4IAKA

Low temperature x-ray structure of camp dependent protein kinase a in complex with high sr2+ concentration, adp and phosphorylated peptide psp20
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Insights into the Phosphoryl Transfer Catalyzed by cAMP-Dependent Protein Kinase: An X-ray Crystallographic Study of Complexes with Various Metals and Peptide Substrate SP20.
pubmed doi rcsb
source organism Mus musculus
total genus 112
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4iakA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4iakA02
4MEDA 3GI3A 2BCJA 4PUZA 3Q4TA 3L9NA 3PWDA 2QU6A 3TKHA 3V5TA 4FTUA 4DF3A 2B1PA 3DK7A 5M4UA 2EXMA 2Y9QA 1UNGA 2YABA 2WMSA 4XG7A 4WBOA 5CASA 3MB6A 5AP4A 2C6IA 3PP0A 5EQPA 4KB8A 3KMUA 5HX6A 5L8KA 3R9OA 4ANNA 5HORA 4FVQA 5LVNA 3MV5A 2F9GA 1IEPA 4WRSA 4DFYA 2QG7A 3V8SA 5JRSA 3MFUA 3F5XA 4MBIA 3DBEA 3BGZA 4QMSA 1KWPA 3RHXA 3ROCA 3FE3A 3GC9A 2B9JA 2H9VA 4RWJA 3QWJA 4BZNA 2BKKA 3PPJA 3AG9A 2Y4IB 5CSWA 1H07A 3D2KA 1ERKA 1W84A 4BIDA 3NIZA 5EI8A 2OW3A 3R02A 1IG1A 4EOQA 2WTWA 3MY0A 2I40A 3HYHA 2XM9A 2GTNA 2R3OA 3FMDA 3IW7A 4KNBA 5AV2A 2Y4IC 4G3EA 2Y6OA 4AXAA 4JOAA 3LMHA 4EC8A 3ROYA 1IAHA 4GG5A 2VGPA 3M2WA 3MH1A 4AACA 1Q8UA 4MNEB 4JQ8A 5F94A 4ZXTA 3R9DA 2B54A 2UW8A 1W82A 3GCUA 4QP6A 1KV2A 1J7IA 3MN3A 4YUQA 3U54A 3NLBA 3C51A 4QRCA 1YXUA 4IW0A 4KBCA 3LQ5A 1WVYA 4GSBA 2CMWA 4FZAB 4NW6A 4U44A 3R7EA 1ZYDA 2VWXA 1Q97A 2UZWE 3QRTA 4JR7A 4QMZA 3GQIA 4ZAUA 2WMQA 2XNBA 4HPUE 3ZHPC 4R3PA 5A4EA 4FSTA 1M7QA 1SVGA 2JKQA 3DTCA 3ZONA 4CKRA 3PWYA 3HDMA 4XG9A 1YOLA 2GNHA 4FIHA 4IX6A 5KKRB 4HYHA 3QX4A 4G3CA 4YNEA 3O8TA 3ZO3A 4D9TA 3IKAA 4RA5A 5BQ0A 5L2SA 3Q3BA 4U80A 3R1SA 4NWMA 4O0YA 2HOGA 1YVJA 2YDKA 2OF2A 4B8MA 4EOSA 1NVQA 3FV8A 4L8MA 3MFRA 4I23A 3WF5A 4I0TA 2C69A 3HVCA 1Q62A 4G3GA 4M66A 4FIFA 5CZIA 5AUZA 5JFSA 4FVPA 3UQFA 3W33A 2O2UA 4BDJA 2CGUA 4FKTA 4X21A 5KO1A 4FL2A 4U8ZA 4F6SA 2XIKA 1UKIA 4AGCA 4WG5A 5C9CA 5ANOA 4YTHA 1E1XA 1OIRA 5C8KA 3SA0A 1YRPA 4GKIA 2ONLA 3AGLA 5L4QA 3BU6A 3CBLA 3FSFA 2ZM3A 4QT1A 4U41A 5H3QA 1CMKE 3MPAA 5L2TA 2JGZA 4HOKA 2V22A 2XNPA 1G3NA 1H4LA 1XJDA 4FK6A 4L3LA 4D4RA 5IA2A 4M8TA 4H1JA 3ET7A 4K1BA 1KE8A 2QNJA 3VUMA 4DA5A 3D4QA 2B9IA 4A4LA 4MTAA 4YP8A 3FI2A 3ALNA 3C4CA 4H3QA 4AG8A 3NCGA 3SKCA 4D4SA 3FLZA 3IW8A 2AUHA 4DEBA 4A06A 4QTCA 4JQ7A 4JXFA 1XQZA 5TOZA 4PDOA 2WQMA 4P2KA 4MVFA 5CEPA 1IASA 1ZMWA 3G6HA 3Q4UA 5DG5A 4AW2A 4RX7A 3BPRA 3EQPA 2XP2A 3F66A 3W10A 2W17A 3G51A 3R7VA 3W2QA 3IDBA 4MH7A 5AUWA 1WAKA 3HP2A 4OTPA 5AUUA 4FYNA 4CFVA 4KKEA 3PPKA 5M4IA 3QZGA 3TNWA 4FT3A 2HIWA 1XBCA 3BYVA 3JR1A 1UV5A 4JRNA 3GU6A 1XR1A 3QX2A 4QMYA 5CYIA 2O63A 4BBEA 4F9YA 5M57A 5LVOA 4D2PA 5BVNA 3QHWA 3NRMA 3MVMA 3PVBA 4YHTA 2WMVA 1Y57A 5CAPA 1YI6A 5D9HA 1MQ4A 4AOIA 4QPAA 5AP7A 2ZM4A 4XG4A 2VTTA 4FKQA 3CJGA 2I1MA 5HO6A 4O7VA 3UO6A 4O81A 3ODZX 3JYAA 4KA3A 3TG1A 3RKBA 4AA5A 3VS1A 3W2PA 3NUAA 3A61A 5JMSA 4DEAA 3OCGA 2YWPA 4I6BA 4J7BA 3EHAA 4RJ8A 4D55A 4EH9A 4QOXA 4DTKA 4BIBA 3CTHA 4AW1A 4E26A 3TNIA 3C4XA 1R1WA 3IDCA 2XYNA 4CFXA 3H10A 5K5XA 4XV1A 4C02A 3IW5A 4AT5A 3NW5A 4Z7HA 4EJNA 3FZRA 1OMWA 2QOIA 2XK3A 4OTIA 2JIIA 4FBXA 4RVMA 3P1AA 4H58A 5FBNC 3QD4A 4ACDA 2OZAB 4C34A 4BY9E 3VS5A 3EQFA 3F7WA 4J8MA 2RFDA 4RX8A 4C7TA 4FTCA 4OBPA 5FQDC 5HVJA 3W18A 5JRQA 3QGWA 4K77A 1GIIA 5FTQA 2X2MA 2W4OA 2PPQA 3RNIA 1H1QA 2BVAA 2OJGA 5BPYA 4GJ3A 4NM5A 3CSVA 2IVVA 3PA5A 4LG4A 3VWAA 1JOWB 4IM3A 3FLNC 3LMIA 2O0UA 3ANQA 2Q0NA 1FBNA 3FMJA 1JLUE 1W0XC 2I0EA 4ARKA 2PVMA 4MK0A 2A27A 4CG9A 2AC5A 2IW8A 3U6HA 4WA9A 4WHZA 3R00A 3IW4A 1OVEA 4I6QA 4G9RA 4LRJA 4DH5A 2O3PA 5AADA 3ALOA 2CKQA 5E91A 3NNXA 5AA8A 4FZ7A 1K9AA 5TE0A 2VWWA 3QTSA 1Z57A 4GMYA 4NJDA 4OTDA 2X2LA 3PPZA 2W5HA 4FSYA 4I5MA 2XNEA 4DFBA 3LCDA 1AQ1A 1FGKA 2OFVA 3OD6X 1R78A 4FKRA 1ZZ2A 3A62A 3A2CA 3I5NA 4JIAA 4PWNA 5GHVA 1F3MC 4EOKA 5J79A 3JY9A 3EN7A 2HYYA 4H1MA 3ZLSA 4BCJA 3BU3A 3UO5A 2B55A 3F88A 5FTGA 5J1VA 2OU7A 4WSQA 5CTPA 4CTCA 1GZOA 1JSVA 2ZYBA 4DITA 4E93A 3VBYA 4FF8A 3QQHA 4CYIA 4EHZA 2E9UA 4RGJA 1LUFA 4LUDA 4G3FA 4IWOA 4ENXA 1PRYA 1ZYCA 4PL3A 4XV9A 5IISA 3S2PA 3CKXA 3NUSA 3QU0A 4YJRA 4B99A 3BRBA 3CD3A 2OXXA 4BI0A 3R63A 5HE1A 3DBCA 3AD4A 3NDMA 3PY1A 4JG8A 2HK5A 4X3FB 1U46A 1WBPA 4KAOA 5GJGA 5D10A 2QR8A 1PMVA 5TR6A 4BYIA 4ERWA 5LMKC 4QTEA 3HX4A 3LFEA 4O0VA 4ZS0A 4B0GA 4WUAA 3OS3A 4X3FC 1H25A 3FJQE 1YXXA 3GCQA 4UMPA 5A4QA 4EHGA 4DCAA 1H1PA 2UZEA 5D1JA 3OCBA 3HRFA 4PP9A 4FSUA 3V6RA 2CNVA 4DT9A 3FQEA 3NNVA 4ZTQA 2IZUA 3NYXA 4L44A 4PQNA 5AAGA 4FTJA 3MTFA 5AR8A 5IZFA 3CY3A 2PHKA 3BYMA 3BI6A 3DFCB 4O27B 4RC3A 4UMTA 4DBNA 4GVAA 4P5QA 4CT1A 1EH4A 3ULZA 4FV3A 4UXLA 4USFA 4FT7A 3S1HA 4I22A 2CCIA 3KN6A 4OTWA 3TEIA 4E3CA 1OKYA 1GZ8A 4XP2A 4ALVA 1OGUA 3G0EA 5HBEA 3RCDA 4GT3A 4W9XA 5EG3A 1Q3DA 2RL5A 2XEYA 3P23A 3HGKA 5JFWA 4AS0A 2IVTA 2WEVA 3TTJA 2NRUA 2ITVA 1XHAA 2Z2WA 4K18A 3TV4A 2YEXA 2HWOA 4HVDA 2BRBA 3OT3A 1GNGA 4FOBA 2YISA 4P7EA 4XS2A 3B8QA 4FTQA 5E8ZA 5DI1A 5IH6A 5HX8A 3PJ2A 3W55A 5AEPA 2JKOA 3P0MA 4XG2A 3BHHA 5A4TA 4I41A 4F1TA 4DC2A 3FL5A 3QYWA 5C26A 2P0CA 4EBWA 4D2TA 5I9WA 