4E6DA

Jak2 kinase (jh1 domain) triple mutant in complex with compound 7
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
293
structure length
286
Chain Sequence
DPTQFEERHLKFLRQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYNLKLIMEFLPYGSLREYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 286
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e6dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e6dA01
2OICA 2BR1A 5M09A 3RPYA 4EZ5A 4FTIA 4RWIA 4MCVA 2X4ZA 3COHA 3BLHA 3P79A 3QRKA 2R4BA 2XNOA 2OIQA 3RBWA 1NVSA 2UZEA 4IVCA 5IA5A 4YO4A 2RSVA 2XKCA 3PFQA 5LMKA 3MIAA 5B2KA 5AADA 3VUMA 1M2QA 5JQ5A 2BTSA 2YDJA 3NUUA 4AFEA 4YZBA 4DCEA 4NTSA 3R7YA 2B4SB 2VV9A 3BYUA 4KBAA 4AT5A 2GNGA 5KBQA 4AZSA 3I81A 3MY5A 3NZ0A 4UYNA 4ZZNA 5IQFA 3H0YA 3F9NA 3GQLA 4EZ3A 3NEWA 3E63A 4PPBA 1JSVA 4GU9A 1U5QA 2QOBA 2BZKB 4GCJA 4HZRA 2ZM3A 4MNFA 4XG8A 3EJ1A 4FZFB 3GU6A 4YLLA 1YDSE 4IB0A 4CFNA 3M1SA 4QPAA 3C0IA 3S4QA 3N4UA 2PZIA 3BLQA 4ANSA 3QFVA 1H4LA 3I5NA 5L3AA 4E93A 4GFMA 4PL3A 2FSTX 3RHXA 3MN3A 5IU2A 3QYWA 3PY1A 1H28A 3SG8A 4EOSA 4X3FB 2YAAA 4QMOA 4CZTA 4K33A 5K3YA 3MFSA 5BVFA 4GG7A 4BDCA 3ZC5A 3FLSA 3OG7A 3NVMB 3NDMA 2IG7A 2QR8A 2XK9A 3CQWA 1J3HA 3KN5A 4FKQA 3DS6A 2JFMA 3ZOSA 3EKNA 3ZU7A 4FVRA 3OXIA 4QNAA 3MI9A 4TXCA 5CT7A 4YJQA 4R3PA 4ONAA 1OL6A 1YXXA 3JUHA 3AOXA 3FMDA 4GIHA 3F3ZA 4Q9SA 4ZY5A 4O0RA 2WMBA 4IC8A 4YC8A 3QD2B 3LAUA 4UV0A 4CTBA 4NM5A 5ANGA 5EKOA 4RWJA 4BZNA 1OZ1A 2G2FA 3PA3A 4QP3A 4XJ0A 2WMXA 3MVHA 3AXWA 4XRLA 3ZCLA 5FTGA 3R9HA 4DEHA 4QQ5A 4LMUA 3F69A 4C38A 5CEOA 3HDMA 3KRLA 5HTIA 2NNWB 1TKIA 4M14A 3FQHA 5CQWA 4BB4A 4EQCA 4EUUA 4RSSA 4DTBA 3DZOA 2YM6A 3TNWA 2C4GA 3KL8A 5E8YA 4FG8A 3EZVA 4ORKA 2H34A 3CY3A 4CTCA 3GC0A 5HD4A 4U42A 2OK1A 3TKHA 4DEEA 1ZY5A 1U54A 4FOCA 2OLCA 4LV5A 4ITHA 5E1SA 4H1MA 3QXPA 3FZRA 5AIKA 4EHGA 3LIJA 4Y73A 3G5DA 4HOKA 3BV2A 2VO0A 1XJDA 3F66A 4KNBA 3QRIA 4XHKB 1IRKA 4FT7A 3O51A 3FY0A 4FTMA 5EYKA 2VWUA 3KREA 4DCAA 2OIDA 3FZPA 3VBWA 3DNEA 1F3MC 3HA6A 5A4QA 5KKRC 5L6PA 4BCQA 5L6WL 4BHZA 3BYMA 2V7OA 3NS9A 1F5QA 4HGEA 4UXLA 2RG5A 4DE4A 1REKA 4FMQA 5I5ZA 2HCKA 3DBFA 3UQGA 5LCJA 4ZXTA 3LM0A 3FAAA 5ETFA 5CEKA 3BE9A 3A60A 2I0VA 2Y6MA 4ZS0A 5M44A 4F9AA 4JQ8A 2VWVA 3RKBA 4BCGA 3FI4A 2PUIA 3CSVA 2IN6A 1W98A 3COKA 2FO0A 1IAJA 1YDTE 4NKSA 3D7ZA 3RPRA 3G33A 2BRNA 4A7CA 2XEYA 4QP7A 5HBEA 4TYIA 4YC6A 3QUPA 5CVFA 4N57A 4OAUC 1Q97A 3MW1A 2WMTA 3TTJA 3ENHA 4TW9A 4CV8A 3OUNB 3SA0A 4FSYA 5HLPA 1OPLA 2J5FA 3MA6A 4K8AA 1DI9A 5GZ9A 5T6KA 4IAIA 2XBJA 2YWPA 2WQEA 3NUNA 2Y0AA 3TIYA 3OT3A 3NYVA 3PE1A 3PRFA 5D9HA 3I1AA 4X2KA 3UMWA 3VF9A 1SYKA 4BICA 3VBVA 2CKQA 3U9CA 4ITJA 3EN9A 5ACKA 3CTHA 4NCTA 3CGOA 3VQUA 3FL5A 3FZTA 4AZTA 4FEWA 2ITOA 2UW6A 3U87A 2F57A 1U5RA 4RQVA 4RIXA 5HIBA 3V51A 4JAIA 1J1BA 2HY81 4S30A 3VQHA 3G9NA 4OTRA 2XH5A 1BI7A 3R28A 5BMMA 3VRYA 2ONLA 4F0FA 1GJOA 1R3CA 2WMRA 1WBWA 4WNMA 5LVNA 3HDNA 2PZYA 3C13A 5HG8A 3BELA 2XUUA 3HRFA 3ACJA 4NIFA 3EYGA 1OITA 1STCE 5IQBA 1J7LA 2VGOA 3EHAA 4D5HA 3D2IA 3VW6A 3GP0A 3PG1A 5A3XA 1ZARA 3HP5A 1KWPA 3CGFA 4IFCA 3ZONA 4DFXE 3UQCA 4HZSA 3R04A 4PTGA 4Y72A 1GZOA 1CTPE 4MD7E 5LMAA 3W2CA 3WF6A 4CSVA 3F2RA 1PXMA 3IQ7A 2EU9A 2R9SA 3O23A 1OIRA 3SW7A 3QXOA 3SXSA 4LMNA 5DPVA 3DJ7A 4V05A 3WZKA 3BHVA 3MFRA 4GKHA 3FBVA 5IUHA 4JRNA 3BQRA 3KK9A 5KMMA 4E6DA 3PVWA 3FMJA 2JIUA 4QP2A 4XP0A 2XIKA 3TUDA 3PWDA 4GK3A 4BI1A 1IASA 4QTBA 4R8QA 4ZSLA 4S32A 1U54B 2Z7SA 4F1MA 4EOIA 1TQPA 1V0OA 4FL1A 4NW6A 2YERA 5EM6A 4BZDA 3PJCA 3BGQA 3NUSA 1O6YA 4D28A 4DEIA 4IAAA 2UW4A 5DT0A 2VWZA 3G6GA 2PZ5A 3R1QA 5EQPA 2WD1A 3GC8A 1A9UA 4IWDA 2GHGA 2VTLA 4QMVA 5HVYA 3V5WA 4YO6A 2HIWA 4YURA 1OPKA 4D9TA 2YN8A 5BYZA 4CMOA 4L45A 4LUEA 4RJ7A 3R7GA 3R9NA 2BRMA 3VIDA 5M4IA 1PMUA 3GB2A 3RCDA 1ZZLA 3H0ZA 3R8UA 3NCZA 3DB8A 3TDWA 2VX1A 2W5BA 3AT2A 3PSDA 3QTZA 4M7IA 5E7RA 4EHZA 3HA8A 5HNBA 3FMEA 4O38A 1H0VA 4M66A 2OFUA 4NJ3A 1XBBA 2VX3A 2DYLA 4FSUA 4JT3A 2CPKE 2Q0BA 4EH8A 4ZJIA 5JH6A 3PVUA 5HE3A 4DG0E 2HXLA 3A99A 3VWAA 4L3JA 4DTAA 5GIOE 2EUFB 4G17A 3DK7A 4N6ZA 3ZC6A 3FXXA 4EH6A 3SKCA 2OGVA 5EI6A 4BWKA 1Q99A 4UWCA 3R8PA 2VTJA 4JI9A 2UZLA 4E4NA 2OI4X 3NUAA 4M8TA 3QUEA 3C0HA 4C4GA 2HZ4A 3P7BA 4RJ5A 1R39A 3F2NA 4X2GA 4CFUA 3WF5A 4JG7A 4AU8A 5DWRA 4MXXA 2C6LA 3GCQA 1QPJA 4XBUA 4I93A 4CLIA 1GZKA 4CV9A 3U4UA 1URCA 5AUXA 2VTMA 3C7QA 1R0EA 3A7HA 3LVPA 4XS2A 3JXWA 3BHTA 4GUEA 5A14A 2QU6A 4DEBA 5K4IA 3FI8A 5CQUA 5IH5A 3H4JA 5BX0A 1YOLA 4O81A 3F6XA 4YJRA 4IAYA 3POOA 4IM0A 4NW5A 4RIXB 4D4SA 2WQMA 5FWKK 2F2CB 5H8BA 3BV3A 2O5KA 4G6LA 4RA5A 2KULA 5IUGA 3KVWA 4OTDA 3LFFA 4BDIA 1OM1A 3EZRA 3SVVA 3R7VA 2F7XE 4H1JA 4C35A 1B38A 4A07A 1WMKA 4U3YA 3D5WA 4NIFB 2OFVA 4IACA 2VTHA 4TYJA 4X2FA 1VJYA 2UVZA 4EK4A 5AX3A 5CSHA 4XV3A 4GEOA 3FXWA 4AZFA 4W4VA 2SRCA 3DA6A 3EQRA 4C36A 4BDEA 4EHEA 5AUZA 3MFTA 4AA4A 3Q4CA 4WA9A 3HUBA 1OIQA 3RM6A 4UB7A 3Q60A 3QCQA 2QURA 3D83A 4E5BA 1APME 2Z7LA 4IVDA 4M0YA 2BKKA 2P55A 3OBJA 3CS9A 3PG3A 1H1SA 3AMAA 3BX5A 3RK7A 2OJJA 3KGAA 4D4YA 1CKPA 1YWVA 3FKNA 3ZEPA 3ZHPC 4BCNA 4IM2A 4LFIA 4EH2A 5GZ8A 5AR3A 4QMPA 4O0TA 4IEBA 2YZLA 