4IAKA

Low temperature x-ray structure of camp dependent protein kinase a in complex with high sr2+ concentration, adp and phosphorylated peptide psp20
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Insights into the Phosphoryl Transfer Catalyzed by cAMP-Dependent Protein Kinase: An X-ray Crystallographic Study of Complexes with Various Metals and Peptide Substrate SP20.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/peptide
total genus 112
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4iakA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4iakA02
4BFMA 4FEXA 3HP5A 3HUBA 4QMYA 3V01A 4E4NA 5AUTA 4CLIA 1YW2A 4RPVA 2QOHA 3BBTB 3LQ5A 4WT6A 3VBQA 3CD3A 3DCVA 1UNGA 4FV4A 2OLCA 3QRKA 3V04A 2CKOA 1YDTE 4N0SA 3FZSA 5I3RA 1KV2A 2XYNA 3VS5A 4CCUA 2WXVA 3WIKA 1PXMA 2BFXA 4PMPA 3UIMA 4CT2A 1WBPA 2PZIA 3IDBA 4MVFA 5FP5A 3W1FA 2VTHA 3GBZA 4YHJA 5AM6A 4BCNA 3LCSA 4W9XA 1FVVA 4A7CA 5CANA 4I6HA 4RJ3A 3BKBA 3NS9A 1PHKA 2XBAA 2ITOA 3CR0A 4YPSA 3F7WA 2VTPA 4EH7A 4LOPA 3AD5A 4L6QA 1WBNA 3DGKA 5D41A 2RSVA 1AGWA 1JNKA 5AIKA 3M42A 3NW6A 2W96B 5IISA 4FZDB 3D5UA 3UOKA 4LUDA 3OUNB 2JBPA 4L43A 2CGXA 3BX5A 3O7LB 4LRKA 4YGAA 4D2WA 1JKTA 1YOJA 4JAJA 4AOJA 4MF1A 3C1XA 4WNOA 4BC6A 5IUGA 4I6QA 2QR7A 3ORIA 4QP6A 3Q53A 4QYEA 2B1PA 4GW8A 1YWVA 3OXTA 4R1YA 4UBAA 1HOWA 1UU8A 2V5QA 1JVPP 2UZOA 3A7GA 2IVVA 3ZLWA 4BICA 3QZIA 4MXCA 2JDRA 3SG8A 1F3MC 4ZK5A 2W05A 4BTFA 4WNPA 1IA9A 1I09A 2BRNA 3KXXA 3VF8A 4DFUA 1JPAA 1YHVA 1JKLA 4BWKA 4D2PA 3SX9A 3FXXA 3PLAE 3OCGA 4DH7A 3Q96A 5L8KA 1W83A 4GYGA 4CTBA 4MD9E 4BWXA 2PZPA 1QPCA 3I4BA 2V55A 4CTCA 2OU7A 2PSQA 3R9DA 5L3AA 2PMOX 3DBCA 4ITIA 4IAIA 4R3CA 1CKPA 4C62A 1OMWA 5EH0A 3CY2A 4M67A 4F9WA 2G2IA 3EKNA 4YUQA 3Q5IA 3EFLA 5E1SA 3TKHA 3H9FA 3C0IA 3UODA 3R00A 4RIXA 2GHGA 2PK9A 3ZCLA 1ATPE 3OWPA 2R7BA 4LUEA 4BGHA 5M4IA 3B8RA 2ZDTA 3OCSA 4FSZA 4JLCA 4M3QA 4V0GA 3UZRA 3FY0A 3AC4A 3UVPA 4QP7A 1M2QA 4DFYA 4F64A 5HU9A 5LOHA 4CD0A 3LXKA 4IX4A 3R73A 5JGAA 3NPCA 1J7IA 3C0GA 3ZBFA 4YTFA 3QQGA 5GIPE 4KB8A 4C4GA 5C4LA 4HYIA 4XUFA 4MNEA 4LRMA 5IA5A 3ATSA 2YM6A 4IJ9A 2RGPA 2GPHA 4QMTA 3RPVA 4BWPA 2W1ZA 2P0CA 3RVGA 5EQYA 4I3ZA 4RQKA 1TQIA 4G5PA 3LFSA 5M4CA 4APCA 3DAKA 2ITPA 4YR8A 1G5SA 2UZDA 3QTWA 5FBOA 3BYMA 2V0DA 3DXNA 5BYZA 2Z7QA 4GVJA 4DFXE 2CKPA 3HKOA 4FSYA 5CENA 4EH5A 3NSZA 5BVDA 3FEGA 4O6EA 4FKWA 2IVSA 2H96A 3PIYA 5DEWA 5BUIA 1G8AA 3QALE 5JSMA 4BCQA 3SHEA 5FXSA 3OXIA 3KA0A 5TE0A 1FBNA 2QC6A 2XNNA 3F3WA 4ANOA 2YIWA 2ZM4A 2XK9A 2XBJA 3U51A 4YLJA 3DQXA 4USFA 5CTPA 4A06A 4L7FA 1XWSA 4Q9ZA 3VS6A 2R64A 5DT0A 5C8NA 4O21A 5A54A 4PWNA 2RIOA 2YACA 3Q4TA 2WMBA 2WMVA 1GZKA 2A19B 3C4WA 3DAJA 3R8ZA 3UPZA 4KIKB 4L44A 3BYSA 4C35A 4QT1A 3HVCA 4IZ5A 1CMKE 4AGDA 2GS6A 3NWWA 3OY1A 2A1AB 4PRJA 4QMUA 3I60A 2JEDA 1DM2A 3NW5A 5KHXA 3RK9A 2PE0A 4DCAA 3W2RA 5JQ5A 5JEBA 3RINA 4F6WA 4AT5A 2BAJA 1R0EA 3EQFA 1SVHA 3NGAA 5IA4A 4XV9A 3UG2A 3Q9ZA 2FYSA 3PXRA 3VBWA 4D1XA 4LMNA 3GEQA 4CRLA 4JI9A 2Y7JA 5E8WA 1IAHA 4PMMA 4F9BA 3ZFMA 5IA0A 5HO8A 3ZM4A 3ZDUA 2W1FA 1ZYSA 5J5TA 3G15A 4EI4A 1GZOA 4KKEA 4O82A 4FKVA 3O8UA 4C02A 3QX2A 4C4FA 4FVQA 4AA4A 5E1EA 4DEHA 2P4IA 3V5JA 2WTWA 1YXUA 4L9IA 3ZYAA 3ZFYA 1YHSA 4TYIA 5L2SA 3EQRA 4QNAA 4EZ5A 5KMOA 5CF4A 3F7ZA 4OBOA 1QPDA 4D9UA 3ALOA 1PXPA 3PA5A 1YWRA 4I5PA 1DAYA 5GZ9A 5IUIA 3VN9A 5CXZA 4I1ZA 4IB5A 4HW7A 3GNIB 3EFKA 2JFLA 2XNMA 4ZLZA 4RWJA 4LOQA 2ITYA 4F0GA 4QD6A 3ORNA 4I0TA 5EOBA 1BMKA 5ETIA 4ID7A 3H9OA 4DLIA 3FXZA 3JVRA 4KD1A 4XCUA 3GT8A 3PIXA 4LYNA 4UYNA 1WFCA 1YXXA 1V0PA 5M56A 4EOQA 3QRIA 3FYKX 2YAKA 1XBAA 1Y8GA 2RFSA 4MCVA 3I79A 4PMTA 1PMVA 3QQKA 4RT7A 4YTCA 5AAEA 2VTMA 5IEXA 3K5VA 2BR1A 2F7EE 4DITA 2YCQA 3UNJA 4DLJA 1R39A 1H07A 5HD4A 1DI8A 3TG1A 4NCTC 1Z9XA 3P7BA 4D5HA 4RFYA 4J52A 4IZYA 2BDJA 3NDMA 4AX8A 5BYLA 4O91A 4YJOA 5CSWA 5AP2A 3H0ZA 3RI1A 5TT7A 4CQEA 2LGCA 3HZTA 4TNBA 5CAPA 2BILB 2IN6A 2QI8A 2R3MA 3EN7A 4ZSEA 4BF2A 2BAKA 3R7VA 4R1VA 2GQSA 1G3NA 2VGOA 4WO5A 4O84A 1TQPA 4BL1A 4XV1A 2QKWB 1Q8WA 4AT4A 2GNFA 1ZLTA 4QMSA 1B38A 3R9RA 3WF6A 4E73A 3OWJA 4ASEA 3EN4A 3GCPA 4U97A 4XP0A 4CFXA 4H1JA 4UN0C 5CSPA 3DXPA 1V0BA 3UQGA 1DS5A 4H3BA 3QD0A 2XB7A 2PZRA 2W1GA 3RNYA 1M52A 2VN9A 2O63A 3ZS5A 4HVGA 2JDSA 4K18A 5TOZA 4EK4A 4GG7A 2YLFA 5HBEA 3ORTA 3NUNA 3AGMA 3LXPA 4EC8A 3OP5A 3COIA 5JN2A 2C6DA 1GIIA 2VO0A 4BR3A 3CC6A 3SC1A 3V8TA 4WKQA 4XLIA 3MFSA 5EYKA 1SVEA 5EI2A 5B2KA 4F4PA 1OM1A 3F3ZA 4ZLYA 2KULA 3HRBA 3QTIA 3E3BX 2BVAA 5EDRA 2X2MA 3VS0A 2J6MA 4WHZA 4Y73A 2LAVA 1WBOA 4E5BA 3KL8A 4NSTA 1YWNA 5AP7A 3FC2A 3OD6X 4FV5A 3TV4A 3W8LA 4I5CA 4E20A 1Q61A 3AT2A 5HCZA 1E1XA 3PJCA 3CP9A 5I9ZA 2XKEA 4EKLA 2OZAA 4NH1A 4XEYA 5CNNA 3VUKA 4U44A 1KOBA 4CCBA 4AT3A 4I6FA 3OROA 2RG5A 4Y8DA 3KXMA 5BVKA 4HCTA 3CSVA 2E9OA 3NAYA 3PSCA 5FP6A 3Q3BA 5DVRA 1NVQA 1VZOA 4IVCA 4OT6A 4M13A 2QU5A 5EKOA 5CSHA 3HV4A 3LZBA 4IADA 1YXTA 1E9HA 2REIA 3V6RA 4CZYB 4YU2A 1A48A 2GQRA 3I6UA 4DTBA 4K2RA 4F1MA 2GNIA 2WTVA 5DR2A 4JIKA 3BU6A 4QMWA 3IGGA 4QQCA 3QUPA 3R83A 3K54A 3KK9A 5IQCA 5F95A 5L6WL 3VO3A 4A4OA 5C9CA 3FQHA 4KIPA 4EYJA 4O7VA 2ETMA 3SVVA 3PVUA 3U4WA 