3L8SA 1XBAA 2IZTA 3PTGA 4X6RA 4MCVA 4RIWB 3TKIA 4W4XA 3OXZA 5HHWA 3ATSA 3VBTA 4OTQA 4I94A 4IC7A 4RFMA 4RZVA 4YC3A 5M09A 4ZP5A 5HIBA 3ZUTA 2XS0A 5CEMA 4LV8A 2IJMA 3RWPA 2C30A 4K8AA 1OBDA 3V5WA 2UW9A 5BYLA 1OUYA 3QTIA 4NK9A 4EQMA 3I60A 5DRDA 3ZDUA 2UW0A 4L67A 1UU9A 4HVSA 3BWFA 4HCTA 2G2HA 3E8NA 4XNEA 2OH4A 4ZZNA 4PDSA 3MY1A 4XRJA 3EWHA 5H8GA 4BKJA 3MW1A 4MBLA 4ZY5A 4ZTRA 4BCGA 3UMWA 3SXFA 3PY3A 2EU9A 2XNOA 3BV2A 3WF6A 2C3LA 2ZM1A 3SOAA 4EHVA 5IQFA 5HOAA 5JKGA 4F9CA 1OL7A 4BTMA 4TRLA 4QMUA 3RMFA 1W8CA 2VZ6A 5ANJA 3DJ7A 4B8LA 4PTEA 4RVKA 2WTIA 2W1FA 3D5UA 3U87A 3OBJA 5LMKA 4F09A 3K5VA 3ORPA 4OR5A 4JI9A 3NYVA 3NYOA 4GUEA 4YJOA 4ZTLA 5KUPA 5C8MA 4E6DA 4BL1A 5AX3A 3DBFA 5LVLA 2DS1A 5AP6A 1VJYA 4EBVA 4KS8A 5E90A 1ZYSA 2F7XE 4EK5A 5EKNA 5FEEA 3CQEA 3CC6A 3DAEA 2PMOX 3KXXA 4GYIA 2FSLX 4QYYA 5EK7A 2PY3A 2P55A 3F3WA 4GCJA 4M7IA 4RLKA 4JAJA 3HMMA 5HVKA 4AZEA 5I0BA 4Z55A 2C6MA 3ZFMA 3SQQA 4EYMA 1SM2A 4FTNA 3EYGA 4QMQA 3SLSA 4YPSA 3VQHA 2VX0A 4DG2E 5KMKA 4YHFA 3BBTB 2XB7A 4IEBA 3H9OA 4BRXA 3DB6A 2YLFA 3E8DA 5A9UA 3QUEA 4FKIA 4U79A 4EQCA 4PDYA 3I6WA 2WU6A 1STCE 5AAFA 3SX9A 2WNTA 2VWZA 3ZBFA 4RX5A 4I92A 4IWQA 4NKAA 4X7QA 5CSXA 1UU3A 1BL7A 2XBJA 4J52A 4BI1A 3VUGA 5JH6A 3Q2JA 3TM0A 1Q4LA 3BX5A 2JFLA 2WMBA 3C50A 3EL7A 3PSCA 3N4VA 4CZUA 4M15A 3O23A 4UY9A 4BC6A 5LJJA 3GC8A 1ZYJA 3LE6A 4R5YA 4XBUA 5FWKK 3TNHA 3LCKA 3GT8A 4FNWA 2C6OA 2WMTA 1M17A 3CTQA 3JY0A 3M11A 3O8PA 3T9IA 4YMJA 1OKZA 1S9IA 2J0IA 3E5AA 3QTXA 4NJ3A 4ZZMA 2WXVA 3NEWA 4V05A 4CV9A 5JN2A 3GCVA 5H8BA 4RZWA 3W2CA 1QPEA 2CSNA 3LJ1A 4F4PA 4TY1A 3FSKA 4IB5A 4KINA 3PJ8A 5CXHA 2X0GA 3HA8A 5EM5A 5ETIA 3MTLA 3ORKA 4MD7E 2XA4A 3SAYA 4C3PA 5AP5A 4BDIA 5KHWA 1JKTA 3OW4A 4IVCA 2J0MB 2P2IA 1HOWA 4RX9A 2C5VA 4BDGA 2CKEA 2DWBA 2JKKA 2QODA 3FMNA 3BGPA 3P86A 5HBHA 3QCSA 3R8UA 3T3VA 3BHVA 4KBKA 3QCYA 4OAVB 5IKWA 3EFLA 5DR9A 5FXSA 1Y6BA 2W99B 3SXSA 4DLJA 4AN2A 4FSZA 1ZZLA 3GVUA 4TKSA 4YSMA 4C3RA 3C4WA 1APME 3ANRA 2EB2A 2WEIA 3PA4A 1Y91A 2ZMCA 4FTRA 4IJPA 4J97A 3RVGA 4EJ7A 5IQDA 3JXWA 4MWIA 5AUYA 1MUOA 4L46A 3S0OA 3C5IA 4FKGA 5BYYA 3NVMB 4HVHA 3NUYA 4O82A 4U6RA 4RWKA 2BZHB 5IH5A 3QD2B 3EKNA 1NY3A 5M55A 5HGIA 3KGAA 4JR3A 4C4HA 5BVFA 1YHWA 1YW2A 3LFNA 3TV7A 1Q24A 4FC0A 5IEVA 4FSMA 4FV0A 5CEQA 2YN8A 3COHA 4O7WA 3TZ7A 1U5QA 4C4IA 5CANA 5CF4A 3FMMA 5KMMA 3MDYA 4PL5A 4CEGA 5EM7A 3OG7A 4DHFA 2W1HA 4LUEA 2Z7LA 2QO7A 3LFDA 3VRZA 4ANSA 3I0OA 4YURA 2J5EA 2A2AA 3VO3A 2XK4A 1Q8YA 3EMGA 3MA6A 4IAAA 4BDDA 1YDSE 1H0VA 5F20A 1GJOA 4ALUA 3QTUA 3FHRA 4DT8A 4HCUA 2WQEA 3QRUA 4R77A 3QGYA 2BZIB 2W06A 3RZFA 4Z7GA 1PXPA 5JFXA 3DQWA 4O1OA 3G6GA 3DY7A 3OTVA 4RSSA 5GZAA 3ERKA 3E92A 3TI1A 4C4JA 4XH6A 2P2HA 2R3RA 4PMMA 2BMCA 4PRJA 4Q5HA 4APPA 4DEIA 2JDOA 4O0TA 2YZAA 5IA4A 5HCXA 4AT3A 4MXYA 4DG0E 1PF8A 1HCLA 2V7AA 3PJ3A 3PXRA 4AGWA 4E8AA 4DFUA 4O38A 4ITIA 5I4NA 4RPVA 5DWRA 2I6LA 3R7UA 4YZCA 4ZLYA 1G8SA 2WTVA 3AC2A 1UNHA 2XK9A 4IANA 3ELJA 4ACHA 3C4EA 1W7HA 3JVRA 3BBWA 4AZSA 2PUUA 2C6TA 4YJTA 5HU9A 3EQIA 4I6FA 5EDPA 5HG7A 5E4HA 4IC8A 4C33A 2JIVA 2BAQA 3GC7A 3KVXA 3SV0A 4E4LA 3UOJA 3QZFA 2CCHA 4HVIA 2YWVA 1H1SA 4I1ZA 4EEVA 4FOCA 3QQUA 4EWHA 3JS2A 4BYJA 2VNYA 3D9VA 4J71A 3LXKA 2JFMA 3DLSA 3HP5A 4AAAA 4RLLA 3RM6A 3TL8A 1P4FA 2OI4X 4PX6A 5JGBA 2XVDA 3HV7A 3NWWA 5BMMA 3SW4A 4AA4A 2ZB0A 4E7WA 3TZ9A 5BUEA 2XUUA 3QFVA 4I3ZA 5A54A 2WMRA 3TWJA 3GP0A 1KV1A 3LCOA 5GINE 4LFIA 1PXNA 1Z9XA 3MH3A 5ACKA 4IACA 3UZTA 5HCZA 4OAUC 4C2WA 3PVWA 3IW6A 3A8WA 4G6LA 2PYWA 2YDIA 2WTCA 1K3AA 4EH6A 4AE9A 5C01A 1V0BA 5IU2A 1OL5A 4OLIA 1MQBA 3WZKA 5LXMA 3KA0A 3KB7A 3LVPA 4FKOA 4R78A 3QTZA 4HNFA 4BCPA 2UZUE 3EQGA 3VW6A 1T45A 3VVHA 4IAKA 5ETAA 2VWBA 5IA5A 4XV3A 5C4LA 3FZOA 1O6LA 5DNRA 3DQXA 2PE2A 3PG3A 3RWQA 4ZZOA 2VX3A 4GT4A 4ACMA 3HEGA 5I3RA 4F9WA 1SMHA 3EB0A 3UDBA 4RQKA 4FA2A 4LGGA 1L8TA 4UB7A 3UODA 4F99A 4CMOA 2Z60A 3O96A 3E87A 2HENA 3ZM9A 3OWKA 2V55A 4IB3A 2ITOA 4GJ2A 4QMPA 4EKKA 4RIOA 1J1CA 3NAYA 4R1VA 2GCDA 3GU8A 5BNJA 2OGVA 5KZIA 4F7LA 3BKBA 1OPKA 2QR7A 2VWIA 3LFQA 4E6QA 4MQ2A 4DFNA 3CGFA 3FQHA 2W9FB 3IGOA 4ZSGA 4BFMA 3H30A 1Z5MA 5KX8A 1R0EA 5EW8A 4W9WA 1OL6A 1A06A 2XCKA 4CKJA 3W32A 5FGKA 4YBJA 3ZFYA 4IAYA 5CU3A 3AC1A 4P90A 5CZHA 4O6LA 2BALA 2R3QA 3TTIA 3C1XA 2R3HA 1MRVA 2ZB1A 3UE4A 3FKNA 2J90A 5J1WA 4A9SA 3A8XA 1ZOEA 5B2KA 2ZDTA 3P9JA 4EOMA 4JT3A 5J5SA 1KE9A 4QMXA 5CU6A 4AW5A 2GQGA 4YZMA 3VJNA 5L3AA 2OF4A 2DQ7X 2QD9A 3DK6A 2WB8A 3A7FA 1YDRE 2ZJWA 3P7AA 3DAKA 2WAJA 1FINA 4NT4A 3A7JA 5HTCA 5HG8A 4F1MA 5L2IA 3D5XA 4GK2A 3RI1A 5J9YA 5FDXA 5T68A 4UWCA 2W1DA 2ZOQA 4PTGA 4EKLA 4IMYA 1JSUA 3IS5A 2ERZE 4GVJA 4U3ZA 5JGAA 1O6KA 1UWJA 1P14A 2CKOA 2C3JA 1YHSA 4WT6A 4V0GA 5ITAA 1ZMVA 3KXZA 4C4FA 3Q6UA 5KBRA 4ERKA 1A9UA 5ETCA 3QKMA 3KK9A 5CT7A 5AIRA 5DA3A 4E5AX 4JDKA 4MBJA 3R04A 4QQJA 5LWMA 4I5CA 1VZOA 1FVRA 2JIUA 5LCKA 5IQAA 1RW8A 4E20A 2HCKA 4NL0A 2AYPA 3F6XA 3PE1A 5HLWA 3BV3A 2JDVA 4Y72A 2YZLA 1PHKA 3CD8A 1FMOE 3MH2A 3KMMA 2X8EA 3EN5A 3BLHA 4Y46A 5J8IA 2ERKA 3VIDA 4QMNA 4RFYA 2F2CB 4W8DA 1H8FA 1JWHA 3FAAA 1RDQE 4F0IA 5HZNA 4Z9LA 3BLQA 3PSDA 4FKPA 2OZOA 2X81A 2UW3A 2YIXA 2QO2A 