5HI2A 3UVPA 1KE7A 2DS1A 4W9XA 4WRGA 2C1BA 2YCRA 4IBMA 4RJ8A 3REPA 3ANQA 4ZMFA 4HVDA 4PX6A 2Y7JA 3RZBA 1Z5MA 2ETRA 4ACGA 3A4OX 4E20A 4AZEA 1W8CA 4EZ7A 4YMJA 3DXQA 1J7IA 2YIWA 4C62A 3GGFA 2ZJWA 4FV9A 2HENA 4CCBA 1PMVA 4NJDA 3K5UA 5EI2A 3PXRA 5B0XA 1J91A 1YXUA 4ZMEA 1B39A 2GQRA 2UW8A 3LE6A 4UMPA 2YISA 4IM3A 1BUHA 3UTOA 4FV6A 4D0XA 1M14A 3QQLA 3BHUA 4I92A 3QTRA 2QO7A 5DGZA 4RIYB 2C69A 5IISA 3QKLA 4RG0A 4F6UA 1NXKA 3R8VA 4ANBA 2FH9A 4FL2A 4FL3A 4KIOA 1FGKA 3PVGA 5A4TA 3TT0A 3UP2A 5D1JA 2VWYA 4G3EA 2C6TA 4BBEA 4EK3A 2GQSA 4IC7A 4CG8A 2I0YA 1IA8A 3TZ9A 3OT8A 5IMXA 3PXKA 4LRMA 2CDZA 3DFCB 4AOTA 3CBLA 2RGPA 4FT5A 3VRZA 4BCPA 3PIYA 4QYFA 5AP7A 4MF0A 4O7NA 4J52A 1YHSA 1O6KA 4RC2A 4GKIA 4BTFA 4M69B 4OTIA 4F6WA 2BRGA 2WTDA 2AYPA 1QCFA 4J95A 4R6VA 4U3ZA 3W2PA 3IW4A 5EYCA 2P4IA 2J0IA 3ZUTA 2X7FA 1HCLA 3NIEA 4M67A 4RC3A 2DQ7X 3TCPA 3RAHA 2OW3A 5ANIA 2UZTA 5CEQA 2R3KA 1URWA 2E9UA 3HMNA 3LFSA 5CEIA 3ZBXA 4F64A 3CXWA 4G9RA 4RIWB 2RFEA 5HG7A 4RVKA 4AZWA 4WBBB 4IAKA 1J7UA 5DA3A 3MB7A 5FM2A 3NIZA 4AP7A 3RNIA 5JRQA 2PVKA 4DN5A 3PXFA 3DLZA 1E1VA 2WTVA 4NZWB 4DTKA 4I5HA 4DT9A 3TZ8A 2X8IA 3ZO4A 4HVHA 3UGCA 3HAVA 4RWKA 4OR5A 5E8SA 4MBIA 4MNEA 4YJNA 1M7NA 2VO6A 1OI9A 4NM3A 4WUNA 5FDXA 2ZM1A 2C3IB 3TZ7A 3CPBA 4GV1A 4O22A 3RWPA 2WQBA 4K18A 4M13A 4BCOA 4EOLA 5C8NA 4QRCA 4ZTSA 4F7SA 2BFYA 3ROCA 3DT1A 3MH2A 3VN9A 5T3QA 5E90A 3U54A 1GIJA 3NLBA 3FMMA 4UXQA 5JKGA 1B6CB 2VTIA 2PTKA 2VTQA 4OTQA 5JFWA 2I7QA 2O2UA 5EM8A 3R8MA 5CALA 4DFUA 5DR2A 5DH3A 3ZFMA 4FX3A 4EWQA 5CF8A 4UMQA 4BCMA 2WAJA 3CD3A 3LXKA 2V22A 4QP6A 2XA4A 5JSMA 4AWIA 2XK3A 3R01A 3GVUA 2PVMA 5CF4A 2QCSA 3BE2A 4ALWA 5A4EA 2C5XA 2QHMA 5I4NA 3EMGA 5FP6A 4JG8A 2R7BA 2IZUA 1YHWA 4OBQA 4ACHA 4NM7A 3FI2A 3R2YA 4BWPA 4C57A 4ZZOA 3ZXZA 1PRYA 3AD6A 4YLJA 4CMUA 4EK8A 3F88A 3FV8A 1TQMA 1BLXA 4QMYA 1DS5A 1FVRA 2UZWE 3LPBA 3NUPA 5HE2A 3QTQA 5ANKA 2NO3A 5H3QA 4ZJJA 5ITAA 4KUJA 3Q4UA 4D9UA 2QLUA 3ZDUA 4RLKA 3SXRA 2O8YA 2PVNA 3RK5A 2PU8A 4DEAA 3JY9A 1H1PA 4J97A 2PVHA 4G3CA 5IEVA 4RX8A 3TKIA 3RALA 4J8NA 4Z7GA 2OJ9A 3G90X 4LQMA 1CKJA 2PVLA 3PZEA 4DBXA 3RPOA 4QYEA 3LZBA 2I40A 1H8FA 4EOQA 3UPXA 3HRCA 3GENA 4DAWA 4MBLA 4BL1A 3AD5A 4RZVA 2BKZA 3HX4A 2F4JA 4CQGA 4FEQA 3EL8A 5CSVA 3UC3A 4CRLA 4YTCA 4PY1A 4AACA 1QPEA 4IX3A 4RC4A 2BHEA 2WTKB 5KMJA 4XLVA 3IW8A 4ZZMA 5FEQA 3G15A 5I9YA 3AQVA 4IE9A 4FKOA 4X3FC 3KXGA 3AC2A 3BKBA 2RFSA 2XKDA 4RWLA 4PMTA 3QCYA 4CVAA 2ZM4A 3BQCA 3WIKA 2O64A 3TG1A 3H9RA 1XH9A 5EW3A 5EYMA 4TL0A 3ZUUA 4C02A 4BCKA 2J0LA 4I23A 3VHKA 2JAVA 4IDVA 1YKRA 1ZOGA 3U51A 2J2IB 3IW7A 3TL8A 3MGYA 5CANA 4ZLYA 4MBJA 2GCDA 4EKKA 1PXPA 2OH4A 3A4PA 3C4CA 5EHLA 1PXIA 4DFZE 2JKKA 4O2PA 5JGAA 4NYEA 3K3JA 4N70A 4ERKA 3CY2A 3R8LA 5GINE 3UDBA 2JAMA 3TTIA 4GRBA 1HCKA 1NY3A 1ZAOA 5AMNA 4FKPA 4U0IA 4RVMA 2R3OA 4CXAA 5BVDA 1FVTA 3F5XA 2FSLX 4AF3A 2UW5A 4AX8A 4QPSA 5BYLA 3QTXA 3ODZX 4WG5A 2VWXA 3GU7A 3VHEA 3FE3A 1UVRA 1YOMA 3IPHA 4ZP5A 4BBMA 2EB2A 5BUJA 2QOHA 5DOSA 5IA4A 2XM8A 4EWHA 3AMBA 3GFWA 4FKUA 2G2HA 4ZSAA 3UC4A 5KMIA 3O71A 3ANRA 2OZAA 3ZTXA 1BYGA 1AD5A 2OKRA 5IQIA 1OKZA 5ANEA 5JQ8A 1XKKA 1A06A 2FSOX 4G3GA 3ORZA 3ROYA 4E4XA 1XR1A 4AN3A 5IA3A 3CCNA 4QMMA 4X2JA 4F7NA 4BGQA 1H0WA 5CZIA 2WTJA 3ZO3A 5FDPA 3BBTB 4FTUA 4F99A 4ZSEA 4HVSA 3ZS5A 1LEZA 2JFLA 3OFMA 4I94A 2ITNA 1S9JA 2VGPA 5DBXA 4CG9A 1Q3WA 1WAKA 5KHWA 5CXHA 3TNIA 3SLSA 2C0IA 4V0GB 2J50A 3L8PA 4GK4A 2GSFA 5ANDA 4I4EA 1M52A 5M53A 4XG2A 3D15A 3NNWA 4QTDA 4FC0A 4IFGA 1QPCA 3QZIA 3DNDA 4MYGA 4RMZA 5CI7A 3LMIA 1Q8ZA 3C4FA 4RFZA 3BHYA 3QQFA 3Q5IA 4K77A 5HE1A 2XCKA 3GU5A 4FF8A 4QYYA 5E4HA 1OGUA 2QQ7A 4FV3A 2H9VA 4E8AA 1XH5A 4EJNA 3ZZEA 4JBVA 3R9DA 1KUTA 2UVXA 4FBXA 4DC2A 4EH4A 2VTAA 5HICA 5E1EA 5TO8A 4FV0A 4CLJA 2ZB0A 5HBJA 5FXSA 4JS8A 4JDJA 3EB0A 5AR8A 4C2WA 3PP1A 5EFQA 3QWKA 2A27A 4LYNA 1WCCA 5ANOA 1OMWA 3TNQB 3BIZA 2GS2A 1H1RA 3DGKA 4IJ9A 4C34A 3IK3A 3LFEA 5E8VA 1V0PA 2ZV2A 4RJ3A 1PXNA 2WNTA 4F0GA 2I0EA 2X6DA 2QOCA 2UZOA 3Q9XA 2OF4A 2VTTA 3DK6A 1XHAA 3F3VA 3LFQA 2IW9A 2PSQA 2YIYA 3COIA 4E4LA 3UP7A 2O0UA 5JMSA 2PYWA 3SHEA 3M11A 3R1NA 3GNIB 3GOKA 4KIKA 5CENA 3UNZA 4FE2A 4MX9A 1YOJA 2P3GX 2YLFA 2CMWA 4RX9A 3MH1A 4RFMA 4TNDA 4AAAA 5BYYA 4QMUA 1SM2A 5KZ0A 4GSBA 1JQHA 2GFCA 3S0OA 4O7VA 4BDBA 4O6EA 1OL2A 5EDRA 4D0WA 4PNKA 1UU9A 2I1MA 4ARKA 4YU2A 4FIFA 4F65A 3KRWA 3E8CA 1RJBA 2R3RA 3CJFA 3FHIA 3JPVA 4DGMA 3DTWA 4W4XA 3KY2A 1MRUA 1PKGA 2BHHA 2PE2A 4PPCA 1WVXA 4C7TA 3LJ0A 3V5PA 2IPXA 1FPUA 2XF0A 5CASA 5I9XA 4OGRA 4BZOA 3PLAE 4O91A 3NAYA 3PXQA 3RCJA 3OVVA 4HCVA 3UVRA 5IH4A 4NU1A 4G6OA 3UMXA 3ORLA 4NKAA 3WE8A 5G1XA 4ZY4A 4A9SA 2UW9A 4IMYA 4RRVA 1ZRZA 4FYOA 3H9FA 3KF4A 4I5CA 4UZDA 5IDNA 4P5ZA 5EW8A 5CEPA 4CRSA 2OG8A 5AUUA 4DBNA 4KBCA 4RIOA 3QA0A 4L3PA 3R7OA 3GCSA 5HX6A 3B2WA 3T9IA 4YTFA 1U59A 3QC4A 3S2PA 4BTKA 3ZXTA 1SVEA 4C59A 1FBNA 3V5JA 5GZAA 2IJMA 4IXPA 2UZNA 2E9NA 2HW6A 3VUKA 3DJ6A 4PUZA 4Y5QA 4APPA 2QG7A 4JR7A 4LG4A 4WRSA 3LQ8A 3RAIA 4F63A 2W9FB 3KC3A 4GU6A 3DDQA 5M55A 2E9OA 2B9IA 3UIMA 4ZJVA 4C3PA 4IZ5A 4EC9A 1OL1A 3PPKA 1LUFA 3O8TA 4QMZA 5DR9A 5GJGA 4BKJA 1XH6A 3ZH8A 3ORNA 3P4KA 