HU9A 5M4IA 1PXIA 3PP1A 4DCAA 4BDBA 3Q60A 3QLFA 3DK6A 3BQCA 3UPXA 2BZJA 3QRKA 1VYWA 4P90A 2OF4A 2R3HA 1DM2A 4HJOA 5CVGA 2VTTA 1WBWA 3RTPA 2WEVA 4G3DA 5IQIA 4B6LA 4YMJA 3D9VA 1K3AA 2ITYA 4WBOA 5KKRC 2ZAZA 4L3PA 2R4BA 4M12A 3HA8A 4GS6A 5BVWA 1STCE 3H30A 1KE8A 3I60A 4ASXA 2IW6A 1H00A 4IX5A 4NYEA 2ERKA 1PHKA 4QYHA 3ZTXA 3O7LB 1EH4A 2VWIA 2ITTA 3RPYA 3DAJA 5EI6A 2WAJA 3KF4A 2VUWA 5K0XA 3UE4A 4BI2A 3EYGA 4O27B 1XBAA 4D5KA 2ITXA 2BILB 4DE4A 3UNKA 3OBGA 3CC6A 4E8AA 5DH3A 3KULA 2G15A 5AP2A 3JYAA 1YI3A 3LAUA 4BCGA 4LV7A 2ESMA 1PRYA 4IZ5A 1Z5MA 2R3JA 4PWNA 3BHHA 5EM6A 1ATPE 5AM7A 2QURA 3TN8A 3DS6A 4FZ6A 1U54A 3R7OA 4EKKA 4YLLA 4EL9A 4C57A 2C3LA 1E9HA 4LRKA 4XJ0A 3OG7A 2YLFA 4MBIA 4E1ZA 2QOQA 3LVPA 2JFLA 2GSFA 2WHBA 3PJ3A 5EFQA 5M51A 4FR4A 4FC0A 4GRBA 3W0PA 4I0SA 4DFBA 1B38A 4FV2A 5CAOA 5JGBA 2W96B 2ZM1A 1XH8A 1H0WA 3TV7A 4JBPA 4N6YA 3P1AA 2VWWA 4I6BA 4ZSEA 3BYMA 2QO2A 1ZLTA 3B2WA 3GCUA 5AV1A 4CFVA 3BHYA 4ITIA 4KINA 5DT3A 4YUQA 3HAMA 4AE9A 2CPKE 5DGZA 2C0IA 4IAAA 4DGMA 2BKKA 4QP7A 5E8VA 2VO6A 2BIKB 3DNEA 3RPVA 4YU2A 4KUJA 3D7ZA 3GC9A 1OECA 4AXAA 4GUBA 4YZDA 5HNGA 4ZTRA 4U0IA 2I6LA 3MA6A 4FKQA 2YIXA 4FNXA 2ITUA 1TFFA 2UZVA 4CZUA 4DITA 3EQRA 5KNJA 2ACXA 4KB8A 2R3PA 4O21A 1IAJA 4ALVA 3QL8A 2VWXA 3TNHA 3GU4A 3R73A 3AC8A 2W5AA 5D41A 5FWKK 2Z8CA 4QMYA 3RP9A 3MTLA 2VO3A 4L45A 4V01A 5HOAA 3C13A 4O82A 4LFIA 2FUMA 4AWIA 3ZRLA 5K4IA 4Z9LA 2QOCA 1UNHA 4QMWA 2C68A 3DBDA 4YJVA 3RINA 2PVRA 2BZIB 4WNPA 3UYSA 4MXCA 2GPHA 5L8LA 3QQKA 2XM8A 4FOBA 4IWQA 2XIKA 3CBLA 3QTZA 3KN6A 4E5AX 1H8FA 1OIRA 3AD4A 4BB4A 1YHSA 4PMMA 3A8XA 3BGQA 5FDPA 2WO6A 3CP9A 1LEWA 1XH6A 4RLLA 4FT5A 4BI0A 4QMNA 1PMEA 3BYVA 1FINA 3FY2A 