4E6DA

Jak2 kinase (jh1 domain) triple mutant in complex with compound 7
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
293
structure length
286
Chain Sequence
DPTQFEERHLKFLRQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYNLKLIMEFLPYGSLREYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 101
structure length 286
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e6dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e6dA01
2XH5A 5CU3A 5BMSA 5H8BA 1XBBA 2DUVA 3FZTA 4I3ZA 5FP6A 3HA8A 4BN1A 3LXNA 4NZWB 3D5WA 4KD1A 4XOYA 1GZ8A 1OZ1A 3ZONA 4U42A 2CGWA 4GYIA 2PUNA 4XBUA 3RHXA 2VNWA 2VTNA 4IZ5A 4EWHA 5FDXA 2CKPA 2QKRA 3KY2A 3MPMA 3QX2A 5IEXA 2X6DA 3ORKA 3D94A 2BKKA 4YJPA 4E93A 2R2PA 5L2SA 4F6WA 4G1WA 3C4CA 2PZRA 4ALVA 1QPJA 4RX5A 5IF1A 4L3PA 4DEAA 2XCHA 4FKTA 1FINA 3PIZA 5J95A 3A60A 2RSVA 2UW7A 4DTBA 3EOCA 4QMZA 3W32A 4CT2A 1PY5A 1RQQA 2WKMA 2XIKA 2JAMA 1O6LA 4OTDA 5IA0A 5KMJA 1I44A 1UU8A 1ZYSA 4RJ8A 4GVJA 2B53A 4EI4A 4F08A 3FSKA 2Y7JA 1ZZ2A 3EKKA 4AW0A 3CP9A 3VRZA 4LGHA 3LFNA 4AA5A 5ETAA 2WTDA 2GCDA 3FYJX 3IW6A 4FOCA 4FSTA 1AQ1A 2YISA 4RRVA 2XS0A 3Q5IA 4BGGA 2XF0A 3QC4A 3HUCA 2UZOA 5ETCA 4MXCA 4YJTA 4AT5A 3VBTA 2PZYA 1W0XC 3FV8A 2R3JA 4UN0C 4QMLA 3N4VA 3MS9A 3MH3A 1XH6A 4QYHA 4GKIA 4L7SA 4C02A 4WRSA 4YHJA 4ZTSA 4EOPA 5KZIA 3KMUA 5IA5A 3HMIA 4X3JA 1W82A 3FKLA 4X2KA 4BTJA 3PJ1A 2X2MA 2JKOA 4L00A 5H3QA 4JVGA 4D9UA 4FL1A 2V62A 4NTSA 3VN9A 3W2OA 5BQ0A 3FEGA 3LXPA 2ITWA 4KIKA 4H36A 4BY9E 3O8TA 4PWNA 5AV2A 1R0EA 3JXWA 4FUXA 4P90A 3UO4A 3PA5A 3EH9A 4CFWA 4CZTA 5FWKK 5LXMA 4GL9A 4ONAA 1JPAA 2VWVA 4L68A 5HGIA 3SQQA 3COIA 3VBVA 2XIZA 4GMYA 4IFGA 3FZRA 2BAQA 2H6DA 5HESA 2OW3A 4ZY6A 3DJ5A 4DFLA 5IA1A 4ZS4A 5GINE 4TYJA 3TV7A 5HE1A 3W2CA 3EN6A 4OBQA 3UOHA 4R1YA 3R8LA 5HEZA 5AV4A 1Y8YA 3FBVA 3ZLWA 3DTWA 4GIHA 2QLUA 4IC7A 3RPOA 3V5JA 3FKNA 5EKOA 3UIXA 4DBNA 3R1SA 5EDPA 4EOIA 3FMNA 2XJ2A 2QO9A 4TYGA 5HVJA 3HV7A 3FLNC 3RWPA 3TUBA 3Q4UA 5AUVA 4CZUA 3WF7A 4ZTMA 4WT6A 3KCFA 4AN9A 4MWIA 4FL3A 4L3JA 2X81A 2HZ0A 2ITPA 2YITA 4B8MA 4O0RA 2PL0A 4KKEA 3ROYA 4C34A 1BL6A 4FNWA 4JDJA 5DH3A 2VO6A 3A8XA 4A4XA 4BGHA 4DG3E 2BAJA 4P5ZA 3R28A 4FTNA 4U81A 3QZIA 5FBOA 4F9WA 1URCA 3MJ2A 5KHXA 3WILA 2BPMA 4O0YA 5CQUA 3UG2A 5J87A 4HCVA 3VS5A 1FVVA 1ZRZA 5FEEA 3I79A 5AIRA 4C57A 3Q4CA 2QOKA 1VZOA 1Z57A 3H4JA 1UWJA 5CYIA 4FA2A 2WXVA 3TNQB 4DGGA 4HVDA 4F99A 4HCUA 1PXMA 5DA3A 3RPRA 4DN5A 4MYGA 5K0XA 2B4SB 2H8HA 4JG8A 2A19B 4YLJA 2XJ1A 5EK7A 3W8QA 5TT7A 3S4QA 4PDSA 4ZIMA 2C68A 3V8SA 2EB2A 4AT4A 5LMKA 4IB0A 4AFJA 2J7TA 4KSPA 2IZRA 4JAJA 3V5PA 3MJ1A 2VO0A 3ANRA 4ZTLA 4KUJA 1DS5A 1OKYA 2VTHA 3DA6A 4EH9A 3VAPA 1WCCA 3R9NA 3MH2A 4AA0A 5K5XA 4ZK5A 1U5RA 3EQBA 2P55A 3M11A 4Q5EA 3IK3A 4F63A 3E8CA 3QHWA 5E90A 4U43A 4EH3A 5KNJA 5M4CA 2OG8A 3U54A 2GQSA 1JSVA 5IA3A 4I21A 1Q8UA 3LZBA 4IX3A 1QMZA 4BCHA 4AA4A 5KMLA 5BYZA 2C3JA 3PVGA 4IQ6A 4F7NA 4QYFA 3OW3A 3E7OA 4IADA 3EL8A 4AXAA 4C37A 4IX5A 4LYNA 4YJRA 4RFZA 4E6AA 2E9OA 2W06A 2Z7LA 1XBCA 2X7FA 5M09A 4CFNA 2X6EA 3IOKA 3DFAA 5IU2A 3PP1A 4FIIA 2B0QA 5BUJA 3TWJA 3HDNA 2W1GA 2J0MB 2ZB1A 1S9JA 1U54A 3UZRA 1U4DA 2NRUA 4FV6A 4FC0A 5A54A 4DH1A 2G9XA 3F9NA 2QG7A 3HGKA 5KMIA 3TKIA 5DT0A 4HYSA 4APCA 3G9NA 4OT5A 2HW7A 1PKDA 4MCVA 2XZSA 5A14A 1Q8TA 3I5NA 3L1SA 3MB6A 4WSQA 2J5FA 2Y8OA 5CAUA 3ZC5A 2Z2WA 4XLVA 2NRYA 4X2FA 2W1IA 3S3IA 4DFBA 5IZFA 1Q61A 1R78A 4FIHA 4BTMA 2P0CA 4H05A 4L9IA 5IUGA 2HK5A 2UV2A 5CSVA 4K33A 3ZSIA 1REJA 4ORKA 3OF0A 3VO3A 3VS2A 2IW8A 3UQCA 3ZTXA 4FVPA 3VUIA 4ASZA 4M68A 4D4VA 4F9AA 4I4FA 2VO7A 4FT5A 1APME 4BZOA 3QX4A 3KN5A 3OBJA 3V51A 5LVNA 5HVKA 4IWOA 5M4UA 4Q5HA 3FDNA 3PTGA 5CENA 3MBLA 3QCQA 3E8NA 4BIDA 2ACXA 4O2ZA 3F5PA 4BDDA 4YO4A 3BLHA 1R1WA 3D2KA 3KRLA 3MA3A 4GK3A 3VHEA 4DE4A 4I24A 2GQGA 3FZSA 3E62A 3V5WA 2C6LA 2WU6A 2XVDA 4V0GB 4QYYA 4RX9A 4W4XA 4C58A 3OEZA 2FO0A 2XK3A 4IZ7A 4K9YA 4V05A 3K3JA 4IAAA 4BDAA 4D0WA 4EH2A 4E7WA 2VX1A 2JDSA 2C5OA 1R39A 4O84A 2WPAA 3GI3A 4J1RA 4BR3A 1YXVA 4WBBB 1YVJA 3FKOA 4HYIA 4B4LA 5FXRA 2VWXA 3NYXA 3FQSA 4YZBA 4O82A 3QQKA 4HOKA 1WBOA 5AP1A 4O7ZA 2I40A 3ZRMA 2UZLA 5EM7A 4AN3A 4PL3A 3PG3A 4RVLA 3ET7A 1KOBA 2XNBA 3BGPA 2CN8A 4EOKA 2X9EA 4XG7A 1TVOA 4XG9A 3UP7A 3NAYA 4D5KA 3Q96A 4BCJA 4E1ZA 2CKOA 3P7BA 4EH6A 4ZZNA 3II5A 4FTCA 4O7NA 5DRDA 3Q9ZA 4YPDA 4X2JA 5HVYA 4TNBA 3TEIA 3ULZA 4Y85A 5IMEA 3RPSA 4P2KA 3NW5A 5CS6A 4J97A 4FX3A 2BIYA 4EK8A 3IW8A 5JH6A 2IPXA 4S30A 4PMTA 3ZFMA 4BI2A 4F1TA 5AUUA 3EQHA 3RK5A 4E26A 4U6RA 4CVAA 3MFTA 2ETKA 5C4LA 1G8SA 3PLAE 4YNEA 4J71A 2BRMA 4DG2E 4F0FA 3ULIA 4OTPA 5HO7A 1H00A 3SXFA 5E1SA 4EBWA 4UBAA 3THBA 5J8IA 5AA9A 2FSMX 2YIYA 3AC8A 1DM2A 3MVJA 1WAKA 4HYUA 2WIHA 2Y4IC 3PY1A 3RZFA 5C01A 2HYYA 4OTGA 2OZAA 3ZMMA 1FMKA 3ZC6A 4HPUE 4F1OA 4CQEA 3QTIA 3TZ7A 4ALUA 2WD1A 3HMNA 5IEVA 4E3CA 5CEMA 2LGCA 3L9LA 3R6XA 4XMOA 4D5HA 4DFZE 2JFLA 3IPHA 5GIOE 4Z16A 3CPBA 3DV3A 2HXQA 5CQWA 3BHYA 4JS8A 5HBEA 4D1SA 5L2IA 4B6LA 3ORPA 4XX9A 4AE6A 2X2KA 4GK2A 1UKHA 4PF4A 4JG7A 3GCSA 4QMVA 4I1ZA 2ETMA 3EYHA 2OWBA 4M84A 4O27B 3CKXA 2GSFA 4KKGA 4L67A 2R0IA 2WEIA 3RPYA 5CLPA 4D2PA 