5I9UA 4AXAA 3P7CA 5IQGA 3GI3A 4IAZA 1PHKA 3ZSGA 5AP6A 4XP3A 2PPQA 2YDIA 4FSNA 3OMVA 5IQCA 3MFUA 2BMCA 2QD9A 2XRUA 4XMOA 5IQDA 4F1OA 1UKHA 2YCSA 3PJ2A 5HX8A 4L8MA 2RFDA 4M68A 5BVEA 1XQZA 1FVVA 5AUTA 2F49A 4KS7A 2HZ0A 4U41A 1FMKA 4FTJA 3CR0A 4EL9A 5BUIA 2R3HA 4DLJA 4EKLA 1YI6A 2WB8A 3KRRA 2PVJA 1O9UA 4ASDA 5IKWA 5A4CA 3L9LA 4XG4A 2WGJA 3P08A 5L8JA 1IA9A 4BWXA 5EQYA 5C8MA 4MXCA 5AP1A 2HWOA 2W06A 3QLFA 4KIKB 3WZUA 2HZNA 4F09A 3IDBA 4FTRA 4GH2A 4QQTA 3DK3A 4O0VA 4S2ZA 3QL8A 4FNWA 3O50A 4ZTNA 2QOFA 3ID6C 4L46A 3SAYA 3PZHA 3LCSA 4I1ZA 2OXYA 2CLQA 5CNNA 5J79A 4FKWA 4K0YA 5JFXA 4IHPA 4EORA 3DCVA 2ITXA 3DBCA 5CAUA 3Q2JA 4IANA 5FXQA 5CVHA 5AV1A 4D2PA 4FSWA 3PXYA 5FTOA 5IPJA 3U6JA 3SXFA 5DEYA 3D14A 4EQUA 5IQEA 4U9AA 2BPMA 4ACDA 2JBPA 4G5PA 1Y6BA 4R5SA 4BYIA 3JR1A 2YEXA 3UE4A 3IO7A 4V01A 4R7BA 3QALE 3LFNA 4R5YA 1FMOE 3R1YA 4X21A 3KULA 4G6NA 4QMTA 4FODA 3FYKX 4FEUA 4JJRA 2XZSA 4TT7A 2C1AA 4MF1A 1CDKA 3OCSA 4ITIA 2JKOA 1BX6A 3QYZA 5EM5A 2WMQA 4JR3A 3DDPA 3ERKA 3AT3A 4FKGA 4I0RA 4FIIA 4R78A 5EDQA 4IDTA 4U81A 4XG9A 4YLKA 5A6NA 1MRYA 4RX7A 4S31A 2W4OA 1WVYA 2W1ZA 5HQ0A 1SNUA 4OAVB 1Y8GA 4RFYA 4Y5HA 1P14A 1YXSA 4H3BA 4WG4A 1L8TA 3V3VA 4ASEA 2RKUA 3LQ5A 3L9PA 2QONA 5CY3A 4NSTA 3HMMA 1H25A 5IF1A 4D58A 3EQCA 2Z02A 3KMUA 4OTFA 4XG6A 5TF9A 4LGGA 2WIHA 3UZPA 3TNHA 5L6OA 3EN6A 1CMKE 3OZ6A 2XNNA 3UO4A 3HMOA 2C6EA 3MY0A 4PMSA 2W1FA 4O21A 3DOGA 5DE2A 4U5JA 5CAVA 2BVAA 4MWIA 4FSZA 4LRKA 2A19B 2BZJA 5E8UA 2R3FA 5E8WA 4DFYA 5L2SA 2CNVA 2UZVA 4X6QC 2UW0A 2OXXA 3MH3A 4I21A 1H08A 1L3RE 3QQHA 4F7LA 4KIPA 5F94A 1H24A 4WSQA 4AG8A 4E6QA 1U4DA 1OECA 1OVEA 4M3QA 3NNXA 1JNKA 2B7AA 3QZFA 5EHOA 5G6VA 4U8ZA 4O82A 2WEIA 3CE3A 5CSWA 2X39A 3TXOA 3MTLA 3QKMA 4U43A 4C3RA 3MTFA 2XRWA 4UYAA 2YAKA 1PXKA 2GNJA 3L8SA 1UKIA 5EH0A 5CXZA 2JIIA 5LQFA 2WFYA 4U80A 2KTYA 4LUDA 1WBPA 3VS5A 3C5UA 4X7QA 4J7BA 5JZNA 2Q83A 3VC4A 4KSPA 1Y91A 3Q5ZA 4GVJA 1LPUA 4J96A 5HG5A 3KXXA 2Q0NA 3EQDA 4FIEA 5AP3A 4IQ6A 2Z8CA 4E4MA 4I0TA 3FZ1A 5EYDA 2Y9QA 5J9LA 3QU0A 3B2TA 5I9WA 1MUOA 3CPCA 4JDKA 1W83A 2BDWA 3C9WA 4ENYA 2VWIA 4K2RA 1V1KA 2BCJA 2GPHA 3E62A 2GU8A 2VN9A 3E92A 3NUXA 5AR5A 2YWVA 3OWKA 4XBRA 5HNGA 4ZLOA 5KMKA 3K5VA 3LXNA 3V6SA 3FDNA 2R3NA 2VNWA 5LVLA 1DM2A 1KOAA 4U79A 4NM0A 3C51A 2B0QA 4BCHA 4EOJA 3I6WA 3QCSA 4OTPA 3Q96A 3IGOA 4ZK5A 2H96A 5JGDA 2OJIA 4R1YA 1XH7A 3DKGA 1P4FA 3FC2A 3ZO2A 2XBAA 3HP2A 3KULB 3SG9A 4WBOA 1Q8UA 4L7FA 2JDTA 3E88A 4C2VA 3EQIA 4ZEGA 1OB3A 3OCTA 5DG5A 2W9ZB 1ZLTA 2W1DA 2CCIA 2VWBA 4TYHA 3UQFA 4U40A 4FTNA 5A9UA 2NRUA 1I09A 2GHLA 4CT1A 4I5MA 3ZYAA 2XNPA 1ZY4A 3Q2MA 5I9VA 2I6LA 3DXPA 2R3QA 5DT4A 5B2LA 5CNOA 3HV7A 3NGAA 5D12A 2XYUA 4MVFA 1OKVA 4AGUA 3OP5A 3T3UA 2WOTA 5J1VA 5HBHA 4CCUA 4RVTA 2VRXA 4NT4A 3WF8A 4DF3A 4D2WA 3E8DA 4CD0A 4EUTA 3BCEA 3FKOA 1ZOHA 4AFJA 1PJKA 5TE0A 5J9YA 1QL6A 3FYJX 3V01A 4CKJA 3L1SA 5J8IA 2ZV7A 4FIGA 3THBA 5J5TA 4FV7A 3KMMA 3D2KA 4QMWA 4BTJA 4HGTA 1SMHA 3QTWA 2G9XA 2IVVA 2XVDA 1YRPA 4JVGA 4EONA 3H30A 5AP2A 5KKRB 4FZ7A 3CLYA 2HELA 3EH9A 5H8EA 3VF8A 3CQUA 2XK8A 4XV2A 3UODA 2W17A 3PSBA 5HU3A 1OL7A 1P5EA 4USFA 3HV6A 4KBKA 4JG6A 4UEUA 3DBDA 4B4LA 2XM9A 2B54A 1H00A 3C50A 1PXOA 2XNGA 2XIZA 4G16A 3IKAA 1RW8A 3Q32A 3R00A 1Q4LA 3F3TA 3N9XA 5J5SA 3GEQA 1BL7A 2VTOA 4I22A 5AV0A 4JNWA 4PRJA 5DT3A 1KSWA 4CKIA 3C4ZA 2YLEA 2J0JA 3A61A 1PW2A 4L00A 4IW0A 3A7JA 3HGKA 4FV8A 3COMA 3JVSA 4DH3A 4HVIA 3KRXA 3DKFA 1XBCA 2QKWB 4O7LA 3BYSA 2BAKA 5KO1A 4K1BA 4H05A 3ZLXA 3PYYA 4QMNA 4DEGA 5AFVA 3IONA 4A9UA 2XK4A 3E7OA 3NR9A 2ZV8A 5IH6A 3U6HA 4JX3A 5HGIA 3EN7A 4AQCA 5L2TA 2GFSA 2W0JA 4RJ4A 4J8MA 2JGZA 4L3LA 4L52A 3WIGA 4ZS4A 1JKTA 2W7XA 3QX2A 2VTNA 5CSPA 5K9IA 4GT4A 1KE5A 4MAOA 2GTNA 2OXDA 4O7TA 1DAYA 5HD7A 4AN9A 4CT2A 3PJ1A 3E8NA 5L2IA 4I6BA 1YWNA 2WO6A 4G31A 4RA4A 4RBLA 3R83A 3MVMA 4ASXA 3FZSA 3UOKA 4M15A 2XK7A 4IX4A 2BAJA 3O2MA 4GG5A 2IZSA 4L53A 4LOOA 2CCHA 3QRTA 4LM5A 3ODYX 4R7IA 3E93A 3TUBA 2PVRA 3CTJA 3VS6A 4F9YA 1G3NA 3S95A 3V5TA 4A9RA 4A4OA 3SD0A 3OCBA 3PA5A 4F1TA 4ZTLA 4IWQA 4AN2A 2F7ZE 1ZMUA 4FTLA 3PPZA 3KEXA 3NNVA 2O65A 4I4FA 2IZRA 3W10A 4HGSA 4D4RA 4P90A 4FTTA 5CS6A 3A7IA 4D4VA 5F95A 4DFNA 4FG9A 2VD5A 3JYAA 4G2FA 2FA2A 2Y4PA 2W4JA 4QOXA 3KRJA 2XCHA 4BHNA 1GZ8A 3WE4A 4PWNA 3PUPA 2C5VA 2HY0A 3RAKA 2BZIB 1YI4A 1W7HA 3GFEA 5DR6A 5AX9A 4M84A 2WMAA 5HCYA 3FJQE 3IDPA 4XV1A 4FV2A 4YUQA 1IG1A 4ID7A 2V55A 3F7WA 1GIIA 3WZDA 1UU3A 3I60A 5T68A 3W55A 3U55A 3LJ1A 3DY7A 1LP4A 2BALA 3LFAA 4EH3A 2PMOX 2A4LA 3EN5A 5CF5A 5FEDA 3M2WA 2VTPA 2WKMA 2Z2WA 2XJ1A 1WBOA 3FHRA 4FIJA 3Q9ZA 3FPMA 3NCGA 4YNOA 3K2LA 2QU5A 1TVOA 3A8XA 3BU3A 5LWNA 4BY9E 3EKKA 3EFJA 5TKDA 2LAVA 5KHXA 4FNXA 4TWNA 4QYHA 4P2KA 3HLLA 2Z60A 4QMSA 5EOBA 5FG8A 3ZM9A 4PQNA 3QF9A 3T3VA 5FUTA 1K3AA 3OEZA 3BPRA 3OWPA 2VUWA 2FYSA 2QI8A 3H3CA 4GJ2A 3UNJA 1W0XC 3FLZA 3U9NA 5KCVA 2CKOA 5D7AA 5CSXA 4BIEA 3KXMA 4GS6A 4ANLA 4EK6A 4B9DA 3KB7A 1Q24A 4FK6A 1GY3A 3CQEA 4W8DA 2VTRA 4XH6A 1PYXA 2WTWA 3PY3A 5EW9A 4GYGA 4ZY6A 3RHKA 3SDJA 5IA0A 1BL6A 3HECA 3V5LA 3VBYA 1IEPA 2PUUA 2VU3A 3OOMA 1H26A 2E2BA 4RZWA 2BIKB 4AW2A 4I5PA 3DTCA 4FG7A 