3GP0A 4K77A 1L3RE 5HG7A 3ZFYA 4EOIA 2ZB1A 3AC2A 2WOTA 1FGIA 2RG6A 3HYHA 2O65A 3A7FA 4IAIA 1NXKA 2G2FA 4AE6A 4ZY5A 5FUTA 4EJ7A 4XP2A 3Q4CA 3QKMA 4W4YA 3VBWA 3HKOA 4UX9A 4IMYA 2E2BA 5KO1A 4C33A 2R2PA 5AA8A 3H3CA 4G5PA 4PMPA 2NRUA 4IQ6A 3NAXA 4NU1A 5EI2A 5I9UA 2VN9A 4EC9A 4AZVA 3UBDA 3VO3A 2YDIA 3UZTA 4FSQA 3L9LA 3Q32A 4RWLA 3FC1X 1FVRA 5I3RA 3DXQA 4CG9A 5I3OA 3TZ9A 5ETIA 4FKWA 4IEBA 4OTRA 4FKIA 3N51A 3P5KA 5CNNA 3ZSGA 4EK6A 3PVWA 3UG2A 3N4TA 3PIZA 5F1ZA 4I24A 3ITZA 3ZLSA 3G33A 4MH7A 4AACA 4D1ZA 5KMLA 3FZ1A 5LWMA 3AC5A 4FUYA 4QPSA 5JT2A 3EIDA 4F0GA 3HAVA 1BI8A 3FLZA 4XG7A 4L3LA 3Q3BA 3C7QA 3IW5A 3UO5A 3FPMA 4JQ7A 3ZDIA 4AUAA 4TL0A 3BHTA 3EQCA 4DGOA 5KKRB 2ETKA 2SRCA 3T3VA 4EOJA 4JLCA 1ZOEA 5CY3A 4QP9A 3WIGA 3W0SA 3PA5A 2W1FA 3UMXA 4G1WA 2VTIA 1PXKA 4K6ZA 4FYNA 4BCOA 2HZ4A 3FKNA 4EZ3A 2VTPA 3QKKA 3QD0A 4E6CA 2IF8A 2XJ1A 3DCVA 3VS3A 2OICA 3ULIA 3F2NA 4CMUA 2LGCA 1YDSE 4LUDA 3TUDA 3TJCA 2XK6A 4KKHA 2W4OA 4AQCA 4M0ZA 5HLWA 5DPVA 2V7AA 3EQBA 3FJQE 4GVJA 5ANKA 3ZEPA 2YM7A 4QMPA 2A2AA 4ZSLA 4E93A 4PDSA 4I6QA 5LCKA 4UMQA 4EHZA 3AMAA 3CJGA 1G3NA 4FT7A 5CTPA 4I5CA 5FXQA 1U59A 4BCHA 1BX6A 5IUIA 4IHPA 3P7CA 1YWNA 3UP2A 5AP4A 3SHEA 2CNUA 3KRJA 4DH3A 3FLYA 2RGPA 4M69B 4QQJA 3IW4A 2CHLA 2UZDA 2RKUA 4WRSA 4E5BA 4WNOA 3TT0A 4EH4A 3ZU7A 5E90A 4W9XA 2CKQA 5CT7A 4XBUA 4FKLA 3O8TA 1W2CA 2EXCX 3ACJA 4CZYB 1YI6A 3BYSA 4RGJA 5GNKA 3ZFMA 4AW0A 2X8DA 3T3UA 2X6EA 1TVOA 1KE5A 3ZC6A 2Q0BA 4GT4A 4WA9A 3MIYA 4LV8A 5L2WA 4IFCA 3G90X 5CU4A 3PVGA 1XH9A 1B6CB 4L43A 4DEIA 1Q4LA 3NYNA 3WE8A 3ZCLA 4L52A 4AZSA 2GQSA 3KREA 4QPAA 3VUIA 5TO8A 3WZDA 5AP0A 3DDQA 4I5HA 4FYOA 3U9NA 4MXAA 2UW3A 5BV3A 3PPJA 4NCTA 2OFVA 1XR1A 