3E63A 4O7LA 2IVSA 4IX6A 5DYJA 4RIYA 2IW9A 3LMIA 3BYVA 3QXPA 2AC3A 4PNIA 1FGKA 2Y6MA 3FSFA 3R1NA 4AF3A 3GC0A 1OL5A 2JDVA 4KS8A 3IDCA 3GC7A 1BKXA 3E64A 3F5UA 4XYFA 5AP7A 3LCOA 4C4GA 2J50A 4CG8A 3F7WA 1XBAA 3A2CA 3IW7A 4C3PA 3AD5A 3MV5A 3QUDA 2B1PA 4FKPA 5HNIX 3IKAA 3ITZA 2X7OA 4M7IA 3LQ8A 3FMKA 2VAGA 3OUKA 1O6KA 4RGJA 5IMXA 3Q6UA 4FV9A 4Y95A 1JAMA 3VUDA 2YWVA 3RGFA 3FE3A 3I6UA 4K6ZA 1WBTA 2WHBA 1GIIA 4IM0A 5JZNA 4JQ7A 3K2LA 4DC2A 5AR7A 1M52A 4EK5A 4FG8A 1E1XA 2BZIB 2R0UA 1YWNA 1KV1A 1OECA 2P3GX 3PJ3A 4IM3A 5FUTA 4CYIA 3L9PA 4CFUA 3ZM9A 3NYVA 5LVLA 1MP8A 3BV3A 3LFAA 3QRIA 4FI1A 1Q97A 3EJ1A 3D0EA 2V7AA 3W8LA 3M1SA 3ZSHA 3G0EA 2AYPA 3BYOA 5JRQA 3ORIA 3CGOA 2C6MA 4O0VA 2JIIA 2DWBA 3KF7A 1JVPP 3KVWA 3RAKA 5DEWA 4U97A 5EG3A 2W96B 2F2CB 3VUMA 1ZLTA 3GOKA 2YN8A 4PTEA 3W2RA 3QLGA 3KMMA 3KRJA 3LLAA 3ZFXA 3NUXA 2GTMA 3NNWA 4BDJA 5FXQA 3QQHA 1URWA 1FPUA 1F5QA 1NVRA 2XNGA 2VWZA 4QTAA 2CCHA 5AM7A 2J0LA 4IIRA 4X6RA 4C61A 3V3VA 1KSWA 3KRRA 5C4KA 3LFEA 4MF0A 1KOAA 3L8XA 2HENA 2Z7RA 4RVMA 3P0MA 3MN3A 4FTAA 3NYOA 3WF5A 3BEAA 4I0RA 5JFXA 3C0HA 3RAWA 5I9UA 3B2WA 2EWAA 3OXTA 3ZZEA 3ATSA 3BBTB 2VN9A 3ZLXA 4I41A 4FZAB 4G5PA 4GCJA 2XNEA 2F2UA 4Y5HA 4Y73A 4ZMFA 3BCEA 3R9DA 4RG0A 3UYTA 4BDFA 3BHVA 1ZOEA 3P4KA 1H26A 3GB2A 3ZUUA 2UZWE 2GFSA 3P86A 3ZO2A 4EJNA 3VNTA 1DI8A 3I6WA 2XYUA 1W7HA 4HZRA 4ANQA 3R8PA 4BL1A 2QVSE 5JFWA 3UMWA 4B7TA 3ORNA 3G9LX 2XIXA 4MBJA 3OOGA 2BHEA 3OHTA 3QZFA 5EH0A 4C4EA 2Q83A 2G2FA 3WYYA 3AD4A 3DCVA 3EMGA 4IVCA 3U4UA 4A7CA 5AAEA 2EB3A 2J9MA 3CQUA 4I5CA 4MQ2A 4EKKA 5CEIA 5CU4A 3SOAA 5J9ZA 4W4WA 5GJDA 2W9FB 4F70A 2PZ5A 4QMXA 4DYMA 2I7QA 1IAJA 2WQBA 4QYEA 1PKGA 4FKLA 5DLSA 4OBOA 3BWJA 3MIAA 3QTSA 2VRXA 4WOVA 3P7CA 5H2UA 5JK3A 4BKYA 4HVGA 1P2AA 3PE2A 5AM6A 2F7ZE 4RJ7A 4OTIA 5FRIA 4EOLA 2CLXA 4YBKA 3FC2A 1M2RA 5IQEA 5HCYA 4M66A 4GG7A 4NM0A 1NY3A 3TN8A 3C4FA 4C36A 4QP1A 3KULA 5I4NA 4QPSA 1JSUA 3R2BA 4JOAA 3RK9A 5CNNA 3W2PA 3OWJA 5I5ZA 4WNMA 1B6CB 2OSCA 3WF9A 2Z02A 3NUSA 3A8WA 4FTMA 5DOSA 1CSNA 2ZDUA 4QTCA 4BICA 3KXNA 4RC4A 2HELA 2PTKA 3MI9A 2XIRA 4BZDA 2XKEA 1YXTA 2Z7QA 3NNVA 1OIRA 4LV5A 3TG1A 1CTPE 2DYLA 4RFYA 3NMUF 3FI2A 4FSNA 1ZOHA 2ERZE 3KXMA 3UGCA 1A48A 2JEDA 2C0IA 2KTYA 4AUAA 4BRXA 3UYSA 1Y8GA 3QXOA 1J7IA 3JY0A 2UW9A 1ZMWA 1WVWA 5AR5A 5J79A 4I6QA 4QP6A 3D5UA 2LAVA 4EUTA 3BU5A 4UALA 2YZLA 2ZYBA 3P5KA 4G3CA 3TUDA 1W8CA 3CSVA 2P33A 5AUZA 3UIMA 4G3EA 3EQDA 3G0FA 4H3QA 4ZP5A 3ZYAA 3NEWA 4O0XA 1ZMUA 2H96A 2W1ZA 4JQEA 1ZMVA 2ZMCA 1OPJA 4TWNA 2OLCA 2GHLA 4KAOA 2YM5A 4ZLZA 2BFYA 3MA6A 2ZV9A 4EZ3A 2VGOA 4FG9A 2QI8A 4FTUA 4DITA 5D11A 5IQGA 3Q32A 3HAVA 1LUFA 4IJPA 4YTIA 5IG1A 5M07A 4MNEB 5T3QA 3BKBA 2SRCA 2IN6A 1YKRA 1AGWA 4RZWA 2W4KA 3PPZA 4QP8A 3ZRLA 3EZVA 3FMDA 3G51A 4Z55A 5C8KA 4FKIA 4MKCA 3DB6A 3EFWA 4FVRA 4QMYA 4OTFA 3EWHA 4IZAA 1M7NA 3HA6A 3MB7A 4QQ5A 3QFVA 5A4QA 2UZBA 1Q8ZA 2IO6A 5HE0A 4FV7A 3K54A 4DGLC 2NNWB 4EH5A 3DNDA 1OKZA 3KEXA 4RC3A 3SXRA 3UVPA 2ITNA 3HV6A 4BCOA 3KREA 5DN3A 2VX0A 4II5A 3SX9A 3LJ2A 2JIVA 2OIDA 2XA4A 2YDIA 4J7BA 4DH5A 2ITTA 4OLIA 4R5SA 4FSUA 1ZYLA 4RIXB 5IPJA 2R3GA 3CKWA 3GQLA 4D2WA 4QQJA 5CZIA 4QT1A 4IH8A 3COMA 3C0GA 3A4PA 4IB1A 2R9SA 4ITJA 2BIKB 3PJ8A 4EOJA 5KE0A 5C8NA 2BR1A 1FVRA 3CY3A 3A7JA 3VS6A 3QD0A 4ZJJA 2XIYA 3RI1A 3ZSGA 5CVHA 3FI4A 4F64A 4RJ3A 2XBJA 3W2SA 4WUNA 1YDSE 2IG7A 4KINA 3Q53A 5F20A 4C4HA 5I0BA 4MXXA 1QCFA 3G2FA 5JGBA 4TW9A 3VBXA 3ZFYA 3BU6A 1H8FA 1KE5A 4U80A 4JX7A 4XLIA 3SRVA 4XHKB 3UJGA 3W16A 2GNLA 4EWQA 5AA8A 4CCBA 5BVFA 4HGLA 3CGFA 2C3IB 3ZEWA 1WBWA 2QOLA 3NSZA 2ITVA 4M97A 3S0OA 2B54A 3F82A 4HJOA 4MXOA 3F3VA 4YJOA 3OTUA 2C0TA 4YUQA 3LOKA 4EOQA 5I9ZA 1PXKA 4OUCA 1SZMA 3EZRA 3WIKA 5ACBC 5HZNA 1UV5A 5K9IA 3L8VA 3EN4A 5L6WL 5I9WA 2YJRA 3MFRA 3RKBA 1JKSA 3F2NA 3HRFA 1ND4A 2B9IA 3CXWA 4FR4A 4BF2A 3ZO1A 4HVIA 2ZOQA 3T9TA 4AX8A 3Q04A 2W4OA 5D7VA 5DR6A 4E4LA 3TDWA 3OZ6A 4IAIA 5JT2A 3BIZA 4K8AA 3ALNA 2FSTX 4YU2A 2XCKA 3ZXTA 3LCKA 3QRTA 3U55A 4QP7A 2R3RA 2Y4IB 4KBCA 5AR8A 1CKIA 5HBHA 1H1RA 5HQ0A 4EYJA 5CXZA 4IM2A 3AC2A 3F2RA 4XG8A 5EW9A 4CQGA 4B9DA 1GIHA 2YM6A 4FT0A 2BAKA 4JIAA 3ZLYA 1CKJA 4RIOA 5A4EA 3LLTA 2Y0AA 5CEQA 1WBSA 3NLBA 4G2FA 3ZU7A 2YIWA 5AR2A 1PMUA 2W1EA 4QTDA 3ZS5A 1NW1A 4UY9A 3ERKA 3DS6A 1DAYA 4WKQA 4EQMA 2R3KA 3R30A 2PVMA 3UO5A 2CKQA 1V0PA 4BYJA 3ATTA 4N4SA 2QR7A 1H08A 2QHNA 2X4FA 4TRLA 3OCBA 3A7GA 4O1OA 3VWAA 4D9TA 2V22A 5CT7A 3WZDA 4A4OA 5AP5A 3PP0A 3R83A 4FEWA 1ZOGA 4I93A 4V0GA 5BMMA 1K2PA 3FQHA 4WG4A 4BYIA 5J9YA 4O83A 4BB4A 1OIYA 4FZDB 2X2LA 5I3OA 4EUUA 1SMHA 3UNKA 3KQ7A 4R78A 3AQVA 4JT3A 3JVSA 5ETFA 4XP2A 5LMKC 2RFDA 2WQOA 4BIBA 4FBXA 2JBOA 2BRBA 4FKVA 2ETRA 2IWIA 3MDYA 4LV8A 3C4XA 4W4VA 5BYYA 3DXNA 3HL7A 1OIQA 1H07A 3QA8A 4F9CA 5M08A 3MGYA 4ANOA 5BUEA 4BTKA 4H39A 3R0TA 1KE8A 3QWJA 3TNWA 4BBFA 4FTOA 2GS6A 4A9SA 4A9UA 1XH9A 3E3BX 1K9AA 3PJ2A 3MVHA 3TV6A 4FTTA 2ZMDA 3FMLA 2WNTA 3EN9A 3JR1A 2WQEA 3WE4A 4XV1A 5L3AA 5L2TA 2OF4A 4L52A 3PFQA 4C38A 4CRLA 5E9EA 3O7LD 4RC2A 1G8AA 4NL0A 3MY5A 3PXRA 4AZFA 1ZY4A 5ANKA 5GZ9A 1ZARA 4TYHB 4X3FC 2OGVA 3RP9A 3FPMA 4W9XA 4PL5A 5DGZA 3E8EA 3RK7A 3SG9A 