3TUDA 3UPZA 1XH9A 2ETMA 4WOVA 2PWLA 4D2SA 1PXJA 3HZTA 3RPRA 4L3JA 4G16A 4XG8A 5CU2A 2GS7A 3RPOA 2UUEA 4FK3A 3ENHA 5DH3A 3C7QA 3LCTA 3DKFA 3NNWA 2OIQA 3CIKA 3POOA 3CS9A 4IX3A 4QP8A 2QC6A 3AD5A 4TW9A 4H05A 2YACA 1YDTE 4HGEA 4L45A 4FSRA 3RJCA 5BUJA 2OIDA 2YM7A 1YWVA 2ITNA 4O2ZA 2HZIA 4NIFA 5IUGA 4OUCA 4EH7A 2I0VA 3CY2A 4TYHB 4B6LA 1VR2A 4FT5A 4IM0A 4GW8A 3LM0A 4CFMA 3QCQA 2X8IA 5M08A 4IB1A 5KKRC 4N0SA 3R1YA 3QUPA 1OIQA 3L8XA 4O7RA 3MBLA 5JZNA 3V01A 4X2GA 4O7ZA 1RQQA 3I7BA 3OCTA 4UEUA 4F63A 3VF8A 1H27A 5DR6A 1WBSA 2QOKA 2Z7RA 1RJBA 3VC4A 2VV9A 4RIXA 3WZEA 2DUVA 3I79A 3P79A 2R5TA 3QA0A 4IZYA 5M4CA 5IQEA 4WKQA 2XK8A 2Y4PA 3TT0A 4JDHA 3FMEA 1YOJA 4GUBA 1YWRA 1RE8A 2CPKE 2EB3A 3LPBA 5IF1A 2C3IB 4FEQA 4AF3A 5ANGA 1SNXA 5I5ZA 3BQRA 4DGGA 5AP0A 5AP1A 2X7GA 3LM5A 4E6AA 3CGOA 2I0YA 3FWQA 5ANKA 4L6QA 2WMUA 4BICA 3DCVA 5E8YA 4DTBA 3NGAA 3OWJA 3DNDA 5KHXA 4BDCA 3MSSA 3MFTA 4ACGA 3TDWA 5F1ZA 3TV6A 5IQHA 4QMLA 1REJA 3IG7A 3RPVA 4FIEA 4BB4A 5IMEA 4F6WA 3WYXA 4KIPA 2QI8A 3KVWA 3WZDA 5CENA 1I09A 3C4FA 3RNYA 3R8VA 3U4WA 3GU7A 5L2WA 3ZBXA 4L00A 4JX7A 3DJ5A 3BELA 1OECA 3OCSA 1H1RA 2CN5A 3VUIA 5HU3A 4J53A 4JLCA 1QPCA 2PVFA 2XNMA 1WBVA 4YNOA 4FKWA 4KIKA 4A4XA 4H39A 4ASXA 3O7LD 4FKLA 3NR9A 3BHYA 3DXPA 3PDTA 5HE2A 3ZH8A 4IVAA 1CKIA 3MVJA 4QD6A 2YCQA 5HNIX 2VTHA 4UV0A 4G6NA 3IDPA 1PYEA 4D5KA 3OZ6A 4X0MA 1OPLA 4E73A 3S3IA 3PJ1A 3PIYA 4QP7A 2FA2A 2YCSA 1YQJA 3ETAA 3F5PA 4U9AA 4E1ZA 2BDWA 3ATTA 3G15A 2UZOA 1PXLA 4U40A 3DKOA 2J4ZA 4QMWA 3O2MA 4EZ5A 2W96B 2WOTA 2X6DA 4YBKA 2GHMA 4W4YA 5EM8A 2ZDUA 5T6KA 2VTNA 4DINA 5IQCA 5CXZA 5C1QB 3RCJA 4FYOA 4PPBA 3SDJA 1JPAA 2XIRA 3R71A 4O0XA 4Y83A 5LOHA 2XEZA 2V5QA 4JX3A 3ZSIA 3BWJA 5L6OA 2UZLA 4GK4A 4HGTA 2ITWA 2FVDA 2WO6A 3W2OA 1G8AA 3UQCA 2GU8A 3Q5ZA 1FQ1B 2QONA 4S32A 4BDBA 1GZNA 2WQBA 4O83A 4NTTA 5HD4A 2NPQA 2O8YA 3FC2A 3U9NA 3UOLA 3NVKI 2R7BA 4BN1A 3UZPA 5EW3A 5E1EA 5J95A 3RZBA 5FP6A 3NPCA 4ZOGA 2HY0A 2XJ1A 5K0KA 2BTRA 2CGXA 4BCQA 4ITHA 5DGZA 2PZIA 4BF2A 3DFAA 3R01A 5DOSA 5I9UA 4C0TA 1GY3A 5E8XA 2PVKA 4EH5A 4RMZA 3O51A 1BI8A 3QQKA 3UNZA 4IVBA 4IHPA 2FSMX 1OIYA 4LMNA 4BGHA 5A14A 3R8MA 4FV6A 2GPHA 4IDTA 2GSFA 2XIXA 5K0XA 2GNGA 5AUVA 2VGOA 3F2NA 3QQGA 3MESA 5ICPA 3WARA 4CMTA 3DKCA 3QF9A 5AFVA 2C5YA 3BYUA 5L2QA 4OT5A 3LIJA 3DA6A 1OPJA 1XWSA 4LGDA 5EYDA 1DAWA 3DAJA 2C6LA 4QMOA 2OJ9A 5EDQA 4AQCA 1YKRA 3MGYA 1OB3A 3GXLA 3DDQA 1OUKA 4B7TA 5EHLA 1PMNA 4O0RA 3UVQA 2E9NA 3BYSA 5AV0A 4G34A 3UGCA 4AZVA 5FEQA 4CRLA 3F7ZA 3S95A 4D1XA 4F9BA 5E1SA 2ETKA 4YJPA 4II5A 4I21A 1PMEA 4IB0A 4YJSA 1ZXEA 3ZEWA 4FG8A 2CLQA 3LQ8A 4S30A 2A4LA 4ACCA 2PVHA 1E1VA 2OKRA 5LWNA 3RAKA 4R3RA 2PL0A 3R9NA 4RA4A 3UVRA 2FB8A 4C57A 2XCHA 3PSBA 4GL9A 5IMXA 4FEXA 3BIZA 4M14A 4EOOA 3EQHA 1CSNA 2G01A 3FYKX 4BTFA 2IW9A 4DCEA 4L68A 3R22A 2C6KA 3UOKA 5LVMA 4FICA 4DGLC 5M44A 3ORNA 4ZTSA 2XKFA 4QTBA 3UP7A 3IGGA 4FV8A 4GS6A 4FMQA 4I4FA 3UPXA 3Q9YA 3IOPA 5CEKA 3FHIA 5GIOE 4QNAA 4IWPA 3IQ7A 4DN5A 3RINA 1R0PA 4EUTA 3QAME 2OSCA 3TUBA 1SVHA 4PNIA 5AM7A 4D1ZA 5AM6A 3R7YA 2YHVA 2BIYA 1H00A 2B4SB 4N4SA 4QMTA 5HTBA 5KMOA 3PFQA 4NTSA 3K2LA 3E8EA 2R3MA 5DEWA 1PKGA 4J98A 4F0GA 1R39A 4RWIA 5G6VA 3I4BA 1Q8TA 2A19B 3KRLA 3ZRLA 3OW3A 2WHBA 5TT7A 4D58A 3MJ1A 4QNYA 3ZUVA 2JAVA 3SW7A 1KOBA 1GIJA 5IG1A 4JAIA 4QP9A 3WI6A 2VTSA 1YHVA 1KSWA 1ZY5A 4F7JA 1OBGA 1TVOA 4QMMA 4F7SA 4M67A 2WTDA 4AA0A 4DLIA 4X2NA 2CGWA 5CSPA 3MIAA 3TXOA 3CP9A 4X2KA 1SVEA 3UMXA 2WMAA 4TTHB 3TN8A 3RPSA 5BVDA 1R3CA 4EH3A 1SZMA 2WQNA 5HG5A 3V51A 4ANBA 4D0XA 2OXDA 2PTKA 2XIYA 3L8VA 2HW7A 4WNPA 5IDPA 2BZKB 3SGCA 3BE9A 1CKPA 2V7OA 4BCOA 3A99A 1O9UA 4EH2A 4I20A 2G9XA 3R2BA 5AP2A 1TQMA 2WKMA 2BRNA 2HXLA 3E88A 5F95A 5CI6A 4BCKA 1ZOGA 1CKJA 4CNHA 1XH6A 3BEAA 4U43A 4UYAA 5DPVA 4O7TA 2ZAZA 3FLYA 3QKKA 4EK8A 2ESMA 5D12A 2X1NA 5GZ9A 2J0JA 3VUKA 5LVPA 3QD0A 3ZUUA 3AQVA 4G6OA 3PLAE 1WZYA 3QQLA 4FTIA 4FZDB 4FTTA 3N51A 3SG8A 2EUFB 4RVLA 3Q96A 4KIOA 2JITA 4O96A 3WE4A 4CSVA 2OICA 5DHJA 3KL8A 2J7TA 1L3RE 4NZWB 2JKMA 3ZXZA 3E3BX 3I1AA 3GU5A 4PP7A 3HAMA 4XP0A 3PJCA 4M0YA 2IW6A 3N4TA 2VO6A 3TACA 4N57A 2R9SA 3WF8A 3AT3A 4FNXA 1MRYA 4EOIA 4MXZA 3AGMA 1DI9A 5AA9A 3PYYA 4JDJA 2UVZA 3BU5A 4TWCA 3ZYAA 4LQMA 5DIAA 4GV1A 1IA9A 4O7YA 2QOBA 3FL4A 2PMIA 4HGLA 2QKWB 2VAGA 2CJMA 5HLPA 5JSMA 1U54A 3QD3A 4FUXA 3T8OA 4MXCA 5JEBA 2R3KA 3CQUA 4C58A 4X3FA 1TQIA 4GEOA 1BI7A 1XH4A 4QTAA 3VS2A 3LW0A 3ORXA 3ZEPA 2F4JA 4BDEA 4IDVA 3KRJA 4FIGA 2VU3A 5DRBA 2VTRA 3PIXA 1ZMUA 4IZ5A 5BVOA 4HYIA 1UVRA 4NM0A 2PVJA 3MJ2A 4J99A 4N70A 5HIDA 5KZ0A 1OL2A 3Q4ZA 3HMPA 5H9BA 4ZLOA 4G31A 3ORMA 4O86A 2JDSA 3T9TA 2E2BA 2ZV9A 2YM8A 5A3XA 3PZHA 1YWNA 3PLSA 5DFPA 3F3TA 4IBMA 3FLQA 3QTWA 3DB8A 4F08A 2G15A 2ETRA 4OBOA 5CWZA 4Q9ZA 4EQUA 4F9AA 2XYUA 4JS8A 4M84A 3CKWA 5CAQA 4C36A 4LMUA 2BUJA 5BVEA 1B6CB 3ORZA 5M07A 5LARA 2HXQA 5AR7A 2F7ZE 3FQSA 5I9XA 3VS4A 4IWDA 3H0YA 3OOMA 2BRGA 5I9ZA 4UN0C 2VX1A 4ORKA 5HI2A 4XV2A 3G9NA 1KUTA 3KCFA 4FZ6A 4AP7A 4BDFA 1H08A 3LAUA 3O17A 3C4ZA 3IPHA 4ZSEA 4EORA 1PYXA 4EC9A 1A48A 4OTRA 2LGCA 5HNGA 4FKVA 2E9OA 5EKOA 4ZJJA 4HVGA 2YIWA 2ZV8A 3D14A 2QHNA 3F2AA 4H36A 