4FSZA 3QTRA 3F82A 5DT0A 1MQBA 4BDFA 1H08A 5J9LA 4EOSA 2HENA 3S3IA 3VW8A 4KKGA 4H3QA 4E3CA 3QYZA 2JDRA 4IM2A 2QOFA 4XG3A 4A07A 4YNEA 1V1KA 2BHEA 2W05A 5J95A 3QZHA 2IVSA 4MNEA 1ZARA 4EC8A 3Q5ZA 4MCVA 5B0XA 3A7GA 4AF3A 3ZO2A 4WBBB 3I0QA 1UWHA 3O7LD 3BE2A 3MY0A 3PDTA 2A4LA 5HO6A 5K5NA 2C5VA 3DBCA 4O4BB 5EKNA 2H34A 4DT8A 3RMFA 2YAKA 2XS0A 2I0VA 3KEXA 3U8WA 4CTBA 3LXNA 3EWHA 4BDKA 4D2RA 4IDVA 3C50A 3R0TA 4F1TA 2W4JA 3CSVA 3MPMA 1GIIA 4P7EA 3VUMA 4O83A 3CQEA 2C69A 4AXFA 4M15A 3MTFA 2O2UA 5ACKA 4C4GA 5BUEA 2PUIA 3KU2A 2CLQA 5HO7A 4FIFA 3UNZA 1ZMUA 2VX1A 4OBQA 2QKRA 2HYYA 2ZV9A 3PLSA 3QF9A 1VZOA 3I6UA 4IWOA 4FG8A 4LMUA 1R0PA 4LMNA 3PFQA 3MA3A 4ZLYA 3L9NA 4KIKA 4ITHA 4L67A 3KMUA 4WT6A 2WKMA 4YJSA 4I4EA 4IW0A 2JBOA 4DN5A 2PZYA 3OHTA 5M06A 4I41A 3LMIA 1JPAA 4BR3A 1SNUA 2XUUA 4HGLA 4V04A 3W8QA 3EQHA 4XLIA 4Q2AA 2JDOA 2GS7A 3R7YA 2B7AA 4X21A 2BDJA 4FEUA 4R7HA 5JGDA 4USDA 3BYOA 1SVHA 1UU9A 3PWDA 1Q24A 5CZIA 4OTIA 1UWJA 2ZOQA 4D4RA 3G15A 4N57A 5H3QA 3FXWA 2UW0A 2OSCA 2JAMA 4WD5A 4Y8DA 3S95A 2ZDUA 5IA3A 4MNFA 3Q9XA 4II5A 3POZA 5AR8A 1LP4A 2Y9QA 4GIHA 4OTPA 3GC8A 2YCRA 4QMOA 2AYPA 3ZM4A 4LL5A 4D2VA 3FYKX 1LPUA 4MYGA 4MXOA 3NVMB 3KXHA 4FEQA 4LQMA 4BCFA 4Y73A 3TG1A 4TTHB 3ORNA 4RX9A 4DH8A 2HZIA 2WGJA 1G5SA 5EYDA 3SX9A 4BBEA 3CXWA 3HMPA 4FV6A 5LMBA 4L3JA 3R1YA 3VF8A 3FXXA 4YSJA 4XV3A 3FZPA 2OG8A 2KULA 2W99B 4U45A 5FRIA 5IF1A 3W0RA 2IVUA 4TT7A 1XWSA 4BDCA 4NT4A 4CNHA 3FQHA 4L7FA 2XARA 4YC6A 4FZAB 4IX4A 1IEPA 2IEWA 4AAYA 4CMTA 2WMQA 4HYUA 2J51A 5ETCA 1OIYA 2XNBA 5CENA 2VAGA 2WQBA 4EOKA 1WAKA 4PUZA 4PL3A 2J4ZA 5LVMA 4ZSJA 1PXNA 4E4XA 5EOBA 4GL9A 5ANDA 3QQFA 5HQ0A 3TDVA 2R3RA 4O4DA 2WMAA 3ZUTA 2W1HA 