4L45A 3FI8A 4IVDA 1BX6A 4NM3A 1UNGA 4GT4A 4V01A 4NFNA 1DAWA 1GNGA 4UWCA 4WBOA 1IEPA 4NKSA 4E5BA 5IA4A 4NTTA 4MK0A 3FAAA 2O63A 3ELJA 5JRSA 4IZYA 4LOQA 1MRUA 1XO2B 4U7ZA 2F9GA 5ANIA 3NYNA 5KMMA 3KK8A 4GV1A 4RX7A 1ERKA 3D14A 2W4JA 5C1QB 2PVKA 4USEA 4X21A 5J7BA 4PRJA 3UTOA 5DWRA 2VD5A 3A62A 4AN2A 5IKWA 1GAGA 5D12A 4CZYB 2RKUA 3MPTA 4MNFA 3SXSA 3ACJA 2ZAZA 4I0SA 4J8MA 5AR3A 3EYGA 3IW4A 4QP3A 1XQZA 3R04A 4EKLA 1YXSA 1QPCA 4EOMA 3ACKA 2PULA 3RCDA 2A1AB 4UB7A 2R3OA 3TM0A 3C4EA 2UUEA 2YDJA 4R8QA 3MPAA 4XUFA 3U6JA 3W55A 4U0IA 3KXGA 1T45A 4BC6A 3AD6A 3FLWA 2OFVA 5AX9A 3OCSA 4G6OA 4EEVA 2JBPA 3CC6A 3MYGA 4JR3A 3KRXA 3CPCA 4FK3A 3WE8A 1H0WA 1MQ4A 5F4NA 5D1JA 5KUPA 2B9FA 3BE2A 3WI6A 4LOPA 3IGGA 3OBGA 4AW2A 1KWPA 4AG8A 2PE2A 3VS3A 4AZEA 4F7LA 1DI9A 1MQBA 2I0VA 5DPVA 4QQTA 5KBQA 2OH0E 4QPAA 4O1PA 1NVQA 3H30A 3OUNB 3LVPA 2PVFA 1YQJA 3ORZA 3C13A 4QMOA 1TQMA 2XMYA 4QP2A 4RBLA 4U5JA 3I0QA 4UEUA 3QGYA 3VUKA 3VW8A 2A0CX 3DKOA 4RIWA 3CS9A 4FYNA 4DHFA 4CNHA 5LJJA 4DH3A 4E6CA 5TO8A 2YCSA 3TIZA 5H9BA 5HLWA 3QQLA 5KCVA 3N51A 5HU3A 4FVQA 5IQAA 3EQFA 4B99A 4JI9A 2O2UA 2J4ZA 3GBZA 2OXXA 4BBMA 4M69B 2OJFE 4HGSA 3QLFA 2I0EA 4IWDA 5AMNA 3EFKA 4FE2A 1IASA 4OAUC 5DNRA 3QHRA 3WZUA 1XH4A 2PY3A 4X2NA 1I09A 3UNJA 4KIOA 4ANLA 3I7BA 3W33A 2YHVA 4GFMA 4PV0A 4FEUA 4G9RA 1BI7A 4E5AX 4DLJA 2B55A 3DDPA 2B9JA 4X2GA 4DLIA 2PVNA 5DHJA 4HPTE 5I3RA 2X7GA 3UIBA 4JIKA 3GC8A 3DAKA 4Q2AA 3NCGA 3QTWA 3JY9A 4MD9E 3DKGA 3GCQA 4ERWA 2VUWA 2X8IA 3OD6X 4ZSEA 2XM9A 5AUXA 4FUYA 4EK3A 4DCEA 4IANA 5T6KA 2GPHA 4KKHA 2WEVA 4L46A 4LFIA 2BFXA 3QC9A 4N0SA 3NUAA 3HMPA 5JKGA 4AP7A 2G15A 4OT6A 3JVRA 1H28A 1V1KA 3DBDA 3HEGA 5EM6A 1PF8A 4MBLA 4BDBA 4IAYA 4W8EA 3TV4A 4DGOA 1KUTA 1EH4A 1U59A 2A4LA 4F65A 3LM5A 4Z9LA 2PE1A 4I6HA 2JC6A 4LI5A 3RMFA 4B8LA 5HCXA 4WNKA 4CTCA 4ENYA 3TUCA 1YOLA 4BWXA 3HV3A 4BWPA 1H1QA 3IOPA 2VZ6A 2C1AA 3A7HA 4AT3A 3HX4A 1TQIA 3VC4A 1FOTA 3RCJA 3TXOA 4GSBA 5EFQA 1YHWA 2ZV7A 5HKMA 2XEZA 4G6LA 3DBEA 4XOZA 3NX8A 2VTAA 4F9YA 3QUEA 4FGBA 2DQ7X 3EFJA 5BUIA 4CT1A 5CAPA 3DKCA 3MSSA 2HAKA 3ZCLA 5AUYA 1OUYA 2JDOA 2YCQA 2WFYA 2RF9A 4LMNA 2JAVA 3R9HA 4AOJA 3D83A 4UV0A 2FSLX 2G2IA 2WZJA 3KVXA 4MD7E 2QOBA 3VQHA 3HV4A 3R2YA 3ZRKA 4AW5A 4PP9A 5CSXA 3UMXA 3C9WA 4HGTA 3DBFA 4LGGA 1M2PA 4DFNA 3PVUA 4MF1A 2BTSA 4DH7A 4R77A 3LW0A 4P5QA 5CXHA 1CDKA 5IISA 2HZNA 3EFLA 2QOFA 2YLEA 4XEYA 5K4IA 3LCSA 4LRKA 5C8MA 2CGVA 3Q9YA 3RNIA 3U4WA 5DR2A 1JKLA 5LMBA 3P08A 3D5XA 1WMKA 3V5QA 4NYEA 4TTHB 3QCXA 2O8YA 4BI0A 4ASXA 4IJ9A 5EI8A 4O81A 2WB8A 2J0IA 4E5WA 4YTCA 1W83A 5LARA 3WARA 2FB8A 2PK9A 1ZYJA 2IZSA 3QYZA 1J91A 3DK6A 1Q8YA 3EKNA 4JNWA 5CVGA 3UNZA 1XWSA 2JITA 3P9JA 4CKIA 3PJCA 1GZNA 2PUIA 1U5QA 4CEGA 4UXQA 3D15A 2P2HA 4TY1A 4ZTNA 3SOCA 3B8QA 4MH7A 4F0GA 2I1MA 2VTJA 3DU8A 4IAKA 4RA4A 4QYGA 5CASA 5J7HA 1UWHA 3R00A 1LPUA 3C7QA 3HVCA 3VBQA 4Y5QA 5HX8A 3E8DA 3IDBA 4FT7A 4GT3A 5JEBA 4IB3A 3KK9A 5ANOA 2QNJA 5KHWA 1P14A 4LOOA 2VWWA 2YWPA 3EQGA 4FV3A 4L3LA 4NM7A 2O64A 2OKRA 1CKPA 3PSCA 4IAZA 4XH6A 5D41A 4TL0A 2JKQA 2QO7A 5BX0A 2PPQA 2BDWA 3QRUA 1OMWA 4J52A 3OTVA 4BBEA 2W99B 2W5HA 3P79A 4QPMA 2ZV2A 3COKA 4GW8A 3BU3A 3TZ9A 3CTJA 4U3ZA 3QTUA 4L42A 5HE2A 2Z8CA 4AGDA 4D0XA 3QD4A 1VYZA 1U46A 3R1YA 5L6OA 2OJGA 4QMUA 3FMJA 3RWQA 4ACMA 4L44A 3NGAA 4O96A 3BV2A 3KKVA 5E91A 1KV2A 2CGXA 3QA0A 5FTGA 4IHPA 3HAMA 2BMCA 1J1BA 5J5SA 4K11A 3VULA 1G3NA 4A9TA 5CAOA 3G6HA 3U87A 3QKLA 5E8UA 1L8TA 2BRNA 2R3MA 4G3DA 1FGIA 4MNEA 4YP8A 5CF8A 5EM5A 4U41A 2VWBA 4J98A 4RJ4A 4TYIA 5FP5A 3ANQA 3R8VA 4H1MA 3C50A 4L01A 2WTJA 3UIUA 2GQRA 4NW6A 5CAQA 3JUHA 2GHGA 1XR1A 3QWKA 1SVEA 3QAME 2C30A 4FODA 4G16A 4PDOA 3EHAA 3O2MA 4C3FA 5KO1A 1XH7A 4FKWA 5GJFA 4BWKA 2X1NA 5CAVA 3GU6A 3G6GA 3DAEA 3CY2A 3OY3A 4RWIA 1A9UA 3CTHA 2UVZA 4EQUA 4OGRA 4QD6A 3G33A 3IS5A 3W10A 3ZXZA 2GS2A 3DNEA 4D2TA 4CCUA 4D2SA 4L53A 3HKOA 4OTQA 3UDBA 4LL5A 3I4BA 2PVLA 1LR4A 2F7XE 3RAIA 3FLYA 3GC9A 1PXNA 3OG7A 3PYYA 5EDRA 4RIXA 3L8PA 4YBJA 4F1MA 3MH0A 4FSWA 4XV2A 5AV0A 4TN6A 4XG6A 4RX8A 2E9NA 4EZ7A 3Q6WA 3UG1A 4FKJA 5HCZA 4YZMA 1IR3A 4LUDA 4YNOA 5I9VA 4EHGA 1VEBA 4GJ2A 2XK7A 4FG7A 1STCE 3GGFA 2F57A 1H1PA 4NCTA 5CALA 3IDPA 3HZTA 3POOA 3CD8A 5TOZA 2ZB0A 5GIPE 5ANEA 5H8GA 2BTRA 5A4LA 3H0YA 5D7AA 3D2IA 3O23A 3ROCA 5DMZA 3A99A 4DG0E 5EW8A 2UZTA 4RVKA 4OR5A 5CNOA 3ZO3A 1IG1A 1OB3A 4GG5A 3G15A 4AACA 2I6LA 2O5KA 2UZEA 3CE3A 5L8KA 3CD3A 1M7QA 1ZZLA 4FIGA 5E8XA 5FGKA 1E9HA 1NA7A 3KF4A 4MTAA 3C5UA 5L6PA 5EHOA 5M06A 5HIDA 5EHYA 4D28A 5KKRC 4YJNA 4ANMA 3OOMA 4JBPA 3F7ZA 4I94A 4NUSA 4QMMA 4FSZA 5EOLA 5J5TA 3KU2A 5K3YA 2CN5A 4NFMA 3V6SA 5JQ8A 3LQ5A 3FLSA 4NIFB 2RG5A 4X3FB 3TJCA 2CNUA 4H3PA 5AP3A 4ZJVA 4ZZOA 5DEYA 1U54B 2YM4A 4OBPA 5HU9A 3DXQA 2QLQA 3NUUA 5EQYA 3ODYX 2WU7A 4IX4A 4DEIA 4A4LA 2C5YA 3OXZA 1W98A 5HNGA 1H1WA 2C47A 2EXMA 3GFWA 4QRCA 4YJQA 3CQEA 3ZUTA 4Z7GA 2QCSA 4FKOA 1REKA 3BHTA 2V5QA 3QKKA 1J7LA 3FXXA 1YW2A 4FK6A 4M14A 1YI3A 3H9FA 4J96A 1TKIA 3GEQA 4Y72A 4RFMA 3FZOA 3FXZA 3UPZA 3LKMA 5CWZA 2C3LA 2YJSA 2VO3A 4YZNA 2C0OA 1G5SA 3WBLA 5FBNC 2P2IA 2OF2A 1X8BA 3BEGA 2WMTA 4O7SA 1PMVA 1MRVA 2W0JA 