4CYJA 2IVUA 2YDJA 3WZUA 3NMUF 4GU9A 4ZK5A 3UIUA 3QQFA 5FDPA 3LHJA 3RGFA 3ZTXA 4TZRA 4RBLA 4KBAA 1JKSA 2O64A 2J5FA 3HV4A 3WBLA 5IA1A 4QYGA 4ZSAA 3OY3A 3DBDA 1IA8A 4NU1A 4UMRA 4XOZA 4BTJA 4HPTE 1Q3WA 2BFXA 5G1XA 2REIA 3F3VA 2YCRA 2EWAA 4U97A 4WSYA 2X39A 1LEWA 4A4OA 3V5PA 3QCXA 2R3JA 5E9EA 1Q99A 4D2WA 5KBQA 4MD9E 2JDTA 4IAFA 4R5SA 3VHKA 3C0HA 5JK3A 4JG7A 4OTFA 5IA0A 3OUNB 2BPMA 3ZXTA 2J0LA 5J9ZA 3PXQA 3Q53A 3ZLXA 3JVSA 4ZIMA 3VBWA 4QO9A 3L9LA 4CFUA 3R1NA 4L9IA 1YXSA 2JDRA 4EH4A 1ZLTA 3LXNA 4KRDA 4Y73A 3E64A 3PA3A 3NZ0A 3FXWA 5HO8A 1PJKA 5GIPE 2PE0A 2B9FA 4M3QA 3KC3A 2UW7A 2XRWA 3OP5A 4MKCA 2Y7JA 1YXVA 2HW6A 3C13A 2RFNA 5IEYA 2WU7A 3VHEA 3AC5A 1O6YA 3NUPA 3OOGA 3AT2A 3PRFA 1URWA 3BYOA 1NA7A 4RQVA 3KY2A 4EI4A 2R3PA 3IO7A 5E8UA 2VTAA 3WOWA 5B7VA 2NP8A 3B8RA 5EW9A 2PUIA 2J50A 2GFSA 2NO3A 2VRXA 2UZVA 4XOYA 4FKUA 2Z8CA 2X8DA 4G17A 3FDNA 4RIYA 3RAHA 3VS7A 4DFLA 1I44A 4A9RA 1KE7A 3ACKA 3FZSA 2FSOX 2XNNA 4LRMA 2CNQA 2WPAA 2VNWA 2G2FA 5ACBC 4BWKA 4BCFA 3KXMA 5KE0A 4A9UA 4YHJA 3F61A 1GIHA 4ZSJA 4AT4A 3FZPA 3U9CA 4FTLA 2C1BA 4NSTA 5GJFA 3V8WA 5KMJA 3HL7A 4XP3A 4OTHA 4O2PA 3P5KA 1M7NA 3VRYA 3FY2A 1DS5A 1K2PA 5HTIA 3D15A 3CQWA 4M13A 4J96A 4Q2AA 4AOTA 2CGVA 3F3ZA 3W8LA 2UZDA 4QQ5A 3KQ7A 3LLTA 4QP3A 5IQIA 2WD1A 3PUPA 5E7RA 3OC1A 4BWPA 3ENMA 4XBRA 2W5BA 3TIYA 4DEHA 3II5A 1U5RA 5CT0A 2UVXA 4FV1A 3ZO1A 3TCPA 5KNJA 4IJ9A 5IUHA 4YJQA 1OZ1A 3IK3A 3FZTA 4LGHA 1JKKA 3KULA 1DM2A 3B2TA 1PKDA 4A7CA 2XJ0A 5EI6A 2ITYA 2YIYA 2C3KA 4N6ZA 4XHKB 4Y95A 3QL8A 3EZVA 1UWHA 3ORTA 3P4KA 4C8BA 2DYLA 1HCKA 2FYSA 2WGJA 4GT5A 3SD0A 1S9JA 2FGIA 4CRSA 3ZFXA 5KCVA 3HUCA 4P4CA 3RAIA 3UC4A 3GC0A 2PZRA 1XH8A 2R3LA 1PXMA 3ODYX 2W1CA 3FKLA 3SVVA 2PULA 3GOPA 4LI5A 1NVSA 1FOTA 4DH8A 4GFMA 4CMUA 1YI3A 2RSVA 4EL9A 4CVAA 2UW6A 2FH9A 4GFOA 2W1EA 2UVYA 1VYZA 4O7LA 1ZARA 4U5JA 3FMKA 4YO4A 3A7GA 5CS6A 4WIHA 2ZV7A 2C0OA 4KD1A 4E5WA 2F2UA 4FR4A 2HY81 4QP4A 4G5JA 3L8PA 3NUUA 3QUDA 4BHZA 5JGDA 3I0QA 3NSZA 4MHAA 4LRKA 4AFEA 3F69A 1OITA 2YIRA 4KSPA 3VS0A 3BEGA 1Q8WA 3FXXA 4F64A 2E9PA 4O0WA 3VAPA 3W8QA 2Y0AA 3DGKA 4JBQA 4O6EA 3VF9A 2GHGA 2QLUA 4DH1A 4HJOA 4NM3A 4BCIA 5JQ8A 3AC4A 3PP1A 5HIEA 4Y5HA 2PE1A 5AWMA 2BZJA 4YLKA 3F2RA 3SHEA 3QLGA 3I81A 3NIEA 1KE5A 4MX9A 4TWOA 4UZDA 4D4YA 4F6UA 2OXYA 3DZQA 1XH5A 3F5GA 2R2PA 2B7AA 1LP4A 3U4UA 4Y8DA 4ZTHA 2B52A 4FODA 2AC3A 3WZJA 5DBXA 4U45A 3EN6A 4OGRA 4OBQA 4XUFA 2H96A 4KUJA 2XKEA 3Q5IA 5AIKA 3DKGA 5M53A 3C5UA 5HCYA 3V04A 3KXHA 4XYFA 3KXNA 3PXKA 3PE2A 2BAJA 3EYHA 4L7SA 3A7HA 4CFFA 3WILA 3F9NA 4RRVA 3ZO4A 4TPTA 1LEZA 3UIBA 2YM6A 3EQBA 3GOKA 4M69A 4NIFB 4BGQA 4J95A 4E4NA 4FEUA 1LR4A 4YU2A 4R7IA 4D1SA 4BI2A 2F57A 5FP5A 4O22A 3W1FA 4PMTA 4JIKA 4EUUA 3HMIA 4C3FA 4AGUA 4CTBA 4O0SA 3TKUA 1NW1A 2IVSA 2P4IA 5ANEA 5DMZA 4IE9A 5FM2A 2PVLA 1G5SA 3R8LA 2VWUA 4JDIA 1JVPP 4D5HA 3EN4A 2C1AA 2BHHA 2QLQA 2YCFA 4RIXB 5T3QA 3ZDIA 5JZJA 4BZOA 4ZY4A 4RVTA 5BX0A 3QXPA 3R2YA 4M0ZA 4C62A 5EM6A 2C0TA 4E6CA 3TUCA 5F4NA 3OFMA 3OEFX 3IONA 3VJOA 5BUIA 3PRIA 4NCTC 1GZKA 2J0KA 3OF0A 4CG8A 3V5JA 4IAZA 5CALA 5FD2A 1IR3A 1WBTA 2X4FA 3KN5A 4KABA 4BDHA 3OMVA 2ONLC 4E4MA 4EOLA 3G33A 4FV4A 4I93A 3HV6A 2P3GX 1U59A 3EZRA 2YLEA 3SRVA 1OIUA 3ZLYA 2BROA 2CN8A 3QRIA 4U0IA 1DI8A 1M2QA 1UNLA 3FLWA 4BDKA 3KRXA 4ID7A 3EFJA 3Q52A 4DEDA 4RC2A 5FUTA 4AWIA 5GNKA 2BAKA 2X7FA 3GU4A 3DTWA 3D5VA 4EK3A 4E5BA 4AUAA 3H9RA 3K3JA 2BHEA 4G1WA 3R21A 4CGAA 3LXPA 3U6JA 4EZ3A 3PXFA 4O7SA 3D7ZA 2X2KA 4EK6A 1J91A 4ZY6A 1WMKA 2W05A 3QALE 4IVDA 4KIKB 5KMIA 1B39A 1KOAA 4FV7A 2W4JA 1W98A 1BKXA 3MPMA 5DEYA 4PL4A 4TXCA 5DT3A 2BDFA 5HE3A 2X4ZA 3ZOSA 3HRCA 3VUDA 2ITPA 4FTOA 3NS9A 3D7TA 4H3PA 3Q9ZA 3OUKA 4QP1A 3DPKA 5CSHA 3Q04A 3NCZA 4TNBA 1REKA 1IRKA 3GQLA 5AJQA 3QTRA 3HAVA 3ZLWA 2FSTX 3R28A 5EH0A 4TYGA 4K2RA 5JFVA 4R7BA 1PMUA 1YOMA 2BIKB 4EOJA 4X3JA 3EOCA 4CCBA 1U4DA 4UYNA 4AZWA 1OKVA 1V0PA 3R30A 3RK5A 1JQHA 3ID6C 2RF9A 2BKZA 2ITZA 3RHKA 4CKIA 4R1YA 1H1WA 4FKSA 5FEDA 3V8TA 3P08A 3FPQA 3OY1A 4I4EA 5EYMA 5DLSA 4FV5A 3UC3A 4AN3A 4FGBA 5HLNA 4FL1A 2PK9A 2XBAA 2VN9A 3VULA 2YJSA 3H4JA 3BQCA 3COIA 5D7VA 4AZFA 2J51A 4U3YA 1JKLA 1UKHA 2R3FA 3QHRA 4M97A 5CNOA 2ACXA 2RFEA 3B2WA 3M42A 4GG7A 4ITJA 2ITQA 5FBOA 4YLLA 4AE6A 5BVKA 2WOUA 2LAVA 2WTKB 3E3PA 4XRLA 2CLXA 5GJDA 3QXOA 3HNGA 4YJUA 3WF7A 5HEZA 3UIXA 3BHUA 3TZ8A 2JBOA 4LV5A 2O65A 4RJ3A 1Q41A 4MAOA 3UG2A 5A6NA 2RG5A 2I7QA 3JUHA 3ZC5A 4ZMFA 5CY3A 2WTKC 2Y8OA 5DVRA 4DH7A 2XH5A 3UQGA 4NCTA 2QO9A 1ZY4A 4B4LA 3AT4A 1JAMA 4BGGA 4FIIA 2SRCA 2C47A 3OWLA 5EQEA 1NXKA 5D11A 3KF4A 3DZOA 5B0XA 5IH4A 4UMUA 3D94A 4UALA 4YTFA 1F5QA 2GS2A 3RALA 2IZSA 4PMSA 3DXQA 3E7VA 1BLXA 5J7HA 5CVFA 4ZJVA 2Z02A 2WQOA 5HESA 4JNWA 2RFSA 2VD5A 2WMWA 2WZJA 3HUBA 4UMQA 3DOGA 5CU4A 2OJJA 3LJ2A 5CI7A 3N4UA 2F7EE 5H2UA 2J9MA 5HO7A 2PVRA 2GNLA 1WBOA 3QC9A 3RP9A 3ZS5A 1OM1A 1IAJA 5AR2A 4DE4A 2XZSA 4ZTNA 5BMSA 5H8EA 5L8JA 2QG5A 3WYYA 4CXAA 4QQTA 2VTQA 4R6VA 5CLPA 4YPDA 4V01A 4MNEA 5AR5A 4Z3VA 5IUIA 3QBNA 4AFJA 3KFAA 1UU7A 5A4LA 4FSNA 4EWQA 1F0QA 1WCCA 1M2PA 3NW7A 2CHLA 2BRMA 3IECA 4WUNA 4DFXE 3N9XA 4NEUA 3AMBA 3JPVA 1WFCA 3E93A 