3TXOA 2Y4IB 3SRVB 3GI3A 2V55A 2BCJA 5JZNA 3C4XA 3EQIA 5FTGA 5T3QA 4RA5A 5EKOA 3BI6A 1R0EA 4P5QA 4R78A 2VRXA 3WF9A 2R3OA 3QFVA 3I1AA 4HOKA 3FXZA 2BRGA 3THBA 2GNJA 3VS4A 2XAMA 3NNVA 3R04A 1Q3DA 3A99A 1CKPA 4G6OA 1JKSA 2OBJA 3FLNC 3FV8A 3R9DA 4X2KA 5M09A 2R3LA 4QMLA 3V5QA 2WU6A 4AOTA 3D5XA 3H10A 3PJCA 3ZC5A 4PP9A 2F7XE 3VBQA 3Q6WA 3R8ZA 3RJCA 4FGBA 3MY1A 2FA2A 2IPXA 3FQEA 2JIVA 1ZYDA 3R22A 4AN3A 4PPBA 3NUUA 4AN2A 3LFBA 5KCVA 4EOLA 2XNOA 4KKEA 5JEBA 1FVTA 3PE2A 3QCYA 2V62A 3DJ7A 3QX4A 4L01A 3VS5A 3R9RA 3BGZA 3H0ZA 3HUBA 3L8XA 5M53A 3DZQA 1H1WA 4EQUA 3KMWA 1OMWA 3ZONA 2OLCA 3C5IA 2VTRA 4WKQA 1J7LA 2ZV8A 1TZDA 1YVJA 2P3GX 4IACA 1KE9A 4ALUA 4FTLA 5CSVA 4ZOGA 5LVLA 2X9FA 5HVKA 2GNGA 2YIYA 5M44A 2IZRA 4QMZA 3MGYA 3BWFA 3VQHA 4P5ZA 3BLQA 4NK9A 2B9FA 1WVYA 3TM0A 4ANLA 1RDQE 5JMSA 2G2HA 4R3CA 2BMCA 4JAIA 4E6DA 3TNIA 3QQHA 5IA2A 3SW7A 3DFCB 5IQBA 5E4HA 2ONLC 2JGZA 2BIYA 4DHJA 4WG4A 2HCKA 5HGIA 3T9TA 4KAOA 4BIDA 2QOKA 4GK4A 4OUCA 3KY2A 4JDIA 4FRFA 4IJ9A 4AA5A 1OBDA 5M4FA 3F5GA 4LI5A 3P86A 2J0LA 1Y91A 1PJKA 2R3NA 3CTHA 1GY3A 4Y72A 3MVJA 4F1OA 3ZYAA 5HIBA 4D4VA 1JVPP 5CSWA 2BFXA 3W8LA 1JKKA 1ZRZA 3VHKA 3F3WA 4IE9A 3WF7A 2XANA 2J0IA 4LUEA 5FM3A 4ZJIA 4EKLA 3E7OA 5T68A 3R1SA 4QTBA 5BVDA 1OVEA 1QPCA 4KABA 3MYGA 1OL5A 1NVSA 3LFEA 4G2FA 3FZTA 2PPQA 4GFOA 3FMNA 3IW6A 2HK5A 3ZUUA 4HVIA 3UODA 3SG8A 4AZFA 4C02A 2CCIA 5LOHA 2QU5A 5FM2A 4YZCA 3C4EA 3LKMA 5JQ8A 3PSBA 4L7SA 4EZ5A 3R00A 4ITJA 3UZRA 4IC8A 2B4SB 2WZJA 4KBKA 5F94A 2IZUA 3NPCA 3VNTA 3AT2A 3HMIA 4C2WA 3MJ2A 1Y6AA 1DI8A 3LCTA 1UNLA 3QC4A 4QQTA 2QLUA 3G5DA 3NAYA 4RMZA 4RVKA 5D7AA 1YXVA 3IDBA 4NJ3A 2GNFA 3RWPA 1GIHA 4NW5A 2P33A 5DLSA 5AX9A 4Q9ZA 