4U41A 4RBLA 3KREA 3WF9A 3IS5A 4GUBA 4G31A 4LMUA 5AR3A 3LE6A 2X2LA 3ACJA 3VHKA 3LKMA 2QR8A 3KEXA 2HOGA 4DGLC 3RAIA 4GL9A 5I4NA 3KF7A 4WRGA 5GHVA 1OPJA 4C4HA 3MPMA 1XH9A 4UALA 4F9YA 4G5JA 1OL2A 4XV2A 4FBXA 3V5QA 4CYJA 5LWMA 4IVAA 2Z2WA 3NIZA 1IG1A 4O7NA 2UUEA 5DI1A 2C1AA 5CI7A 3FZOA 1FMOE 3U9CA 3NVKI 3NYVA 4FSMA 4IE9A 3IDCA 5CNOA 1XH4A 3MVHA 4OGRA 4U43A 1XH8A 3VS7A 3ZXZA 4AW2A 3PIZA 4BTKA 1PRYA 4M97A 2E9VA 4EOSA 4R7BA 5FLFA 3Q32A 5J1WA 2PVMA 3PY0A 2Z02A 1Q24A 2XZSA 5HLPA 4EHEA 2JLDA 5HG9A 4IW0A 1H01A 4H39A 1YOLA 3UIXA 2YIRA 5J79A 2B9HA 4UWCA 3DFAA 5FD2A 4GK3A 2WQEA 5HG5A 2ZJWA 3R7GA 3H30A 3T8OA 4MXXA 3T9IA 2C3LA 3A4OX 4C8BA 4CEGA 4I22A 4PTGA 3FPMA 4O0SA 5CLPA 1U46A 3HV7A 3L8PA 4C3PA 5A9UA 5AAFA 2IW6A 2OW3A 4HCUA 5L4QA 4NYEA 4TN6A 2QNJA 1JAMA 4UMQA 4DH8A 3ORPA 3TKUA 3OT8A 1ZWSA 3R22A 1MRUA 2X4FA 5CU3A 4FOBA 3MDYA 4MBLA 3IW7A 3UO4A 5FTGA 2QLQA 1PJKA 3EQGA 4CKIA 2VUWA 1UU3A 2W5AA 4U5JA 5J95A 4K1BA 2WMSA 4U40A 2GDOA 3QTRA 4NWMA 3NUUA 4RX5A 3AC1A 4AWIA 4NL0A 5KUPA 3JUHA 5AR7A 4RWIA 3DXQA 4IAAA 2PPQA 4TWNA 4YJTA 4KSQA 2HENA 3P79A 4KNBA 5CEIA 4B8MA 3OFMA 4AE6A 4D28A 3UP2A 4EK8A 3TJCA 3HGKA 2CN8A 4G6NA 4JR3A 4ALUA 4DG2E 4I92A 3ZSIA 3FSKA 4FSQA 4C4EA 4UMTA 2QG5A 4PX6A 5KKRC 4U80A 5J9ZA 2WEIA 4DC2A 1PXOA 3B2TA 1M7NA 4KRDA 4FYNA 2ZM1A 1A06A 1H28A 3Q04A 5EKNA 2CMWA 4YC3A 4XYFA 2G2HA 3DOGA 4TRLA 1BYGA 4WSYA 3H0YA 1VYZA 4OTQA 2W06A 4PDPA 2GNGA 3ZRLA 2BZJA 3OOMA 4YJQA 2YJSA 4QTEA 3DJ6A 4YO6A 4CXAA 2WKMA 3G90X 4GH2A 2NO3A 4E4XA 2R3KA 3JR1A 4C3RA 4D1SA 4D58A 3OOGA 5IMEA 4X3FA 3D5WA 1KV1A 4E4LA 4CVAA 5M44A 3R9OA 4E26A 3QZHA 4FTJA 3TWJA 2VTRA 4EEVA 4O7WA 3KRLA 4L45A 3K3IA 2FSTX 4AZSA 1MRVA 3E7VA 3ORZA 4JBQA 2GNLA 4FK6A 2YCRA 4JG8A 4O0WA 4LI5A 4AS0A 4WOVA 3MIYA 3S2PA 4HYUA 2IO6A 3L9MA 4R8QA 5ANJA 1JWHA 3UOJA 3Q60A 3ETAA 2UW0A 5EQEA 3E87A 3D5VA 3TNPC 4L8MA 4U8ZA 4BCHA 4DH3A 4EUUA 2X8DA 1H1SA 2Y0AA 3VS3A 2OJGA 2WTIA 1FVRA 4G16A 3PDTA 1QCFA 5I9WA 2WTDA 4CNHA 3BRBA 2X6EA 3QL8A 4FKLA 5EW3A 5HZNA 4DT8A 2OK1A 4W4WA 2ZV7A 4TYHB 4DEBA 2XK4A 2HXQA 3Q2JA 2A0CX 2J5EA 3BHTA 1W0XC 1ZOEA 4K11A 2CHLA 3BGQA 3R7IA 4GJ3A 5IH4A 2XJ2A 1OIUA 2P33A 4G3DA 1JKKA 1GZ8A 3QWJA 4XBRA 2PVJA 3P0MA 5EK7A 4O22A 2YDIA 1WVWA 2CSNA 2Z7RA 4NM3A 4FV2A 3E8NA 4XG2A 1S9IA 2CKEA 3HECA 4DFNA 2UW3A 1R3CA 3R1NA 4C2VA 4QMPA 3SDJA 3EIDA 3GQIA 3LFAA 4XJ0A 3RTPA 4D2VA 5AAGA 5T3QA 2XK6A 3GENA 3U8WA 3ZOSA 2CJMA 5FEDA 5E8XA 4E4MA 2B7AA 1P4FA 5FUTA 4FTIA 4IAZA 4JR7A 2YDKA 3BWFA 5IU2A 2CNQA 1O6YA 4FKPA 3VC4A 4CFMA 3BHUA 3F2NA 5K0XA 3UG1A 3DV3A 2XKCA 2C4GA 4YO4A 2ITUA 3KCFA 3IQ7A 3E88A 3DT1A 3QWKA 4A9SA 3RPYA 3KF4A 3TUCA 2HZIA 5J9LA 3RNIA 3TV6A 3U9NA 4RG0A 1UKHA 3Q4ZA 4YJVA 1K3AA 1UWJA 2P55A 1ERKA 4D5KA 2R3GA 2UZWE 4WG5A 3TZMA 1OUYA 2QOFA 3ULIA 5EW8A 5IZFA 2C3IB 1OZ1A 4UXQA 3KY2A 4FSUA 3OWKA 5HG8A 4ZIMA 3CKXA 3C4ZA 3WOWA 4BHNA 4BGQA 3GCVA 3U6IA 2ITVA 4ASDA 4G1WA 4S34A 3KVWA 2JKQA 4KS8A 5CEQA 4XG4A 3MH3A 4YJPA 5AEPA 2XRUA 2H6DA 2VWWA 3LFEA 3C4EA 3BE2A 3IW8A 4GV1A 2GTMA 4FV6A 5HD7A 3MH0A 1YVJA 3V3VA 4JJRA 5HE2A 5I3OA 4JQ8A 3ZM9A 1O6LA 1OKVA 3QCQA 2JKMA 3DKOA 5DRBA 3UOLA 3NAXA 3AC2A 2WPAA 3BEGA 4Y46A 4DF3A 1WCCA 4IFGA 2F7XE 4FIHA 4E6CA 4EYMA 4X2GA 4FTAA 3MWUA 3D5XA 4CZUA 1OIRA 5ANEA 2SRCA 5E8SA 3M2WA 5KNJA 4IFCA 2WD1A 3O8PA 2QVSE 5H9BA 1RE8A 4XMOA 5L2TA 5F4NA 2BZHB 2ITWA 2IZSA 3ZZWA 4EK5A 5KCVA 3PG3A 3JY0A 3R6XA 4M69A 1GNGA 3WZEA 1FPUA 1OKWA 4AU8A 4X0MA 4GMYA 1ZZLA 4DEAA 5M53A 5EI6A 2P2HA 2Y6MA 5FQDC 1M2RA 3OS3A 1GJOA 3QTQA 1XBCA 3WE4A 5IDPA 4K0YA 5J7BA 3FL5A 5DR6A 5CVFA 3PRIA 4DTKA 5DR9A 1BI8A 1I44A 4HJOA 4TT7A 3P5KA 1RW8A 2UW5A 4ANQA 2J0IA 2JDOA 2XUUA 4QPSA 4ZP5A 3MV5A 5E90A 3NX8A 4GK2A 3TZ7A 4D4SA 4ITHA 2OH0E 1PY5A 4ZY6A 2J50A 1SNXA 3FMMA 3BIZA 4U81A 4CT1A 1T45A 5BPYA 1BL6A 2FA2A 2XNEA 4FKQA 4GU9A 5J87A 2G01A 3QXPA 4H1MA 4PQNA 2W0JA 3R1SA 2HCKA 4FSTA 1L3RE 3W55A 4FTUA 5EQPA 1Q3WA 4Z16A 1ZY4A 5DG5A 4S2ZA 4UWYA 2E9PA 4AGWA 3G33A 4FTOA 2OF4A 4OTFA 5I9VA 2VU3A 4BDHA 3ORXA 4QP2A 4UY9A 3EN5A 2IW8A 4TWOA 5AA8A 4WUNA 3S4QA 2ZOQA 3QXOA 4RIOA 4YZBA 2VWBA 4HCVA 4EQCA 2RF9A 2X8EA 1YI6A 4G3EA 3LOKA 4QYFA 5HIDA 2OJJA 3BHYA 4AFEA 2XNPA 4HOKA 5DHJA 3ACKA 3LLAA 2YM8A 3FL4A 4YC6A 3R8MA 2XIXA 3DAEA 4ZSGA 3R63A 5ETCA 5HLWA 1H1QA 2I7QA 2Y4IB 3QTZA 4L3LA 1JBPE 2BKZA 2QHMA 3LW0A 3SA0A 1LP4A 4U3YA 3MFUA 2DQ7X 4AOIA 5A14A 5CYIA 3BHHA 4JL9A 3KRJA 3PVGA 3TEIA 3OMVA 5A6OA 4WBOA 4QMMA 2W4OA 3C4XA 3AT3A 4O7ZA 1SYKA 2DUVA 1ZYLA 4MHAA 2HZ0A 1OPLA 3WF5A 1GZNA 3SLSA 4KRCA 4ANMA 2F49A 3ENMA 2B52A 3I6WA 3A8WA 2HXLA 4OLIA 5EHLA 2BAQA 1OGUA 4AGCA 4BCFA 2R3HA 5DNRA 5TF9A 4MWHA 3RP9A 5ICPA 4MF0A 3KRXA 2G9XA 3CIKA 3F5PA 4FTLA 3TNHA 2VTNA 5CSXA 1Q8YA 3VW6A 4BVUA 4RVTA 3O2MA 3MTLA 5EFQA 4YURA 5CU0A 2VO3A 5CZIA 3FZRA 5JFSA 3V5LA 1O6KA 4ENYA 3ZLYA 3WZUA 2QURA 3GOKA 4L46A 4LV8A 1KE7A 1REJA 4G9RA 2OWBA 5E91A 5IQDA 2UZNA 3MFTA 5HX8A 3NCGA 5DRDA 3WARA 4BIEA 5HQ0A 3EOCA 2R3OA 5E8UA 4PY1A 3R04A 4XRLA 5LMKA 4IX6A 2HY81 3WZJA 4Y5QA 4LGGA 3C9WA 4A9YA 3VHEA 3ZEWA 3HV5A 4YBKA 4E8AA 2O2UA 1CSNA 4JQ7A 3F3UA 4HNIA 5IA3A 4RC2A 3MY5A 5FRIA 2RL5A 2ZB0A 4PP7A 3KULB 