3VS6A 4IM2A 4BCNA 5IEXA 3KU2A 4P5ZA 5J7BA 2JEDA 3MI9A 3G9LX 4M68A 3MYGA 4ALWA 4FX3A 3QKLA 5IQGA 3G5DA 5LMBA 1TKIA 4FE2A 4ENYA 2VTJA 2R0UA 4IXPA 3UOHA 4DEGA 2V0DA 3ZZWA 3M1SA 4PNKA 4TYHA 3U6IA 4GYGA 1ND4A 2W0JA 3S00A 2Q0BA 5CX9A 3ZU7A 5C4KA 2XKCA 3TZMA 3GCSA 1DAYA 2R7IA 3I5ZA 4HZRA 4UBAA 5CSVA 3P78A 4BWXA 4D4VA 5D7AA 3MWUA 3KCKA 3R6XA 5FM3A 3EQDA 3GFEA 1WBWA 5BVWA 5BYZA 4L43A 3TIZA 2Q83A 3GFWA 4U81A 2C5OA 2QURA 3OWPA 2BILB 4XLVA 3RM7A 1J3HA 3D5WA 5K9IA 3R9RA 3G2FA 4QYHA 2GTMA 3QA8A 1VYWA 4JG6A 3DK3A 3P7CA 4R7HA 1J1BA 2WMXA 4CV8A 3E62A 3QC4A 2CNUA 4ZSLA 2UZNA 5EHYA 4ZLZA 5DT0A 3GB2A 4HCVA 4IX4A 4FZFB 2VTPA 2VWYA 4A9YA 2OO8X 3UZRA 5C27A 1Q8ZA 2VUWA 4AX8A 4NYEA 4O84A 4I0SA 4EYJA 4FEVA 2ITXA 2R3NA 4EK4A 2R4BA 1PXOA 1M2RA 4MWHA 3NW6A 3NX8A 3KXGA 3LZBA 1FVVA 4QTDA 2H8HA 3KRRA 2BTSA 3ZRMA 2C68A 2W1IA 3LJ0A 5EI2A 4L01A 4O21A 2Y6MA 4CQEA 3ITZA 3TNPC 3LOKA 4S2ZA 3QZHA 4FNZA 5C8NA 2R3IA 4FEWA 5HICA 2YIQA 3BE2A 4LL5A 3P7BA 2XM8A 4CFWA 3HDNA 4ASEA 3HV5A 2RGPA 3SC1A 2X9EA 3HMOA 3NYNA 2IWIA 1E9HA 4QPSA 2H6DA 3MIYA 2OK1A 2F49A 3R7IA 4DH3A 3MB7A 4O0UA 3VBVA 4IZAA 3C9WA 1Y8YA 5L6WL 3LQ3A 1JNKA 4CLIA 4KSQA 5DYJA 4C4EA 3KEXA 5AUTA 4TYIA 2YAKA 3DJ6A 4K9YA 4RJ4A 3V5QA 5FG8A 3ACJA 5HQ0A 2WFYA 2OLCA 4UWYA 3FEGA 4YZNA 4USDA 5EOBA 2KULA 3K3IA 2YM3A 4Y5QA 4D2RA 2C6EA 4RJ5A 4S34A 4APCA 4IZ7A 5AR4A 5DR2A 4EHEA 3A7IA 2QKRA 5I3OA 1U54B 3FYJX 3GEQA 4OW8A 2GFCA 2PSQA 2C0IA 3FPMA 3U8WA 4I0RA 2VO3A 4TWPA 4YLJA 3BGQA 5EOLA 4KIQA 2QU5A 3KRWA 5CAUA 4BDAA 3ORIA 4U7ZA 3UBDA 4IFCA 5E8SA 4FUYA 5J87A 4I5HA 3Q9WA 3BLRA 1H26A 3SXRA 2C5XA 1FPUA 3O0GA 4J8NA 5K5NA 3Q4CA 1UA2A 3RTPA 4D9UA 3FI3A 4MYGA 3SG9A 4YC6A 3EQCA 2HZ0A 5TF9A 4MD8E 4F65A 1FMKA 1ZOHA 2WIHA 3EFWA 4N6YA 3TJDA 5JT2A 3W16A 2BR1A 3QLFA 4L42A 4R8QA 5FTOA 2G2IA 1J7UA 3HV3A 2OZAA 3F5UA 4LL0A 2PUPA 3H0ZA 4C59A 4K11A 4C35A 3KREA 4PF4A 3NNUA 3KMWA 1XH7A 4TWNA 4X2JA 3Q60A 2W1GA 3BZ3A 4MXAA 1QMZA 3O7LB 5IPJA 2W5AA 4HGSA 4K33A 2HAKA 3CCNA 3WF9A 4HW7A 2XF0A 2GNJA 1BYGA 2JD5A 4FT0A 4I24A 4LM5A 4XX9A 5IDNA 3RK7A 3FI4A 2JAMA 2W7XA 1CM8A 5AAEA 2QOFA 2UZTA 4USEA 4MXXA 3OXTA 4NW5A 2PVYA 4IAIA 4MXOA 4PV0A 2OH0E 5CU0A 2QOCA 4QYEA 5K3YA 2X7OA 5AP3A 5M56A 3MFSA 1FGIA 2QOQA 3HRBA 4A07A 1YI4A 2O5KA 3V5LA 1ZRZA 5LCJA 3NUNA 2QOLA 3FI8A 1LPUA 1NVRA 2QQ7A 4XJ0A 5AMNA 5FRIA 3WIGA 3G0FA 2PVNA 2QVSE 5ETFA 3R7GA 3CXWA 3O8UA 5CEOA 3ORLA 5DN3A 1FVTA 1PW2A 1ZAOA 2A1AB 4JJRA 5C03A 2XNGA 4UWBA 2KTYA 4ANLA 3VUHA 2ZMDA 4AU8A 3EH9A 3NAXA 4PTCA 4IFGA 3GENA 2UZBA 3PVGA 3MA3A 4BBFA 3DDPA 3ZSGA 3VNTA 4XG6A 4LOQA 5AV3A 4DGNA 4GIIA 3CEKA 3FKOA 4NKSA 3LXLA 3EQRA 4FG9A 2GS6A 4TYJA 5CF6A 3PG1A 1P5EA 4BCMA 2HZ4A 3FLSA 3W2RA 1BUHA 3Q6WA 2X6EA 3CPBA 1AD5A 4RJ7A 4ASZA 2IZRA 4O91A 5FXRA 4JBVA 3RBWA 4G5PA 4FTKA 1XKKA 5DT4A 3O50A 4L3PA 4NFMA 3D0EA 3UO4A 3OTUA 2QCSA 4R3CA 4BVUA 2EVAA 1ATPE 3QWKA 2ITUA 5CNNA 4MNFA 4MQ1A 4CD0A 5IQBA 4YZ9A 3I7CA 4X6QC 3PVUA 4CLJA 4XLIA 3SOCA 3MPTA 4BHNA 3A60A 4RIYB 3FZ1A 3OXIA 4FG7A 5KMNA 2VTMA 5E8VA 4IQ6A 2XK6A 3E7OA 3KF7A 3BCEA 3OT8A 2WIPA 4KS7A 4WRGA 4XMOA 1P2AA 4AN9A 2YM5A 2BFYA 4BKYA 4PDPA 3LFAA 3TNQB 3DU8A 4ANQA 3QQJA 4FTAA 3ULIA 4K6ZA 2CKPA 4YC8A 3PIZA 5CF5A 4YTIA 5JQ5A 4G2FA 1Y6AA 3GUBA 5M51A 1ZYLA 3R0TA 5AV4A 3BHTA 4CT2A 1UU8A 4HYUA 3I6UA 3MVHA 2IG7A 3LFFA 2GQSA 3D2IA 5LMAA 2PU8A 3THBA 4XEYA 4X2FA 4FSWA 2P33A 2GHLA 4G9CA 3ZRKA 2ZV2A 3UJGA 3RK9A 3U51A 3K5UA 4TN6A 4YZBA 3AMYA 4IH8A 5EFQA 4WNMA 2R64A 4WO5A 3R8ZA 3TJCA 4Y85A 5FXQA 2EXEA 3HECA 5HKMA 3ZM4A 3CPCA 2GNFA 2JLDA 4HYSA 4C61A 3AMAA 5HVYA 3PY0A 1OL1A 4RIWA 4TL0A 1PY5A 3R73A 3OEZA 2JBPA 4EH8A 3L1SA 2B9HA 4FIJA 4J1RA 4WNOA 4AW0A 5E92A 3KULB 3UYTA 3E63A 4CFNA 5HNBA 3HKOA 2V62A 3QYZA 1T46A 3CJFA 3V6SA 2PMLX 2XKDA 4F1OA 4RT7A 4DBXA 2JC6A 3UTOA 3ZCLA 5J5TA 4LOPA 2WELA 4C2VA 2Z7SA 3CTJA 4IIRA 4I6HA 3VW8A 2OFUA 4WG3A 1ZWSA 2IO6A 4WNKA 2XJ2A 1VEBA 2W4KA 3HMNA 4FI1A 1QPJA 2QOOA 3V3VA 4B9DA 3A4PA 1NT2A 2RIOA 4GFGA 2XMYA 3LCSA 1PXIA 3DBQA 4ONAA 4BCHA 3VQUA 3VBXA 4O7NA 1H0WA 4LOOA 2OIBA 4I5PA 4EOPA 4L7FA 3AD6A 1KE6A 2BDJA 3LMGA 4M12A 3L9PA 3HA6A 4DFZE 3WIKA 4RWLA 4W8EA 1QL6A 2FUMA 3D83A 2R3GA 5A4CA 3H3CA 4WG4A 2NRYA 4Q9SA 3FUPA 2Z7QA 2GDOA 2VO7A 3LKMA 3OHTA 5B2MA 2C4GA 4L52A 2E9VA 4L53A 3MS9A 3GGFA 4DYMA 3VUTA 1B38A 4ZS4A 4FV9A 2W1ZA 3UYSA 4Z16A 4TYEA 3AC8A 4Q5EA 4DGOA 5I9VA 2B0QA 4YSJA 1CDKA 1OI9A 1GOLA 3IOKA 4D28A 3O71A 4ANMA 2HZNA 3F82A 4DAWA 5ANIA 3POZA 5AX9A 4HNIA 4EONA 1GAGA 2OJIA 1P4OA 3OVVA 4G3DA 5EQYA 3Q2MA 2VO0A 3GNIB 3EJ1A 4JQEA 1Q61A 4BKZA 3DLZA 3DXNA 2C6DA 3MH0A 5EYCA 3WE8A 1BX6A 3UNJA 1V0OA 1J7LA 5M06A 3QRKA 2YM4A 5CQUA 3C0GA 2C5NA 4KKHA 3F3UA 2RG6A 1W83A 3EFKA 3R1QA 4KKGA 2R0IA 4JVGA 5J9LA 2IPXA 4BIEA 5L8LA 2XIZA 3VBQA 3HLLA 3CLYA 4NH1A 4ZEGA 4YJVA 4ASDA 3Q9XA 3UVPA 4KWPA 2PUNA 4M69B 2UW5A 4GRBA 4H3BA 5HD7A 5TO8A 2YAAA 4FT9A 3R8PA 2PZPA 2VTIA 2GNIA 3UNKA 1XBBA 3EKKA 3MY5A 4FSQA 4U42A 5D41A 3REPA 4A9TA 3EIDA 1SYKA 2QHMA 2EXCX 4QMVA 4O1PA 2W9ZB 3QTQA 4F0FA 3FXZA 3A4OX 5CQWA 4NFNA 4YTCA 5AV1A 4XG3A 3L9MA 4WD5A 4PY1A 2CDZA 3H9FA 2YFXA 5AR3A 3FBVA 1PXKA 3S4QA 3UG1A 4CZTA 1SNUA 