2I7QA 3ALOA 4DG3E 3BQRA 3PPKA 4HGEA 5IZFA 4ZXTA 3KKVA 1S9IA 2VO7A 4FV8A 2BAKA 3EZVA 4RC2A 3BEGA 4BZNA 3LPBA 2XEZA 3P79A 1CM8A 4FTQA 5HIEA 4I6LA 5K5XA 4D9UA 2PSQA 4TYIA 3UGCA 4S30A 2ITPA 3BYUA 3E8DA 3UIUA 3Q9ZA 1MRUA 1YXXA 3L9MA 4QMQA 2PL0A 4RJ7A 3QTSA 4H3PA 3TV4A 5HTBA 3LIJA 2O0UA 4O7VA 3R9HA 2WIHA 3PIYA 3EKNA 4BBMA 2R0UA 2O63A 4GT5A 4GK3A 2ITWA 2C5NA 3DTWA 3DXPA 5HI2A 5CU6A 2PK9A 3DAKA 4MWHA 5L6PA 3DFAA 2Z02A 4BGQA 3G0EA 4NM3A 3ETAA 2HAKA 3F7WA 4GG5A 4C38A 4AGUA 3BHVA 4O0SA 5AAEA 2J0MB 2UUEA 1JLUE 2J5FA 3E3PA 2I0EA 4FODA 4RJ6A 5CXZA 2B53A 2GFSA 3E5AA 4HCTA 5C8KA 4CLJA 2UV2A 2WQOA 3QQUA 5TF9A 3N4UA 4DAWA 4UYAA 4CT1A 4Z16A 1O6YA 4ZTSA 4G5JA 2OWBA 2PZIA 1M2PA 5LMKC 3KXNA 3RPSA 2P4IA 2ZM3A 4RJ5A 3R7EA 4CKIA 4QP8A 2PZ5A 4D4SA 5M08A 4F08A 3V3VA 1XMMA 1F0QA 2BDFA 1H25A 1J91A 2OH4A 3D5VA 4FZFB 2BHHA 2CDZA 2HY0A 1WBSA 3HRBA 4FTNA 4XNEA 3W18A 2J7TA 2CNQA 3UC3A 4RQVA 1U5QA 2B0QA 3MFTA 3F9NA 4IVCA 4RZWA 3K3JA 1BUHA 2CLXA 2XJ2A 5EHOA 3AC4A 1BMKA 3DAEA 3OF0A 2J9MA 3VJNA 3FDNA 2WTCA 4FZDB 4C4IA 4V0GB 1AQ1A 4O1OA 4BYIA 2GU8A 4C34A 5LXMA 3UP7A 2ITQA 5BUJA 3MIAA 5IQFA 1H1RA 4ANSA 3OEZA 4IZYA 4EWQA 3S2PA 4ENYA 5IQDA 2EXMA 1MRYA 4F65A 2GNHA 2VNWA 1YRPA 2OH0E 3NLBA 4QOXA 4XHKB 3VBXA 3TYKA 1UKIA 3TKHA 5FBOA 4TYHA 2C6EA 4UYNA 4FIGA 5CNOA 4D9TA 3C0IA 5LQFA 3LCKA 5HLNA 5DBXA 3CPBA 5EG3A 3QCQA 2HXQA 2EXEA 4IC7A 4PPCA 4LOOA 3NCZA 2WOUA 3KL8A 1OGUA 1U4DA 5J8IA 4FEVA 5E8TA 4BIBA 3F2AA 4LOQA 4G9RA 4ERWA 5IDPA 4KA3A 2VTQA 3MDYA 3EOCA 4FIIA 3ORLA 4JR3A 2P2IA 3AMBA 3AQVA 4D2TA 2PVMA 3BZ3A 2OXXA 3BRBA 3K2LA 5HVJA 1P4FA 3EJ1A 4IWPA 2Z60A 3CGFA 3DA6A 5DR9A 3TWJA 2XMYA 4FNWA 5B2MA 3AC1A 4W4VA 5CSPA 4RIYA 4RSSA 