3MYGA 3HV6A 5BMMA 4EOPA 1WMKA 4UX9A 1IA8A 5DYJA 4DE4A 4YLLA 4I93A 3AG9A 3QZFA 4CFUA 2VV9A 4NK9A 1RDQE 2UV2A 3VNTA 5IA2A 2J90A 3N4VA 3PXKA 3A62A 2NPQA 2W99B 1PW2A 3KMMA 3EZRA 5EW9A 3L8SA 4QP1A 3PFQA 5HU3A 4UZHA 5KX8A 1REKA 5HNBA 5LVPA 4UMRA 1KE6A 3VQUA 1DI9A 5CF8A 1Q5KA 3VS2A 2WB8A 2Q0BA 2R5TA 3BBWA 4QYHA 5F94A 2ACXA 3DBEA 3GU5A 4FKSA 4W9WA 5CZHA 3VF9A 4IM0A 2GCDA 4M0ZA 3WZDA 4BZNA 5IF1A 3KQ7A 2J0MB 2YLEA 2IVUA 4HGSA 5C26A 4EOMA 4FA2A 3EQCA 4MD7E 1OKYA 4FUYA 5EM5A 4DGOA 2ITTA 4FNWA 4R7HA 4JRNA 3ODZX 2DS1A 4A4LA 3DU8A 4EHZA 1JSTA 5DGZA 3KKVA 4CMTA 2F2CB 4Q5EA 3CGFA 4L68A 4U0IA 5GZAA 3G2FA 3VQHA 5ANKA 4CMOA 2ESMA 3I7BA 3C0HA 4U79A 3FLNC 5IH6A 4FTTA 3NVMB 4I0RA 2FH9A 4G6LA 3FQSA 3V51A 3ZC5A 5HOAA 5AX9A 4BGGA 3CJGA 4RX7A 1U5RA 4M14A 5IQAA 3ITZA 5H3QA 4JBOA 2WTJA 4TZRA 4OBQA 2Y4PA 4YMJA 2VTLA 1NVSA 1UVRA 4MEDA 5AJQA 3DQWA 5HVKA 1QPEA 2C3KA 2PUIA 4QPMA 2F4JA 2JKOA 3FMNA 4U3ZA 2IW9A 3ZU7A 4KIKA 4DH5A 3R0TA 1U5QA 5KHWA 5HORA 2QD9A 4PV0A 3T9TA 2C30A 4QYYA 2W4JA 4PF4A 4DYMA 3P86A 1IR3A 4O0VA 4W4XA 5ITAA 3QTSA 2OIQA 1YI4A 3F82A 4QOXA 4YC8A 3NUYA 3BWJA 1J91A 1OPKA 2NNWB 3FWQA 4O7RA 2BFYA 4MH7A 1P4OA 3E8DA 4RWLA 4BDBA 1W7HA 4L53A 4BDCA 5KMMA 1Q41A 4L3PA 1UNHA 2WQNA 2ZMDA 5BVOA 5C4KA 3QA8A 2XCHA 3LXLA 3GC0A 4W8DA 3BGPA 4IAFA 2OFVA 4RJ5A 3UPXA 5J7HA 1ZYCA 5C8MA 1YRPA 4DH1A 2A4LA 3RJCA 3C4CA 3ZUVA 1WBSA 3PPJA 5AUVA 4LG4A 3W33A 4X7QA 2WGJA 1GIHA 4LQMA 4F7SA 4O0RA 2QU6A 2OG8A 2VTJA 3AGLA 3F3TA 4MXAA 3TIYA 3QTUA 1OKZA 4KKGA 4BCKA 4G34A 2WMQA 3BU3A 5BQ0A 5AR4A 5HNGA 4PTEA 2IZRA 4A9RA 1P14A 2PVKA 1APME 2C0OA 4QP8A 2IWIA 2FSMX 4J8MA 4IACA 5HTBA 2W9FB 4O0YA 1QMZA 3C50A 4D1ZA 3I5ZA 2H34A 3R01A 5DN3A 4LGDA 2AC5A 3JXWA 4Q2AA 4AF3A 4IXPA 4H05A 4AFJA 4EC9A 4Z9LA 3FKOA 3I7CA 3LFBA 4HVHA 5AFVA 2BIYA 5JK3A 3QA0A 2JIUA 2XNGA 3QLGA 5H8GA 2ZV9A 5HVYA 4EQUA 4IVBA 2EB2A 4HVSA 3NYNA 4CFNA 4ZXTA 2C5VA 4EH8A 4F65A 4Q9SA 1OECA 3VW8A 1LR4A 5C1QB 2VWUA 3KU2A 4HYHA 2PZYA 3RALA 1CKIA 4XG6A 4DN5A 4KABA 2E9UA 2X7FA 3MA3A 4P5QA 2XP2A 4EH9A 2AUHA 2Q83A 3TDWA 2FB8A 4M84A 3LMHA 4F7NA 2UW8A 5AP6A 2C47A 3D4QA 4MX9A 4ZSAA 3DTWA 1LEWA 2OXYA 5JGBA 3COKA 4DHFA 3PXYA 2UW4A 4R78A 3VBVA 4TPTA 3FLYA 3I0QA 2QOLA 2VX0A 3KVXA 3QRUA 5AR8A 3EB0A 3L9PA 4CRSA 4DG3E 4LRJA 4R3PA 5AUXA 4AP7A 2V7AA 3EN9A 4CYIA 4RFMA 3NZ0A 2JFMA 4D4RA 3NR9A 2B53A 4XG7A 3CQWA 4U45A 4GIIA 2WMTA 3TTIA 3IPHA 3LCTA 2ITQA 3F61A 4S33A 3R7EA 3RPOA 5AP1A 2ITNA 3VUTA 3OY3A 4O7YA 3GGFA 3L8XA 3ZLXA 5HO6A 5ETFA 2P2IA 2CLQA 3G51A 3LFNA 4XG9A 2YM3A 1P5EA 2JC6A 2O65A 4AZFA 4RIWB 4RLKA 2YISA 3EKKA 2UW7A 3GFEA 1XO2B 1Y57A 3PY1A 3F2AA 5JKGA 1PKDA 3DJ5A 4I24A 4WD5A 1F5QA 4DEGA 3NNVA 2GNHA 5AWMA 3Q9XA 5BX0A 2GTNA 3E7OA 4BB4A 5HHWA 5HX6A 4WBBB 3BHVA 2X8IA 1PXNA 2FVDA 1OL5A 2OGVA 4I20A 5AP5A 1OL7A 3WBLA 4C59A 1QPJA 4KS7A 3TUBA 3ODYX 2OI4X 2EB3A 1PXKA 3AC3A 2HW6A 2ONLA 3A4PA 4GS6A 1MQBA 5CI6A 1UU9A 3Q4CA 5F20A 3QYZA 4TYJA 3W10A 4RA4A 3UTOA 2QO7A 5HKMA 4EBWA 1VEBA 3S95A 3SAYA 4DAWA 4ERWA 1BI7A 4IM3A 4LL0A 2XJ0A 3WE8A 1R78A 4BBEA 2GU8A 2XMYA 3TJDA 1FINA 5M06A 3FBVA 3IK3A 2XVDA 3ATTA 4FIGA 4JG7A 1XBBA 3LAUA 4P5ZA 3VBTA 1GIJA 1PMUA 3BLRA 3F5UA 3Q9YA 3BLQA 4O0TA 3KN6A 4YJUA 4ZTLA 3R7YA 3WYXA 2GQGA 1W8CA 5E8TA 3L9NA 3UBDA 2XIZA 5EYDA 5HI2A 4ACHA 4F1TA 3ORLA 2WMWA 1H1WA 2GHMA 3UVRA 2OKRA 4BYIA 3P7AA 2VNYA 4EHGA 1Q62A 3LJ2A 3GCQA 3DDPA 4WG3A 4QMNA 2Z7LA 1ZYDA 2PHKA 3W2PA 2I1MA 4B4LA 5A4CA 3DPKA 1ZMUA 2C69A 3MBLA 4AW5A 4BDIA 2YCSA 3LCOA 2VWVA 3AC8A 3DLZA 4F7JA 2FGIA 3QD3A 1KWPA 4KSPA 3EHAA 2B4SB 3OC1A 4H36A 4NT4A 5I0BA 3C7QA 5KMNA 2BRMA 3C5UA 3QKLA 4NFNA 2YA9A 3H3CA 4YBJA 4FK3A 2R7IA 1Q8TA 2UZUE 5JFXA 2Q0NA 3A7FA 3E92A 3DZOA 2YFXA 3SGCA 3BPRA 4R5YA 3BCEA 2UVYA 3KMUA 3VUDA 4FEVA 1Q8UA 4UYAA 1G8SA 2C6EA 5EYCA 3SQQA 3VWAA 1PMNA 2CDZA 2ZV8A 4MWIA 5E92A 4C4IA 3NNXA 3CQEA 3PUPA 5EG3A 4ZTNA 2CGVA 4ACCA 4FKIA 3DTCA 4WA9A 3NLBA 3OEZA 4KBKA 1NXKA 5FXQA 3TCPA 5L8LA 2YEXA 3QU0A 5G1XA 3POOA 2GS2A 4FV1A 2IJMA 1RJBA 3R2BA 2EUFB 5FDXA 5B0XA 3QHWA 2PY3A 3CE3A 5A46A 3QF9A 4F6UA 3IW6A 3DB6A 3U4UA 3GC8A 4EQMA 1H08A 2W1EA 5IEVA 4G3GA 5JFWA 3GP0A 2EU9A 3R8LA 4BCGA 4C57A 3RK7A 1WVXA 2PZ5A 4ACMA 4F70A 4XH6A 4DGNA 3RK5A 3TTJA 3FUPA 2CCIA 4Z7HA 4II5A 3QD2B 4J71A 4G2FA 3MI9A 4JXFA 4BTJA 2JGZA 4ALVA 4CKJA 5DIAA 2YM5A 3ZH8A 3QKMA 4FV8A 4Y95A 3AOXA 4C2WA 3WI6A 2CKQA 2G15A 2XK3A 3TACA 3S00A 2BHHA 3IOPA 2ITXA 4PL5A 4ARKA 5GJGA 1HCLA 4JDHA 4BDKA 3IG7A 4O2PA 4FTRA 2C6MA 4XOYA 4BDAA 5BMSA 5KKRB 4NW6A 2B0QA 1U54B 5ANOA 4B99A 4ANSA 5JQ8A 3ZDIA 3RZBA 5L6OA 4JQEA 3Q5ZA 4FVPA 4ZTRA 2GS7A 1BKXA 2QQ7A 3E62A 4FT5A 5FGKA 2QOKA 2GFCA 4EZ3A 3ZEPA 4L42A 4QNYA 3AMAA 4JX7A 4AW1A 4O7SA 4FGBA 4G3CA 3VULA 5KBRA 5DE2A 5A6NA 4EH6A 3ERKA 2XYUA 3L9LA 5L2IA 1R1WA 1H1RA 4PL3A 4DINA 4FIJA 4F9CA 2C1BA 2VX1A 3FMJA 5E8VA 5KMIA 4NIFA 5ETAA 3II5A 2I0YA 1PYXA 2J9MA 3MGYA 3V8WA 2RFNA 2C0IA 2W1HA 4IWDA 3PJ2A 5DWRA 3BQCA 4CFFA 2X4ZA 1J3HA 4O81A 2EXEA 2PE1A 3O8TA 3N4UA 4YJSA 3IKAA 2CN5A 4TYHA 1WBVA 4CFVA 3NYXA 1W82A 5DH3A 1K9AA 4CKRA 2OJFE 3P7CA 2O64A 4FKGA 5AM7A 5K5XA 2PVRA 3FZ1A 2HWPA 5IMXA 5KO1A 4DBNA 4DGMA 5CASA 