4FGRA 4RFZA 3VN9A 2HWPA 4BZDA 5K4IA 3GBZA 2X9FA 5TKDA 4PPAA 4JL9A 3U55A 4QP2A 3C0IA 4YJNA 4AZTA 2FO0A 4XCUA 1BMKA 3ZO2A 4ZTMA 2GQRA 2OG8A 2XK7A 3NUXA 3VS3A 4FL3A 5A6OA 4CQGA 5E8WA 1M52A 4RJ6A 4WBBB 2I0HA 3R7OA 4V04A 3R83A 4D0WA 4DEEA 2PZYA 4GIHA 4CZYB 1MRUA 5M4FA 1YXTA 4TT7A 1H28A 3SRVB 4NM7A 4AOJA 3PXZA 4V0GB 4IX5A 4QQCA 4S33A 5CAOA 3LFCA 5F9EA 4FTMA 3T3UA 1URCA 3G90X 3AXWA 2A0CX 5CVGA 4FKJA 4C38A 4C37A 3ZSHA 4D2VA 1MP8A 5KMLA 3OBGA 4JBOA 4KRCA 4K0YA 4MF0A 3RAWA 5HBJA 3FMHA 2YJRA 5DE2A 4QPMA 4PPCA 3GCPA 4RC4A 4F70A 4FNYA 3LFBA 2YERA 3COKA 1WVXA 3EN9A 1BL6A 4E4XA 3LLAA 1Y8GA 5EYKA 2WTJA 3AOXA 4JRVA 4DGMA 2NNWB 3RPYA 5CEIA 5B2LA 3QZIA 2BRHA 5K4JA 2OBJA 2OWBA 2UW4A 4F7NA 1XO2B 3KK8A 2J6MA 4W4WA 2GMXA 2H34A 2ITTA 2J2IB 4YO6A 4IADA 4QYFA 5FLFA 4ZMEA 1V1KA 4RG0A 2RKUA 3ZC6A 4GH2A 1JBPE 3Q32A 5LQFA 5AUXA 5E8TA 1H24A 2IN6A 3D7TB 3FC1X 3MVLA 4W4VA 4UXQA 2VTLA 1QCFA 4S31A 2XRUA 4GK3A 1WBNA 1X8BA 3CE3A 4ZJIA 3DS6A 1AGWA 2HELA 4DTAA 4OT6A 5EDRA 1M14A 2PMNX 4ANOA 4AGDA 2YA9A 3K54A 5ANDA 3OROA 3ZMMA 2G1TA 1QPDA 4DG3E 4C4GA 5HE0A 5I9YA 4NUSA 1TQPA 1CTPE 2UV2A 4FVRA 4EZ7A 5CAVA 4OTGA 3UIMA 3PXYA 5EHOA 4GU6A 3TDVA 3E8CA 5HG9A 5CF8A 4BTKA 4GKHA 5A46A 1JSTA 2OJFE 4PMPA 4CCUA 3AC3A 3FY0A 3R9HA 3COMA 2YITA 4HZSA 5IA3A 4MF1A 2VWVA 4YR8A 5GZ8A 2VTOA 3DV3A 3PZEA 3ZZEA 3QRJA 4TNDA 2PZ5A 2QOHA 4FV2A 4JBPA 3UP2A 4YZDA 4BBMA 3CR0A 5CVHA 3KKVA 4UZHA 1WVWA 5L6PA 3LFSA 2B53A 4UX9A 4BR3A 3FMLA 3EL8A 3DNEA 1H01A 4LYNA 1Q5KA 4YGAA 3W2SA 2ZVAA 3DT1A 1OKWA
chains in the Genus database with same CATH superfamily
4MEDA 3GI3A 2BCJA 4PUZA 3Q4TA 3L9NA 3PWDA 2QU6A 3TKHA 3V5TA 4FTUA 4DF3A 2B1PA 3DK7A 5M4UA 2EXMA 2Y9QA 1UNGA 2YABA 2WMSA 4XG7A 4WBOA 5CASA 3MB6A 5AP4A 2C6IA 3PP0A 5EQPA 4KB8A 3KMUA 5HX6A 5L8KA 3R9OA 4ANNA 5HORA 4FVQA 5LVNA 3MV5A 2F9GA 1IEPA 4WRSA 4DFYA 2QG7A 3V8SA 5JRSA 3MFUA 3F5XA 4MBIA 3DBEA 3BGZA 4QMSA 1KWPA 3RHXA 3ROCA 4FJVA 3FE3A 3GC9A 2B9JA 2H9VA 4RWJA 3QWJA 4BZNA 2BKKA 3PPJA 3AG9A 2Y4IB 4I6LA 5CSWA 1H07A 3D2KA 1ERKA 1W84A 4BIDA 3NIZA 5EI8A 2OW3A 3R02A 1IG1A 4EOQA 2WTWA 3MY0A 2I40A 3HYHA 2XM9A 2GTNA 2R3OA 3FMDA 3IW7A 4KNBA 5AV2A 2Y4IC 4G3EA 2Y6OA 4AXAA 4JOAA 3LMHA 4EC8A 3ROYA 1IAHA 4GG5A 4O4EA 2VGPA 3M2WA 3MH1A 4AACA 1Q8UA 4MNEB 4JQ8A 5F94A 4ZXTA 3R9DA 2B54A 2UW8A 1W82A 3GCUA 4QP6A 1KV2A 1J7IA 3MN3A 4YUQA 3U54A 3NLBA 3C51A 4QRCA 1YXUA 4IW0A 4KBCA 3LQ5A 1WVYA 4GSBA 1W2DA 2CMWA 4FZAB 4NW6A 4U44A 3R7EA 1ZYDA 2VWXA 1Q97A 2UZWE 3QRTA 4JR7A 4QMZA 3GQIA 4ZAUA 2WMQA 2XNBA 4HPUE 3ZHPC 4R3PA 5A4EA 4FSTA 1M7QA 1SVGA 2JKQA 3DTCA 3ZONA 4CKRA 3PWYA 3HDMA 4XG9A 1YOLA 2GNHA 4FIHA 4IX6A 5KKRB 4HYHA 3QX4A 4G3CA 4YNEA 3O8TA 3ZO3A 4D9TA 3IKAA 4RA5A 5BQ0A 5L2SA 3Q3BA 4U80A 3R1SA 4NWMA 4O0YA 2HOGA 1YVJA 2YDKA 2OF2A 4B8MA 4EOSA 1NVQA 3FV8A 4L8MA 3MFRA 4I23A 3WF5A 4I0TA 2C69A 3HVCA 1Q62A 4G3GA 4M66A 4FIFA 5CZIA 5AUZA 5JFSA 4FVPA 3UQFA 3W33A 2O2UA 4BDJA 2CGUA 4FKTA 4X21A 5KO1A 4FL2A 4U8ZA 4F6SA 2XIKA 1UKIA 4AGCA 4WG5A 5C9CA 5ANOA 4YTHA 1E1XA 1OIRA 5C8KA 3SA0A 1YRPA 4GKIA 2ONLA 3AGLA 5L4QA 3BU6A 3CBLA 3FSFA 2ZM3A 4QT1A 4U41A 5H3QA 1CMKE 3MPAA 5L2TA 2JGZA 4HOKA 2V22A 2XNPA 1G3NA 1H4LA 1XJDA 4FK6A 4L3LA 4D4RA 3BL9A 5IA2A 4M8TA 4H1JA 3ET7A 4K1BA 1KE8A 2QNJA 3VUMA 4DA5A 3D4QA 2B9IA 4A4LA 4MTAA 4YP8A 3FI2A 3ALNA 3C4CA 4H3QA 4AG8A 3NCGA 3SKCA 4D4SA 3FLZA 3IW8A 2AUHA 4DEBA 4A06A 4QTCA 4JQ7A 4JXFA 1XQZA 5TOZA 4PDOA 2WQMA 4P2KA 4MVFA 5CEPA 1IASA 1ZMWA 3G6HA 3Q4UA 5DG5A 4AW2A 4RX7A 3BPRA 3EQPA 2XP2A 3F66A 3W10A 2W17A 3G51A 3R7VA 3W2QA 3IDBA 4MH7A 5AUWA 1WAKA 3HP2A 4OTPA 5AUUA 4FYNA 4CFVA 4KKEA 3PPKA 5M4IA 3QZGA 3TNWA 4FT3A 2HIWA 1XBCA 3BYVA 3JR1A 1UV5A 4JRNA 3GU6A 1XR1A 3QX2A 4QMYA 5CYIA 2O63A 4BBEA 4F9YA 5M57A 5LVOA 4D2PA 5BVNA 3QHWA 3NRMA 3MVMA 3PVBA 4YHTA 2WMVA 1Y57A 5CAPA 1YI6A 5D9HA 1MQ4A 4AOIA 4QPAA 5AP7A 2ZM4A 4XG4A 2VTTA 4FKQA 3CJGA 2I1MA 5HO6A 4O7VA 3UO6A 4O81A 3ODZX 3JYAA 4KA3A 3TG1A 3RKBA 4AA5A 3VS1A 3W2PA 3NUAA 3A61A 5JMSA 4DEAA 3OCGA 2YWPA 4I6BA 4J7BA 3EHAA 4RJ8A 4D55A 4EH9A 4QOXA 4DTKA 4BIBA 3CTHA 4AW1A 4E26A 3TNIA 3C4XA 1R1WA 3IDCA 2XYNA 4CFXA 3H10A 5K5XA 4XV1A 4C02A 3IW5A 4AT5A 3NW5A 4Z7HA 4EJNA 3FZRA 1OMWA 2QOIA 2XK3A 4OTIA 2JIIA 4FBXA 4RVMA 3P1AA 4H58A 5FBNC 3QD4A 4ACDA 2OZAB 4C34A 4BY9E 3VS5A 3EQFA 3F7WA 4J8MA 2RFDA 4RX8A 4LDTA 4C7TA 4FTCA 4OBPA 5FQDC 5HVJA 3W18A 5JRQA 3QGWA 4K77A 1GIIA 5FTQA 2X2MA 2W4OA 2PPQA 3RNIA 1H1QA 2BVAA 2OJGA 5BPYA 4GJ3A 4NM5A 3CSVA 2IVVA 3PA5A 4LG4A 3VWAA 1JOWB 4IM3A 3FLNC 3LMIA 2O0UA 3ANQA 2Q0NA 1FBNA 3FMJA 1JLUE 1W0XC 2I0EA 4ARKA 2PVMA 4MK0A 2A27A 4CG9A 2AC5A 2IW8A 3U6HA 4WA9A 3UDSA 4WHZA 3R00A 3IW4A 1OVEA 4I6QA 4G9RA 4LRJA 4DH5A 2O3PA 5AADA 3ALOA 2CKQA 5E91A 3NNXA 5AA8A 4FZ7A 1K9AA 5TE0A 2VWWA 3QTSA 1Z57A 4GMYA 3PUFC 4NJDA 4OTDA 2X2LA 3PPZA 2W5HA 4FSYA 4I5MA 2XNEA 4DFBA 3LCDA 1AQ1A 1FGKA 2OFVA 3OD6X 1R78A 4FKRA 1ZZ2A 3A62A 3A2CA 3I5NA 4JIAA 4PWNA 5GHVA 1F3MC 4EOKA 5J79A 3JY9A 3EN7A 2HYYA 4H1MA 3ZLSA 4BCJA 3BU3A 3UO5A 2B55A 3F88A 5FTGA 5J1VA 2OU7A 4WSQA 5CTPA 4CTCA 1GZOA 1JSVA 2ZYBA 4DITA 4E93A 3VBYA 4FF8A 3QQHA 4CYIA 4EHZA 2E9UA 4RGJA 