3CQWA 3MS9A 4GJ2A 5A4EA 5HESA 5CU0A 4IZ7A 1SM2A 4EQCA 5TOZA 3NMUF 2X4FA 3PXZA 4RX7A 2HXLA 2O5KA 4JOAA 4LGGA 3UOHA 3ZMMA 2PTKA 2XBAA 3HECA 4U41A 4C4HA 4NKSA 4QTEA 5H8BA 4KIKB 3R02A 5HO8A 1WVWA 1UKHA 1OB3A 4MD9E 4C36A 1BLXA 3NUAA 2XRUA 1XJDA 3A4OX 5TR6A 4QP4A 4RWJA 1QMZA 2GTMA 2W1EA 2CMWA 3WZEA 5AEPA 3AKJA 1VYZA 3A7IA 3BLRA 3VS0A 1GZNA 4L46A 3OMVA 3PJ2A 1JKLA 4IWDA 3VIDA 3K54A 3Q53A 3Q4TA 5DN3A 4IZAA 4CV9A 5A46A 1XBBA 2EU9A 3G6HA 2E9VA 3OEFX 4AP7A 3VVHA 3NRMA 2VV9A 3II5A 4CFWA 2BRBA 2Z2WA 2ZMCA 3OS3A 5EQPA 1RE8A 2ZJWA 2YWVA 4FTTA 4TRLA 2IN6A 2P0CA 4X3FA 3OWKA 4GKHA 4IDTA 3QUEA 5EM5A 3TJDA 1XQZA 3BWJA 3OUNB 5LVNA 1O9UA 3DXNA 4XMOA 3KGAA 3F2RA 4PDOA 1JWHA 3QRUA 1PYXA 1YHVA 3CS9A 3R2YA 4MAOA 4RIWB 4WOVA 2G01A 3U55A 4UXQA 1W82A 1HCLA 2WFYA 3F6XA 3GCSA 4DLIA 2XK8A 1X8BA 4RIXA 1J1CA 5A4CA 4J71A 5KBRA 2YCFA 2C4GA 2CJMA 4YC3A 3TI1A 1RW8A 1YW2A 4CLIA 3UOJA 1WBVA 3UPZA 4HVSA 4EZ7A 2NNWB 2JFMA 3MFRA 4LGDA 4DEEA 1OZ1A 2V0DA 3H4JA 4AW1A 1J7IA 2JITA 3I6WA 3KCFA 1PXJA 4ARKA 3QC9A 4CV8A 4ID7A 3K5VA 4CVAA 3FSKA 4O6EA 3SOAA 1QPDA 1AD5A 3KFAA 3MY5A 2Q83A 3OCBA 4XV9A 4DLJA 4N6ZA 5CZHA 5DG5A 3O5AA 2B54A 4QNAA 2UZNA 4UV0A 3TUBA 4RWKA 4F6UA 4HGTA 5A9UA 3CD8A 4G16A 4NUSA 5FEDA 2W4KA 4FTKA 5ETFA 3FMDA 4MUQA 1OKYA 3NZ0A 3GU5A 4ZTMA 5CI7A 4H1MA 3QBNA 4CQGA 5AX3A 4IVDA 4CCUA 4D55A 4EK5A 5HIDA 3E3BX 4YTIA 5EDRA 2HWPA 1BI7A 3GT8A 3UVRA 3LFFA 3ZLWA 5IA0A 5LWNA 1ND4A 2BUJA 1Q8TA 3F5PA 5KMMA 3RAHA 3OBJA 5JGAA 4DTAA 5EI8A 3GCVA 4G6NA 3QRJA 4MF1A 4EH2A 4JBOA 4GVAA 2RL5A 4K2RA 3WI6A 4ZAUA 5CEKA 3HEGA 5BVOA 3ORIA 1ZZLA 2ZB0A 5CU3A 4A9SA 3Q9YA 2JAVA 5L2TA 3FC2A 4QDEA 3DBEA 3UDSA 1YKRA 3FL5A 5L8JA 3RWQA 4PRJA 1W2FA 