4DLJA

Human p38 map kinase in complex with rl163
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
351
structure length
336
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Fluorophore labeled kinase detects ligands that bind within the MAPK insert of p38alpha kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 336
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dljA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dljA01
3R73A 2CJMA 4RGJA 3A7GA 4ITJA 1YRPA 3VUIA 2CGWA 1Q8UA 1ZLTA 5H9BA 4EZ7A 1PRYA 1H0WA 4YJUA 4JDHA 4PMTA 5DE2A 2W1HA 5M4CA 2B7AA 4FTLA 1B39A 2YHVA 3ZLXA 4FSMA 3UOLA 3GB2A 3LXKA 2J6MA 3GFWA 4R1YA 4YPDA 2ZAZA 5CAOA 4DFZE 4EI4A 2YJSA 1XH5A 3TWJA 4IAAA 1W82A 3GVUA 2VTPA 5JKGA 4PDYA 4BCFA 2XKCA 2C3IB 3KA0A 3WZEA 3A4PA 4U3YA 4YJPA 5C01A 5I0BA 4QP7A 1EH4A 3U6IA 5IQCA 2NO3A 5AMNA 3D15A 4L9IA 3Q3BA 1Q24A 3TZ9A 2RF9A 1IAJA 3ZO3A 4R5YA 3AC4A 3WIGA 4J97A 3RK5A 3NNUA 4RIWA 4PMSA 5AV1A 3ORLA 2EXMA 4FKIA 3Q5IA 3UP7A 3NUSA 4V01A 4DAWA 3CGFA 4MVFA 4RVLA 2C6TA 2P2IA 4B9DA 5LCKA 4WG5A 5CX9A 4OTFA 4RIOA 2Q83A 4MNEB 3ZSHA 3BELA 3MS9A 3IS5A 4M69A 2E9PA 1KSWA 3ORPA 2WMXA 1XH4A 4S31A 4ZSJA 3D4QA 5F4NA 2F7ZE 4CCBA 5BQ0A 4FSQA 2PMIA 5JFSA 4FV5A 2WMUA 3BU3A 5HTBA 5IQEA 1V0OA 2BRHA 3Q9XA 3OY1A 3EQCA 3ZLWA 3U6JA 1ERKA 3PXFA 2GNJA 2RL5A 2OG8A 3OBJA 4WOVA 4DH1A 5DR6A 5E9EA 4ZMEA 3FKLA 3UZPA 2ONLA 4JLCA 5FQDC 3PDTA 2FUMA 5DYJA 3CD8A 2R4BA 4MF0A 2QR7A 3MYGA 5F1ZA 3BIZA 3D5XA 4YHJA 5ICPA 3P08A 4BTFA 4EOMA 2V7OA 4HOKA 4C58A 3BE9A 4FSTA 4MBIA 2O2UA 4XLIA 2W17A 2R0UA 5DRDA 3O50A 4I93A 2CKQA 2RGPA 1R3CA 4MX9A 1PKDA 2PY3A 4IDVA 3RKBA 3QF9A 4I5PA 4N4SA 4NFNA 2IZSA 3TTIA 5CF8A 3UC3A 4WUNA 4WNKA 5H8BA 3I5ZA 3SDJA 1H1RA 3ZC5A 3V6RA 4RX9A 1ZWSA 4LI5A 3V04A 4IB1A 4KKHA 3BQRA 3FBVA 3K3JA 2PTKA 5DNRA 4KIKA 3MN3A 1OBDA 1M2RA 5H2UA 