4IWOA 4TWCA 5AUVA 4ANMA 5IA2A 3MYGA 3ORXA 2GS7A 3CJGA 4YHTA 5HO6A 2J6MA 3AG9A 5AUYA 3ZDIA 3RVGA 3FMNA 5CAPA 3D94A 3KXZA 2Z7RA 3HUCA 3LOKA 5K4JA 4DH7A 5DEWA 3CTQA 4BCFA 3QD4A 1VR2A 2NPQA 2X2MA 2X8DA 2YIXA 2R7IA 4FV4A 3V5QA 3MS9A 3U4WA 2CKEA 4MQ2A 2PE1A 2B9HA 4L42A 2JKQA 1VYZA 4O0UA 4F9CA 5EKNA 2WXVA 2G2IA 4YTIA 3HZTA 3OXTA 1H1QA 1WBNA 3IW6A 1ZYJA 4OBOA 3TNPC 1M2RA 3SOCA 3HV5A 4U6RA 4IX5A 2C5NA 2XNBA 4L6QA 2DWBA 5HU9A 2WTCA 2ZMDA 3LXPA 3G6HA 3VS2A 3I0OA 2J90A 4WD5A 3UIXA 3UJGA 3MESA 4QQCA 4O84A 2BRHA 3FL4A 4QP4A 1R0PA 4GW8A 3ZMMA 2ESMA 4BFMA 3UZRA 4O0YA 3HVCA 3Q52A 3QLGA 5K5XA 3PY0A 1WZYA 1SNXA 2B9JA 3AC4A 3UIUA 3D5XA 4NWMA 4NEUA 4M12A 3VS1A 4DEDA 2ACXA 3MSSA 3ELJA 1ZOEA 4YPSA 4BDAA 1FGIA 4F9BA 4O7RA 2JD5A 5D11A 2X7GA 4ZLZA 2B9FA 5CAQA 2OZOA 5JFSA 4FT0A 2HOGA 3ORMA 4H58A 4K6ZA 3W1FA 4X6RA 1PY5A 2NP8A 4QPMA 1R1WA 4KA3A 1K9AA 4IH8A 3HRBA 4LI5A 5J9ZA 4AE9A 1PXJA 3NUYA 1PMNA 3GOPA 3IECA 4JDIA 4W4WA 4EH5A 4QNYA 1OUKA 4FNYA 5KX8A 1ZXEA 3OTVA 4ANOA 3EQBA 1AQ1A 4MNEB 1JKLA 5HLWA 3IOPA 1JSTA 4FKLA 3MPTA 3VS3A 1JWHA 5J1WA 5EOLA 5CU6A 2UZUE 4PDSA 1EH4A 4TPTA 4TZRA 4UX9A 3PXZA 3Q4TA 4IAFA 5KNJA 2J51A 3W2OA 1ZWSA 2BAQA 4TYGA 3VUDA 4EEVA 3FMLA 2ITVA 4AGWA 4LV8A 4GFOA 5TOZA 3MDYA 2EXEA 4G3FA 3O7LD 1SZMA 2QOIA 3D7TA 3DAEA 2J0KA 3R6XA 5A46A 1Q8WA 4C37A 4TWPA 4JQEA 4DINA 4FKRA 4PTEA 2WMVA 4L44A 5J7HA 1REJA 5F1ZA 3NVKI 3KCFA 1ZYCA 5D10A 1WVWA 1GZNA 4KD1A 5LCKA 3PSCA 3RTPA 4O0XA 3KU2A 4YJSA 3ZRMA 4O0WA 3WYYA 2C68A 3H10A 1PYEA 3O8UA 2W5AA 4OT5A 4RQKA 1Q5KA 4QP9A 3RK9A 4CFFA 3I4BA 4OLIA 3AGLA 4UBAA 4E5WA 2XYNA 2J7TA 3EQHA 4NH1A 3RAWA 2QODA 3TV4A 5M57A 5LXMA 3DAJA 3TUCA 4O7WA 3F5GA 4D2SA 2CNUA 4PDPA 4DT8A 4I24A 4JDHA 4HYIA 2OO8X 5EI8A 3GXLA 4APCA 4E5AX 5CU4A 1ATPE 3EL7A 2XJ0A 3LFBA 3R7UA 1YHVA 3KMWA 4K11A 4MXYA 2W1GA 4X3FA 5LMKC 5DNRA 3OS3A 2JKMA 2H8HA 3FSKA 3MV5A 4ZTHA 4JAJA 3GCUA 3VJOA 3UPZA 4IIRA 3MH0A 4YHFA 4P5QA 4E3CA 1CKIA 1T46A 4AGCA 4HCUA 3BRBA 3D4QA 2PMLX 2QO9A 3EFLA 3DQXA 2IVTA 2DUVA 5E8TA 4C4IA 5E9EA 4XLIA 3R71A 5IQAA 2NRYA 3FY2A 3ATTA 2YABA 2BILB 5DFPA 4L01A 5AP0A 2C6IA 3P78A 2HK5A 4BVUA 4EBVA 4F08A 5AUWA 4FKVA 1MQBA 2X6EA 4KIQA 5KE0A 3LLAA 2CNQA 3IS5A 1UNGA 3GCVA 3PWYA 5LJJA 1V0BA 4HYUA 1BI8A 4RT7A 2XNEA 1OKYA 2C6OA 3G0FA 4J99A 3BWJA 4BKZA 4QTEA 4MK0A 3QD3A 5IEXA 3P23A 4CGAA 3L8VA 3QTSA 1LEWA 4RVLA 4IWPA 5IZFA 2HW7A 2UW7A 2W1EA 1Y57A 5DN3A 4BKYA 4E6AA 3EFKA 1G8AA 2GNIA 3LFCA 3R8ZA 1QPDA 2PY3A 3F2AA 2B53A 3TZMA 3MJ1A 3WYXA 5HNIX 5LMBA 2IVSA 3E3BX 1JLUE 2OSCA 3IG7A 3ZLWA 3EQPA 4YTHA 5FEEA 5HIDA 3S3IA 3IDCA 3W8LA 4O83A 1UWHA 3VW8A 5FP5A 3OXZA 3ZLSA 4UY9A 4P4CA 4ZTQA 4D55A 3NYNA 2BFXA 3F5PA 4TWOA 4PF4A 4A9YA 2QOLA 4F0IA 3FZOA 2XKFA 3AC1A 4FKJA 4HYHA 3A7FA 3D7TB 3MA3A 5DLSA 3IW5A 3LCTA 4QO9A 3ZZWA 5IA1A 5KMOA 4PP7A 3R0TA 3NYOA 2JIVA 3WBLA 3BEGA 4LOPA 5B7VA 2R3GA 3DZQA 4YBJA 3QZGA 5HVJA 3FEGA 3DKCA 1YI3A 5DHJA 2OZAB 3L9MA 3R2BA 4ZTMA 1JVPP 4L7SA 2JC6A 2PULA 3ATSA 2CGXA 2ZDTA 4HJOA 4DLIA 4L43A 3TDVA 5C26A 4K9YA 4BGGA 4NUSA 1JAMA 4MD8E 4WHZA 4XNEA 3R9OA 3E8EA 3R9RA 4BIDA 4FVPA 5HG9A 4QTAA 3UOLA 3OWLA 3A62A 5CT0A 1Q62A 3ZUVA 3NW5A 3RJCA 3ENMA 4BDFA 2C5OA 5J7BA 1H07A 3MB6A 4I0SA 2XP2A 3W18A 4BI0A 5K0KA 4BCJA 2XIXA 4GFGA 4PPAA 4B0GA 4BIBA 4QMXA 2C30A 4YJOA 2Y4IB 4CQEA 2A0CX 2BZHB 2BUJA 4WNPA 5HVKA 5FBNC 4M0ZA 1OPJA 3WI6A 4PDYA 1T45A 4BDHA 4AA5A 4CZUA 5GJFA 1YVJA 5BVKA 5AR4A 1H01A 2GS6A 4PNIA 4W9WA 4IADA 3QAME 3GUBA 5K5NA 2H6DA 3NPCA 1OBGA 2XNMA 3K3IA 3KVXA 3QZHA 1UV5A 4H39A 4LL0A 3R63A 4WO5A 4A06A 2QO2A 2VO7A 3D5VA 4HGLA 4B8LA 3ALOA 1ZMWA 3ALNA 3CD8A 3H9OA 4UMTA 3BWFA 4FA2A 2R3PA 5HZNA 4FGRA 4L68A 3BU6A 1BKXA 4JL9A 4OTGA 5C8KA 3RI1A 3LHJA 3WOWA 3V8TA 4Y85A 5M07A 3LLTA 3PRIA 4J71A 4Q2AA 4QQJA 3QUDA 1P4OA 4HPTE 2C3LA 1JOWB 4ERWA 3FLWA 4XYFA 1KV1A 4KAOA 1J1CA 4NCTC 5ANJA 5AV2A 4IX6A 3RP9A 5I3RA 3Q3BA 4FICA 5DYJA 1YQJA 2CGWA 4JRVA 4QP8A 3R02A 1Q8YA 4N4SA 4YPDA 2R3JA 4FGBA 2CGUA 4ZSJA 2YHVA 3BGZA 3VAPA 4RPVA 4FSTA 5IG1A 3CKWA 1H1WA 3F3WA 4N0SA 4UMUA 4ALVA 5FBOA 2ONLC 1Q41A 3R7EA 1E1XA 3FWQA 3F5UA 5JFVA 1LR4A 4EC8A 3JS2A 1GNGA 4FT9A 4FZAB 1UA2A 3F3UA 4V04A 3SC1A 4I41A 2JDOA 2LGCA 2P2HA 4I6QA 3A7GA 4TN6A 3Q6WA 5FD2A 4YSJA 2PE0A 4KRDA 4KKGA 2A1AB 2WTIA 3FUPA 5JRSA 5IEYA 4Q5EA 2CHLA 3GCPA 2O3PA 2JDVA 3FC1X 3K54A 4XP2A 5FM3A 4WNKA 4FTQA 2OU7A 2QNJA 2R3IA 2YFXA 2FVDA 3R21A 3UVQA 3UNKA 4JOAA 4DFBA 2FSMX 2R0IA 1KOBA 3P7AA 3WF9A 3O7LB 4MH7A 3LMHA 4DH5A 3R1SA 1OBDA 4JX7A 2F2UA 1JPAA 1XH4A 1OL5A 2F9GA 2RL5A 2W1HA 3PTGA 4DITA 3BLRA 1UNHA 1FOTA 2ZDUA 4X3JA 3QQJA 5F20A 3CEKA 4DHFA 4EH9A 3O0GA 5KBRA 5LARA 3N4VA 3E87A 3HEGA 4FV1A 4YZMA 3Q04A 4N6YA 1MP8A 2BTRA 2GNLA 3BEAA 5TR6A 4BC6A 2W5HA 3II5A 3GQIA 2XIYA 2QOOA 5CWZA 4UZHA 4ZOGA 4O86A 4KB8A 4KSQA 4GJ3A 2HXQA 3DFAA 4O1PA 4BDJA 3MPAA 3E5AA 2PWLA 2OF2A 2X2LA 4C8BA 4F70A 3M42A 4RX5A 2VX0A 4DH1A 4TNBA 2R2PA 3OOGA 4GUBA 3HNGA 3TJDA 3WZEA 3PDTA 3NW6A 2B52A 2EB3A 1Q8TA 1PMEA 4ANNA 4XUFA 2YCQA 5DRDA 5A54A 3KK8A 3JVRA 4FKSA 4FT3A 4HNIA 5I3OA 3VBTA 2IO6A 1FINA 2J0MB 4BDKA 1GOLA 2ZOQA 4D1SA 5CAOA 4JXFA 3RPVA 4C0TA 4IB3A 