3SV0A 2GFSA 5H8BA 5HCXA 2YJRA 3VRZA 2HK5A 3QAME 3HMIA 3RKBA 1KE9A 2YIYA 3LLTA 3EWHA 4RLLA 3UGCA 3E5AA 3Q4UA 4NIFB 5HIEA 4OAVB 3GFWA 5DOSA 5EDPA 1OL1A 2J0LA 4QP3A 3S1HA 4E6AA 5B2MA 3R8UA 3RCJA 2JBOA 3MY0A 4U42A 3LQ3A 4M68A 2WIHA 4BZDA 3ZONA 4HGEA 4I21A 2P3GX 2WU6A 3OT3A 4O83A 3AMBA 2PUPA 2FSLX 2IVTA 4KWPA 4NU1A 5IA1A 3B2WA 1H0WA 2VX3A 3GXLA 2W17A 3E8CA 4RQVA 4I6BA 4C7TA 3W2QA 2WQMA 1XHAA 4YJRA 2QCSA 3G5DA 3FQEA 2B9JA 3VUMA 4UXLA 4ZZOA 3TV7A 2V22A 4YTIA 4FSRA 4I41A 3M1SA 3COHA 5D9HA 5DLSA 4OTGA 3HMMA 1H1PA 4TWPA 2B55A 2C5NA 4QMVA 1F0QA 5H2UA 5LMAA 5J1VA 5IPJA 4FZAB 4FYOA 1JLUE 4P7EA 4RZWA 4NUSA 4F7LA 5KZ0A 5CX9A 2UW9A 5LMBA 1ND4A 3P1AA 4OTPA 4U7ZA 3UDBA 4F6SA 1Q99A 5HVJA 1PYEA 5K5NA 4BDDA 3PZHA 1FGIA 3CY3A 4FIFA 2ZM3A 2F2UA 2OXDA 3ALNA 5AMNA 2Y9QA 3MS9A 5JGDA 4AW0A 1V0OA 2QKRA 3MW1A 4Z3VA 2WTKC 2C5OA 2PUNA 3MH1A 3NRMA 4X3FC 4ZS0A 1J1BA 3LPBA 2J51A 4I0SA 4FEUA 1RQQA 2YABA 4FOCA 4GIHA 4JNWA 4K77A 4PTCA 3JVSA 3SKCA 3SW7A 4CG9A 1H8FA 1WZYA 3QUEA 3LJ0A 2O3PA 3PSBA 4MD8E 4QRCA 3LVPA 3UZPA 4ONAA 3EFWA 3A8XA 3GC9A 4MBIA 4C38A 3A7IA 2PMNX 5A3XA 3UNKA 3EN6A 2XKFA 5CU4A 4OR5A 3UIBA 4RJ7A 3QQLA 4PPCA 1MRYA 5KBQA 3HRFA 3GCSA 3H10A 4XOZA 5A4QA 5LXMA 3EZVA 3PP0A 4F63A 2WIPA 2JAVA 1NT2A 1XH5A 2JDVA 5FM2A 1W84A 2HELA 3VBXA 2ERZE 3GUBA 4J7BA 4E6QA 3PE2A 4ZTSA 4BDEA 4EJ7A 4D4VA 2X7GA 3RWQA 5JMSA 2BKKA 3SXFA 2PULA 4FTQA 2QODA 4EOKA 3FE3A 2X39A 5AUWA 3ZFXA 5F1ZA 2C6OA 2YAAA 3M11A 3DY7A 1ZXEA 4D55A 3ET7A 5CQUA 4FNYA 4FODA 2UZVA 2J5FA 4F0FA 2OSCA 4JRVA 5J9YA 4QP9A 2R3FA 3PVBA 1U4DA 3Q6UA 3K2LA 1OB3A 3AXWA 5CSVA 2JDTA 4FG8A 4Y83A 2H9VA 3FZPA 3ZMMA 4RGJA 4EWHA 3R28A 4FZFB 5LCJA 2PVYA 4YZDA 2NRYA 3FKLA 3JS2A 4QO9A 4AZVA 3KRRA 2OXXA 5IKWA 4CFWA 3QQUA 4IZAA 3UO6A 2PVHA 1YKRA 4FICA 4D2RA 2OZOA 3S0OA 2YITA 2VWIA 4FSWA 4D2SA 2YWVA 2XJ1A 4NEUA 2WOUA 3QCSA 4PDOA 4F9AA 5I9YA 4N57A 1OI9A 2ZV2A 4G6OA 4QMZA 2DWBA 1XKKA 3U54A 2CNUA 4FR4A 1VR2A 3A60A 4IDVA 3CGOA 3O71A 4FL1A 4AN3A 1WVYA 4BCOA 3A61A 4IAYA 2XIKA 3IDPA 2Y6OA 4IC8A 4C36A 4MBJA 4W4VA 5CAQA 3R2YA 2BRBA 3CLYA 3KK8A 3R7UA 2X0GA 3P08A 1E1VA 5AV1A 3O96A 3HV3A 2F7ZE 2E2BA 2QOCA 3R9NA 4ASZA 1PKGA 3FLQA 4A9UA 5HTCA 2R3IA 4FX3A 5LVMA 4L01A 4V04A 1FVTA 1VYWA 2WOTA 4IB1A 4M66A 5JRSA 4RJ6A 1JSVA 4X3JA 5B7VA 3D14A 2R3LA 1T46A 2XNBA 3HAMA 2YERA 4RVKA 2X7OA 4B8LA 3T3VA 2BDWA 4G3FA 1H24A 2XK8A 3PVWA 2B54A 3BLHA 4K6ZA 2GNJA 4BY9E 5AV0A 3FY2A 3I5NA 4FEQA 4XRJA 5EI8A 4E93A 4CGAA 5LJJA 1JOWB 3WZKA 5CF5A 2J0JA 2XK7A 5M57A 4RJ8A 4IEBA 4WIHA 5AUYA 4KKHA 3EMGA 2BTSA 1H0VA 3BEAA 1UNLA 3PWYA 3QLFA 2HZNA 1KE5A 3IO7A 2HAKA 4ZY5A 2VTOA 3PJ3A 3LMGA 4LFIA 4JT3A 4F1OA 1H27A 3D7TB 4JG6A 3SRVA 5E8ZA 5J5SA 2DYLA 4MQ1A 4NM0A 4FEWA 5TR6A 4FNXA 5EHYA 2XIRA 4DGGA 4UEUA 2BDFA 2ZMCA 3UYSA 4NTTA 4IMYA 3W18A 3UP7A 5FXRA 2CPKE 2QOOA 4TYGA 3PXZA 3C51A 4R6VA 1TVOA 5BVWA 4U6RA 5HLNA 4BCMA 2VRXA 2OBJA 5E7RA 3F66A 3D2IA 5M4UA 4FTNA 2Z8CA 3KULA 1ZOGA 3FSFA 1H26A 2QO2A 3PSDA 2Y4IC 3G6HA 4NTSA 4ZJVA 2QHNA 3PPKA 3QBNA 4RC4A 1SNUA 4X2FA 2VO6A 2WELA 5FDPA 3ANRA 4FV9A 3UIUA 2W1IA 3SRVB 4APPA 2PVLA 4PPAA 3IECA 4BBMA 5AV3A 4EBVA 1Q4LA 4MTAA 4FGRA 1UV5A 3PA4A 3U55A 3BYOA 3R8VA 3QQJA 3UQFA 3MA6A 4FKOA 4OAUC 3V8SA 2PVNA 3MJ1A 1PMEA 5BVFA 5J8IA 3DKCA 2X1NA 2YIXA 3GQLA 4ASXA 4J53A 5DMZA 3R30A 4FT9A 4CLJA 4UMPA 3NEWA 4PUZA 4ZTHA 3FPQA 5JZJA 3QX4A 3EFJA 1XH7A 4EOLA 4EUTA 2WFYA 4HNFA 1XJDA 4GVAA 4BKZA 1BX6A 2WMXA 3JY9A 2AYPA 3PJ1A 1Y8YA 3OCBA 4Q5HA 4GEOA 4F08A 2R0IA 4W4YA 4TWCA 1ZOHA 4FV0A 5HESA 5DT3A 4O27B 4YLKA 3KXGA 5KE0A 3W2OA 3EQDA 3QZGA 4L00A 2PMIA 4M15A 1SVGA 4XP2A 3HMOA 5K4JA 4XG3A 1H25A 5C01A 4HYSA 4NFMA 3OW3A 2UZEA 3HAVA 3KXNA 3VVHA 4USEA 4JBVA 2CGUA 3DZQA 1ZARA 2OJ9A 2YN8A 4JOAA 3GI3A 4C34A 3C5IA 1WBWA 5A4TA 4P4CA 3ZXTA 4XX9A 4ACGA 5JH6A 2VTSA 3Q6WA 2E9NA 3G9NA 3FMLA 4MYGA 3ENHA 4S32A 4FT7A 4PDYA 5HG7A 5FG8A 4AN2A 2V62A 3IOKA 2I0VA 4X21A 5LVOA 3RM7A 3D9VA 5E9EA 1B6CB 3IONA 3ULZA 3UE4A 3OXZA 3P23A 4KAOA 4C37A 4LOOA 3QUDA 5DPVA 3RPSA 5HIBA 2BHEA 4CSVA 4GUEA 3A2CA 3F69A 2Y8OA 4NM7A 4KINA 4D2TA 1R0PA 5I9UA 2YIQA 4L3JA 4FTKA 4BCIA 3F5GA 4TKSA 3MPTA 3N4TA 2HZ4A 4PNIA 5LMKC 2ETKA 3F3VA 2A27A 4BCPA 4HPUE 4X2NA 3BZ3A 5HBJA 4YTHA 1IRKA 4ZSLA 5GINE 4L52A 3MVLA 4AGUA 2OICA 3LCKA 4FNZA 3VS1A 4FV7A 3E63A 5AADA 4BZOA 3OF0A 2WU7A 5AUZA 3FYJX 4ZTQA 1MP8A 3HL7A 2PVFA 1PXJA 3QQHA 1ZZ2A 5D7VA 3C13A 4IC7A 1K2PA 2J0KA 4JDKA 5ANIA 4AQCA 4CV8A 1QL6A 3MSSA 4BHZA 4XLVA 4TXCA 2JIVA 5E8YA 1ZMVA 2W9ZB 3P78A 2W7XA 5L2QA 3FLWA 3ELJA 3VBYA 2HY0A 2BROA 3A7HA 3CBLA 3HMPA 2GMXA 3PRFA 4FIIA 4J96A 4FL2A 4RJ4A 4TTHB 3UC3A 4G17A 3UJGA 2B9FA 3TN8A 3OTUA 4RIXB 3W16A 4DEEA 4AN9A 4OBPA 5EM7A 3GVUA 4V0GB 5D7AA 2C6KA 2XCKA 4EWQA 2C3JA 3MVJA 4DCEA 4NJDA 3FKNA 3V5TA 1MUOA 2I0HA 5HE3A 3ZLSA 2R3QA 2WEVA 1SM2A 3HDMA 4DFZE 3LJ1A 4MKCA 3QFVA 4BRXA 5L2WA 3R8PA 3RWPA 4QQJA 3MVMA 3OG7A 1AD5A 3KFAA 3EYGA 3QTXA 5EOLA 4C58A 4E3CA 3OVVA 4AACA 3H9RA 3OZ6A 4GSBA 4MNEB 4EK6A 1PF8A 5CU2A 1UA2A 1CKJA 1IAJA 2J4ZA 4IWQA 3O0GA 3IGOA 3HX4A 1FMKA 4IX3A 4ALWA 1URWA 4BDGA 4BI0A 3DBQA 4RA5A 2R4BA 3JYAA 4H3PA 5JT2A 3VUHA 4KA3A 2CLXA 