1LUFA 4LUDA 4G3FA 4IWOA 4ENXA 1PRYA 1ZYCA 4PL3A 4XV9A 5IISA 3S2PA 3CKXA 3NUSA 3QU0A 4YJRA 4B99A 3BRBA 3CD3A 2OXXA 4BI0A 3R63A 5HE1A 3DBCA 3AD4A 3NDMA 3PY1A 4JG8A 2HK5A 4X3FB 1U46A 1WBPA 4KAOA 5GJGA 5D10A 2QR8A 1PMVA 5TR6A 4BYIA 4ERWA 5LMKC 4QTEA 3HX4A 3LFEA 4O0VA 4ZS0A 4B0GA 4WUAA 3OS3A 4X3FC 1H25A 3FJQE 1YXXA 3GCQA 4UMPA 5A4QA 4EHGA 4DCAA 1H1PA 2UZEA 5D1JA 3OCBA 3HRFA 4PP9A 4FSUA 3V6RA 2CNVA 4DT9A 3FQEA 3NNVA 4ZTQA 2IZUA 3NYXA 4L44A 4PQNA 5AAGA 4FTJA 3MTFA 5AR8A 5IZFA 3CY3A 2PHKA 3BYMA 3BI6A 3DFCB 4O27B 4RC3A 4UMTA 4DBNA 4GVAA 4P5QA 4CT1A 1EH4A 3ULZA 4FV3A 4UXLA 4USFA 4FT7A 3S1HA 4I22A 2CCIA 3KN6A 4OTWA 3TEIA 4E3CA 2XALA 1OKYA 1GZ8A 4XP2A 4ALVA 1OGUA 3G0EA 5HBEA 3RCDA 4GT3A 4QDVA 4W9XA 5EG3A 1Q3DA 2RL5A 2XEYA 3P23A 3HGKA 5JFWA 4AS0A 2IVTA 2WEVA 3TTJA 2NRUA 2ITVA 1XHAA 2Z2WA 4K18A 3TV4A 2YEXA 2HWOA 4HVDA 2BRBA 2X0PA 3OT3A 1GNGA 4FOBA 2YISA 4P7EA 4XS2A 3B8QA 4FTQA 5E8ZA 5DI1A 5IH6A 5HX8A 3PJ2A 3W55A 5AEPA 2JKOA 3P0MA 4XG2A 3BHHA 5A4TA 4I41A 4F1TA 4DC2A 3FL5A 3QYWA 5C26A 2P0CA 4EBWA 4D2TA 5I9WA 3L8SA 1XBAA 2IZTA 3PTGA 4X6RA 4MCVA 4RIWB 3TKIA 4W4XA 3OXZA 5HHWA 3ATSA 3VBTA 4OTQA 4I94A 4IC7A 4RFMA 4RZVA 4YC3A 5M09A 4ZP5A 5HIBA 3ZUTA 2XS0A 5CEMA 4LV8A 2IJMA 3RWPA 2C30A 4K8AA 1OBDA 3V5WA 2UW9A 5BYLA 1OUYA 3QTIA 4NK9A 4EQMA 3I60A 5DRDA 3ZDUA 2UW0A 4L67A 1UU9A 4HVSA 3BWFA 4HCTA 2G2HA 3E8NA 4XNEA 2OH4A 4ZZNA 4PDSA 3MY1A 4XRJA 3EWHA 5H8GA 4BKJA 3MW1A 4MBLA 4ZY5A 4ZTRA 4BCGA 3UMWA 3SXFA 3PY3A 2EU9A 2XNOA 3BV2A 3WF6A 2C3LA 2ZM1A 3SOAA 4EHVA 5IQFA 4AAYA 5HOAA 5JKGA 4F9CA 1OL7A 4BTMA 4TRLA 4QMUA 3RMFA 1W8CA 2VZ6A 5ANJA 3DJ7A 4B8LA 4PTEA 4RVKA 2WTIA 2W1FA 3D5UA 3U87A 3OBJA 5LMKA 4F09A 3K5VA 3ORPA 4OR5A 4JI9A 3NYVA 3NYOA 4GUEA 4YJOA 4ZTLA 5KUPA 5C8MA 4E6DA 4BL1A 5AX3A 3DBFA 5LVLA 2DS1A 5AP6A 1VJYA 4EBVA 4KS8A 5E90A 1ZYSA 2F7XE 4EK5A 5EKNA 5FEEA 3CQEA 3CC6A 3DAEA 2PMOX 3KXXA 4GYIA 2FSLX 4QYYA 5EK7A 2PY3A 2P55A 3F3WA 4GCJA 4M7IA 4RLKA 4JAJA 3HMMA 5HVKA 4AZEA 5I0BA 4Z55A 2C6MA 3ZFMA 3SQQA 4EYMA 1SM2A 4FTNA 3EYGA 4QMQA 3SLSA 4YPSA 3VQHA 2VX0A 4DG2E 5KMKA 4YHFA 3BBTB 2XB7A 4IEBA 3H9OA 4BRXA 3DB6A 2YLFA 3E8DA 5A9UA 3QUEA 4FKIA 4U79A 4EQCA 4PDYA 3I6WA 2WU6A 1STCE 5AAFA 3SX9A 2WNTA 2VWZA 3ZBFA 4RX5A 4I92A 4IWQA 4NKAA 4X7QA 5CSXA 1UU3A 1BL7A 2XBJA 4J52A 4BI1A 3VUGA 5JH6A 3Q2JA 3TM0A 1Q4LA 3BX5A 2JFLA 2WMBA 3C50A 3EL7A 3PSCA 3N4VA 4CZUA 4M15A 3O23A 4UY9A 4BC6A 5LJJA 3GC8A 1ZYJA 3LE6A 4R5YA 4XBUA 5FWKK 3TNHA 3LCKA 3GT8A 4FNWA 2C6OA 2WMTA 1M17A 3CTQA 3JY0A 3M11A 3O8PA 3T9IA 4YMJA 1OKZA 1S9IA 2J0IA 3E5AA 3QTXA 4NJ3A 4ZZMA 2WXVA 3NEWA 4V05A 4CV9A 5JN2A 3GCVA 5H8BA 4RZWA 3W2CA 1QPEA 2CSNA 3LJ1A 4F4PA 4TY1A 3FSKA 4IB5A 4KINA 3PJ8A 5CXHA 3NFGB 2X0GA 3HA8A 5EM5A 5ETIA 3MTLA 3ORKA 4MD7E 2XA4A 3SAYA 4C3PA 5AP5A 4BDIA 5KHWA 1JKTA 3OW4A 4IVCA 2J0MB 2P2IA 1HOWA 4RX9A 3W0PA 2C5VA 4BDGA 2CKEA 2DWBA 2JKKA 2QODA 3FMNA 3BGPA 3P86A 5HBHA 3QCSA 3R8UA 3T3VA 3BHVA 4KBKA 3QCYA 4OAVB 5IKWA 3EFLA 5DR9A 5FXSA 1Y6BA 2W99B 3SXSA 4DLJA 4AN2A 4FSZA 1ZZLA 3GVUA 4TKSA 4YSMA 4C3RA 3C4WA 1APME 3ANRA 2EB2A 2WEIA 3PA4A 1Y91A 2ZMCA 4FTRA 4IJPA 4J97A 3RVGA 4EJ7A 5IQDA 3JXWA 4MWIA 5AUYA 1MUOA 4L46A 3S0OA 3C5IA 4FKGA 5BYYA 3NVMB 4HVHA 3NUYA 4O82A 4U6RA 4RWKA 2BZHB 5IH5A 3NFFB 3QD2B 3EKNA 1NY3A 5M55A 5HGIA 3KGAA 4JR3A 4C4HA 5BVFA 1YHWA 1YW2A 3LFNA 3TV7A 1Q24A 4FC0A 5IEVA 4FSMA 4FV0A 5CEQA 2YN8A 3COHA 4O7WA 3TZ7A 1U5QA 4C4IA 5CANA 5CF4A 3FMMA 5KMMA 3MDYA 4PL5A 4CEGA 5EM7A 3OG7A 4DHFA 2W1HA 4LUEA 2Z7LA 2QO7A 3LFDA 3VRZA 4ANSA 3I0OA 4YURA 2J5EA 2A2AA 3VO3A 2XK4A 1Q8YA 3EMGA 3MA6A 4IAAA 4BDDA 1YDSE 1H0VA 5F20A 1GJOA 4ALUA 3QTUA 3FHRA 4LV7A 4DT8A 4HCUA 2WQEA 3QRUA 4R77A 3QGYA 2BZIB 2W06A 3RZFA 4Z7GA 1PXPA 5JFXA 3DQWA 4O1OA 3G6GA 3DY7A 3OTVA 4RSSA 5GZAA 3ERKA 3E92A 3TI1A 4C4JA 4XH6A 2P2HA 2R3RA 4PMMA 2BMCA 4PRJA 4Q5HA 4APPA 4DEIA 2JDOA 4O0TA 2YZAA 5IA4A 5HCXA 4AT3A 4MXYA 4DG0E 1PF8A 1HCLA 2V7AA 3PJ3A 3PXRA 4AGWA 4E8AA 4DFUA 4O38A 4ITIA 5I4NA 4RPVA 5DWRA 2I6LA 3R7UA 4YZCA 4ZLYA 1G8SA 2WTVA 3AC2A 1UNHA 2XK9A 4IANA 3ELJA 4ACHA 3C4EA 1W7HA 3JVRA 3BBWA 4AZSA 2PUUA 2C6TA 4YJTA 5HU9A 3EQIA 4I6FA 5EDPA 5HG7A 5E4HA 4IC8A 4C33A 2JIVA 2BAQA 3GC7A 3KVXA 3SV0A 4E4LA 3UOJA 3QZFA 2CCHA 4HVIA 2YWVA 1H1SA 4I1ZA 4EEVA 4FOCA 3QQUA 4EWHA 3JS2A 4BYJA 2VNYA 3D9VA 4J71A 3LXKA 2JFMA 3DLSA 3HP5A 4AAAA 4RLLA 3RM6A 3TL8A 1P4FA 2OI4X 4PX6A 5JGBA 2XVDA 3HV7A 3NWWA 5BMMA 3SW4A 4AA4A 2ZB0A 4E7WA 3TZ9A 5BUEA 2XUUA 3QFVA 4I3ZA 5A54A 2WMRA 3TWJA 3GP0A 1KV1A 3LCOA 5GINE 4LFIA 1PXNA 1Z9XA 3MH3A 5ACKA 4IACA 3UZTA 5HCZA 4OAUC 4C2WA 3PVWA 3IW6A 3A8WA 4G6LA 2PYWA 2YDIA 2WTCA 1K3AA 4EH6A 4AE9A 5C01A 1V0BA 5IU2A 1OL5A 4OLIA 1MQBA 3WZKA 5LXMA 3KA0A 3KB7A 3LVPA 4FKOA 4R78A 3QTZA 4HNFA 4BCPA 2UZUE 3EQGA 3VW6A 1T45A 3VVHA 4IAKA 5ETAA 2VWBA 5IA5A 4XV3A 5C4LA 3FZOA 1O6LA 5DNRA 3DQXA 2PE2A 3PG3A 3RWQA 4ZZOA 2VX3A 4GT4A 4ACMA 3HEGA 5I3RA 4F9WA 1SMHA 3EB0A 3UDBA 4RQKA 4FA2A 4LGGA 1L8TA 4UB7A 3UODA 4F99A 4CMOA 2Z60A 3O96A 3E87A 2HENA 3ZM9A 3OWKA 2V55A 4IB3A 2ITOA 4GJ2A 4QMPA 4EKKA 4RIOA 1J1CA 3NAYA 4R1VA 2GCDA 3GU8A 5BNJA 2OGVA 5KZIA 4F7LA 3BKBA 1OPKA 