3DJ7A 3PRIA 4NKAA 3AMBA 3VBWA 4IDTA 4PDPA 5H8EA 3ID6C 4JXFA 3LXKA 3CR0A 5I9YA 2IZUA 4ACGA 3CJFA 3UVRA 5CEOA 3PSDA 2VTQA 4FYOA 3F6XA 4DGNA 3K3IA 3OC1A 3VS7A 3ZUVA 2OJ9A 2NPQA 3H10A 3NUYA 4ASDA 2FVDA 4O7TA 5A4TA 3PXYA 4YTHA 3G5DA 4NWMA 5L8LA 3QUPA 1LEWA 2GNIA 3RPVA 5L2WA 3Q52A 2ZM1A 4GUBA 5IUIA 4A06A 1UU3A 4IWPA 2Y9QA 5FDPA 5A46A 2YABA 4NM5A 3SLSA 1P4OA 3LE6A 5IQCA 3R02A 1FQ1B 2UVXA 4QMQA 3QTRA 3NPCA 3LCTA 4XS2A 4AOTA 4LM5A 4I5PA 2FGIA 3FL4A 3O96A 4TWCA 2GDOA 4S32A 1F0QA 3R8ZA 3BQCA 5IUHA 2JKKA 4GFGA 3KFAA 3SC1A 1OVEA 3LXLA 3DY7A 5M53A 3DB8A 2HY81 2UZVA 1JKTA 3F3UA 4HVHA 2WMQA 3G90X 4GU6A 5J1WA 1YWRA 3GENA 5ETIA 4M3QA 3SVVA 1ZWSA 4KRDA 5IDPA 4FSQA 4IXPA 4X6QC 4BGQA 4DEEA 4F0IA 5IH6A 2ZDTA 4IE9A 2OIBA 2VTPA 3W2QA 2R3LA 4ACDA 4BDKA 4R7BA 3DDQA 4QQCA 4C4FA 2BZHB 5EHLA 4O0SA 4EYMA 3TZMA 4BTFA 4DTKA 4WG3A 3DZQA 1ZYCA 4PPAA 5IQDA 5HG8A 3UOLA 4BCGA 5HORA 3KRWA 2BZJA 1OKWA 2BVAA 3VHKA 3BRBA 4QOXA 5A6OA 5JQ5A 3A7FA 1UU7A 2ESMA 3R22A 4D1ZA 5AADA 4ZJIA 2CNQA 5E4HA 1UKIA 3R7IA 3WZKA 3F3WA 3DTCA 3IQ7A 3BPRA 3LFFA 4IWQA 5CU6A 5DBXA 2JLDA 2FH9A 5C27A 4CV9A 3FL5A 5CEPA 4YSMA 3R7YA 3LFBA 1YI6A 2H9VA 3NNUA 4MD8E 2VWYA 5J1VA 4RJ6A 2VTLA 3NUNA 3OWLA 5L4QA 5HO8A 3ZHPC 2X8EA 2XEYA 4HVSA 4N70A 4ZAUA 4G5JA 4RWJA 4UMTA 1V0BA 2XNMA 3DQXA 3OEFX 2J90A 2R3QA 5EM8A 1FMOE 4DCAA 2W1CA 2H34A 3KMWA 3HP2A 4FIFA 4FEQA 4PNKA 3U8WA 2ITOA 3DK7A 4ZSGA 1ATPE 4GU9A 4TYEA 4Q9SA 2XJ0A 4BIEA 1PMNA 2C1BA 3FI3A 3CTQA 2W5AA 4S34A 4GJ3A 3KGAA 4RIYB 5A3XA 5HG5A 2WMRA 1Q62A 4EQCA 2C3KA 4YSJA 5ITAA 4FTRA 2F4JA 2GNJA 4Z7HA 2GU8A 3BWFA 4DBXA 4U44A 2ONLA 2R64A 4IVBA 4IBMA 4O91A 3BLQA 4XP0A 1QL6A 4MWHA 1CM8A 4I4EA 2OH4A 4L7FA 5KX8A 3TCPA 4IEBA 3EN5A 1WFCA 2VNYA 3R9RA 4YJUA 4KBAA 4DFYA 3TACA 2X9FA 2WGJA 3GUBA 3QQJA 5HTIA 3U9CA 3QL8A 3VS4A 4MBIA 5CSWA 3FY0A 3ZLSA 2WMWA 3QQGA 2YEXA 4F6SA 4LQMA 3DAJA 4CMUA 4DF3A 3GU7A 5E8SA 5K5NA 4V04A 5B2MA 4Y8DA 2GNHA 4AS0A 4Z3VA 4XG2A 4EOSA 1MUOA 3Q5ZA 4BDCA 3UQFA 3FYKX 4AGWA 1R3CA 3TKUA 2I0YA 4AAAA 1UNLA 4RVTA 3GCPA 1PMEA 1WVXA 4XNEA 3DBCA 5BVOA 2UW5A 2W5BA 4JRVA 4CFXA 4M15A 5EKNA 2ZM3A 4KNBA 2W9ZB 2Z7SA 3JS2A 4QMWA 3R7UA 1OL1A 4DT8A 1OL2A 3LJ1A 4MXZA 1O9UA 2OZOA 3TNPC 3UODA 3OT3A 2PVJA 2XK6A 2E2BA 2CHLA 2FYSA 3V04A 5EI2A 2PHKA 5E1EA 4TZRA 2QR8A 4KIPA 4EOOA 2VTMA 3HV5A 2HZIA 3Q2MA 3AG9A 1MRYA 4FV4A 5LCKA 4DH8A 3QCSA 3WF8A 3I5ZA 1AD5A 2E9VA 3O51A 4I6FA 2HXLA 3P1AA 4LUEA 3CJGA 5M4IA 2G01A 3PVWA 4WNOA 2WQNA 1YI4A 5M57A 4C8BA 4BVUA 5LOHA 3ZBXA 3EIDA 3F3TA 5EQPA 2XKCA 4FTJA 5FM2A 2YM8A 3AC5A 1YOMA 4ALWA 1B38A 4GKHA 2C6TA 4O21A 5AAFA 2QU5A 2VTSA 2ITYA 3C4WA 3OVVA 3TZ8A 5M56A 3PIYA 1P5EA 2WMBA 4H1JA 2C5XA 5LWNA 4E6QA 5HTBA 4KB8A 2OICA 3ORMA 3WZEA 4BDHA 5LVMA 1F3MC 3T8OA 2PSQA 4LRJA 2UW0A 3OY1A 3FZ1A 2R3HA 3R73A 2ERKA 4PTGA 4W9WA 4YLLA 5GHVA 5M51A 5ANGA 4LGDA 5AAGA 2J2IB 2WTKC 5KMKA 3EQCA 3EQRA 3PXKA 1VR2A 3PE1A 4D4RA 4K18A 3PIXA 3E88A 4YURA 4IW0A 2W1FA 3OT8A 2PVRA 5BVWA 2CPKE 4FV2A 5GZAA 3LMHA 1IAHA 4OTRA 2OFUA 4DEBA 3IW5A 2QURA 4C4JA 4TT7A 4U3YA 5C03A 3S2PA 3U51A 4OW8A 1BUHA 3QCYA 1RE8A 2XM8A 4JQ8A 5HD4A 2IJMA 4LL0A 4RQVA 3LHJA 4EK6A 4ZEGA 2CJMA 3UO6A 3C5IA 4CG9A 3DZOA 4NU1A 4AGUA 1SYKA 1YOJA 2X4ZA 3A61A 4QMTA 1OUKA 5FXSA 3DGKA 5TF9A 3P7AA 3I60A 3NUPA 4BI1A 4BZNA 4E20A 4CKRA 5AFVA 3KA0A 4D55A 4DAWA 3VS1A 2CKEA 3IGOA 2OJJA 4PPCA 3OCGA 4O7WA 1Q41A 3R21A 1Q5KA 4WD5A 2PYWA 1H0VA 3E92A 4ZZMA 3AOXA 2YCRA 1A06A 1Q3DA 3QRKA 4H58A 4RSSA 4QTBA 4XV3A 2A2AA 3MVLA 3TTIA 4PX6A 2ZJWA 4TXCA 3B8RA 4FZFB 5AR4A 4BCMA 2IVTA 3KC3A 4ANNA 3HUBA 1OBGA 5ACKA 1CMKE 4BDIA 4FIJA 2IW6A 3BYUA 2GMXA 4FV0A 3AT2A 2YACA 4BFMA 4E8AA 1IRKA 3KULB 4PUZA 5A4CA 3ALOA 3POZA 2GTNA 2UW3A 4JDIA 1Z9XA 4ZSJA 3BYSA 2OXDA 3U6HA 2I0HA 3OCTA 4ASEA 3GVUA 4Y83A 3OMVA 5DG5A 3U6IA 2XNOA 4HZSA 2YZAA 1GY3A 3ORTA 3IONA 4YLKA 3ORLA 5AP4A 3VJOA 4UWYA 2CSNA 5CU0A 2PMNX 1H27A 4CLJA 3UC3A 4N57A 3RBWA 3H9RA 3K5UA 3OXIA 3A4OX 4DTAA 5M4FA 2EUFB 3F88A 4ANSA 3PVBA 2QD9A 5CSHA 4NJDA 2YA9A 5KKRB 3AC3A 4FKRA 5F9EA 2BRHA 2BROA 2HW6A 2V7OA 5KZ0A 2Y4PA 4FSYA 5HLNA 2PU8A 5DT3A 4FSMA 4OTHA 2VTOA 2QC6A 5EYCA 4EL9A 2WTIA 4C33A 2RG6A 4KSQA 4LRMA 2YIXA 2CCIA 4RLKA 1ZYDA 3KB7A 2WTCA 3BLRA 3PA3A 3PY3A 3NIEA 2BZKB 3MH1A 4FL2A 5TE0A 2GFCA 3AT4A 2PUUA 5EOBA 2WMXA 3LFCA 1Q3WA 3MW1A 4C0TA 4ENXA 3NR9A 1QPEA 4FKQA 2R5TA 3COHA 3HLLA 3HYHA 4G9CA 3VF9A 4EC8A 3D7TB 3KN6A 4QP9A 4YZDA 4ERKA 1FBNA 2BKZA 4YHTA 3O71A 4GYGA 4MXYA 1ZXEA 1GZKA 2XB7A 2Q0BA 2YAAA 4JRNA 3H0ZA 1PYEA 1YHSA 5B0XA 4CD0A 3N4TA 3FQEA 2YERA 1VJYA 1M14A 3NVKI 1RDQE 1WBVA 3LFSA 4YR8A 3RTPA 4W8DA 4HNFA 2EVAA 2XKFA 5CY3A 5DI1A 4ZTQA 5HE3A 5CF4A 2W1DA 2WMSA 4BHNA 4RQKA 1RJBA 3LFQA 5HBJA 4ZTRA 2XRUA 3HECA 3TL8A 1OL7A 3ZOSA 4DEDA 3GU8A 5BVNA 4DINA 3UOJA 1OM1A 4NW5A 3PWYA 3MVMA 2BALA 3ZBFA 4EH8A 1OKVA 3UC4A 4P7EA 3E93A 2AC5A 4JAIA 4BDEA 2PMIA 3QF9A 4YJVA 1LEZA 5K4JA 1JBPE 3QD2B 5T68A 2WOTA 2VV9A 3UVQA 4HGEA 3Q2JA 3FLZA 1SNXA 3VUGA 1BLXA 2XUUA 4ACHA 4JDHA 5AV1A 5IH5A 2X8DA 2YAKA 5FG8A 4ZLOA 4C35A 3IO7A 4J8NA 2YDKA 4QMPA 2YCFA 4IB5A 5GZ8A 1K3AA 1SM2A 4ZSLA 5LQFA 1FVTA 2GS7A 1JKKA 5HI2A 