3MESA 4JXFA 4L01A 4NW5A 1OUKA 3SOCA 4O27B 4QMZA 4DH3A 5CU2A 2OW3A 4OGRA 4EOOA 5CAPA 2XRWA 5I4NA 4F1TA 2WMAA 1DAWA 2JAMA 4O1PA 3R9NA 5HD4A 5LWMA 2GPHA 5AR3A 4AGWA 4YTFA 2J4ZA 2QKWB 3LMGA 3DV3A 2E2BA 1XH9A 3I6UA 4I41A 3NIEA 4CFUA 2R3LA 3QA0A 5IA3A 2EXCX 2I0HA 3GCQA 4JVGA 3EMGA 1SZMA 1W7HA 4R3RA 5AR5A 4GK4A 2E9UA 3FC2A 5CENA 4J98A 3UOHA 3ZUTA 2J0IA 3E8NA 2WMWA 3DB6A 4K2RA 2ZMCA 3GU6A 5IISA 5KUPA 3SC1A 3RALA 2VTLA 2YN8A 4JDIA 4K8AA 4HVSA 2XBJA 3DTWA 4RRVA 1OKWA 3R22A 4EJ7A 3ELJA 3NW7A 3FDNA 3AD5A 1Q8YA 2BVAA 3GCSA 1JOWB 1ZOEA 5B2MA 2BTRA 3BLHA 3BEAA 4LRMA 2BZIB 2C0OA 5AAGA 1M2PA 3BWJA 3QD2B 3PJ3A 1J7IA 5C4LA 2BFXA 4RIYA 2GNLA 2AYPA 2YM5A 4BIDA 4BN1A 3AC5A 4CD0A 2HW7A 4XS2A 2VTRA 5BVNA 2YWVA 5HO6A 3BYUA 3KREA 4JBVA 5G6VA 3G6GA 4EYMA 1H00A 3H10A 3W33A 1FOTA 5HBHA 1JPAA 3IECA 1J1BA 3RP9A 2WO6A 3EKNA 4PWNA 5CVGA 4CKIA 4FTMA 5IEYA 4TW9A 2OZOA 2PL0A 1UU7A 4X2JA 4XH6A 3S3IA 4A9SA 4YJQA 4ZTNA 4X3JA 1Q8TA 2BROA 4CQEA 3ROYA 3DK6A 3QC4A 5AA8A 4G17A 4DINA 3D7ZA 5KMNA 4DFNA 4X0MA 4GYGA 1WVXA 3LMIA 2VUWA 4QP1A 4RJ5A 4ZJJA 3NUAA 2R3NA 3AGLA 3D0EA 5CU4A 5AUYA 3QRJA 4WD5A 3G0FA 4E6AA 2XJ2A 3DS6A 4ZZOA 5M44A 3WZKA 3QD0A 3CQEA 3SHEA 4BICA 4NM3A 3ZFXA 3DKGA 1IG1A 2GCDA 2Q0BA 3UO5A 4EH2A 4RWJA 2ITQA 3KY2A 3DZQA 2XIXA 4XP0A 4Y46A 5J95A 4O7ZA 4II5A 5K4IA 5EM8A 3DLZA 3TNQB 3I81A 1O6LA 2JBPA 4I6QA 4OBQA 5DT0A 4DTAA 2QCSA 5CEKA 4GT4A 4KBKA 4ACHA 2X6DA 3BEGA 3RJCA 4ZSAA 4HGTA 3HLLA 5ETIA 5HG5A 4EH7A 3PG3A 3CLYA 4AT3A 4FYNA 4LOPA 4AN3A 5M09A 3LLTA 4FL3A 4AGDA 5C9CA 4D28A 1ZRZA 5TKDA 3FHRA 3FI4A 5FEQA 1DM2A 3BU6A 4EHEA 3DDQA 4DLIA 4G3EA 5C8NA 5E8XA 5CYIA 3EYGA 4I4FA 5FD2A 3V5TA 3QZFA 4FNXA 2UZVA 4WNOA 5EHOA 4RQVA 1E1XA 2XMYA 3CC6A 5H8EA 4CRLA 3GOPA 4E4NA 2OLCA 4D9UA 4EUTA 3VBTA 2B9JA 1UNGA 3WI6A 4MBJA 4IQ6A 3VBQA 3NUYA 4GIHA 4JG7A 4RVTA 5E8UA 3E62A 1RJBA 