2QR7A 2VWIA 3LFQA 4E6QA 4MQ2A 4DFNA 3CGFA 3FQHA 2W9FB 3IGOA 4ZSGA 4BFMA 3H30A 1Z5MA 5KX8A 1R0EA 5EW8A 4W9WA 1OL6A 1A06A 2XCKA 4CKJA 3W32A 5FGKA 4YBJA 3ZFYA 4IAYA 5CU3A 3AC1A 4P90A 5CZHA 4O6LA 2BALA 2R3QA 3TTIA 3C1XA 2R3HA 1MRVA 2ZB1A 3UE4A 3FKNA 2J90A 5J1WA 4A9SA 3A8XA 1ZOEA 5B2KA 2ZDTA 3P9JA 4EOMA 4JT3A 5J5SA 1KE9A 4QMXA 5CU6A 4AW5A 2GQGA 4YZMA 3VJNA 5L3AA 2OF4A 2DQ7X 2QD9A 4DHJA 3DK6A 2WB8A 3A7FA 1YDRE 2ZJWA 3P7AA 3DAKA 2WAJA 1FINA 4NT4A 3A7JA 5HTCA 5HG8A 4F1MA 5L2IA 3D5XA 4GK2A 3RI1A 5J9YA 5FDXA 5T68A 4UWCA 2W1DA 2ZOQA 4PTGA 4EKLA 4IMYA 1JSUA 3IS5A 2ERZE 4GVJA 4U3ZA 5JGAA 1O6KA 1UWJA 1P14A 2CKOA 2C3JA 1YHSA 4WT6A 4V0GA 5ITAA 1ZMVA 3KXZA 4C4FA 3Q6UA 5KBRA 4ERKA 1A9UA 5ETCA 3QKMA 3KK9A 5CT7A 5AIRA 5DA3A 4E5AX 4JDKA 4MBJA 3R04A 4QQJA 5LWMA 4I5CA 1VZOA 1FVRA 2JIUA 5LCKA 5IQAA 1RW8A 4E20A 2HCKA 4NL0A 2AYPA 3F6XA 3PE1A 5HLWA 3BV3A 2JDVA 4Y72A 2YZLA 1PHKA 3CD8A 1FMOE 3MH2A 3KMMA 2X8EA 3EN5A 3BLHA 4Y46A 5J8IA 2ERKA 3VIDA 4QMNA 4RFYA 2F2CB 2NYAA 4W8DA 1H8FA 1JWHA 3FAAA 1RDQE 4F0IA 5HZNA 4Z9LA 3BLQA 3PSDA 4FKPA 2OZOA 2X81A 2UW3A 2YIXA 2QO2A 3TUDA 3UPZA 1XH9A 2ETMA 4WOVA 2PWLA 4D2SA 1PXJA 3HZTA 3RPRA 4L3JA 4G16A 4XG8A 5CU2A 2GS7A 3RPOA 2UUEA 4FK3A 3ENHA 5DH3A 3C7QA 3LCTA 3DKFA 3NNWA 2OIQA 3CIKA 3POOA 3CS9A 4IX3A 4QP8A 2QC6A 3AD5A 4TW9A 4H05A 2YACA 1YDTE 4HGEA 4L45A 4FSRA 3RJCA 5BUJA 2OIDA 2YM7A 1YWVA 2ITNA 4O2ZA 2HZIA 4NIFA 5IUGA 4OUCA 4EH7A 2I0VA 3CY2A 4TYHB 4B6LA 1VR2A 4FT5A 4IM0A 4GW8A 3LM0A 4CFMA 3QCQA 2X8IA 5M08A 4IB1A 5KKRC 4N0SA 3R1YA 3QUPA 1OIQA 3L8XA 4O7RA 3MBLA 5JZNA 3V01A 4X2GA 4O7ZA 1RQQA 3I7BA 3OCTA 4UEUA 4F63A 3VF8A 1H27A 5DR6A 1WBSA 2QOKA 2Z7RA 1RJBA 3VC4A 2VV9A 4RIXA 3WZEA 2DUVA 3I79A 3P79A 2R5TA 3QA0A 4IZYA 5M4CA 5IQEA 4WKQA 2XK8A 2Y4PA 3TT0A 4JDHA 3FMEA 1YOJA 4GUBA 1YWRA 1RE8A 2A98A 2CPKE 2EB3A 3LPBA 5IF1A 2C3IB 4O4BB 4FEQA 4AF3A 5ANGA 1SNXA 5I5ZA 3BQRA 4DGGA 5AP0A 5AP1A 2X7GA 3LM5A 4E6AA 3CGOA 2I0YA 3FWQA 5ANKA 4L6QA 2WMUA 4BICA 3DCVA 5E8YA 4DTBA 3NGAA 3OWJA 3DNDA 5KHXA 4BDCA 3MSSA 3MFTA 4ACGA 3TDWA 5F1ZA 3TV6A 5IQHA 4QMLA 1REJA 3IG7A 3RPVA 4FIEA 4BB4A 5IMEA 4F6WA 3WYXA 4KIPA 2QI8A 3KVWA 3WZDA 5CENA 1I09A 3C4FA 3RNYA 3R8VA 3U4WA 3GU7A 5L2WA 3ZBXA 4L00A 4JX7A 3DJ5A 3BELA 1OECA 3OCSA 1H1RA 2CN5A 3VUIA 5HU3A 4J53A 4JLCA 1QPCA 2PVFA 2XNMA 1WBVA 4YNOA 4FKWA 3BLAA 4KIKA 4A4XA 4H39A 4ASXA 3O7LD 4FKLA 3NR9A 3BHYA 3DXPA 3PDTA 4AXEA 5HE2A 3ZH8A 4IVAA 1CKIA 3MVJA 4QD6A 2YCQA 5HNIX 2VTHA 4UV0A 4G6NA 3IDPA 1PYEA 4D5KA 3OZ6A 4X0MA 1OPLA 4AQKA 4E73A 3S3IA 3PJ1A 3PIYA 4QP7A 2FA2A 2YCSA 1YQJA 3ETAA 3F5PA 4U9AA 4E1ZA 2BDWA 3ATTA 3G15A 2UZOA 1PXLA 4U40A 3DKOA 2J4ZA 4QMWA 3O2MA 4EZ5A 2W96B 2WOTA 2X6DA 4YBKA 3P5JC 2GHMA 4W4YA 5EM8A 2ZDUA 5T6KA 2VTNA 4DINA 5IQCA 5CXZA 5C1QB 3RCJA 4FYOA 4PPBA 3SDJA 1JPAA 2XIRA 3R71A 4O0XA 2AQXA 4Y83A 2XEZA 5LOHA 2V5QA 4JX3A 3ZSIA 3BWJA 5L6OA 2UZLA 4GK4A 3W0MA 4HGTA 2ITWA 2FVDA 2WO6A 3W2OA 1G8AA 3UQCA 2GU8A 3Q5ZA 1FQ1B 2QONA 4S32A 4BDBA 1GZNA 2WQBA 4O83A 4NTTA 5HD4A 2NPQA 2O8YA 3FC2A 3U9NA 3UOLA 3NVKI 2R7BA 4BN1A 3UZPA 5EW3A 1W2CA 5E1EA 5J95A 3RZBA 5FP6A 3NPCA 4ZOGA 2HY0A 2XJ1A 5K0KA 2BTRA 3W0QA 2CGXA 4BCQA 4ITHA 5DGZA 2PZIA 4BF2A 3DFAA 3R01A 5DOSA 5I9UA 4C0TA 1GY3A 5E8XA 2PVKA 4EH5A 4RMZA 3O51A 1BI8A 3QQKA 3UNZA 4IVBA 2AEGA 4IHPA 2FSMX 1OIYA 4LMNA 4BGHA 5A14A 3R8MA 4FV6A 2GPHA 4IDTA 2GSFA 2XIXA 5K0XA 2GNGA 5AUVA 2VGOA 3F2NA 3QQGA 3MESA 5ICPA 3WARA 4CMTA 3DKCA 3QF9A 5AFVA 2C5YA 3BYUA 5L2QA 3AKJA 4OT5A 3LIJA 3DA6A 1OPJA 1XWSA 4LGDA 5EYDA 1DAWA 3DAJA 2C6LA 4QMOA 2OJ9A 5EDQA 4AQCA 1YKRA 3MGYA 1OB3A 3GXLA 3DDQA 1OUKA 4B7TA 5EHLA 1PMNA 4O0RA 3UVQA 2E9NA 3BYSA 5AV0A 4G34A 3UGCA 4AZVA 5FEQA 4CRLA 3F7ZA 3S95A 4D1XA 4F9BA 5E1SA 2ETKA 4YJPA 4II5A 4I21A 1PMEA 4IB0A 4YJSA 1ZXEA 3ZEWA 4FG8A 2CLQA 3LQ8A 4S30A 2A4LA 4ACCA 2PVHA 1E1VA 2OKRA 5LWNA 3RAKA 4R3RA 2PL0A 3R9NA 4RA4A 3UVRA 2FB8A 4C57A 2XCHA 3PSBA 4GL9A 5IMXA 4FEXA 3BIZA 4M14A 4EOOA 3EQHA 1CSNA 2G01A 3FYKX 4BTFA 2IW9A 4DCEA 4L68A 3R22A 2C6KA 3UOKA 5LVMA 4FICA 4DGLC 5M44A 3ORNA 4ZTSA 2XKFA 4QTBA 3UP7A 3IGGA 4FV8A 4GS6A 4FMQA 4I4FA 3UPXA 3Q9YA 3IOPA 5BV3A 5CEKA 3FHIA 5GIOE 4QNAA 4IWPA 3IQ7A 4DN5A 3RINA 1R0PA 4EUTA 3QAME 2OSCA 3TUBA 1SVHA 4PNIA 5AM7A 4D1ZA 5AM6A 3R7YA 2YHVA 2BIYA 1H00A 2B4SB 4N4SA 4QMTA 5HTBA 5KMOA 3PFQA 4NTSA 3K2LA 3E8EA 2R3MA 5DEWA 1PKGA 4J98A 4F0GA 1R39A 4RWIA 5G6VA 3I4BA 1Q8TA 2A19B 3KRLA 3ZRLA 3OW3A 2WHBA 5TT7A 4D58A 3MJ1A 4BJJB 4QNYA 3ZUVA 2JAVA 3SW7A 1KOBA 1GIJA 5IG1A 4JAIA 4QP9A 3WI6A 2VTSA 1YHVA 1KSWA 1ZY5A 4F7JA 1OBGA 1TVOA 4QMMA 4F7SA 4M67A 2WTDA 4AA0A 4DLIA 4X2NA 2CGWA 5CSPA 3MIAA 3TXOA 3CP9A 4X2KA 1SVEA 3UMXA 2WMAA 4TTHB 3TN8A 3RPSA 5BVDA 1R3CA 4EH3A 1SZMA 2WQNA 5HG5A 3V51A 4ANBA 4D0XA 2OXDA 2PTKA 2XIYA 3L8VA 2HW7A 4WNPA 5IDPA 2BZKB 3SGCA 2XAMA 3BE9A 1CKPA 2V7OA 4BCOA 3A99A 1O9UA 4EH2A 4I20A 2G9XA 3R2BA 5AP2A 1TQMA 2WKMA 2BRNA 2HXLA 3E88A 5F95A 5CI6A 4BCKA 1ZOGA 1CKJA 4CNHA 1XH6A 3BEAA 4U43A 4UYAA 5DPVA 4O7TA 2ZAZA 3FLYA 3QKKA 4EK8A 2ESMA 5D12A 2X1NA 5GZ9A 2J0JA 3VUKA 5LVPA 3QD0A 3ZUUA 1G8KA 3AQVA 4G6OA 3PLAE 1WZYA 3QQLA 4FTIA 4FZDB 4FTTA