3HYHA 3CTJA 4BN1A 3D94A 4EOIA 1AQ1A 3D7ZA 2KTYA 3R1QA 5KMLA 5IQGA 4N6ZA 4RFZA 3VAPA 4O2ZA 4NKAA 3CD8A 4ZZMA 3GU6A 4AAAA 3F9NA 2WMUA 4FG9A 1X8BA 2VZ6A 2NP8A 3BYUA 4IDTA 5L8JA 1P2AA 4NCTA 4BBFA 4M7IA 2XS0A 2OJIA 4OW8A 2W1DA 3BV2A 3F2RA 2R3NA 3DK7A 5I9XA 1JQHA 2XNOA 5DFPA 2OF2A 3I1AA 5HE1A 2RFDA 5AP0A 4GCJA 3WF8A 3E64A 1Z5MA 2XM8A 3N51A 4CMUA 4B7TA 2QOIA 3QRJA 4A9TA 4GKIA 3QCXA 3UO5A 3Q52A 3KXZA 5CEMA 3PA3A 2HYYA 5AR2A 3Q2MA 4ACDA 3CTHA 3ZO4A 3DA6A 2WQOA 4GFOA 4MXYA 4HVIA 3DK6A 3QCYA 2VNWA 1IASA 3CJFA 3LM5A 4UB7A 3FHRA 3QD4A 3GU8A 3UQCA 5G6VA 5IH5A 4GJ2A 3U6JA 3UYTA 5EHOA 4QTDA 4WRSA 5DT4A 4IH8A 2FSOX 2I6LA 5HGIA 1Q97A 1B39A 2RKUA 4M0YA 3RGFA 1KE8A 3OW4A 5GJDA 4Y5HA 3TNIA 4ZTMA 4F0IA 4OUCA 4J1RA 4OTRA 5FBNC 4RIWA 5ANDA 2C6TA 2NRUA 3PZEA 2QOBA 2XEYA 4QQTA 1H4LA 4N6YA 3REPA 4CG8A 3CXWA 3FMDA 1JSUA 4IVDA 2VWYA 1KUTA 5AX3A 3ZC6A 1XR1A 3A7JA 3VIDA 2C5XA 3HRCA 4ANNA 5GZ8A 5GJFA 3U6HA 1ZRZA 5JFVA 1TKIA 1URCA 2XIYA 5GIOE 3CPCA 3CQUA 3R9HA 1YDSE 4RC3A 3EQPA 2X9FA 3IW4A 4FIEA 4FVRA 4IAKA 3RM6A 5CALA 1NVRA 3ZUTA 3UMXA 4XG8A 2UZLA 4FKRA 3RHKA 3ZRKA 3EYHA 4BI2A 5HEZA 4GKHA 5C8KA 3BYVA 3FI4A 1YQJA 2PE2A 2A2AA 3HEGA 4ZAUA 5A4LA 4KUJA 4E7WA 5AUUA 4IHPA 3NW7A 3NYOA 3QHRA 2FUMA 3MTFA 1ZAOA 2C68A 5CT0A 4UMUA 1SMHA 3HDNA 4QMQA 5AP3A 1GOLA 5JRQA 3HA8A 3KMWA 5C03A 3THBA 2OFUA 3H4JA 4XP3A 2BZKB 1LEZA 3QRTA 3D15A 4GT3A 4DEDA 2HWOA 3PXQA 4NKSA 3KCKA 3WYYA 4FTCA 2BALA 3T3UA 4IIRA 2QOQA 4FKTA 3PE1A 4IBMA 3VRYA 2VWXA 3ROYA 3EL7A 5K0KA 3LIJA 3RCDA 5D11A 1YXSA 2YCFA 4AE9A 4YNOA 1WBTA 3P9JA 5IQFA 2CGWA 4RMZA 2UVZA 3TDVA 2VGPA 2R3PA 4MQ2A 2JD5A 4FZ6A 5LCKA 5T6KA 3UMWA 3TM0A 2C6LA 1J7LA 4RIYA 1YHWA 4D0XA 1Y91A 4C61A 4KBAA 4W8EA 3QYWA 3UVQA 2PUUA 2V7OA 3NNWA 3C4FA 3D0EA 1GAGA 1A9UA 4FC0A 4IWOA 4XS2A 5CQWA 1FGKA 3TT0A 3AQVA 3ZBXA 3O7LD 3QGYA 4ZY4A 5IEYA 4QQ5A 4EOJA 4BIDA 5M08A 2PL0A 3TNWA 4ZMFA 4X2JA 5GNKA 1H00A 4UV0A 4AOTA 5M55A 3FLZA 3PJ8A 4I4FA 2G2FA 5FEEA 2R2PA 2BRGA 3K3JA 4D9TA 4I4EA 3E93A 3FI2A 1NA7A 4O0XA 1BLXA 3OEFX 4R3RA 4RVMA 3F5XA 3TZ9A 5CEOA 4HPTE 3OBJA 4RIYB 2UZBA 3SOCA 4DA5A 4YHTA 3RBWA 5CAUA 5K4IA 2CNVA 2C0TA 2XM9A 2JITA 2GHLA 3OTVA 1OL6A 3PWDA 3Q9WA 4KIQA 3PPZA 5IDNA 2YZAA 3UOHA 3ZTXA 4BCJA 4D4YA 4GT4A 4O38A 2GSFA 5BYYA 3L1SA 4MNFA 3NIEA 5CS6A 2O5KA 3FJQE 3DK3A 2RG6A 3WIGA 4EL9A 3BGZA 2R0UA 3HLLA 4IQ6A 5FTOA 4ZJIA 4HVDA 5KMJA 5ACKA 4L67A 1PXIA 4RX9A 2OH4A 5E4HA 1U59A 2ONLC 2ZYBA 2OZAB 3OWLA 4JAIA 4KBCA 4TNDA 3TKIA 3HMNA 4M12A 2O8YA 4ERKA 1M2PA 3VUGA 4EH4A 4WUAA 3F88A 3R02A 2VTAA 3CTQA 5CXHA 4C4JA 5CAVA 2VAGA 1UKIA 3MJ2A 4RSSA 3FI8A 3V6SA 5AV4A 4EKKA 3NUSA 1O9UA 4ZS4A 3EH9A 4USDA 4ZLOA 4O7LA 3ZZEA 3QKKA 3L8VA 4N70A 2RFEA 3FDNA 5ACBC 4E5AX 3MFRA 3RHXA 3GU4A 4BKJA 1U54A 5CF6A 3E8EA 5L6PA 3A99A 4ENXA 1FQ1B 4YZCA 3ZUUA 4FF8A 4LGHA 4FT0A 4V01A 5CEKA 1Q3DA 2W4KA 3EJ1A 4JDIA 3LXNA 5HO7A 1Y6BA 4A4XA 4BDJA 4QTAA 4MXOA 3OBGA 4B6LA 3MB6A 3GOPA 3ORMA 1OIYA 4ITJA 3KGAA 4ZJJA 2F57A 1CDKA 3AD4A 5AP4A 4E1ZA 4R7IA 4JBPA 3B8QA 3LFDA 4ZEGA 5IG1A 2H8HA 3DBFA 2QG7A 5FTQA 3LHJA 3W32A 2IPXA 3MESA 4GG5A 3BELA 4O0UA 4EH2A 3FC1X 3G0FA 3LCDA 3LQ8A 4I23A 5DEYA 4FZ7A 4OT5A 3R7OA 2WNTA 4AUAA 4LM5A 4RRVA 3PLSA 3PYYA 1GY3A 3P4KA 4FTMA 3WF7A 2ZB1A 2ERKA 3GCUA 1BL7A 5CEPA 3V5PA 4G9CA 5A4EA 4AA5A 1OIQA 4KIOA 3DLSA 5K9IA 4QMOA 2WO6A 2OIDA 3O17A 2YM4A 5M51A 4HZSA 5HTIA 2ZVAA 4MK0A 4AZEA 4YP8A 4UWBA 3QGWA 3DNEA 3D83A 3ORKA 2OO8X 3OHTA 4IB3A 1LPUA 4P2KA 4A07A 1V1KA 1OVEA 1FOTA 4WG4A 1NW1A 4R77A 2I0EA 3V5WA 5CU6A 5LARA 5CWZA 2YHVA 3DDQA 3FHIA 4HGLA 3RZFA 5DA3A 3SOAA 3D2KA 4QTBA 4YZNA 3CKWA 4Y85A 2CCHA 2XRWA 2W5BA 4OTIA 5EYMA 3SXSA 4JIAA 4O86A 1TQMA 4FSNA 4CZTA 4I94A 2HW7A 1OITA 1UWHA 3FLSA 4K33A 4PP9A 3SD0A 1Q8ZA 4NW5A 2W1CA 5CVHA 4EORA 3ZHPC 4JS8A 3FAAA 4FV3A 1JKSA 5TKDA 4BDFA 3OUKA 2XA4A 1IEPA 5TO8A 1XH6A 3F6XA 3HP2A 1YOMA 2JAMA 4FT3A 2ZDUA 5H8EA 4YHFA 4E6DA 4MAOA 5BNJA 2UZTA 2C6IA 3ROCA 2Z7SA 3PY3A 2PU8A 1OBGA 4YJNA 4QYGA 4EH3A 3FZTA 3MH2A 3TNQB 4BI1A 4EONA 3ZO1A 2OIBA 3ZSHA 5DBXA 3DKGA 4BIBA 5AV2A 4F09A 3ID6C 3ZO2A 4EOOA 4Z7GA 4ANLA 4J97A 4EZ7A 4BKYA 1SZMA 4PMSA 2YM7A 4TW9A 5EM8A 1ZMWA 2JKKA 1DAWA 3RAKA 4DBXA 2XEZA 3KXHA 4IANA 3DS6A 2VTQA 2X2KA 4O1OA 2J2IB 3UC4A 4Z55A 2XH5A 2VTIA 3FI3A 4CQGA 4RVLA 3O23A 2XF0A 4UZDA 5HCYA 1NY3A 1ZYJA 4I5MA 2EVAA 1Z57A 4R5SA 3ZSGA 4HZRA 4D0WA 3WILA 4GK4A 4AZTA 4EK3A 2HIWA 2YWPA 5AR5A 1MQ4A 3LFQA 2PMLX 3HNGA 5M09A 3R21A 3R71A 4FG7A 4B0GA 5HE0A 4J95A 2BRHA 3NUPA 1WAKA 4MXZA 2BTRA 2WTKB 5T68A 4YSJA 2YZLA 4EJNA 4X3FB 4IB0A 4ZSJA 3TIZA 2XKDA 4NM5A 2PYWA 3BE9A 3VS4A 3CEKA 3DNDA 3U87A 2IZUA 4XBUA 4FKJA 3GC7A 5C27A 2BZIB 4YNEA 2R9SA 3NMUF 5EDQA 5EM6A 4DFLA 3MB7A 4E5WA 1BUHA 5CVGA 2ITZA 4WNMA 2X81A 3AC5A 4I5HA 4QTCA 3VUIA 4BYJA 5D1JA 3NUAA 2AC3A 4S31A 4M8TA 4YSMA 4LL5A 4ZOGA 2R3JA 3AMYA 3QC9A 2WMRA 4FKUA 3UNZA 4C0TA 4F99A 3PP1A 4PL4A 4N4SA 3ANQA 4ORKA 1VJYA 5ANGA 2BIKB 5LQFA 1EH4A 3JPVA 5K3YA 4B9DA 4NJ3A 5IQHA 2I40A 2QLUA 1M14A 5IQBA 1XQZA 2J7TA 3GU7A 5KMKA 2WTCA 2YDJA 4K9YA 3CS9A 3I81A 2WQBA 4AZWA 5IUHA 3SXRA 3NNUA 4Y72A 4FE2A 4FUXA 3RAWA 2VD5A 1ZY5A 2EXMA 4XV3A 