3F3ZA 1OL6A 4ZOGA 2Y6OA 4IC8A 2QKWB 1HCKA 3WIGA 4YTFA 4XCUA 5FQDC 3GP0A 4XV9A 5A9UA 3SA0A 4PMPA 3SRVB 4D2VA 3ENHA 4O0TA 4ZY5A 5IQBA 2C6KA 4M67A 4BKJA 4C62A 5EQEA 3PZHA 1H1SA 2UZUE 5DT4A 2R3PA 1XKKA 5FEQA 4FOBA 2EXCX 1H01A 2WIPA 3H3CA 3SGCA 3BHHA 4NIFA 4X3FA 4M12A 2PE0A 5FM3A 4M8TA 5E92A 4FMQA 1QPDA 4S33A 5M55A 4DA5A 1YRPA 4WG5A 4KA3A 5AEPA 2BDFA 3C4ZA 2AUHA 2QOOA 2RFSA 3E7VA 2X0GA 3R9OA 2V55A 4FNYA 2XRWA 4GIIA 4D2RA 1PW2A 4CSVA 3TT0A 3D7ZA 4IVAA 1JOWB 4MQ1A 4DFXE 4ZTHA 5CEKA 4N6YA 4DGMA 4Q9ZA 3O7LB 2QONA 5BVKA 2CMWA 2GHMA 3LIJA 5D10A 5JFSA 5DFPA 2OI4X 3C1XA 3CEKA 2HWPA 3AGLA 5FTQA 5B2KA 5B2LA 3K5VA 4D1XA 3FHIA 4FNZA 4JBVA 1NT2A 2CNVA 4R7IA 3F61A 4CKJA 4G17A 2C5NA 2E9UA 4GFOA 5CX9A 4MVFA 5I9XA 2BCJA 1JLUE 4AGCA 5JZJA 1H24A 1PXPA 3EQIA 4F7JA 2UZDA 4RMZA 3TNHA 2C6EA 3OWKA 3O17A 3VUHA 3FWQA 3Q60A 3OS3A 3QTZA 4CFVA 4AZVA 4XP3A 3BHUA 3UZTA 2QG5A 2IZTA 2QOIA 3PZEA 4IAFA 3FC1X 4NT4A 4U79A 3PUPA 4G3FA 2JD5A 5LVPA 5IQHA 2P4IA 3DK3A 5DVRA 3R71A 3TJDA 2OIQA 3NRMA 2UW8A 5F1ZA 4R1VA 2NP8A 2OU7A 3DFCB 5L2QA 4CMTA 3W1FA 4KABA 4XRLA 3MTFA 3QQUA 2C6IA 1S9IA 4J99A 4ZXTA 2QODA 4RT7A 4UZHA 4XBRA 4BCPA 5HD7A 5CSPA 4TWOA 3NW6A 1O6YA 3AXWA 2R3IA 5AUWA 3BGQA 3MY1A 5TR6A 4CXAA 4GUEA 4YMJA 3F69A 3LCDA 3UPXA 2W17A 5AWMA 4YZCA 5JFVA 4NCTC 5ANJA 5HO6A 5IDNA 3I1AA 1IA9A 4D58A 3D4QA 4KIQA 1WBPA 4TPTA 3PXFA 3QBNA 3PWDA 2BRGA 4ANBA 4UWBA 1PXLA 3BYMA 5GJGA 1R0PA 3CQWA 4JX3A 4BKZA 3QRJA 2XYNA 4S2ZA 2CLQA 3D9VA 2J0KA 4UX9A 5AP0A 4X7QA 2G2HA 3VQUA 4EJ7A 4A9RA 4RPVA 4BCNA 2JKMA 4KWPA 5IQIA 2WQMA 3IG7A 5CU2A 4I20A 4RWLA 4AE9A 2FUMA 3RZBA 4C7TA 5HG9A 2ITQA 2B52A 2J5EA 4KIKB 3V5LA 4O0WA 3UP2A 3VF8A 1YHVA 2WO6A 4ZMEA 3FHRA 1YWVA 5E7RA 1J7UA 3R7VA 1XJDA 3GQIA 3E87A 3UBDA 5G1XA 3M2WA 2BILB 3DLZA 3Q3BA 3KXXA 4PTCA 3WF6A 3MESA 3REPA 1SVGA 4WHZA 4OAVB 2VWUA 5BYLA 4ID7A 4GS6A 3PY0A 4FTQA 5E8TA 4QMSA 5AP2A 4EHZA 1OPKA 2WTWA 3E3PA 1LP4A 1WVYA 3DBQA 4HNIA 3RALA 3NAXA 4TNDA 3V6RA 5HG7A 4APPA 2REIA 3QZHA 4UYNA 1J3HA 1T46A 4PP7A 3GCUA 3SDJA 3KXHA 3MFUA 4XJ0A 2QHMA 3OFMA 3VVHA 2UW4A 3T9IA 2B9HA 3BX5A 1BMKA 3O0GA 3BQRA 4K0YA 4XRJA 4E4MA 2PMLX 4R3RA 4DFUA 4JLCA 3LAUA 4JBOA 2R3NA 4IFCA 4NJ3A 4QP4A 3ZZWA 2WMAA 2VTTA 3R8UA 3V01A 4AQCA 1OBDA 2R3FA 2EXEA 4USDA 3MIYA 4RA5A 4O86A 2ZVAA 2QOCA 2VTIA 4R3PA 5E8VA 3EL7A 2RFEA 4FZ6A 5G6VA 4JJRA 3LPBA 3NCZA 1Z5MA 2XKDA 4OTWA 5FEDA 4FTLA 3CBLA 4DEHA 2WTKB 4FV5A 1UU9A 1OITA 4ITHA 4FTIA 3Q9XA 5FTOA 3N9XA 3GT8A 4AW1A 4O7RA 1H4LA 3RJCA 3NDMA 5LCJA 4R6VA 4ZLYA 4AWIA 2YIRA 4CV8A 2BUJA 1BYGA 1W84A 3ZH8A 4F4PA 2F7EE 3KCKA 4GH2A 3BGZA 3DT1A 5LVOA 4X0MA 2YFXA 5L8JA 5IA2A 4A07A 2XNNA 4U45A 4FGRA 4ZY4A 4EORA 4J95A 4UMQA 4RZVA 2QOQA 3RINA 2QQ7A 4C2VA 3F5GA 4I22A 4YO6A 3ZO4A 4FSRA 4IMYA 3D5VA 1YXXA 2IVVA 2WMUA 2QO2A 3DLSA 1XH8A 3FMMA 3L9NA 4NEUA 2C6OA 4RIWB 3ZEPA 5BNJA 4C4IA 5KMOA 3ZM4A 2R7IA 3ZDIA 1Q24A 4TKSA 3PA4A 5AUTA 2YIQA 5F95A 5CF6A 5JN2A 5J9LA 3ODZX 3JPVA 4I0TA 5HICA 5A6NA 4DEGA 2V0DA 3BELA 1YDRE 3PG1A 2OJIA 3AT3A 2VGPA 4WSYA 3V8TA 3DXPA 1PXIA 2RFNA 2HOGA 4FEVA 4CMOA 5AP6A 3QZGA 3UQGA 4PMSA 4E6DA 4EH7A 3QU0A 1Q99A 3I7CA 4BHZA 3FJQE 1E1VA 5CT0A 4O0UA 1KE6A 4BCKA 4JDKA 4UMPA 2EU9A 3ZDUA 3ETAA 3HDMA 4BCIA 2BHHA 4KS7A 4JR7A 5BPYA 5CTPA 5CVFA 1OI9A 1SVHA 2VTRA 4NK9A 4C2WA 2GNGA 4ARKA 2YM7A 2WOUA 4MHAA 4FF8A 4FIEA 2O0UA 2VWIA 4L8MA 5AIKA 4BCFA 4CFFA 4FICA 2RGPA 4FKUA 4WO5A 3UOKA 4YC8A 3AC1A 3H9OA 3I0OA 2C5VA 1M2QA 2PZPA 2XP2A 2W05A 3DOGA 4HYHA 4PQNA 4P4CA 2F49A 3RAHA 4D4YA 1HCLA 4UMRA 4O7YA 3QTQA 2HCKA 2B7AA 4PY1A 4AOIA 4M0ZA 5EYKA 4B0GA 4C3RA 3VBYA 5E8ZA 3FY2A 2UZNA 2W7XA 4S31A 3NZ0A 3EN7A 2X39A 5DRBA 1BL7A 5HTCA 5JMSA 4USFA 1NVSA 3LM0A 2J6MA 2OXYA 3F5XA 4EBVA 4CGAA 4FTKA 4U9AA 3R8MA 1Q8WA 3HNGA 4K77A 3R7EA 3LJ0A 3A7IA 4O22A 5AV3A 5K0KA 4G6NA 1PRYA 3BBWA 5DIAA 3CIKA 3P78A 4QO9A 4RWKA 2WTVA 4AZWA 1Y6AA 4EHEA 2ZM4A 3R01A 2DS1A 1OPLA 3GU4A 4U8ZA 4AFEA 3IECA 2R4BA 1M17A 2ONLC 3C51A 4MXAA 1JNKA 4I23A 3SKCA 4E73A 5LMAA 3PPKA 4UMUA 1UVRA 4UXLA 3WZJA 1PXJA 5C26A 3T3UA 2PMOX 1V0OA 3RNYA 3JYAA 4E4XA 3SG8A 3M42A 3DPKA 4M0YA 4TWPA 4EH4A 4GK4A 5DR9A 5FD2A 1WZYA 3GXLA 5HIBA 3SW7A 3OP5A 5E8YA 2PUPA 3GU5A 4QTEA 3NS9A 4FNXA 2Q0NA 2XNPA 3FXWA 3FUPA 2JIUA 3HRBA 3PXQA 4KBKA 2JDTA 3WOWA 1IA8A 2JGZA 2VU3A 3KL8A 4C59A 5EI6A 4WRGA 2HWOA 4R5YA 3S00A 4LMUA 4O6LA 3TNIA 3FMHA 3SV0A 2XK8A 1Y6BA 3P23A 3RVGA 4G34A 4I6BA 4GVAA 1YXUA 3QYWA 4EHVA 3V5TA 3NWWA 3SD0A 3AMYA 3F66A 5JGDA 2NO3A 4EZ5A 5HX6A 5CI7A 2OBJA 3L8SA 2O3PA 5EW3A 3OROA 3O50A 3U9NA 3FLQA 3DKFA 4TYHA 1UNHA 4BCQA 3BI6A 2FA2A 2RL5A 1B39A 3TDVA 4Y46A 3MFSA 1GJOA 4F09A 5IH4A 3R63A 1P4FA 2CDZA 3Q4ZA 3LFDA 4LG4A 4EONA 2JFMA 2PVYA 3NW7A 4O6EA 3R7OA 3VIDA 4D4SA 4F9BA 5CF5A 2JDRA 4QNYA 3PXZA 3MWUA 3R1QA 3GFEA 2O65A 2ZV8A 2J51A 2WELA 4QMNA 4PMMA 2G1TA 3C0IA 3RM6A 3ENMA 3W18A 4EK4A 3S1HA 3MY0A 3NNXA 1GZOA 1ZY5A 3QKMA 5KBRA 4J53A 3TI1A 2CGUA 2OZAB 3RM7A 3VW6A 2PVHA 4FV8A 5ICPA 4GT5A 2ITZA 4G31A 5CANA 3Q9WA 4YGAA 4MX9A 3UE4A 2IVUA 3QQFA 5C9CA 3MTLA 1KE7A 4BDGA 3L9MA 4R3CA 1JSTA 1H25A 1Q4LA 4NH1A 5BVDA 2YM3A 4RJ5A 2OO8X 4CFMA 5M44A 1PYXA 