3P4KA 2IW9A 1XH7A 4B0GA 2XA4A 3C4EA 5M4IA 3I0OA 5GZ9A 3RVGA 4GEOA 1APME 3VBWA 4H36A 3SA0A 3OCBA 4AZSA 3OOGA 4C3RA 4YSJA 3F9NA 4HYHA 1M2QA 2QOBA 4OTHA 2P3GX 5KHXA 4M0ZA 4NW6A 5A9UA 2O64A 3ZEWA 3GGFA 4O7RA 3MWUA 3HUCA 4BTKA 4FIHA 3KFAA 4UMUA 3VUTA 2FO0A 4NKSA 4QTAA 3EN6A 3SD0A 4FKLA 2HAKA 1L3RE 4CT1A 3UG2A 2X8EA 1OECA 4JAJA 4YNOA 5KMIA 4ASXA 2BZHB 3PXRA 3ZRKA 5A4CA 2V62A 3BPRA 2PPQA 3NSZA 4ORKA 3BX5A 4BCHA 1GZNA 3IDCA 3RAIA 5LMKA 4NTSA 4TN6A 5CNNA 5K5XA 2YABA 4QQ5A 2VWUA 5D41A 5J87A 5E8ZA 2HY81 2X4ZA 4LGGA 5L2WA 3R28A 3VHKA 2RFNA 2X9FA 4YLKA 2X7FA 3I4BA 2QLQA 3QQGA 4QTCA 2GQSA 2DWBA 1UWHA 3OP5A 5KHWA 4W4VA 3FE3A 1X8BA 4DC2A 2YM4A 4ENYA 5IH6A 4DT8A 4ZSGA 4ZXTA 1GJOA 1H1PA 1IA9A 3E92A 3GCVA 3LXLA 3RPOA 3TNWA 1AQ1A 2BALA 2ETMA 4FX3A 4L45A 3OBGA 3ZZEA 4DT9A 1PXMA 2NPQA 4BRXA 3QKKA 1YXUA 2YAAA 3ZEPA 4MQ2A 4QYFA 5EHLA 5LVOA 3OC1A 2UZWE 3TZ8A 3EFWA 2W5HA 1JKSA 1Q4LA 2W1FA 1F0QA 2OFUA 3BGZA 3ZTXA 3UNKA 3SKCA 4YO6A 1FVTA 3LCKA 2OICA 3QGYA 4HNFA 4V0GB 4BCMA 4D55A 5FXSA 3TCPA 3FPQA 2UUEA 4RJ4A 3V5WA 2A0CX 2PMNX 1FMKA 5AP7A 4JX7A 5DIAA 2X2MA 2VO3A 1PY5A 4XG9A 2C6MA 3UDBA 2PUNA 3RI1A 5I9XA 5FBNC 4O0SA 4BDHA 4LMUA 2ONLC 4QMLA 2XK9A 2BMCA 2IW8A 2QODA 3DOGA 3T9TA 2R64A 3NUUA 3A7IA 5IH5A 5GIPE 1QPJA 3OD6X 5D12A 4PL5A 3R6XA 4GJ3A 4FV0A 4L46A 3LFNA 4XV2A 4O96A 4AGCA 3LFSA 4DCEA 5KMJA 4CQGA 1PMVA 2I1MA 4X3FA 4BIBA 2C6KA 4EH6A 4D2PA 1PXKA 4ONAA 4A06A 4E5AX 2HOGA 2VTTA 4LV8A 4MD9E 3SRVB 4LYNA 4FG7A 5HLNA 4CFWA 2IVUA 3C7QA 4W8EA 3VNTA 3G2FA 5KKRC 1OPJA 2GFCA 2ETKA 3KKVA 2XIYA 4K9YA 3CKWA 4K0YA 4FC0A 4O7WA 3QTXA 3AXWA 4PL3A 3ZHPC 3HA8A 2Z7QA 2YM6A 2PVMA 2RKUA 1IASA 4MYGA 1WAKA 3MFTA 1H0VA 5J9YA 3I5NA 2IJMA 3OHTA 4Z7HA 4LM5A 5J7BA 3ATSA 3U87A 1J3HA 3G0EA 2PVHA 2PUIA 1S9IA 3OWJA 2PVRA 4QMMA 2WPAA 5JK3A 2J0MB 5DR2A 3G33A 4JG6A 5DI1A 4KA3A 2ITOA 