3ZRMA 2O0UA 3EL8A 1M7QA 5D10A 3MY1A 2VO7A 5HICA 1LUFA 4FI1A 4GFMA 4QPAA 4ZMEA 3FMHA 4U9AA 4GFGA 4J98A 3NCZA 3AT4A 4V05A 3DBDA 2PTKA 1Y6AA 4EHVA 4OTHA 3HUCA 4J99A 4CV9A 3POZA 2BUJA 3BI6A 3PTGA 5M4FA 4O7TA 4K8AA 3KRWA 4C3FA 2FO0A 4RWKA 1W98A 4X6QC 3RMFA 2F9GA 5HNIX 2PWLA 4AA0A 1J7UA 3LFFA 3BU5A 4OTWA 2IG7A 3EQIA 4DT9A 4TYEA 2VTTA 3RAHA 4GU6A 4RZVA 3EQBA 2ETRA 4HGTA 4DFBA 4TY1A 3W8QA 4DG0E 3CCNA 3EQHA 4NZWB 3BV3A 4H3QA 4RX8A 5F9EA 3E3PA 3FV8A 3R1YA 2BCJA 4YZMA 3HA6A 5I5ZA 3O50A 3KN5A 3N9XA 4J8NA 1L8TA 3ZO3A 4XNEA 1STCE 3FXWA 3GB2A 3LFCA 3OCTA 5FM3A 5KZIA 5IQIA 5BUEA 3NUXA 4IX5A 5AIRA 1UU7A 2BMCA 1S9JA 4FL3A 4P90A 4IWPA 5CT7A 2WHBA 4YPDA 5FEQA 1J1CA 4H58A 4ANBA 5LVNA 2BPMA 4WSQA 3VJOA 3LM0A 3W2SA 3LMIA 2G1TA 2UW6A 1PXLA 3DB8A 3PXFA 3COMA 4L7SA 4OTDA 4QMLA 3W2CA 2QONA 2WAJA 3K5UA 5BVNA 3SG9A 5IQEA 4GRBA 3MIAA 4DTAA 3G6GA 4JX3A 1KSWA 1M17A 4IZ7A 4TL0A 4QMXA 4LV5A 3MPAA 3D7TA 5FWKK 5LVLA 3KC3A 5BUJA 1YI3A 4S30A 4GYIA 4X6RA 4YZ9A 2UVXA 4QP4A 3QQFA 2WMAA 2IZTA 4JDJA 4M69B 1YXVA 1CM8A 2X6DA 3DFCB 2JIIA 4C33A 3I0OA 3CPBA 4IJPA 5AA9A 1OUKA 4DEIA 4PPBA 3AD6A 4JVGA 5CAOA 3G0EA 2B9IA 5D12A 4O6LA 5BVEA 4AG8A 3G9LX 4WNKA 4X2KA 4ZZNA 1KOAA 3TXOA 5HBHA 4PNKA 4GT5A 3UZTA 3KB7A 2ZAZA 2WZJA 3QC4A 3SW4A 4IM2A 2W5HA 2X9EA 5B2LA 3TUDA 2VWZA 3S3IA 2Z60A 3MN3A 1HCKA 3TL8A 1OBDA 3IW5A 5JZNA 4FMQA 3FMEA 3VJNA 4O1PA 4PDSA 3PG1A 2QO9A 3O51A 3FMKA 3TZ8A 2R3RA 2EXCX 3TI1A 1YDRE 5LWNA 3BQRA 1CTPE 4BTMA 5CY3A 3DKFA 3RPRA 5M07A 4O96A 4XHKB 4AXAA 2EWAA 3DJ7A 2C5YA
chains in the Genus database with same CATH superfamily
4BFMA 4FEXA 3HP5A 3PUFC 3HUBA 4QMYA 3V01A 4E4NA 5AUTA 4CLIA 1YW2A 4RPVA 2QOHA 3BBTB 3LQ5A 4WT6A 3VBQA 3CD3A 3DCVA 1UNGA 4FV4A 2OLCA 3QRKA 3V04A 2CKOA 1YDTE 4N0SA 3FZSA 5I3RA 1KV2A 2XYNA 3VS5A 4CCUA 2WXVA 3WIKA 1PXMA 2BFXA 4PMPA 3UIMA 4CT2A 1WBPA 2PZIA 3IDBA 4MVFA 5FP5A 3W1FA 2VTHA 3GBZA 4YHJA 5AM6A 4BCNA 3LCSA 4W9XA 1FVVA 4A7CA 5CANA 4I6HA 4RJ3A 3BKBA 3NS9A 1PHKA 2XBAA 2ITOA 3CR0A 4YPSA 3F7WA 2VTPA 4EH7A 4LOPA 3AD5A 4L6QA 1WBNA 3DGKA 5D41A 2RSVA 1AGWA 1JNKA 5AIKA 3M42A 3NW6A 2W96B 5IISA 3W0PA 4FZDB 3D5UA 3UOKA 4LUDA 3OUNB 2JBPA 4L43A 2CGXA 3BX5A 3O7LB 4LRKA 4YGAA 4D2WA 1JKTA 1YOJA 4JAJA 4AOJA 4MF1A 3C1XA 4WNOA 4BC6A 5IUGA 4I6QA 2QR7A 3ORIA 4QP6A 3Q53A 4QYEA 2B1PA 4GW8A 1YWVA 3OXTA 4R1YA 4UBAA 1HOWA 1UU8A 2V5QA 1JVPP 2UZOA 3A7GA 2IVVA 3ZLWA 4BICA 3QZIA 4MXCA 2JDRA 3SG8A 1F3MC 4ZK5A 2W05A 4BTFA 4WNPA 1IA9A 1I09A 2BRNA 3KXXA 3VF8A 4DFUA 1JPAA 1YHVA 1JKLA 4BWKA 4D2PA 3SX9A 3FXXA 3PLAE 3OCGA 4DH7A 4AXDA 3Q96A 5L8KA 1W83A 4GYGA 4CTBA 4MD9E 4BWXA 2PZPA 1QPCA 3I4BA 2V55A 4CTCA 2OU7A 2PSQA 3R9DA 5L3AA 2PMOX 3DBCA 4ITIA 4IAIA 4R3CA 1CKPA 4C62A 4MUQA 1OMWA 5EH0A 3CY2A 4M67A 4F9WA 2G2IA 3EKNA 4YUQA 3Q5IA 3EFLA 5E1SA 3TKHA 3H9FA 3C0IA 3UODA 3R00A 4RIXA 2GHGA 2PK9A 3ZCLA 1ATPE 3OWPA 2R7BA 4LUEA 4BGHA 5M4IA 3B8RA 2ZDTA 3OCSA 4FSZA 4JLCA 4M3QA 4V0GA 3UZRA 3FY0A 3AC4A 3UVPA 1XMLA 4QP7A 1M2QA 4DFYA 4F64A 5HU9A 5LOHA 4CD0A 2A98A 3LXKA 4IX4A 3R73A 5JGAA 3NPCA 1J7IA 3C0GA 3ZBFA 4YTFA 3QQGA 5GIPE 4KB8A 4C4GA 5C4LA 4HYIA 4XUFA 4MNEA 4LRMA 5IA5A 3ATSA 2YM6A 4IJ9A 2RGPA 2GPHA 4QMTA 3RPVA 4BWPA 2W1ZA 2P0CA 3RVGA 5EQYA 4I3ZA 4RQKA 1TQIA 4G5PA 3LFSA 5M4CA 4APCA 3DAKA 2ITPA 4YR8A 1G5SA 2UZDA 3QTWA 5FBOA 3BYMA 2V0DA 3DXNA 5BYZA 2Z7QA 4GVJA 4DFXE 2CKPA 3HKOA 4FSYA 5CENA 4EH5A 3NSZA 5BVDA 3FEGA 4O6EA 4FKWA 2IVSA 2H96A 3PIYA 5DEWA 5BUIA 1G8AA 3QALE 5JSMA 4BCQA 3SHEA 5FXSA 3OXIA 3KA0A 5TE0A 1FBNA 2QC6A 2XNNA 3F3WA 4ANOA 2YIWA 2ZM4A 4AXCA 2XK9A 2XBJA 3U51A 4YLJA 3DQXA 4USFA 5CTPA 4A06A 4L7FA 1XWSA 4Q9ZA 3VS6A 2R64A 5DT0A 5C8NA 4O21A 5A54A 4PWNA 1G8JA 2RIOA 2YACA 3Q4TA 2WMBA 2WMVA 1GZKA 2A19B 3C4WA 3DAJA 3R8ZA 3UPZA 4KIKB 4L44A 3BYSA 4C35A 4QT1A 3HVCA 4IZ5A 4O4EA 1CMKE 4AGDA 2GS6A 3NWWA 3OY1A 2A1AB 4PRJA 4QMUA 3I60A 2JEDA 1DM2A 3NW5A 5KHXA 3RK9A 2PE0A 4DCAA 3W2RA 5JQ5A 5JEBA 3RINA 4F6WA 4AT5A 2BAJA 1R0EA 3EQFA 1SVHA 3NGAA 5IA4A 4XV9A 3UG2A 3Q9ZA 2FYSA 3PXRA 3VBWA 4D1XA 4LMNA 3GEQA 4CRLA 4JI9A 2Y7JA 5E8WA 1IAHA 4PMMA 4F9BA 3ZFMA 5IA0A 5HO8A 3ZM4A 3ZDUA 2W1FA 1ZYSA 5J5TA 3G15A 4EI4A 1GZOA 4KKEA 4O82A 4FKVA 3O8UA 4C02A 3QX2A 4C4FA 4FVQA 4AA4A 5E1EA 4DEHA 2P4IA 3V5JA 2WTWA 1YXUA 4L9IA 3ZYAA 3ZFYA 1YHSA 4TYIA 5L2SA 3EQRA 4QNAA 4EZ5A 5KMOA 5CF4A 3W0NA 3F7ZA 4OBOA 1QPDA 4D9UA 3ALOA 1PXPA 3PA5A 2XAMA 1YWRA 4I5PA 1DAYA 5GZ9A 5IUIA 3VN9A 5CXZA 4I1ZA 4IB5A 4HW7A 3GNIB 3EFKA 2JFLA 2XNMA 4ZLZA 4RWJA 4LOQA 4QDEA 2ITYA 4F0GA 4QD6A 3ORNA 4I0TA 5EOBA 1BMKA 5ETIA 4ID7A 3H9OA 4DLIA 3FXZA 3JVRA 4KD1A 4XCUA 3GT8A 3PIXA 4LYNA 4UYNA 1WFCA 1YXXA 1V0PA 5M56A 4EOQA 3QRIA 3FYKX 2YAKA 1XBAA 1Y8GA 2RFSA 4MCVA 2XAOA 3I79A 4PMTA 1PMVA 3QQKA 4RT7A 4YTCA 5AAEA 2VTMA 5IEXA 3K5VA 2BR1A 2F7EE 4DITA 2YCQA 3UNJA 4DLJA 1R39A 1H07A 5HD4A 1DI8A 3TG1A 4NCTC 1Z9XA 3P7BA 4D5HA 4RFYA 4J52A 4IZYA 2BDJA 3NDMA 4AX8A 5BYLA 4O91A 4YJOA 5CSWA 5AP2A 3H0ZA 3RI1A 5TT7A 4CQEA 2LGCA 3HZTA 4TNBA 5CAPA 2BILB 2IN6A 2QI8A 2R3MA 3EN7A 4ZSEA 4BF2A 2BAKA 3R7VA 4R1VA 2GQSA 1G3NA 2VGOA 4WO5A 4O84A 1TQPA 4BL1A 4XV1A 2QKWB 1Q8WA 4AT4A 2GNFA 1ZLTA 1TZDA 