4IDVA 4I5HA 4YHFA 2R7BA 4ZS0A 3EQPA 4JL9A 2PZIA 3GCVA 4L6QA 5D9HA 4UZDA 2UVYA 5HHWA 1PXOA 4YC3A 4W4YA 2RIOA 5E8WA 3QGWA 4WUAA 3D7TA 3DQWA 4HW7A 5IQFA 1ZAOA 3TKHA 4F6UA 1PHKA 1SNUA 2ITXA 3I81A 2YLFA 4FKSA 3V8WA 4EC9A 2ITUA 3PSBA 4PL4A 3TTJA 5CI6A 4I5MA 5GNKA 5BVEA 5DE2A 4CRSA 2C6DA 4MEDA 3WYXA 4FKGA 3FPQA 3VJNA 1RW8A 2BDJA 4NSTA 4K1BA 3SHEA 3O8UA 4O38A 3QD3A 5AX3A 3FZPA 4O7VA 3R7GA 2FSOX 2HY0A 4FZ7A 3UZPA 1XH5A 5CZHA 4AZSA 3F2AA 4YZ9A 5IEYA 1Y91A 2HIWA 5TKDA 1OIUA 3HRCA 3T3VA 2UW6A 4U40A 3BZ3A 4GRBA 3GOPA 3B2TA 2HZ4A 3SW4A 4FV1A 1YDTE 3NIZA 3FMEA 2VX3A 5ANDA 3VUTA 4ZSAA 4CLIA 4WA9A 5FLFA 1JQHA 1UA2A 3BE9A 3PRFA 4FT3A 2OK1A 5HLPA 3PLSA 3PPJA 4M69A 5HOAA 4M13A 5JGAA 3LQ3A 3S95A 5HNBA 2J0JA 4XG3A 2W1HA 4A9YA 1WBNA 1XHAA 3Q4TA 3QALE 3DJ6A 4G3GA 4K2RA 3AMAA 5EYDA 4E4NA 4F7SA 3GNIB 4YPSA 5LWMA 4CTBA 1Y57A 5B7VA 2Z60A 4R7HA 3CCNA 3ORXA 3E5AA 4O2PA 1KE9A 5KMNA 1GOLA 1HOWA 4CYJA 3N4UA 1J1CA 5AJQA 5HIEA 4YJSA 4AU8A 3EB0A 2GNFA 4KRCA 3PDTA 3CLYA 3HP5A 5JSMA 5EYMA 3AGMA 1OGUA 4YC6A 1NXKA 2QU6A 4L43A 4JBQA 4RLLA 4JG6A 4H3BA 4QNAA 4ITIA 1VYWA 2XK9A 1L3RE 2A27A 3KXZA 2XK4A 3LMGA 4HCTA 4PPBA 3NVMB 3SAYA 4XG4A 2WMVA 2C69A 2KULA 4MAOA 3QTXA 3VS0A 2QOHA 2PWLA 3TIYA 1BI8A 4PDYA 3VRYA 3RHKA 3O8PA 2WAJA 4AZTA 2XBAA 4WIHA 3HMOA 5EDQA 4DT9A 4GEOA 4I92A 1TQPA 2E9PA 4WNPA 3AC4A 1GIJA 4FT9A 2C4GA 4IACA 4N6ZA 3HMMA 3OWPA 1JWHA 5F94A 4UYAA 3OW4A 4FEXA 1PJKA 4ACCA
chains in the Genus database with same CATH superfamily
2XH5A 5CU3A 5BMSA 5H8BA 1XBBA 2DUVA 3FZTA 4I3ZA 5FP6A 3HA8A 4BN1A 3LXNA 4NZWB 3D5WA 4O4DA 4KD1A 4XOYA 1GZ8A 1OZ1A 3ZONA 4U42A 2CGWA 4GYIA 2PUNA 4XBUA 3RHXA 2VNWA 2VTNA 4IZ5A 4EWHA 5FDXA 2CKPA 2QKRA 3KY2A 3MPMA 3QX2A 5IEXA 2X6DA 3ORKA 3D94A 2BKKA 4YJPA 4E93A 2R2PA 5L2SA 4F6WA 4G1WA 3C4CA 2PZRA 4ALVA 1QPJA 4RX5A 5IF1A 2XAOA 4L3PA 4DEAA 2XCHA 4FKTA 1FINA 3PIZA 5J95A 3A60A 2RSVA 2UW7A 4DTBA 3EOCA 4QMZA 3W32A 4CT2A 1PY5A 1RQQA 2WKMA 2XIKA 2JAMA 1O6LA 4OTDA 5IA0A 5KMJA 2XAMA 1I44A 1UU8A 1ZYSA 4RJ8A 4GVJA 2B53A 4EI4A 4F08A 3FSKA 2Y7JA 1ZZ2A 3EKKA 4AW0A 3CP9A 3VRZA 4LGHA 3LFNA 4AA5A 5ETAA 2WTDA 2GCDA 3FYJX 3IW6A 4FOCA 4FSTA 1AQ1A 2YISA 4RRVA 2XS0A 3Q5IA 4BGGA 2XF0A 3QC4A 3HUCA 2UZOA 5ETCA 4MXCA 4YJTA 4AT5A 3VBTA 2PZYA 1W0XC 3FV8A 2R3JA 3UDSA 4UN0C 4QMLA 3N4VA 3MS9A 3MH3A 1XH6A 4QYHA 4GKIA 4L7SA 4C02A 4O4EA 4WRSA 4YHJA 4ZTSA 4EOPA 5KZIA 3KMUA 5IA5A 3HMIA 4X3JA 1W82A 3FKLA 4X2KA 4BTJA 3PJ1A 2X2MA 2JKOA 4L00A 5H3QA 4JVGA 4D9UA 4FL1A 2V62A 4NTSA 3VN9A 3W2OA 5BQ0A 3FEGA 3LXPA 2ITWA 4KIKA 4H36A 4BY9E 3O8TA 4PWNA 5AV2A 1R0EA 3JXWA 4FUXA 4P90A 3UO4A 3PA5A 3EH9A 4CFWA 4CZTA 5FWKK 5LXMA 4GL9A 4ONAA 1JPAA 2VWVA 4L68A 5HGIA 3SQQA 3COIA 3VBVA 2XIZA 4GMYA 4IFGA 3FZRA 2BAQA 2H6DA 5HESA 2OW3A 4ZY6A 3DJ5A 4DFLA 5IA1A 4ZS4A 5GINE 4TYJA 3TV7A 5HE1A 3W2CA 3EN6A 4OBQA 3UOHA 4R1YA 3R8LA 5HEZA 5AV4A 1Y8YA 3FBVA 3ZLWA 3DTWA 4GIHA 2QLUA 4IC7A 3RPOA 3V5JA 3FKNA 5EKOA 3UIXA 4DBNA 3R1SA 5EDPA 4EOIA 3FMNA 2XJ2A 2QO9A 4TYGA 5HVJA 3HV7A 3FLNC 3RWPA 3TUBA 3Q4UA 5AUVA 4CZUA 3WF7A 4ZTMA 4WT6A 3KCFA 4AN9A 4MWIA 4FL3A 4L3JA 2X81A 2HZ0A 2ITPA 2YITA 4B8MA 4O0RA 2PL0A 4KKEA 3ROYA 4C34A 1BL6A 4FNWA 4JDJA 5DH3A 2VO6A 3A8XA 4A4XA 4BGHA 4DG3E 2BAJA 4P5ZA 3R28A 4FTNA 4U81A 3QZIA 5FBOA 4F9WA 1URCA 3MJ2A 5KHXA 3WILA 2BPMA 4O0YA 5CQUA 3UG2A 5J87A 4HCVA 3VS5A 1FVVA 1ZRZA 5FEEA 3I79A 5AIRA 4C57A 3Q4CA 2QOKA 1VZOA 1Z57A 3H4JA 1UWJA 5CYIA 4FA2A 2WXVA 3TNQB 4DGGA 4HVDA 4F99A 4HCUA 1PXMA 5DA3A 3RPRA 4DN5A 4MYGA 5K0XA 2B4SB 2H8HA 4JG8A 2A19B 4YLJA 2XJ1A 5EK7A 3W8QA 5TT7A 3S4QA 4PDSA 4ZIMA 2C68A 3V8SA 2EB2A 4AT4A 5LMKA 4IB0A 4AFJA 2J7TA 4KSPA 2IZRA 4JAJA 3V5PA 3MJ1A 2VO0A 3ANRA 4ZTLA 4KUJA 1DS5A 1OKYA 2VTHA 3DA6A 4EH9A 3VAPA 1WCCA 3R9NA 3MH2A 4AA0A 5K5XA 4ZK5A 1U5RA 3EQBA 2P55A 3M11A 4Q5EA 3IK3A 4F63A 3E8CA 3QHWA 5E90A 4U43A 4EH3A 5KNJA 5M4CA 2OG8A 3U54A 2GQSA 1JSVA 2XARA 5IA3A 4I21A 1Q8UA 3LZBA 4IX3A 1QMZA 4BCHA 4AA4A 5KMLA 5BYZA 2C3JA 3PVGA 4IQ6A 4F7NA 4QYFA 3OW3A 3E7OA 4IADA 3EL8A 4AXAA 4C37A 4IX5A 4LYNA 4YJRA 4RFZA 4E6AA 2E9OA 2W06A 2Z7LA 1XBCA 2X7FA 5M09A 4CFNA 2X6EA 3IOKA 3DFAA 5IU2A 3PP1A 4FIIA 2B0QA 5BUJA 3TWJA 3HDNA 2W1GA 2J0MB 2ZB1A 1S9JA 1U54A 3UZRA 1U4DA 2NRUA 4FV6A 4FC0A 5A54A 4DH1A 2G9XA 3F9NA 2QG7A 3HGKA 5KMIA 3TKIA 5DT0A 4HYSA 4APCA 3W0NA 3G9NA 4OT5A 2HW7A 1PKDA 4MCVA 2XZSA 5A14A 1Q8TA 3I5NA 3L1SA 3MB6A 4FJVA 4WSQA 2J5FA 2Y8OA 5CAUA 3ZC5A 4QDEA 2Z2WA 4XLVA 2NRYA 4X2FA 2W1IA 3S3IA 4DFBA 5IZFA 1Q61A 1R78A 4FIHA 4BTMA 2P0CA 4H05A 4L9IA 5IUGA 4DDIA 2HK5A 2UV2A 5CSVA 4K33A 3ZSIA 1REJA 4ORKA 3OF0A 3VO3A 3VS2A 2IW8A 3UQCA 3ZTXA 4FVPA 3VUIA 4ASZA 4M68A 4D4VA 4F9AA 4I4FA 2VO7A 4FT5A 1APME 4BZOA 3QX4A 3KN5A 3OBJA 3V51A 5LVNA 5HVKA 4IWOA 5M4UA 4Q5HA 3FDNA 3PTGA 5CENA 3MBLA 3QCQA 3E8NA 4BIDA 2ACXA 4O2ZA 3F5PA 4BDDA 4YO4A 3BLHA 1R1WA 3D2KA 3KRLA 3MA3A 4GK3A 3VHEA 4DE4A 4I24A 2GQGA 3FZSA 3E62A 3V5WA 2C6LA 2WU6A 2XVDA 4V0GB 4QYYA 4RX9A 4W4XA 4C58A 3OEZA 2FO0A 2XK3A 4IZ7A 4K9YA 4V05A 3K3JA 4IAAA 4BDAA 4D0WA 4EH2A 4E7WA 1G8JA 2VX1A 2JDSA 2C5OA 1R39A 4O84A 2WPAA 3GI3A 4J1RA 4BR3A 1YXVA 4WBBB 1YVJA 