3GC7A 3ZFYA 3KFAA 4FK3A 3Q9WA 4C3FA 4C4EA 4UMRA 4FSRA 3DV3A 2PK9A 3ORTA 4IVAA 4X0MA 4YJVA 1NVRA 4QD6A 4B8MA 2Z7QA 4E7WA 3HL7A 5H2UA 2GHMA 4L67A 2ITQA 3V8SA 3QTUA 1SVHA 4KS8A 3NMUF 5A6OA 2C5YA 3LXLA 2VWWA 4MXZA 4BYJA 4H3QA 4KRCA 4MEDA 4ASZA 2PMNX 3DB6A 3ORIA 3EN4A 4X2NA 2WQNA 1G8SA 3SOAA 4E6CA 5HCZA 2GMXA 2YIRA 5HHWA 4I20A 3DJ5A 3LFDA 2BDJA 2XS0A 4FKIA 5EG3A 2X0GA 3G9LX 3BU5A 3I7BA 1AGWA 1WBVA 2PHKA 1MQ4A 4G34A 5AWMA 1YDRE 3PJ3A 5L8LA 1XWSA 3BZ3A 1XBAA 3PE2A 5E91A 2ERZE 3R30A 1Q3DA 2C47A 3Q6UA 2YZAA 4NK9A 5C4LA 4GYIA 3PLSA 2IWIA 4OT6A 1Q61A 4EI4A 3N4TA 4QMLA 5F9EA 3PP0A 5HKMA 2R3LA 3L9NA 5AAGA 1ZMVA 5L8KA 4YGAA 4Z9LA 2CKPA 4II5A 3OEFX 2VO3A 3UG1A 2EXCX 3G0EA 3LCDA 5H9BA 3O8PA 4OW8A 4HNFA 2V7AA 4PDOA 3P9JA 3RPSA 3U8WA 1NVQA 3C5IA 3DBQA 5CZHA 3BGPA 3MIYA 1RDQE 4RJ6A 4Y8DA 5AEPA 3FLYA 2QVSE 5HO7A 3QQGA 4W8EA 1WBTA 2WU7A 5KZIA 2F7EE 2XJ2A 4E73A 1RQQA 4AZVA 4KINA 3CKXA 4PP9A 2XKEA 3OUKA 3LJ2A 3MVLA 1G5SA 3VS4A 4F7JA 4EHVA 5JK3A 4BDGA 4A9TA 3FMHA 5C4KA 1Z57A 4CEGA 2JDSA 2YM8A 4GT3A 4I3ZA 5IMEA 1KE8A 4KWPA 5EDPA 3TI1A 5IQHA 4TY1A 3TKUA 4MQ1A 4RIYA 3U6IA 4BF2A 5M08A 3NW7A 3HMPA 2EWAA 5HE0A 3SRVA 4CMTA 5H8GA 2C0TA 5CEMA 4UALA 5BVWA 5ETCA 3I5ZA 5C01A 5LVPA 4DH8A 3OHTA 2XB7A 3HMIA 1NW1A 3BYOA 4G9CA 5CF6A 4C4HA 2JITA 3VBQA 1CM8A 4OBPA 5CU3A 5CTPA 5HOAA 4YZDA 2HAKA 1YXTA 3RWQA 4BCIA 1IR3A 4XG3A 4YZNA 4O1OA 1VEBA 2B1PA 4G5JA 4B7TA 5LWMA 2R0UA 4O96A 5L4QA 3DU8A 4M69A 4WKQA 4WOVA 1ZZ2A 4E26A 4C33A 4Y95A 4UWBA 4IB1A 3PPJA 2WEVA 2QLQA 2PZRA 4PMPA 5I9ZA 4AW5A 3W8QA 4Y46A 4AUAA 1YWRA 1VYWA 2IZTA 4D1ZA 5BNJA 2B55A 4FVQA 3PIXA 4GIIA 3QC9A 4RIWA 3UG2A 3NWWA 3FXZA 3EOCA 3IGGA 5C1QB 4BTMA 1ZYDA 4U97A 2G01A 5AR2A 5LVMA 3QD0A 2PVFA 3G2FA 5HO8A 4TTHB 5K0XA 1A48A 1KV2A 3Q9YA 2ITPA 5AV3A 1OKWA 4XOYA 3ITZA 2ZYBA 4GL9A 4PL5A 2QC6A 3WF7A 4FTKA 4D5KA 4JIKA 5AAEA 2PUPA 3DXNA 3V8WA 4F6SA 3FKLA 5BQ0A 5KMNA 4FTCA 5FTQA 3TJCA 2V62A 4OTHA 2BROA 2R64A 2WHBA 3KCKA 2ZMCA 3O17A 4C4FA 2UVYA 3SX9A 4ZSGA 3ZSIA 4R77A 2WTKC 1JSUA 3CC6A 4FZDB 3QGYA 2WQOA 4YSMA 2QHNA 2VAGA 2GNFA 2HYYA 3RGFA 4FSQA 4DA5A 3F7ZA 2YIQA 2HZIA 5ACBC 2E9PA 1RE8A 4JBPA 3C4WA 3E64A 3G51A 2GQGA 3FLQA 2XMYA 3MY1A 4EOKA 3F61A 1WBSA 3QBNA 5AM6A 4Z3VA 1Y8YA 2EXMA 2UUEA 4FR4A 2IVUA 2IW6A 4J98A 4M97A 1IAHA 2G1TA 3QRUA 2RF9A 4MXOA 3TWJA 4NFMA 2VTSA 2FB8A 2C6MA 3DLSA 3AC8A 4JBOA 3RM7A 4EJ7A 5E8XA 3FSFA 4GT5A 4MKCA 4BRXA 2PZPA 3ZRKA 2XEZA 3MPMA 1M7QA 1I44A 4Z7HA 2YM5A 3UZTA 2ITWA 4O7ZA 4WIHA 5AIRA 4FUYA 2W4KA 3RZFA 3NNUA 3W2SA 5M06A 5GHVA 4HYSA 4TYHB 3V04A 2YM4A 3HKOA 5ICPA 3O96A 4H3PA 4JBQA 4FNZA 4WNOA 2O63A 3VUIA 4F4PA 2WZJA 5D7VA 3VS0A 4FEXA 5AM7A 4P7EA 2E9VA 3OCGA 3UO6A 5CVGA 4FSMA 4YZCA 1U46A 3LM5A 2CSNA 3VVHA 2W1CA 3ZBFA 1ERKA 3ORKA 3ZRLA 4JLCA 2YITA 3SRVB 5IUIA 3HAMA 3CIKA 1YW2A 4DGOA 2GNHA 3GU4A 4QYGA 2ITZA 3KKVA 4HPUE 3JY0A 1OIYA 1GAGA 3C4XA 3S00A 1UWJA 2JLDA 5M4UA 5GIPE 4EQMA 1ZYLA 4YJUA 5ETAA 1NA7A 2C6DA 2YA9A 3EQFA 3HYHA 3QQUA 5BPYA 4IB5A 4FTAA 2HWPA 4EYMA 2AC3A 1XH8A 3OD6X 4QTCA 4XOZA 5HTBA 5HORA 4J1RA 4HCTA 2P0CA 2VNYA 3P86A 4LOQA 2WIPA 2X7OA 3UYTA 2BIYA 2RFNA 3VJNA 4D2VA 3POZA 5E8ZA 4WSYA 3FQSA 4FZ6A 2VZ6A 4H36A 2P2IA 5CYIA 3PJ8A 4MXAA 3FPQA 4QP1A 5FLFA 2QKRA 2RIOA 2YM3A 2PL0A 4I6HA 5EM7A 3KF7A 3T8OA 2WPAA 4CYJA 5B2MA 4EOOA 4FKTA 1Z9XA 4CFWA 3C0GA 4G1WA 5C9CA 4F9WA 3PIZA 4OUCA 2Y6OA 3P5KA 2PMIA 4ANQA 3UOJA 2JEDA 3P0MA 2FGIA 2X8EA 3QA8A 4O0SA 5M4CA 4FOBA 1PF8A 4LRJA 5C27A 3OF0A 4ACCA 2PVYA 2Y8OA 3RMFA 3N51A 1FQ1B 2WMSA 5M56A 4HW7A 3EIDA 2XIRA 3WILA 4CFVA 2CLXA 4A4LA 2WELA 4U7ZA 2C0OA 3OC1A 4B99A 5KUPA 4O6LA 3ZFXA 3CP9A 4DFLA 1WFCA 1CSNA 5JT2A 5AJQA 4ENXA 3LQ3A 4EBWA 2IW8A 3DBEA 4DG2E 3DPKA 2OJGA 3BBWA 4BGHA 3A8WA 4NTTA 5CU2A 3TV6A 4BR3A 5HCXA 4UN0C 5AV4A 4L9IA 3V6RA 3OTUA 5D41A 3TN8A 5M4FA 3MJ2A 4EOPA 1UU8A 2J9MA 4FIHA 5KMLA 4O7SA 2V5QA 2ZVAA 3ET7A 2QG5A 1R78A 5M51A 4EYJA 2W1IA 3KXNA 1P2AA 4S33A 5J87A 4FTOA 4UWYA 2ZAZA 4CFXA 2PUNA 1BMKA 4FEVA 4MHAA 2ITYA 4MTAA 5TT7A 2QOQA 2EVAA 2RG6A 4YJPA 3ZO1A 4CYIA 1K2PA 3W16A 3KA0A 4CZYB 4O2ZA 1OUYA 3NX8A 4R1VA 4USDA 4D2TA 5CU0A 4Q9ZA 4WG3A 3BI6A 4YBKA 4C58A 3ACKA 4KKEA 5AA9A 4WUAA 4V0GA 3VBXA 2OIBA 3OW3A 4LL5A 4AS0A 3B8QA 4XV9A 5BUEA 5DRBA 3EQGA 4YP8A 4DG3E 2BRBA 3MVJA 3VUGA 4GMYA 2CN8A 3I79A 5HLNA 4AOIA 4R3RA 3TACA 3LKMA 5CI6A 4IZ7A 3I0QA 2YJRA 3QRJA 3AGMA 5DI1A 4NFNA 3LW0A 4FI1A 4GVAA 3ZEWA 5FXRA 4PV0A 3A2CA 5CX9A 5DIAA 3MWUA 3UYSA 4O27B 3W2RA 1M17A 2BDFA 2UW3A 5HIEA 1DI8A 2FUMA 5AP4A 3ULIA 4EK5A 5EQEA 2CN5A 4ZAUA 3EWHA 2QR7A 4IZAA 3OY1A 3C1XA 3QCXA 2YCFA 3AMYA 3SV0A 5L2QA 3EFWA 5BVNA 4C4JA 3HV3A 5FGKA 5GJDA 3FI3A 5AAFA 5LVOA 4BI2A 3KN6A 4O7YA 3DAKA 4GK2A 4ZTRA 3ZSHA 1W82A 2WMWA 4JIAA 2P33A 3QKKA 3AC3A 1TQIA 1S9IA 2Y4IC 4LGHA 2X9FA 5HEZA 3R7IA 4QMQA 4C61A 4USEA 4B6LA 2ITUA 3S1HA 3OBGA 4BDDA 4YNEA 5BVOA 5L2WA 2OBJA 2W99B 1ZYSA 1JKSA 4J53A 2WOUA 1X8BA 4TKSA 4D2RA 4D1XA 4R7HA 4IVBA 5J95A 3SW4A 3ZLYA 4DGNA 3W2QA 1ND4A 1XO2B 4Y83A 5JGBA 3D5UA 4Z16A 1KE6A 3PA4A 3Q53A 3ULZA 4AA0A 2J4ZA 2A2AA 3P1AA 5EK7A 1NT2A 3E7VA 1QMZA 1JBPE 4FUXA 3FQEA 4RGJA 3FLNC 4PL4A 3HV4A 