1B38A 4QMSA 3R9RA 3WF6A 4E73A 3OWJA 4ASEA 3EN4A 3GCPA 4U97A 4XP0A 4CFXA 4H1JA 4UN0C 5CSPA 3DXPA 1V0BA 3UQGA 1DS5A 4H3BA 3QD0A 2XB7A 2PZRA 2W1GA 3RNYA 1M52A 2VN9A 2O63A 3ZS5A 4HVGA 2JDSA 4K18A 5TOZA 4EK4A 4GG7A 2YLFA 5HBEA 3ORTA 3NUNA 3AGMA 3LXPA 4EC8A 3OP5A 3COIA 5JN2A 2C6DA 1GIIA 2VO0A 4BR3A 3CC6A 3SC1A 3V8TA 4WKQA 4XLIA 3MFSA 5EYKA 1SVEA 5EI2A 5B2KA 4F4PA 1OM1A 3F3ZA 4ZLYA 2KULA 4AXEA 4BJJB 3HRBA 3QTIA 3E3BX 2BVAA 5EDRA 2X2MA 3VS0A 2J6MA 4WHZA 4Y73A 2LAVA 1WBOA 4E5BA 4JMQA 3KL8A 4NSTA 1YWNA 5AP7A 3FC2A 3OD6X 4FV5A 3TV4A 3W8LA 4I5CA 4E20A 1Q61A 3AT2A 5HCZA 1E1XA 3PJCA 3CP9A 5I9ZA 2XKEA 4EKLA 2OZAA 4NH1A 4XEYA 5CNNA 3VUKA 4U44A 1KOBA 4CCBA 4AT3A 4I6FA 3OROA 2RG5A 4Y8DA 3KXMA 5BVKA 4HCTA 3CSVA 2E9OA 3NAYA 3PSCA 5FP6A 3Q3BA 5DVRA 1NVQA 1VZOA 4IVCA 4OT6A 4M13A 2QU5A 5EKOA 5CSHA 3HV4A 3LZBA 4IADA 1YXTA 1E9HA 2REIA 3V6RA 4CZYB 4YU2A 1A48A 2GQRA 3I6UA 4DTBA 4K2RA 4F1MA 2GNIA 2WTVA 5DR2A 4JIKA 3BU6A 4QMWA 3IGGA 4QQCA 3QUPA 3R83A 3K54A 3KK9A 5IQCA 5F95A 5L6WL 3VO3A 4A4OA 1ST4A 5C9CA 3FQHA 4KIPA 4EYJA 4O7VA 2ETMA 3SVVA 3PVUA 3U4WA 4U41A 4RBLA 3KREA 3WF9A 3IS5A 4GUBA 4G31A 4LMUA 5AR3A 3LE6A 2X2LA 3ACJA 3VHKA 3LKMA 2QR8A 3KEXA 2HOGA 4DGLC 3RAIA 4GL9A 5I4NA 3KF7A 4WRGA 5GHVA 1OPJA 4C4HA 3MPMA 1W2DA 1XH9A 4UALA 4G5JA 1OL2A 4XV2A 4F9YA 4FBXA 3V5QA 4CYJA 5LWMA 4IVAA 2Z2WA 3NIZA 1IG1A 4O7NA 2UUEA 5DI1A 2C1AA 5CI7A 3FZOA 1FMOE 3U9CA 3NVKI 3NYVA 4FSMA 4IE9A 3IDCA 5CNOA 1XH4A 3MVHA 4OGRA 4U43A 1XH8A 3VS7A 3ZXZA 4AW2A 3PIZA 4BTKA 1PRYA 4M97A 2E9VA 4EOSA 4R7BA 5FLFA 3Q32A 5J1WA 2PVMA 3PY0A 2Z02A 1Q24A 2XZSA 5HLPA 4EHEA 2JLDA 5HG9A 4IW0A 1H01A 4H39A 1YOLA 3UIXA 2YIRA 5J79A 2B9HA 4UWCA 3DFAA 5FD2A 4GK3A 2WQEA 5HG5A 2ZJWA 3R7GA 3H30A 3T8OA 2AEGA 4MXXA 3T9IA 2C3LA 3A4OX 4C8BA 4CEGA 4I22A 4PTGA 3FPMA 4O0SA 5CLPA 1U46A 3HV7A 3L8PA 4C3PA 5A9UA 5AAFA 2IW6A 5CAOA 2OW3A 4HCUA 5L4QA 4NYEA 4TN6A 2QNJA 1JAMA 4UMQA 4DH8A 3ORPA 3TKUA 3OT8A 1ZWSA 3R22A 1MRUA 2X4FA 5CU3A 4FOBA 3MDYA 4MBLA 3IW7A 3UO4A 5FTGA 2QLQA 1PJKA 3EQGA 4CKIA 2VUWA 1UU3A 2W5AA 2X0OA 4U5JA 5J95A 4DHIB 4K1BA 2WMSA 4U40A 2GDOA 3QTRA 4NWMA 3NUUA 4RX5A 3AC1A 4AWIA 4NL0A 5KUPA 3JUHA 5AR7A 4RWIA 3DXQA 4IAAA 2PPQA 4TWNA 4YJTA 4KSQA 2HENA 3P79A 4KNBA 5CEIA 4B8MA 3OFMA 4AE6A 4D28A 3UP2A 4EK8A 3TJCA 3HGKA 2CN8A 4G6NA 4JR3A 4ALUA 4DG2E 4I92A 3ZSIA 3FSKA 4FSQA 4C4EA 4UMTA 2QG5A 4PX6A 5KKRC 4U80A 5J9ZA 2WEIA 4DC2A 1PXOA 3B2TA 1M7NA 4KRDA 4FYNA 2ZM1A 1A06A 1H28A 3Q04A 5EKNA 2CMWA 4YC3A 4XYFA 2G2HA 3DOGA 4TRLA 1BYGA 4WSYA 3H0YA 1VYZA 4OTQA 2W06A 4PDPA 2GNGA 3ZRLA 2BZJA 3OOMA 4YJQA 2YJSA 4QTEA 3DJ6A 4YO6A 4CXAA 2WKMA 3G90X 4GH2A 2NO3A 4E4XA 2R3KA 3JR1A 4C3RA 4D1SA 4D58A 3OOGA 5IMEA 4X3FA 1W2CA 1KV1A 3D5WA 4E4LA 4CVAA 3R9OA 5M44A 4E26A 3QZHA 4FTJA 4F78A 3TWJA 2VTRA 4EEVA 4O7WA 3KRLA 4L45A 3K3IA 2FSTX 4AZSA 1MRVA 3E7VA 3ORZA 4JBQA 2GNLA 4FK6A 2YCRA 4JG8A 4O0WA 4LI5A 4AS0A 4WOVA 3MIYA 3S2PA 4HYUA 2IO6A 3L9MA 4R8QA 5ANJA 1JWHA 3UOJA 3Q60A 3ETAA 2UW0A 5EQEA 3E87A 3D5VA 3TNPC 4L8MA 4U8ZA 4BCHA 4DH3A 4EUUA 2X8DA 1H1SA 2Y0AA 3VS3A 2OJGA 2WTIA 1FVRA 4G16A 3PDTA 1QCFA 5I9WA 2WTDA 4CNHA 3BRBA 2X6EA 3QL8A 4FKLA 5EW3A 1W2FA 5HZNA 4DT8A 2OK1A 4W4WA 2ZV7A 4TYHB 4DEBA 2XK4A 2HXQA 3Q2JA 2A0CX 2J5EA 3BHTA 1W0XC 1ZOEA 4K11A 2CHLA 3BGQA 3R7IA 4GJ3A 5IH4A 2XJ2A 1OIUA 2P33A 4G3DA 1JKKA 1GZ8A 3QWJA 4XBRA 2PVJA 3P0MA 5EK7A 4O22A 2YDIA 1WVWA 2CSNA 2Z7RA 4NM3A 4FV2A 3E8NA 4XG2A 1S9IA 2CKEA 3HECA 4DFNA 2UW3A 1R3CA 3R1NA 4C2VA 4QMPA 3SDJA 3EIDA 3GQIA 3LFAA 4XJ0A 3RTPA 4D2VA 5AAGA 5T3QA 2XK6A 3GENA 3U8WA 3ZOSA 2CJMA 5FEDA 5E8XA 4E4MA 2B7AA 1P4FA 5FUTA 4FTIA 4IAZA 4JR7A 2YDKA 3BWFA 5IU2A 2CNQA 1O6YA 4FKPA 3VC4A 4CFMA 3BHUA 3F2NA 5K0XA 3UG1A 3DV3A 2XKCA 2C4GA 4YO4A 2ITUA 3KCFA 3IQ7A 3E88A 3DT1A 3QWKA 4A9SA 3RPYA 3KF4A 3TUCA 2HZIA 5J9LA 3RNIA 3TV6A 3U9NA 4RG0A 1UKHA 3Q4ZA 4YJVA 1K3AA 1UWJA 2P55A 1ERKA 4D5KA 2R3GA 2UZWE 4WG5A 3TZMA 1OUYA 2QOFA 3ULIA 5EW8A 5IZFA 2C3IB 1OZ1A 4UXQA 3KY2A 4FSUA 3OWKA 5HG8A 4ZIMA 3CKXA 3C4ZA 3WOWA 4BHNA 4BGQA 3GCVA 3U6IA 2ITVA 4ASDA 4G1WA 4S34A 3KVWA 2JKQA 4KS8A 5CEQA 4XG4A 3MH3A 4YJPA 5AEPA 2XRUA 2H6DA 2VWWA 3LFEA 3C4EA 3BE2A 3IW8A 4GV1A 2GTMA 4FV6A 5HD7A 3MH0A 1YVJA 3V3VA 4JJRA 5HE2A 5I3OA 4JQ8A 3ZM9A 1O6LA 1OKVA 3QCQA 2JKMA 3DKOA 5DRBA 3UOLA 3NAXA 3AC2A 2WPAA 3BEGA 4Y46A 4DF3A 1WCCA 4IFGA 2F7XE 4FIHA 4E6CA 4EYMA 4X2GA 4FTAA 3MWUA 3D5XA 4CZUA 1OIRA 5ANEA 2SRCA 5E8SA 3M2WA 5KNJA 4IFCA 2WD1A 4DDGA 3O8PA 5BV3A 2QVSE 5H9BA 1RE8A 4XMOA 5L2TA 5F4NA 2BZHB 2ITWA 2IZSA 3ZZWA 4EK5A 5KCVA 3PG3A 3JY0A 3R6XA 4M69A 1GNGA 3WZEA 1FPUA 1OKWA 4AU8A 4X0MA 4GMYA 1ZZLA 4DEAA 5M53A 5EI6A 2P2HA 2Y6MA 5FQDC 1M2RA 3OS3A 1GJOA 3QTQA 1XBCA 3WE4A 5IDPA 4K0YA 5J7BA 3FL5A 5DR6A 5CVFA 3PRIA 4DTKA 5DR9A 1BI8A 1I44A 4HJOA 4TT7A 3P5KA 1RW8A 2UW5A 4ANQA 2J0IA 2JDOA 2XUUA 4QPSA 4ZP5A 3MV5A 5E90A 3NX8A 4GK2A 3TZ7A 2X0PA 4D4SA 4ITHA 2OH0E 1PY5A 4ZY6A 2J50A 1SNXA 3FMMA 3BIZA 4U81A 4CT1A 1T45A 5BPYA 1BL6A 2FA2A 2XNEA 4FKQA 4GU9A 5J87A 2G01A 3QXPA 4H1MA 4PQNA 2W0JA 3R1SA 2HCKA 4FSTA 1L3RE 3W55A 4FTUA 5EQPA 1Q3WA 4Z16A 1ZY4A 5DG5A 4S2ZA 4UWYA 2E9PA 4AGWA 