3FKOA 4HYIA 4B4LA 5FXRA 2VWXA 3NYXA 3FQSA 4YZBA 4O82A 3QQKA 4HOKA 1WBOA 5AP1A 4O7ZA 2I40A 3ZRMA 2UZLA 5EM7A 4AN3A 4PL3A 3PG3A 4RVLA 3ET7A 1KOBA 2XNBA 3BGPA 2CN8A 4EOKA 2X9EA 4XG7A 1TVOA 4XG9A 2NYAA 3UP7A 3NAYA 4D5KA 3Q96A 4BCJA 4E1ZA 2CKOA 3P7BA 4EH6A 4ZZNA 3II5A 4FTCA 4O7NA 5DRDA 3Q9ZA 4YPDA 4X2JA 5HVYA 4TNBA 3TEIA 3ULZA 4Y85A 5IMEA 3RPSA 4P2KA 3NW5A 5CS6A 4J97A 4FX3A 2BIYA 4EK8A 3IW8A 5JH6A 2IPXA 4S30A 4PMTA 3ZFMA 4BI2A 4F1TA 5AUUA 3NFGB 3EQHA 3RK5A 4E26A 4U6RA 4CVAA 3MFTA 2ETKA 5C4LA 1G8SA 3PLAE 4YNEA 4J71A 2BRMA 4DG2E 4F0FA 3ULIA 4OTPA 5HO7A 1H00A 3SXFA 5E1SA 4EBWA 4UBAA 3THBA 5J8IA 5AA9A 2FSMX 2YIYA 3AC8A 1DM2A 3MVJA 1WAKA 4HYUA 2WIHA 2Y4IC 3PY1A 3RZFA 5C01A 2HYYA 4OTGA 2OZAA 3ZMMA 1FMKA 3ZC6A 4HPUE 4F1OA 4CQEA 3QTIA 3TZ7A 4ALUA 2WD1A 3HMNA 5IEVA 4E3CA 5CEMA 2LGCA 3L9LA 3R6XA 4XMOA 4D5HA 4DFZE 2JFLA 3IPHA 5GIOE 4Z16A 2X0OA 3CPBA 3DV3A 2HXQA 5CQWA 3P5JC 3BHYA 4JS8A 5HBEA 4D1SA 5L2IA 4B6LA 3ORPA 4XX9A 4AE6A 2X2KA 4GK2A 1UKHA 4PF4A 4JG7A 3GCSA 4QMVA 4I1ZA 2ETMA 3EYHA 2OWBA 4M84A 4O27B 3CKXA 2GSFA 4KKGA 4L67A 2R0IA 2WEIA 3RPYA 5CLPA 4D2PA 3E63A 4O7LA 2IVSA 4IX6A 5DYJA 4RIYA 2IW9A 3LMIA 3BYVA 3QXPA 2AC3A 4PNIA 1FGKA 2Y6MA 3FSFA 3R1NA 4AF3A 3GC0A 1OL5A 2JDVA 4KS8A 3IDCA 3GC7A 1BKXA 3E64A 3F5UA 4XYFA 5AP7A 3LCOA 4C4GA 2J50A 2AQXA 4CG8A 3F7WA 1XBAA 3A2CA 3IW7A 4C3PA 3AD5A 3MV5A 3QUDA 2B1PA 4FKPA 5HNIX 3IKAA 3ITZA 2X7OA 4M7IA 3LQ8A 3FMKA 2VAGA 3OUKA 1O6KA 4RGJA 5IMXA 3Q6UA 4FV9A 4Y95A 1JAMA 3VUDA 2YWVA 3RGFA 3FE3A 3I6UA 4K6ZA 1WBTA 2WHBA 1GIIA 4IM0A 5JZNA 4JQ7A 3K2LA 4DC2A 5AR7A 1M52A 4EK5A 4FG8A 1E1XA 2BZIB 2R0UA 1YWNA 1KV1A 1OECA 2P3GX 3PJ3A 4IM3A 5FUTA 4CYIA 3L9PA 4CFUA 3ZM9A 3NYVA 5LVLA 1MP8A 3BV3A 3LFAA 3QRIA 4O4BB 4FI1A 1Q97A 3EJ1A 3D0EA 2V7AA 3W8LA 3M1SA 3ZSHA 2XANA 3G0EA 2AYPA 3BYOA 5JRQA 3ORIA 3CGOA 2C6MA 4O0VA 2JIIA 2DWBA 3KF7A 1JVPP 3KVWA 3RAKA 5DEWA 4U97A 5EG3A 2W96B 2F2CB 3VUMA 1ZLTA 3GOKA 2YN8A 4PTEA 3W2RA 3QLGA 3KMMA 3KRJA 3LLAA 3ZFXA 3NUXA 2GTMA 3NNWA 4BDJA 5FXQA 3QQHA 1URWA 1FPUA 1F5QA 1NVRA 2XNGA 2VWZA 4QTAA 2CCHA 5AM7A 2J0LA 4IIRA 4X6RA 4C61A 3V3VA 1KSWA 3KRRA 5C4KA 3LFEA 4MF0A 1KOAA 3L8XA 2HENA 2A98A 2Z7RA 4RVMA 3P0MA 3MN3A 4FTAA 3NYOA 3WF5A 3BEAA 4I0RA 5JFXA 3C0HA 2XALA 3RAWA 2X0PA 5I9UA 3B2WA 2EWAA 3OXTA 3ZZEA 3ATSA 3BBTB 2VN9A 3ZLXA 4I41A 4FZAB 4G5PA 4GCJA 2XNEA 2F2UA 4Y5HA 4Y73A 4ZMFA 3BCEA 3R9DA 4RG0A 3UYTA 4BDFA 3BHVA 1ZOEA 3P4KA 1H26A 3GB2A 3ZUUA 2UZWE 2GFSA 3P86A 3ZO2A 4EJNA 3VNTA 1DI8A 3I6WA 2XYUA 1W7HA 4HZRA 4ANQA 3R8PA 4BL1A 2QVSE 5JFWA 3UMWA 4B7TA 3ORNA 3G9LX 2XIXA 4MBJA 3OOGA 2BHEA 3OHTA 3QZFA 5EH0A 4C4EA 2Q83A 2G2FA 3WYYA 3AD4A 3DCVA 3EMGA 4IVCA 3U4UA 4A7CA 5AAEA 2EB3A 2J9MA 3CQUA 4I5CA 4MQ2A 4EKKA 5CEIA 5CU4A 3SOAA 5J9ZA 4W4WA 5GJDA 2W9FB 4F70A 2PZ5A 1XMLA 4QMXA 4DYMA 2I7QA 1IAJA 2WQBA 4QYEA 1PKGA 4FKLA 5DLSA 4OBOA 3BWJA 3MIAA 3QTSA 2VRXA 4WOVA 3P7CA 5H2UA 5JK3A 4BKYA 4HVGA 1P2AA 3PE2A 5AM6A 2F7ZE 4RJ7A 4OTIA 5FRIA 4EOLA 2CLXA 2ZFYA 4YBKA 3FC2A 3O5AA 1M2RA 5IQEA 5HCYA 4M66A 4GG7A 4NM0A 1NY3A 3TN8A 3NFFB 3C4FA 4C36A 4QP1A 3KULA 5I4NA 4QPSA 1JSUA 3R2BA 4JOAA 3RK9A 5CNNA 3W2PA 3OWJA 5I5ZA 4WNMA 1B6CB 2OSCA 3WF9A 2Z02A 3NUSA 3A8WA 4FTMA 5DOSA 1CSNA 2ZDUA 4QTCA 4BICA 3KXNA 4RC4A 2HELA 2PTKA 3MI9A 2XIRA 4BZDA 2XKEA 1YXTA 2Z7QA 3NNVA 1OIRA 4LV5A 3TG1A 1CTPE 2DYLA 4RFYA 3NMUF 3FI2A 4FSNA 1ZOHA 2ERZE 3KXMA 1XMMA 3UGCA 1A48A 2JEDA 2C0IA 2KTYA 4AUAA 4BRXA 3UYSA 1Y8GA 3QXOA 1J7IA 3W0MA 3JY0A 2UW9A 1ZMWA 1WVWA 5AR5A 5J79A 4I6QA 4QP6A 3D5UA 2LAVA 4EUTA 3BU5A 4UALA 2YZLA 2ZYBA 3P5KA 4G3CA 3TUDA 1W8CA 3CSVA 2P33A 5AUZA 3UIMA 4G3EA 3EQDA 3G0FA 4H3QA 4ZP5A 3ZYAA 3NEWA 4O0XA 1ZMUA 3PUFC 2H96A 2W1ZA 4JQEA 1ZMVA 2ZMCA 1OPJA 4TWNA 2OLCA 2GHLA 4KAOA 2YM5A 4ZLZA 2BFYA 3MA6A 2ZV9A 4EZ3A 2VGOA 4FG9A 2QI8A 4FTUA 4DITA 5D11A 5IQGA 3Q32A 3HAVA 1LUFA 4IJPA 4YTIA 5IG1A 5M07A 4MNEB 5T3QA 3BKBA 2SRCA 2IN6A 1YKRA 1AGWA 4RZWA 2W4KA 3PPZA 4QP8A 3ZRLA 3EZVA 3FMDA 3G51A 4Z55A 5C8KA 4FKIA 4MKCA 3DB6A 3EFWA 4FVRA 4QMYA 4OTFA 3EWHA 4IZAA 1M7NA 3HA6A 3MB7A 4QQ5A 3QFVA 5A4QA 2UZBA 1Q8ZA 2IO6A 5HE0A 4FV7A 3K54A 4DGLC 2NNWB 4EH5A 3DNDA 1OKZA 3KEXA 4RC3A 3SXRA 3UVPA 2ITNA 3HV6A 4BCOA 3KREA 5DN3A 2VX0A 4II5A 3SX9A 3LJ2A 2JIVA 2OIDA 2XA4A 2YDIA 4J7BA 4DH5A 2ITTA 4OLIA 4R5SA 4FSUA 1ZYLA 4RIXB 5IPJA 2R3GA 3CKWA 3GQLA 4D2WA 4QQJA 5CZIA 4QT1A 4IH8A 3COMA 3C0GA 3A4PA 4IB1A 2R9SA 4ITJA 2BIKB 3PJ8A 4EOJA 5KE0A 5C8NA 2BR1A 1FVRA 3CY3A 3A7JA 3VS6A 3QD0A 4ZJJA 2XIYA 3RI1A 3ZSGA 5CVHA 3FI4A 4F64A 4RJ3A 2XBJA 3W2SA 4WUNA 1YDSE 2IG7A 4KINA 3Q53A 5F20A 4C4HA 5I0BA 4MXXA 1QCFA 3G2FA 5JGBA 4TW9A 3VBXA 3ZFYA 3BU6A 1H8FA 1KE5A 4U80A 4JX7A 4XLIA 3SRVA 4XHKB 3UJGA 3W16A 2GNLA 4EWQA 5AA8A 4CCBA 5BVFA 4HGLA 3CGFA 2C3IB 3ZEWA 1WBWA 2QOLA 3NSZA 2ITVA 4M97A 3S0OA 2B54A 3F82A 4HJOA 4MXOA 3F3VA 4YJOA 3OTUA 2C0TA 4YUQA 3LOKA 4EOQA 5I9ZA 1PXKA 4OUCA 1SZMA 3EZRA 3WIKA 5ACBC 5HZNA 1UV5A 5K9IA 3L8VA 3EN4A 5L6WL 5I9WA 2YJRA 3MFRA 3RKBA 1JKSA 3F2NA 3HRFA 1ND4A 2B9IA 3CXWA 4FR4A 4BF2A 3ZO1A 4HVIA 2ZOQA 3T9TA 4AX8A 3Q04A 2W4OA 5D7VA 5DR6A 4E4LA 3TDWA 3OZ6A 4IAIA 5JT2A 3BIZA 