3QTIA 3DQWA 4XEYA 1F0QA 1SVGA 2C6KA 3AT4A 4FV5A 3E3PA 4KKHA 4I6FA 4DGLC 2ERKA 3VO3A 4ACMA 3I7CA 4JQ7A 3LMGA 5I0BA 5A4LA 2OJFE 4ALUA 2UZBA 2YDKA 5E92A 1M2PA 3LCKA 1E9HA 4MWHA 5JN2A 4R3CA 1JKKA 5GNKA 2X2KA 1GIHA 3QWJA 3OW4A 4BBFA 2CGVA 5FRIA 3EYHA 4E1ZA 3WZJA 3VUTA 4EOMA 4AT4A 4DYMA 5BMSA 4BN1A 3UBDA 3QGWA 1H27A 1PXLA 4U45A 4YC3A 4EH7A 5HESA 3KQ7A 4XRJA 3TIZA 5AA8A 3ORPA 2X1NA 3WARA 3VULA 1W84A 3BYVA 3NSZA 3TEIA 3VUHA 4AT3A 3QHRA 2ETKA 5FQDC 2R3MA 4Q5HA 3VS7A 5IDPA 3IOKA 2AUHA 3OY3A 4AW0A 4OTWA 1HOWA 4PMMA 4CFMA 4DGGA 4YZ9A 3T9TA 4FYNA 1UU7A 3QX4A 1KE9A 2W96B 1VZOA 2CJMA 3D9VA 2C3JA 3ETAA 4KABA 2GTMA 2UZDA 2WU6A 2YM7A 4TRLA 5C03A 5ETIA 3SQQA 3VNTA 3GBZA 4IZYA 3I6UA 2YACA 3GC9A 3AC5A 3UOHA 1PKDA 4TYEA 3GT8A 4YJTA 4QT1A 5DVRA 3FMKA 4XCUA 5DMZA 1OIUA 3C4EA 3NRMA 5JEBA 4IJPA 2GDOA 2REIA 2W05A 3PVBA 3NAXA 2QOKA 3DKOA 3R73A 2I0HA 3TM0A 3NYXA 3W33A 4AW1A 4LGDA 2R5TA 5CLPA 4RLLA 2X4FA 3RNYA 2JDRA 2ITTA 4Z55A 2J5EA 4CKRA 3UIBA 4A4XA 4NL0A 5EHYA 2X9EA 4AE6A 4W4YA 2G15A 2WMUA 4AOJA 1UNLA 3GU8A 3SGCA 2OWBA 3LCOA 2XK6A 4U44A 3B8RA 3W32A 1Y6AA 3D0EA 3R22A 3UO5A 5LOHA 1DAWA 2V0DA 4WT6A 4HVGA 3QQKA 1YXVA 2AC5A 4PTCA 4S34A 1MRVA 4YR8A 3AD4A 4XG7A 4AGDA 3Q4ZA 1O6LA 3QHWA 5F4NA 3TV7A 3ZM4A 5HTCA 4G3DA 2X81A 3F82A 3L8XA 4MD9E 3MBLA 2YJSA 4CNHA 5JZJA 2JBOA 4YHJA 3BHHA 2ZV9A 5AR7A 2ETMA 2ZB1A 3KXHA 4ZIMA 3OROA 3OWJA 2C3KA 4XX9A 2OH0E 2UV2A 3RINA 5AP5A
chains in the Genus database with same CATH superfamily
2OICA 2BR1A 5M09A 3RPYA 4EZ5A 4FTIA 4RWIA 4MCVA 2X4ZA 3COHA 3BLHA 3P79A 3QRKA 3KIOC 2R4BA 2XNOA 2OIQA 3RBWA 1NVSA 2UZEA 4IVCA 5IA5A 4YO4A 2RSVA 2XKCA 3PFQA 5LMKA 3MIAA 5B2KA 5AADA 3VUMA 1M2QA 5JQ5A 2BTSA 2YDJA 3NUUA 4AFEA 4YZBA 4DCEA 4NTSA 3R7YA 2B4SB 2VV9A 3BYUA 4KBAA 4AT5A 2GNGA 5KBQA 4AZSA 3I81A 3MY5A 3NZ0A 4UYNA 4ZZNA 5IQFA 3H0YA 3F9NA 3GQLA 4EZ3A 3NEWA 3E63A 4PPBA 1JSVA 4GU9A 3O5AA 1U5QA 2QOBA 2BZKB 4GCJA 4HZRA 2ZM3A 4MNFA 4XG8A 3EJ1A 4FZFB 3GU6A 4YLLA 1YDSE 4IB0A 4CFNA 3M1SA 4QPAA 3C0IA 3S4QA 3N4UA 2PZIA 3BLQA 4ANSA 3QFVA 1H4LA 3I5NA 5L3AA 4E93A 4GFMA 4PL3A 2FSTX 3RHXA 3MN3A 5IU2A 3QYWA 3PY1A 1H28A 3SG8A 4EOSA 4X3FB 2YAAA 4DHZA 4QMOA 4CZTA 4K33A 5K3YA 3MFSA 1W2DA 5BVFA 4GG7A 4BDCA 3ZC5A 3FLSA 3OG7A 3NVMB 3NDMA 2IG7A 2QR8A 2XK9A 4O4EA 3CQWA 1J3HA 3KN5A 4FKQA 3DS6A 2JFMA 4O4FA 3ZOSA 3EKNA 3ZU7A 4FVRA 3OXIA 4QNAA 3MI9A 4TXCA 5CT7A 4YJQA 4R3PA 4ONAA 1OL6A 1YXXA 3JUHA 3AOXA 3FMDA 4GIHA 3F3ZA 4Q9SA 4ZY5A 4O0RA 2WMBA 4IC8A 4YC8A 3QD2B 3LAUA 4UV0A 4CTBA 4NM5A 5ANGA 5EKOA 4RWJA 4BZNA 1OZ1A 2G2FA 3PA3A 4QP3A 4XJ0A 2WMXA 3MVHA 3AXWA 4XRLA 3ZCLA 5FTGA 3R9HA 4DEHA 4QQ5A 4LMUA 3F69A 4C38A 5CEOA 3HDMA 3KRLA 5HTIA 2NNWB 1TKIA 4M14A 3FQHA 5CQWA 4BB4A 4EQCA 4EUUA 4RSSA 4DTBA 3DZOA 2YM6A 3TNWA 2C4GA 3KL8A 5E8YA 4FG8A 3EZVA 4ORKA 2H34A 3CY3A 4CTCA 3GC0A 5HD4A 4U42A 2OK1A 3TKHA 4DEEA 1ZY5A 1U54A 4FOCA 2OLCA 4LV5A 4ITHA 5E1SA 4H1MA 3QXPA 3FZRA 5AIKA 4EHGA 3LIJA 4Y73A 3G5DA 4HOKA 3BV2A 2VO0A 1XJDA 3F66A 4KNBA 3QRIA 4XHKB 1IRKA 4FT7A 3O51A 3FY0A 4FTMA 5EYKA 2VWUA 3KREA 4DCAA 2OIDA 3FZPA 3VBWA 3DNEA 1F3MC 3HA6A 5A4QA 5KKRC 5L6PA 4BCQA 5L6WL 4BHZA 3BYMA 2V7OA 3NS9A 1F5QA 4HGEA 4UXLA 2RG5A 4DE4A 1REKA 4FMQA 5I5ZA 2HCKA 3DBFA 3UQGA 5LCJA 4ZXTA 3LM0A 3FAAA 5ETFA 5CEKA 3BE9A 3A60A 2I0VA 2Y6MA 4ZS0A 5M44A 4F9AA 4JQ8A 2VWVA 3RKBA 4BCGA 3FI4A 2PUIA 3CSVA 2IN6A 1W98A 3COKA 2FO0A 1IAJA 1YDTE 4NKSA 3D7ZA 3RPRA 3G33A 2BRNA 4A7CA 2XEYA 4QP7A 5HBEA 4TYIA 3TMOA 4YC6A 3QUPA 5CVFA 4N57A 4OAUC 1Q97A 3MW1A 2WMTA 3TTJA 3ENHA 4TW9A 4CV8A 3OUNB 3SA0A 4FSYA 5HLPA 1OPLA 2J5FA 3MA6A 4K8AA 1DI9A 5GZ9A 5T6KA 4IAIA 2XBJA 2YWPA 2WQEA 3NUNA 2Y0AA 3TIYA 4QDVA 3OT3A 3NYVA 3PE1A 3PRFA 5D9HA 3I1AA 4X2KA 3UMWA 3VF9A 1SYKA 4BICA 3VBVA 2CKQA 3U9CA 4ITJA 3EN9A 5ACKA 3CTHA 4NCTA 3CGOA 3VQUA 3FL5A 3FZTA 4AZTA 4FEWA 2ITOA 2UW6A 3U87A 2F57A 1U5RA 4RQVA 4RIXA 5HIBA 3V51A 4JAIA 1J1BA 2HY81 4S30A 3VQHA 3G9NA 4OTRA 2XH5A 1BI7A 3R28A 5BMMA 4JMQA 3VRYA 2ONLA 4F0FA 1GJOA 3P5JC 3AKLA 1R3CA 2WMRA 1WBWA 4WNMA 5LVNA 3HDNA 2PZYA 3C13A 4AAYA 5HG8A 3BELA 2XUUA 3HRFA 3ACJA 4NIFA 1XMMA 3EYGA 1OITA 1STCE 5IQBA 1J7LA 2VGOA 3EHAA 4D5HA 3D2IA 3VW6A 3GP0A 3PG1A 5A3XA 1ZARA 3HP5A 1KWPA 3CGFA 4IFCA 3ZONA 4DFXE 3UQCA 4HZSA 3R04A 4PTGA 4Y72A 1GZOA 1CTPE 4MD7E 5LMAA 3W2CA 3WF6A 4CSVA 3F2RA 1PXMA 3IQ7A 2EU9A 2R9SA 3O23A 1OIRA 3SW7A 3QXOA 3SXSA 4LMNA 5DPVA 3DJ7A 4V05A 3WZKA 3BHVA 3MFRA 4O4DA 4GKHA 3FBVA 5IUHA 4JRNA 3BQRA 3KK9A 5KMMA 4E6DA 3PVWA 3FMJA 2JIUA 4QP2A 4XP0A 2XIKA 3TUDA 3PWDA 4GK3A 4BI1A 1IASA 4QTBA 4R8QA 4ZSLA 4S32A 1U54B 2Z7SA 4F1MA 4EOIA 1TQPA 1V0OA 4FL1A 4NW6A 2YERA 5EM6A 4BZDA 3PJCA 3BGQA 3NUSA 1O6YA 4D28A 4DEIA 4IAAA 2UW4A 5DT0A 2VWZA 3G6GA 2PZ5A 3R1QA 5EQPA 2WD1A 3GC8A 1A9UA 4IWDA 2GHGA 2VTLA 4QMVA 5HVYA 3V5WA 4YO6A 2HIWA 4YURA 1OPKA 4D9TA 2YN8A 5BYZA 4CMOA 4L45A 4LUEA 4RJ7A 3R7GA 3R9NA 2BRMA 3VIDA 5M4IA 1PMUA 3GB2A 3RCDA 1ZZLA 3H0ZA 3R8UA 3NCZA 3DB8A 3TDWA 2VX1A 2W5BA 3AT2A 3PSDA 3QTZA 4M7IA 5E7RA 4EHZA 3HA8A 5HNBA 3FMEA 4O38A 1H0VA 4M66A 2OFUA 4NJ3A 1XBBA 2VX3A 2DYLA 4FSUA 4JT3A 2CPKE 2AEGA 2Q0BA 4EH8A 4ZJIA 