3G33A 4FTOA 2OF4A 4OTFA 5I9VA 2VU3A 4BDHA 3ORXA 4QP2A 4UY9A 3EN5A 2IW8A 4TWOA 5AA8A 4WUNA 3S4QA 2ZOQA 3QXOA 4RIOA 4YZBA 2VWBA 4HCVA 4EQCA 2RF9A 2X8EA 1YI6A 4G3EA 3LOKA 4QYFA 5HIDA 2OJJA 3BHYA 4AFEA 2XNPA 4HOKA 5DHJA 3ACKA 3LLAA 2YM8A 3FL4A 4YC6A 3R8MA 2XIXA 3DAEA 4ZSGA 3R63A 5ETCA 5HLWA 1H1QA 2I7QA 2Y4IB 3QTZA 4L3LA 1JBPE 2BKZA 2QHMA 3LW0A 3SA0A 1LP4A 4U3YA 3MFUA 2DQ7X 4AOIA 5A14A 5CYIA 3BHHA 4JL9A 3KRJA 3PVGA 3TEIA 3OMVA 5A6OA 4WBOA 4QMMA 2W4OA 2X0QA 3C4XA 3AT3A 4O7ZA 1SYKA 2DUVA 1ZYLA 4MHAA 2HZ0A 1OPLA 3WF5A 1GZNA 3SLSA 4KRCA 4ANMA 2F49A 3ENMA 2B52A 3I6WA 3A8WA 2HXLA 4OLIA 5EHLA 2BAQA 1OGUA 4AGCA 4BCFA 2R3HA 5DNRA 5TF9A 4MWHA 3RP9A 4I6LA 5ICPA 4MF0A 3KRXA 2G9XA 3CIKA 3F5PA 4FTLA 3TNHA 2VTNA 5CSXA 1Q8YA 3VW6A 4BVUA 4RVTA 3O2MA 3MTLA 5EFQA 4YURA 5CU0A 2VO3A 5CZIA 3FZRA 5JFSA 3V5LA 4DHJA 1O6KA 4ENYA 3ZLYA 3WZUA 2QURA 2XANA 3GOKA 4L46A 4LV8A 1KE7A 1REJA 4G9RA 2OWBA 5E91A 5IQDA 2UZNA 3MFTA 5HX8A 3NCGA 5DRDA 3WARA 4BIEA 5HQ0A 3EOCA 2IEWA 2R3OA 5E8UA 4PY1A 3R04A 4XRLA 5LMKA 4IX6A 2HY81 3WZJA 4Y5QA 4LGGA 3C9WA 4A9YA 3VHEA 3ZEWA 3HV5A 4YBKA 4E8AA 2O2UA 1CSNA 4JQ7A 3F3UA 4HNIA 5IA3A 4RC2A 3MY5A 5FRIA 2RL5A 2ZB0A 4PP7A 3KULB 3MYGA 3HV6A 5BMMA 4EOPA 1WMKA 4UX9A 1IA8A 5DYJA 4DE4A 4YLLA 4I93A 3AG9A 3QZFA 4CFUA 2VV9A 4NK9A 1RDQE 2UV2A 3VNTA 5IA2A 2J90A 3N4VA 3PXKA 3A62A 2NPQA 2W99B 1PW2A 3KMMA 3EZRA 5EW9A 3L8SA 4QP1A 3PFQA 5HU3A 4UZHA 5KX8A 1REKA 5HNBA 5LVPA 4UMRA 1KE6A 3VQUA 1DI9A 5CF8A 1Q5KA 3VS2A 2WB8A 2Q0BA 2R5TA 3BBWA 4QYHA 5F94A 2ACXA 3DBEA 3GU5A 4FKSA 4W9WA 5CZHA 3VF9A 4IM0A 2GCDA 4M0ZA 3WZDA 4BZNA 5IF1A 3UDSA 3KQ7A 2J0MB 2YLEA 2IVUA 4HGSA 5C26A 4EOMA 4FA2A 3EQCA 4MD7E 1OKYA 4FUYA 5EM5A 3KIOC 4DGOA 1VLRA 2ITTA 4FNWA 4R7HA 4JRNA 3ODZX 2DS1A 4A4LA 3DU8A 4EHZA 1JSTA 5DGZA 3KKVA 4CMTA 2F2CB 4Q5EA 3CGFA 4L68A 4U0IA 5GZAA 3G2FA 3VQHA 5ANKA 4CMOA 2ESMA 3I7BA 3C0HA 4U79A 3FLNC 5IH6A 4FTTA 3NVMB 4I0RA 2FH9A 4G6LA 3FQSA 3V51A 3ZC5A 5HOAA 5AX9A 4BGGA 3CJGA 4RX7A 1U5RA 4M14A 5IQAA 3ITZA 5H3QA 4JBOA 2WTJA 4TZRA 4OBQA 2Y4PA 4YMJA 2VTLA 1NVSA 1UVRA 4MEDA 5AJQA 3DQWA 5HVKA 1QPEA 2C3KA 2PUIA 4QPMA 2F4JA 2JKOA 3FMNA 4U3ZA 2IW9A 3ZU7A 4KIKA 4DH5A 3R0TA 1U5QA 5KHWA 5HORA 2QD9A 4PV0A 3T9TA 2C30A 4QYYA 2W4JA 4PF4A 4DYMA 3P86A 1IR3A 4O0VA 4W4XA 5ITAA 3QTSA 2OIQA 1YI4A 3F82A 4QOXA 4YC8A 3NUYA 3BWJA 2AQXA 1J91A 1OPKA 2NNWB 3FWQA 4O7RA 2BFYA 4MH7A 1P4OA 3E8DA 4RWLA 4BDBA 1W7HA 4L53A 4BDCA 5KMMA 1Q41A 4L3PA 1UNHA 2WQNA 2ZMDA 5BVOA 5C4KA 3QA8A 2XCHA 3LXLA 3GC0A 4W8DA 3BGPA 4IAFA 2OFVA 4RJ5A 3UPXA 5J7HA 1ZYCA 5C8MA 1YRPA 4DH1A 2A4LA 3RJCA 3C4CA 3ZUVA 1WBSA 3PPJA 5AUVA 4LG4A 3W33A 4X7QA 2WGJA 1GIHA 4LQMA 4F7SA 4O0RA 2QU6A 2OG8A 2VTJA 3AGLA 3F3TA 4MXAA 3TIYA 3QTUA 1OKZA 4KKGA 4BCKA 4G34A 2WMQA 3BU3A 5BQ0A 5AR4A 5HNGA 4PTEA 2IZRA 4A9RA 1P14A 2PVKA 1APME 2C0OA 4QP8A 2IWIA 2FSMX 4J8MA 4IACA 5HTBA 2W9FB 4O0YA 1QMZA 3C50A 4D1ZA 3I5ZA 2H34A 3R01A 5DN3A 4LGDA 2AC5A 3JXWA 4Q2AA 4AF3A 4IXPA 4H05A 4AFJA 4EC9A 4Z9LA 3FKOA 3I7CA 3LFBA 4HVHA 5AFVA 2BIYA 5JK3A 3QA0A 2JIUA 2XNGA 3QLGA 5H8GA 2ZV9A 5HVYA 4EQUA 4IVBA 2EB2A 4HVSA 3NYNA 4CFNA 4ZXTA 3ML1A 2C5VA 4EH8A 4F65A 4Q9SA 1OECA 3VW8A 1LR4A 5C1QB 3UDTA 2VWUA 3KU2A 4HYHA 2PZYA 3RALA 1CKIA 4XG6A 4DN5A 4KABA 2E9UA 2X7FA 3MA3A 4P5QA 2XP2A 4EH9A 2AUHA 2Q83A 3TDWA 2FB8A 4M84A 3LMHA 4F7NA 2UW8A 5AP6A 2C47A 3D4QA 4MX9A 4ZSAA 3DTWA 1LEWA 2OXYA 5JGBA 3COKA 4DHFA 3PXYA 2UW4A 4R78A 3VBVA 4TPTA 3FLYA 3I0QA 2QOLA 2VX0A 3KVXA 3QRUA 5AR8A 3EB0A 3L9PA 4CRSA 4DG3E 4LRJA 4R3PA 5AUXA 4AP7A 2V7AA 3EN9A 4CYIA 4RFMA 3NZ0A 2JFMA 4D4RA 3NR9A 2B53A 4XG7A 3CQWA 4U45A 4GIIA 2WMTA 3TTIA 3IPHA 3LCTA 2ITQA 3F61A 4S33A 3R7EA 3RPOA 5AP1A 2ITNA 3VUTA 3OY3A 3BLAA 4O7YA 4BJJA 3GGFA 3L8XA 3ZLXA 5HO6A 5ETFA 2P2IA 2CLQA 3G51A 4AXFA 3LFNA 4XG9A 2YM3A 1P5EA 2JC6A 2O65A 4AZFA 4RIWB 4RLKA 2YISA 3EKKA 2UW7A 3GFEA 1XO2B 1Y57A 3PY1A 3F2AA 5JKGA 1PKDA 3DJ5A 4I24A 4WD5A 1F5QA 4DEGA 3NNVA 2GNHA 5AWMA 3Q9XA 5BX0A 2GTNA 3E7OA 4BB4A 5HHWA 5HX6A 4WBBB 3BHVA 2X8IA 1PXNA 2FVDA 1OL5A 2OGVA 4I20A 5AP5A 1OL7A 3WBLA 4C59A 1QPJA 4KS7A 3TUBA 3ODYX 2OI4X 2EB3A 1PXKA 2IF8A 3AC3A 2HW6A 3A4PA 2ONLA 4GS6A 1MQBA 5CI6A 1UU9A 3Q4CA 5F20A 3QYZA 4TYJA 3W10A 4RA4A 3UTOA 2QO7A 5HKMA 4EBWA 1VEBA 3S95A 3SAYA 4DAWA 4ERWA 1BI7A 4IM3A 4LL0A 2XJ0A 3WE8A 1R78A 4BBEA 2GU8A 2XMYA 3TJDA 1FINA 5M06A 3TYKA 3FBVA 3IK3A 2XVDA 3ATTA 4FIGA 4JG7A 1XBBA 3LAUA 4P5ZA 3VBTA 1GIJA 1PMUA 3BLRA 3F5UA 3Q9YA 3BLQA 4O0TA 3KN6A 4YJUA 4ZTLA 3R7YA 3WYXA 2GQGA 1W8CA 5E8TA 3L9NA 3UBDA 2XIZA 5EYDA 5HI2A 4ACHA 4F1TA 3ORLA 1XMMA 2WMWA 1H1WA 2GHMA 3UVRA 2OKRA 4BYIA 3P7AA 4DHZA 2VNYA 4EHGA 1Q62A 3LJ2A 3GCQA 3DDPA 4WG3A 4QMNA 2Z7LA 1ZYDA 2PHKA 3W2PA 2I1MA 4B4LA 5A4CA 3DPKA 1ZMUA 2C69A 3MBLA 4AW5A 4BDIA 4FJVA 2YCSA 3LCOA 2VWVA 3AC8A 3DLZA 4F7JA 2FGIA 3QD3A 1KWPA 4KSPA 3EHAA 2B4SB 3OC1A 4H36A 4NT4A 4LDTA 5I0BA 3C7QA 5KMNA 2BRMA 3C5UA 3QKLA 4NFNA 2YA9A 3H3CA 4YBJA 4FK3A 2R7IA 1Q8TA 2UZUE 5JFXA 2Q0NA 3A7FA 3E92A 3DZOA 2YFXA 3SGCA 3BPRA 4R5YA 3BCEA 2UVYA 3KMUA 3VUDA 4FEVA 1Q8UA 4UYAA 1G8SA 2C6EA 5EYCA 3SQQA 3VWAA 1PMNA 2CDZA 2ZV8A 4MWIA 5E92A