4K8AA 3ALNA 2FSTX 4YU2A 2XCKA 3ZXTA 3LCKA 3QRTA 3U55A 4QP7A 2R3RA 2Y4IB 4KBCA 5AR8A 1CKIA 2IF8A 5HBHA 1H1RA 5HQ0A 4EYJA 5CXZA 4IM2A 3AC2A 3F2RA 4XG8A 5EW9A 4CQGA 4B9DA 1GIHA 2YM6A 4FT0A 2BAKA 4JIAA 3ZLYA 1CKJA 4RIOA 5A4EA 3LLTA 2Y0AA 5CEQA 1WBSA 3NLBA 4G2FA 3ZU7A 2YIWA 5AR2A 1PMUA 2W1EA 4QTDA 3ZS5A 1NW1A 4UY9A 3ERKA 3DS6A 1DAYA 4WKQA 4EQMA 2R3KA 3R30A 2PVMA 3UO5A 2CKQA 1V0PA 4BYJA 3ATTA 4N4SA 2QR7A 1H08A 2QHNA 2X4FA 4TRLA 3OCBA 3A7GA 4O1OA 3VWAA 4D9TA 2V22A 5CT7A 3WZDA 4A4OA 5AP5A 3PP0A 3R83A 4FEWA 1ZOGA 4I93A 4V0GA 5BMMA 1K2PA 3FQHA 4WG4A 4BYIA 5J9YA 4O83A 4BB4A 1OIYA 4FZDB 2X2LA 5I3OA 4EUUA 1SMHA 3UNKA 3BLAA 3KQ7A 4R78A 3AQVA 4JT3A 3JVSA 5ETFA 4XP2A 5LMKC 2RFDA 2WQOA 4BIBA 4FBXA 2JBOA 2BRBA 4FKVA 2ETRA 2IWIA 3MDYA 4LV8A 3C4XA 4W4VA 5BYYA 3DXNA 3HL7A 1OIQA 1H07A 3QA8A 4F9CA 5M08A 3MGYA 4ANOA 5BUEA 4BTKA 3W0RA 4H39A 3R0TA 1KE8A 3QWJA 3TNWA 4BBFA 4FTOA 2GS6A 4A9SA 4A9UA 1XH9A 3E3BX 1K9AA 3PJ2A 3MVHA 3TV6A 4FTTA 2ZMDA 3FMLA 2WNTA 3EN9A 3JR1A 2WQEA 3WE4A 4XV1A 5L3AA 5L2TA 2OF4A 4L52A 3PFQA 4C38A 4CRLA 5E9EA 3O7LD 4RC2A 1G8AA 4NL0A 3MY5A 3PXRA 4AZFA 1ZY4A 5ANKA 5GZ9A 1ZARA 4TYHB 4X3FC 2OGVA 3RP9A 3FPMA 4W9XA 4PL5A 5DGZA 3E8EA 3RK7A 3SG9A 4L45A 3FI8A 4IVDA 3W0SA 1BX6A 4NM3A 1UNGA 4GT4A 4V01A 4NFNA 1DAWA 1GNGA 4UWCA 4WBOA 1IEPA 4NKSA 4E5BA 5IA4A 4NTTA 4MK0A 3FAAA 1G8KA 2O63A 3ELJA 5JRSA 4IZYA 4LOQA 1MRUA 1XO2B 4U7ZA 2F9GA 5ANIA 3NYNA 1TZDA 3KK8A 5KMMA 4GV1A 4RX7A 1ERKA 3D14A 2W4JA 5C1QB 2PVKA 4USEA 4X21A 5J7BA 4PRJA 3UTOA 5DWRA 2VD5A 3A62A 4AN2A 5IKWA 1GAGA 5D12A 4CZYB 2RKUA 3MPTA 4MNFA 3SXSA 3ACJA 2ZAZA 4I0SA 4J8MA 5AR3A 3EYGA 3IW4A 4QP3A 1XQZA 3R04A 4EKLA 1YXSA 1QPCA 4EOMA 3ACKA 2PULA 3RCDA 2A1AB 4UB7A 2R3OA 3TM0A 3C4EA 2UUEA 2YDJA 4R8QA 3MPAA 4XUFA 3U6JA 3W55A 4U0IA 3UDTA 3KXGA 1T45A 4BC6A 3AD6A 3FLWA 2OFVA 5AX9A 3OCSA 4G6OA 4EEVA 2JBPA 3CC6A 3MYGA 4JR3A 3KRXA 3CPCA 4FK3A 3WE8A 1H0WA 1MQ4A 5F4NA 5D1JA 5KUPA 2B9FA 3BE2A 3WI6A 4LOPA 3IGGA 3OBGA 4AW2A 1KWPA 4AG8A 2PE2A 3VS3A 4AZEA 4F7LA 1DI9A 1MQBA 2I0VA 5DPVA 4QQTA 5KBQA 2OH0E 4QPAA 4O1PA 1NVQA 3H30A 3OUNB 3LVPA 2PVFA 1YQJA 3ORZA 3C13A 4QMOA 1TQMA 2XMYA 4QP2A 4RBLA 4U5JA 3I0QA 4UEUA 3QGYA 3VUKA 3VW8A 2A0CX 3DKOA 4RIWA 4LV7A 3CS9A 4FYNA 4DHFA 4CNHA 5LJJA 4DH3A 4E6CA 5TO8A 2YCSA 3TIZA 5H9BA 5HLWA 3QQLA 5KCVA 3N51A 5HU3A 4FVQA 5IQAA 3EQFA 4B99A 4JI9A 2O2UA 2J4ZA 3GBZA 2OXXA 4BBMA 4M69B 2OJFE 4HGSA 3QLFA 2I0EA 4IWDA 5AMNA 3EFKA 4FE2A 1IASA 4OAUC 5DNRA 3QHRA 3WZUA 1XH4A 2PY3A 4X2NA 1I09A 3UNJA 4KIOA 4ANLA 3I7BA 3W33A 4O4CA 2YHVA 4GFMA 4PV0A 4FEUA 4G9RA 1BI7A 4E5AX 4DLJA 2B55A 3DDPA 2B9JA 4X2GA 4DLIA 2PVNA 5DHJA 4HPTE 5I3RA 2X7GA 3UIBA 4JIKA 3GC8A 3DAKA 4Q2AA 3NCGA 3QTWA 3JY9A 4MD9E 3DKGA 3GCQA 4ERWA 2VUWA 2X8IA 3OD6X 4ZSEA 2XM9A 5AUXA 4FUYA 4EK3A 4DCEA 4IANA 5T6KA 2GPHA 4KKHA 2WEVA 4L46A 4LFIA 2BFXA 3QC9A 2IEWA 4N0SA 3HMPA 5JKGA 3NUAA 4AP7A 2G15A 4OT6A 3JVRA 1H28A 1V1KA 3DBDA 3HEGA 5EM6A 1PF8A 4MBLA 4BDBA 4IAYA 4W8EA 3TV4A 4DGOA 1KUTA 1EH4A 1U59A 2A4LA 4F65A 3LM5A 4Z9LA 2PE1A 4I6HA 2JC6A 4LI5A 3RMFA 4B8LA 5HCXA 4WNKA 4CTCA 4ENYA 3TUCA 1YOLA 4BWXA 3HV3A 4BWPA 1H1QA 3IOPA 2VZ6A 2C1AA 3A7HA 4AT3A 3HX4A 1TQIA 3VC4A 1FOTA 3RCJA 3TXOA 4GSBA 5EFQA 1YHWA 2ZV7A 5HKMA 2XEZA 4G6LA 3DBEA 4XOZA 3NX8A 2VTAA 4F9YA 3QUEA 4FGBA 2DQ7X 3EFJA 5BUIA 4CT1A 5CAPA 3DKCA 3MSSA 2HAKA 3ZCLA 5AUYA 1OUYA 2JDOA 2YCQA 2WFYA 2RF9A 4LMNA 2JAVA 3R9HA 4AOJA 3D83A 4UV0A 2FSLX 2G2IA 2WZJA 3KVXA 4MD7E 2QOBA 3VQHA 3HV4A 3R2YA 3ZRKA 4AW5A 4PP9A 5CSXA 3UMXA 3C9WA 4HGTA 3DBFA 4LGGA 1M2PA 4DFNA 3PVUA 4MF1A 2BTSA 4DH7A 4R77A 3LW0A 4P5QA 5CXHA 1CDKA 5IISA 2HZNA 3EFLA 2QOFA 2YLEA 4XEYA 5K4IA 3LCSA 4LRKA 5C8MA 2CGVA 3Q9YA 3RNIA 3U4WA 5DR2A 1JKLA 5LMBA 3P08A 3D5XA 1WMKA 3V5QA 4NYEA 4TTHB 3QCXA 2O8YA 4BI0A 4ASXA 4IJ9A 5EI8A 4O81A 2WB8A 2J0IA 4E5WA 4YTCA 1W83A 5LARA 3WARA 2FB8A 2PK9A 1ZYJA 2IZSA 3QYZA 1J91A 3DK6A 1Q8YA 3EKNA 4JNWA 5CVGA 3UNZA 1XWSA 2JITA 3P9JA 4CKIA 3PJCA 1GZNA 2PUIA 1U5QA 4CEGA 4UXQA 3D15A 2P2HA 4TY1A 4ZTNA 3SOCA 3B8QA 4MH7A 4F0GA 2I1MA 2VTJA 3DU8A 4IAKA 4RA4A 4MUQA 4QYGA 5CASA 5J7HA 1UWHA 3R00A 1LPUA 3C7QA 3HVCA 3VBQA 4Y5QA 5HX8A 3E8DA 3IDBA 4FT7A 4GT3A 5JEBA 4IB3A 3KK9A 5ANOA 2QNJA 5KHWA 1P14A 4LOOA 2VWWA 2YWPA 3EQGA 4FV3A 4L3LA 4NM7A 2O64A 2OKRA 1CKPA 3PSCA 4IAZA 4XH6A 5D41A 4TL0A 2JKQA 2QO7A 5BX0A 2PPQA 2BDWA 3QRUA 1OMWA 4J52A 3OTVA 4BBEA 2W99B 2W5HA 3P79A 4QPMA 2ZV2A 3COKA 4GW8A 3BU3A 3TZ9A 4DHIB 3CTJA 4U3ZA 3QTUA 4L42A 5HE2A 2Z8CA 4AGDA 4D0XA 3QD4A 1VYZA 1U46A 3R1YA 5L6OA 2OJGA 4QMUA 3FMJA 3RWQA 4ACMA 4L44A 3NGAA 4O96A 3BV2A 3KKVA 5E91A 1KV2A 2CGXA 3QA0A 5FTGA 4IHPA 3HAMA 2BMCA 1J1BA 5J5SA 4K11A 3VULA 1G3NA 4A9TA 5CAOA 3G6HA 3U87A 3QKLA 5E8UA 1L8TA 2BRNA 2R3MA 4G3DA 1FGIA 4MNEA 4YP8A 5CF8A 5EM5A 4U41A 2VWBA 4J98A 4RJ4A 4TYIA 5FP5A 3ANQA 3R8VA 3W0PA 4H1MA 3C50A 4L01A 2WTJA 3UIUA 2GQRA 4NW6A 5CAQA 3JUHA 2GHGA 1XR1A 3QWKA 1SVEA 3QAME 2C30A 4FODA 4G16A 4PDOA 3EHAA 3O2MA 4C3FA 5KO1A 1XH7A 4FKWA 5GJFA 4BWKA 2X1NA 5CAVA 3GU6A 3G6GA 3DAEA 3CY2A 3OY3A 4RWIA 1A9UA 3CTHA 2UVZA 4EQUA 4OGRA 4QD6A 3G33A 3IS5A 3W10A 3ZXZA