5JH6A 3PVUA 5HE3A 4DG0E 2HXLA 3A99A 3VWAA 4L3JA 4DTAA 5GIOE 2EUFB 4G17A 3DK7A 4N6ZA 3ZC6A 3FXXA 4EH6A 3SKCA 2OGVA 5EI6A 4BWKA 1Q99A 4UWCA 3R8PA 4LV7A 2VTJA 4JI9A 2UZLA 4E4NA 2OI4X 3NUAA 4M8TA 3QUEA 3C0HA 4C4GA 2HZ4A 3P7BA 4RJ5A 1R39A 3F2NA 4X2GA 4CFUA 1TZDA 3WF5A 2IF8A 4JG7A 4DHIB 4AU8A 5DWRA 4MXXA 2C6LA 3GCQA 1QPJA 4XBUA 4I93A 4CLIA 1GZKA 4CV9A 3U4UA 1URCA 5AUXA 2VTMA 3C7QA 1R0EA 3A7HA 3LVPA 4XS2A 3JXWA 3BHTA 4GUEA 5A14A 2QU6A 4DEBA 5K4IA 3FI8A 5CQUA 5IH5A 3H4JA 5BX0A 1YOLA 4O81A 3F6XA 4YJRA 4IAYA 3POOA 4IM0A 4NW5A 4RIXB 4D4SA 2WQMA 5FWKK 2F2CB 5H8BA 3BV3A 2O5KA 4G6LA 4RA5A 2KULA 5IUGA 3KVWA 4OTDA 3LFFA 4BDIA 1OM1A 3EZRA 3SVVA 3R7VA 2F7XE 4H1JA 4C35A 1B38A 4A07A 1WMKA 4U3YA 3D5WA 4NIFB 2OFVA 1VLRA 4IACA 2VTHA 4TYJA 4X2FA 1VJYA 2UVZA 4EK4A 5AX3A 5CSHA 4XV3A 4GEOA 3FXWA 4AZFA 4W4VA 1ST0A 2SRCA 3DA6A 3EQRA 4C36A 4BDEA 4EHEA 5AUZA 3MFTA 4AA4A 3Q4CA 4WA9A 3HUBA 1OIQA 3RM6A 4UB7A 3Q60A 3QCQA 2QURA 3D83A 4E5BA 1APME 2Z7LA 4IVDA 4M0YA 1XMLA 2P55A 3OBJA 3CS9A 2BKKA 3PG3A 1H1SA 3AMAA 3BX5A 3RK7A 2OJJA 3KGAA 4D4YA 1CKPA 1YWVA 3FKNA 3ZEPA 3ZHPC 4BCNA 4IM2A 4LFIA 4EH2A 5GZ8A 5AR3A 4QMPA 4O0TA 4IEBA 2YZLA 5HI2A 3UVPA 3W0OA 1KE7A 2DS1A 4W9XA 4WRGA 2C1BA 2YCRA 4IBMA 4RJ8A 3REPA 3ANQA 4ZMFA 4HVDA 4PX6A 2Y7JA 3RZBA 1Z5MA 2ETRA 4ACGA 3A4OX 4E20A 4AZEA 1W8CA 4EZ7A 4YMJA 3DXQA 1J7IA 2YIWA 4C62A 3GGFA 2ZJWA 4FV9A 2HENA 4CCBA 1PMVA 4NJDA 3K5UA 5EI2A 3PXRA 5B0XA 1J91A 1YXUA 4ZMEA 1B39A 2GQRA 2UW8A 3LE6A 4UMPA 2YISA 4IM3A 1BUHA 3UTOA 4FV6A 4D0XA 1M14A 3QQLA 3BHUA 4I92A 3QTRA 2QO7A 5DGZA 4RIYB 2C69A 5IISA 3QKLA 4RG0A 4F6UA 1NXKA 3R8VA 4ANBA 2FH9A 4FL2A 4FL3A 3BL7A 4KIOA 1FGKA 3PVGA 5A4TA 3TT0A 3UP2A 5D1JA 2VWYA 4G3EA 2C6TA 4BBEA 4EK3A 2GQSA 4IC7A 4CG8A 2I0YA 1IA8A 3TZ9A 3OT8A 5IMXA 3PXKA 4LRMA 2CDZA 3DFCB 4AOTA 3CBLA 2RGPA 4FT5A 3VRZA 4BCPA 3PIYA 4QYFA 3AKKA 5AP7A 4MF0A 4O7NA 4J52A 1YHSA 1O6KA 4RC2A 4GKIA 4BTFA 4M69B 4OTIA 4F6WA 2BRGA 2WTDA 2AYPA 1QCFA 4J95A 4R6VA 4U3ZA 3W2PA 3NFFB 3IW4A 5EYCA 2P4IA 2J0IA 3ZUTA 2X7FA 1HCLA 3NIEA 4M67A 4RC3A 2DQ7X 3TCPA 3RAHA 2OW3A 5ANIA 2UZTA 5CEQA 2R3KA 1URWA 2E9UA 3HMNA 3LFSA 5CEIA 3ZBXA 4F64A 3CXWA 4G9RA 4RIWB 2RFEA 5HG7A 4RVKA 4AZWA 4WBBB 4IAKA 3BL9A 1J7UA 5DA3A 3MB7A 5FM2A 3NIZA 4AP7A 3RNIA 5JRQA 2PVKA 4DN5A 3PXFA 3DLZA 1E1VA 2WTVA 4NZWB 4DTKA 4I5HA 4DT9A 1G8KA 3TZ8A 2X8IA 3ZO4A 4HVHA 3UGCA 3HAVA 4RWKA 4OR5A 5E8SA 4MBIA 4MNEA 4YJNA 1M7NA 2VO6A 1OI9A 4NM3A 4WUNA 5FDXA 2ZM1A 2C3IB 3TZ7A 3CPBA 4GV1A 4O22A 3RWPA 2WQBA 4K18A 4M13A 4BCOA 4EOLA 5C8NA 4QRCA 4ZTSA 4F7SA 2BFYA 4O4CA 3DT1A 3ROCA 3MH2A 3VN9A 5T3QA 5E90A 3U54A 1GIJA 3NLBA 3FMMA 4UXQA 5JKGA 1B6CB 2VTIA 2PTKA 2VTQA 4OTQA 5JFWA 2I7QA 2O2UA 5EM8A 3R8MA 5CALA 4DFUA 5DR2A 5DH3A 3ZFMA 4FX3A 4EWQA 5CF8A 4UMQA 4BCMA 2WAJA 3CD3A 3LXKA 2V22A 4QP6A 2XA4A 5JSMA 4AWIA 2XK3A 3R01A 3GVUA 2PVMA 5CF4A 2QCSA 3BE2A 4ALWA 5A4EA 2C5XA 2QHMA 5I4NA 3EMGA 5FP6A 4JG8A 2R7BA 2IZUA 1YHWA 4OBQA 5HE2A 4ACHA 4NM7A 3FI2A 3R2YA 4BWPA 4C57A 4ZZOA 3ZXZA 1G8JA 1PRYA 3AD6A 4YLJA 4CMUA 4EK8A 3F88A 3FV8A 1TQMA 1BLXA 4QMYA 1DS5A 1FVRA 2UZWE 2X0PA 3LPBA 3NUPA 3QTQA 5ANKA 2NO3A 5H3QA 4ZJJA 5ITAA 4KUJA 3Q4UA 4D9UA 2QLUA 3ZDUA 4RLKA 3SXRA 2O8YA 2PVNA 3RK5A 2PU8A 4DEAA 3JY9A 1H1PA 4J97A 2PVHA 4G3CA 5IEVA 4RX8A 3TKIA 3RALA 4J8NA 4Z7GA 2OJ9A 3G90X 4LQMA 1CKJA 2PVLA 3PZEA 4DBXA 3RPOA 4QYEA 3LZBA 2I40A 1H8FA 4EOQA 3UPXA 4QDEA 3HRCA 3GENA 4DAWA 4MBLA 4BL1A 3AD5A 4RZVA 2BKZA 3HX4A 2F4JA 4CQGA 4FEQA 3EL8A 5CSVA 3UC3A 4CRLA 4YTCA 4PY1A 4AACA 1QPEA 4IX3A 4RC4A 2BHEA 2WTKB 5KMJA 4XLVA 3IW8A 4ZZMA 5FEQA 3G15A 5I9YA 3AQVA 4IE9A 4FKOA 4X3FC 3KXGA 3AC2A 3BKBA 2RFSA 2XKDA 4RWLA 4PMTA 3QCYA 4CVAA 2ZM4A 5BV3A 3BQCA 3BLAA 4QEBA 3WIKA 2O64A 3TG1A 3H9RA 1XH9A 5EW3A 5EYMA 4TL0A 3ZUUA 4C02A 4BCKA 2J0LA 4I23A 3VHKA 2JAVA 4IDVA 1YKRA 1ZOGA 3U51A 2J2IB 3IW7A 3TL8A 3MGYA 5CANA 4ZLYA 4MBJA 2GCDA 4EKKA 1PXPA 2OH4A 3A4PA 3C4CA 5EHLA 1PXIA 4DFZE 2JKKA 4O2PA 5JGAA 4NYEA 3K3JA 4N70A 4ERKA 3CY2A 3R8LA 5GINE 3UDBA 2JAMA 3TTIA 4GRBA 1HCKA 1NY3A 1ZAOA 5AMNA 4FKPA 4U0IA 4RVMA 2R3OA 4CXAA 5BVDA 1FVTA 3F5XA 2FSLX 4AF3A 2UW5A 4AX8A 4QPSA 5BYLA 3QTXA 3ODZX 4WG5A 2VWXA 3GU7A 3VHEA 3FE3A 1UVRA 1YOMA 3IPHA 4ZP5A 4BBMA 2EB2A 5BUJA 2QOHA 5DOSA 5IA4A 2XM8A 4EWHA 3AMBA 3GFWA 4FKUA 2G2HA 4ZSAA 3UC4A 5KMIA 3O71A 3ANRA 2OZAA 3ZTXA 1BYGA 1AD5A 2OKRA 5IQIA 1OKZA 5ANEA 5JQ8A 1XKKA 1A06A 2FSOX 4G3GA 3ORZA 3ROYA 4E4XA 1XR1A 4AN3A 5IA3A 3CCNA 4QMMA 4X2JA 4F7NA 4BGQA 1H0WA 5CZIA 2WTJA 3ZO3A 5FDPA 3BBTB 4FTUA 4F99A 4ZSEA 4HVSA 3ZS5A 1LEZA 2JFLA 3OFMA 4I94A 2ITNA 1S9JA 2VGPA 5DBXA 4CG9A 1Q3WA 1WAKA 5KHWA 5CXHA 3TNIA 3SLSA 2C0IA 4V0GB 2J50A 3L8PA 4GK4A 2GSFA 5ANDA 4I4EA 1M52A 5M53A 4XG2A 3D15A 3NNWA 4QTDA 4FC0A 4IFGA 1QPCA 3QZIA 3DNDA 4MYGA 4RMZA 5CI7A 3LMIA 1Q8ZA 3C4FA 4RFZA 3BHYA 3QQFA 3Q5IA 4K77A 5HE1A 2XCKA 3GU5A 4FF8A 4QYYA 5E4HA 1OGUA 2QQ7A 4FV3A 2H9VA 4E8AA 1XH5A 4EJNA 3ZZEA 4JBVA 3R9DA 1KUTA 2UVXA 4FBXA 4DC2A 4EH4A 2VTAA 5HICA 5E1EA 5TO8A 4LDTA 4FV0A 4CLJA 2ZB0A 5HBJA 5FXSA 4JS8A 4JDJA 3EB0A 5AR8A 4C2WA 3PP1A 5EFQA 3QWKA 2A27A 4LYNA 1WCCA 5ANOA 