4QTCA 4RFYA 5DOSA 3NCGA 3ZBFA 3G9LX 3V01A 1K9AA 2DYLA 5HKMA 1Q8ZA 3D2IA 3ZZWA 2UW4A 2UZTA 3VC4A 3DKOA 2WMBA 3CIKA 1ST4A 3L8VA 4I4FA 4FIHA 5DVRA 5HBJA 2QVSE 4IAKA 2NYAA 3QCSA 2OZAB 2WMRA 3BL9A 4DGLC 3PRIA 2ITOA 4BZOA 3OTVA 1SVEA 2H8HA 2A1AB 2OW3A 4BN1A 3G0FA 2C6IA 5TE0A 2P2HA 3WF8A 4C0TA 3GNIB 2F7ZE 5BQ0A 3LCDA 2ZFYA 3VUHA 4I3ZA 4C8BA 3A8WA 2AC5A 3F5UA 4HZRA 5J7HA 4APCA 4USFA 3QTXA 2PYWA 4H36A 4ONAA 2XKCA 4D4YA 5IQGA 3B2TA 3LLTA 5CEQA 3GVUA 5DHJA 2RG5A 4NTTA 3GENA 4FIEA 1JKTA 4U40A 3P4KA 2PHKA 4BRXA 5D7VA 3I5ZA 4MHAA 4TWCA 1OGYA 4FKRA 2QG7A 3PXKA 2YHVA 4PDPA 4LGHA 3E62A 3DLZA 4AXCA 4WNMA 3C5UA 4LL0A 3AD5A 3NSZA 3QHWA 4UALA 3ZHPC 4PNKA 3LHJA 5JQ5A 1R78A 2VWVA 4XG8A 3Q4UA 4XYFA 3U87A 3TDWA 4NL0A 1GAGA 4H05A 5I5ZA 3WIKA 5E8XA 3U4UA 2HELA 2BRNA 5JFSA 4FG9A 4KS8A 2XNMA 1YHWA 2BTRA 5HBHA 3WZJA 4DH5A 4O7WA 4DDGA 1FQ1B 1IAHA 3U4WA 2OJ9A 3NGAA 2WNTA 3FL4A 4O2ZA 3LM0A 4J95A 3LQ3A 1UU3A 4GJ3A 2BFYA 2GS6A 2QHMA 2REIA 4G3CA 2X0OA 2JLDA 3QX2A 5HE2A 4DTKA 3DZOA 3FMHA 2C5YA 4PDYA 3KXGA 3GFWA 5BYLA 2R7IA 4U9AA 1DS5A 1OL1A 5FEQA 3TV6A 5DIAA 3WZKA 3CY3A 4IANA 4ZP5A 3U54A 5J5SA 2XAOA 3V51A 4FEWA 1ST0A 1FMKA 1Y8GA 2PMIA 2YIQA 2XB7A 4ZTNA 2O8YA 1H1SA 3ZO1A 5HE1A 2R9SA 3P23A 4R8QA 3PXYA 3Q96A 3ORMA 4PPAA 1M14A 3AG9A 1XHAA 3HMOA 5DRBA 4BYJA 4BWPA 4TYEA 3ACKA 3IPHA 4PY1A 3DQWA 3TIYA 2J90A 2HOGA 2IWIA 1OITA 3DPKA 3Q5IA 4R5YA 3W1FA 4EOMA 3NUNA 4R6VA 2FO0A 2G1TA 3DK7A 4C4FA 1NVQA 3FHIA 4E26A 5A4QA 5KMJA 2BZHB 2UVYA 4PL4A 3VS6A 4ENXA 2YEXA 4OT6A 2CKOA 2CN5A 3IS5A 4FSTA 4JBQA 4CYJA 4AG8A 4QMXA 1Y57A 2PE2A 1LUFA 3I79A 4JRVA 2Y4IC 3U9CA 3W32A 3ZRMA 4MXYA 3IKAA 4G3FA 5HE3A 3ID6C 3HX4A 3MH3A 3PA3A 1J1BA 3WARA