1OMWA 3TNQB 3BIZA 2GS2A 1H1RA 3DGKA 4IJ9A 4C34A 3IK3A 3LFEA 5E8VA 1V0PA 2ZV2A 4RJ3A 1PXNA 2WNTA 4F0GA 2I0EA 2X6DA 2QOCA 2UZOA 3Q9XA 2OF4A 2VTTA 3DK6A 1XHAA 3F3VA 3LFQA 2IW9A 2PSQA 2YIYA 3COIA 4E4LA 3UP7A 2O0UA 5JMSA 2PYWA 3SHEA 3M11A 3R1NA 3GNIB 3GOKA 4KIKA 5CENA 3UNZA 4FE2A 4MX9A 1YOJA 2P3GX 2YLFA 2CMWA 4RX9A 3MH1A 4RFMA 4TNDA 4AAAA 5BYYA 4QMUA 1SM2A 5KZ0A 4GSBA 1JQHA 2GFCA 3S0OA 4O7VA 4BDBA 4O6EA 1OL2A 5EDRA 4D0WA 4PNKA 1UU9A 2I1MA 4ARKA 4YU2A 4FIFA 4F65A 3KRWA 3E8CA 1RJBA 2R3RA 3CJFA 3FHIA 3JPVA 4DGMA 3DTWA 4W4XA 3KY2A 1MRUA 1PKGA 2BHHA 2PE2A 4PPCA 1WVXA 4C7TA 3LJ0A 3NFGB 3V5PA 2IPXA 1FPUA 2XF0A 5CASA 5I9XA 4OGRA 4BZOA 3PLAE 4O91A 3NAYA 3PXQA 3RCJA 3OVVA 4HCVA 3UVRA 5IH4A 4NU1A 4G6OA 3UMXA 3ORLA 4NKAA 3WE8A 5G1XA 4ZY4A 4A9SA 2UW9A 4IMYA 4RRVA 1ZRZA 4FYOA 3H9FA 3KF4A 4I5CA 4UZDA 5IDNA 4P5ZA 5EW8A 4I6LA 5CEPA 4CRSA 2OG8A 5AUUA 4DBNA 4KBCA 4RIOA 3QA0A 4L3PA 3R7OA 3GCSA 5HX6A 3B2WA 3T9IA 4YTFA 1U59A 3QC4A 3S2PA 4BTKA 3ZXTA 1SVEA 4C59A 1FBNA 3V5JA 5GZAA 2IJMA 4IXPA 2UZNA 2E9NA 2HW6A 3VUKA 3DJ6A 4PUZA 4Y5QA 4APPA 2QG7A 4JR7A 4LG4A 4WRSA 3LQ8A 3RAIA 4F63A 2W9FB 3KC3A 4GU6A 3DDQA 5M55A 2E9OA 2B9IA 3UIMA 4ZJVA 3TYKA 4C3PA 4IZ5A 4EC9A 1OL1A 3PPKA 1LUFA 3O8TA 4QMZA 5DR9A 5GJGA 4BKJA 1XH6A 3ZH8A 3ORNA 4BJJA 3P4KA 5I9UA 4AXAA 1OGYA 3P7CA 5IQGA 3GI3A 4IAZA 1PHKA 3ZSGA 5AP6A 4XP3A 2PPQA 2YDIA 4FSNA 3OMVA 5IQCA 3MFUA 4AXEA 2BMCA 2QD9A 2XRUA 4XMOA 5IQDA 4F1OA 1UKHA 2YCSA 3PJ2A 5HX8A 4L8MA 2RFDA 4M68A 5BVEA 1XQZA 1FVVA 5AUTA 2F49A 4KS7A 2HZ0A 4U41A 1FMKA 4FTJA 3CR0A 4EL9A 5BUIA 2R3HA 4DLJA 4EKLA 1YI6A 2WB8A 3KRRA 2PVJA 1O9UA 4ASDA 5IKWA 5A4CA 3L9LA 4XG4A 2WGJA 3P08A 5L8JA 1IA9A 4BWXA 5EQYA 5C8MA 4MXCA 5AP1A 2HWOA 2W06A 3QLFA 4KIKB 3WZUA 2HZNA 4F09A 3IDBA 4FTRA 4GH2A 4QQTA 3DK3A 4O0VA 4S2ZA 3QL8A 4FNWA 3O50A 2X0OA 2QOFA 4ZTNA 3ID6C 4L46A 3SAYA 3PZHA 3LCSA 4I1ZA 2OXYA 2CLQA 5CNNA 5J79A 4FKWA 4K0YA 5JFXA 4IHPA 4EORA 3DCVA 2ITXA 3DBCA 5CAUA 3Q2JA 4IANA 5FXQA 5CVHA 5AV1A 4D2PA 4FSWA 3PXYA 5FTOA 5IPJA 3U6JA 3SXFA 5DEYA 3D14A 4EQUA 5IQEA 4U9AA 2BPMA 4ACDA 2JBPA 4G5PA 1Y6BA 4R5SA 4BYIA 3JR1A 2YEXA 3ML1A 3UE4A 3IO7A 4V01A 4R7BA 3QALE 3LFNA 4R5YA 1FMOE 3R1YA 4X21A 3KULA 4G6NA 4QMTA 4FODA 3FYKX 4FEUA 4JJRA 2XZSA 4TT7A 2C1AA 4MF1A 1CDKA 3OCSA 4ITIA 2JKOA 1BX6A 3QYZA 5EM5A 2WMQA 4JR3A 3DDPA 3ERKA 3AT3A 4FKGA 4I0RA 4FIIA 4R78A 5EDQA 4IDTA 4U81A 4XG9A 4YLKA 5A6NA 1MRYA 4RX7A 4S31A 2W4OA 1WVYA 2W1ZA 5HQ0A 1SNUA 4OAVB 1Y8GA 4RFYA 4Y5HA 1P14A 1YXSA 4H3BA 4WG4A 1L8TA 3V3VA 4ASEA 2RKUA 3LQ5A 3L9PA 2QONA 5CY3A 4NSTA 2ZFYA 3HMMA 1H25A 5IF1A 4D58A 3EQCA 2Z02A 3KMUA 4OTFA 4XG6A 5TF9A 4LGGA 2WIHA 3UZPA 3TNHA 5L6OA 3EN6A 1CMKE 3OZ6A 2XNNA 3UO4A 4FJVA 3HMOA 2C6EA 3MY0A 4PMSA 2W1FA 4O21A 3DOGA 5DE2A 4U5JA 5CAVA 2BVAA 4MWIA 4FSZA 4LRKA 2A19B 2BZJA 5E8UA 2R3FA 5E8WA 4DFYA 5L2SA 2CNVA 2UZVA 4BJJB 4X6QC 2UW0A 2OXXA 3MH3A 4I21A 1H08A 1L3RE 3QQHA 4F7LA 4KIPA 5F94A 1H24A 4WSQA 4AG8A 4E6QA 1U4DA 1OECA 1OVEA 4M3QA 3NNXA 1JNKA 2B7AA 3QZFA 5EHOA 5G6VA 4U8ZA 4O82A 2WEIA 3CE3A 5CSWA 2X39A 3TXOA 3MTLA 3QKMA 4U43A 4C3RA 3MTFA 2XRWA 4UYAA 2YAKA 1PXKA 2GNJA 3L8SA 1UKIA 5EH0A 5CXZA 2JIIA 5LQFA 2WFYA 4U80A 2KTYA 4LUDA 1WBPA 3VS5A 3C5UA 4X7QA 4J7BA 5JZNA 2Q83A 3VC4A 4KSPA 1Y91A 3Q5ZA 4GVJA 1LPUA 4J96A 5HG5A 3KXXA 2Q0NA 3EQDA 4FIEA 5AP3A 4IQ6A 2Z8CA 4E4MA 4DHJA 4I0TA 3FZ1A 5EYDA 2Y9QA 5J9LA 3QU0A 3B2TA 5I9WA 1MUOA 3CPCA 4JDKA 1W83A 2BDWA 3C9WA 4ENYA 2VWIA 4K2RA 1V1KA 2BCJA 2GPHA 3E62A 2GU8A 2VN9A 3E92A 3NUXA 5AR5A 2YWVA 3OWKA 4XBRA 5HNGA 4ZLOA 5KMKA 3K5VA 3LXNA 3V6SA 3FDNA 2R3NA 2VNWA 5LVLA 1DM2A 1KOAA 4U79A 4NM0A 3C51A 2B0QA 4BCHA 4EOJA 3I6WA 3QCSA 4OTPA 3Q96A 3IGOA 4ZK5A 2H96A 5JGDA 2OJIA 4R1YA 1XH7A 3DKGA 1P4FA 3FC2A 3ZO2A 2XBAA 3HP2A 3KULB 3SG9A 4WBOA 1Q8UA 4L7FA 2JDTA 3E88A 4C2VA 3EQIA 4ZEGA 1OB3A 3OCTA 5DG5A 2W9ZB 1ZLTA 2W1DA 2CCIA 2VWBA 4TYHA 3UQFA 4U40A 4FTNA 5A9UA 2NRUA 1I09A 2GHLA 4CT1A 4I5MA 3ZYAA 2XNPA 1ZY4A 3Q2MA 5I9VA 2I6LA 3DXPA 2R3QA 5DT4A 5B2LA 5CNOA 3HV7A 3NGAA 5D12A 2XYUA 4MVFA 1OKVA 4AGUA 3OP5A 3T3UA 2WOTA 5J1VA 5HBHA 4CCUA 4RVTA 2VRXA 4NT4A 3WF8A 4DF3A 4D2WA 3E8DA 4CD0A 4EUTA 3BCEA 3FKOA 1ZOHA 4AFJA 1PJKA 5TE0A 5J9YA 1QL6A 3FYJX 3V01A 4CKJA 3L1SA 5J8IA 2ZV7A 4FIGA 3THBA 5J5TA 4FV7A 3KMMA 3D2KA 4QMWA 4BTJA 4HGTA 1SMHA 3QTWA 2G9XA 2IVVA 2XVDA 1YRPA 4JVGA 4EONA 3H30A 5AP2A 5KKRB 4FZ7A 3CLYA 2HELA 3EH9A 5H8EA 3VF8A 2XK8A 3CQUA 4XV2A 3UODA 2W17A 3PSBA 5HU3A 1OL7A 1P5EA 4USFA 3HV6A 4KBKA 4JG6A 4UEUA 3DBDA 4B4LA 2XM9A 2B54A 1H00A 3C50A 1PXOA 2XNGA 2XIZA 4G16A 3IKAA 1RW8A 3Q32A 3R00A 1Q4LA 3F3TA 3N9XA 5J5SA 3GEQA 1BL7A 2VTOA 4I22A 5AV0A 4JNWA 4PRJA 5DT3A 1KSWA 4CKIA 3C4ZA 2YLEA 2J0JA 3A61A 1PW2A 4L00A 4IW0A 2XARA 3A7JA 3HGKA 4FV8A 3COMA 3JVSA 4DH3A 4HVIA 3KRXA 3DKFA 1XBCA 2QKWB 4O7LA 3BYSA 2BAKA 5KO1A 4K1BA 4H05A 3W0RA 3ZLXA 3PYYA 4QMNA 4DEGA 5AFVA 3IONA 4A9UA 2XK4A 3E7OA 3NR9A 2ZV8A 5IH6A 3U6HA 2AQXA 4JX3A 5HGIA 3EN7A 4AQCA 5L2TA 2GFSA 2W0JA 4RJ4A 4J8MA 2JGZA 4L3LA 4L52A 3WIGA 4ZS4A 1JKTA 2W7XA 3QX2A 2VTNA 5CSPA 5K9IA 4GT4A 1KE5A 4MAOA 2GTNA 2OXDA 4O7TA 1DAYA 5HD7A 4AN9A