4C59A 3MSSA 1H1QA 3EQBA 2ZM3A 4FIGA 3TIYA 4E7WA 3ZO1A 3F5UA 3OZ6A 4OAUC 4ZEGA 3OUKA 4YBKA 5AIKA 4QMUA 4O86A 5HG9A 2FGIA 3L9LA 2JFLA 3ZYAA 4YBJA 3QYWA 1PMEA 4I22A 4IADA 4Q9ZA 2VTIA 4BI1A 3O96A 3QCXA 4Z55A 3OXTA 3R7EA 4YZNA 4N6ZA 5DPVA 5J5SA 5AFVA 2VWVA 4FVPA 4R8QA 3QC9A 3DAKA 2UVZA 5HKMA 5F9EA 3LCDA 3H0ZA 3QRUA 2KTYA 2YZAA 3KK9A 3LFEA 3VS0A 2B9FA 2VTSA 3PG1A 4Z3VA 2O65A 3C0HA 3TM0A 5CSVA 3RPVA 3KMMA 4XOYA 4AAAA 4EOKA 5A4LA 2OFVA 3MDYA 4WSYA 3R7YA 3HMIA 1IRKA 3C4CA 1Y6BA 1RDQE 4QP6A 1WBVA 3QD4A 4UMPA 2W4KA 5T3QA 2QOFA 2YCRA 4FNWA 3NLBA 5AV3A 3FMDA 4YC6A 2BDJA 2ITXA 3IK3A 3KRJA 2VX0A 2ITZA 4PP9A 2WIHA 4FVRA 4HCTA 5AX3A 3PJCA 5DFPA 3HP2A 2R3PA 3MGYA 1YI4A 2GDOA 2QO9A 3GNIB 2NNWB 2YAKA 1VZOA 4BBEA 2GHLA 3UPXA 5D1JA 4RWIA 4JRVA 4AF3A 4JT3A 5HNBA 2BIKB 3ZOSA 3RK9A 3HDMA 4AOIA 1IR3A 3OTUA 1OPLA 2CCIA 4EK4A 5HHWA 3NWWA 3DAJA 1G5SA 4E5WA 3DT1A 5TT7A 1FGKA 4W8DA 4FV9A 4KD1A 4PDSA 4WKQA 4CFXA 3R8VA 3PXYA 2YDJA 1R0EA 3QQJA 3U4WA 1V0PA 3WIKA 2DYLA 4DEGA 5LARA 3U8WA 2VWBA 3SXSA 4BFMA 5J8IA 2A4LA 2BRBA 4ZLZA 4K33A 5BMMA 1QPCA 1CKIA 2Z8CA 5JSMA 1YI6A 4IX3A 5FTOA 3I6WA 4AW1A 3ZUUA 4FOBA 4ACCA 3MPAA 4EBVA 3ZCLA 5CAQA 2QQ7A 5AV2A 5KKRB 3NUXA 4RJ3A 2IW6A 3HYHA 4DTKA 3V3VA 4QNAA 4U8ZA 4C4EA 3UQGA 2HZNA 2QLUA 4TNDA 4TZRA 5CT7A 4M67A 4BGQA 4KIKB 5HCXA 3NYNA 3ZRLA 1LEWA 4APPA 1O6KA 4APCA 3FXZA 4BBMA 5J7HA 3TV4A 4IVAA 4CV9A 3DJ5A 3RGFA 4A9TA 4WNMA 1RQQA 4DEHA 4OW8A 1R0PA 3PIYA 3CD3A 3QCSA 4JG8A 4F7LA 1KUTA 2JLDA 5EDRA 4ZY6A 2B0QA 3TNPC 4QMXA 1SVGA 4FIJA 1GIJA 5M57A 1XBAA 4M14A 4U44A 1SM2A 4F0FA 3TNIA 1M52A 4MXYA 4D1XA 3G9LX 1QMZA 4M3QA 4DGMA 5HE1A 3HX4A 4U43A 3WF7A 5JN2A 3F66A 3OXIA 5DLSA 1ZYDA 4HZSA 3BYOA 4CSVA 2FSOX 2WU6A 4KBAA 5C8KA 2ZV7A 5EOLA 2C6EA 2ZM4A 3R7VA 2XJ0A 2VD5A 4FA2A 4CMTA 1J91A 3IOPA 5HZNA 3MPMA 3C4WA 3VS5A 1WBOA 2WD1A 4UZDA 5CNOA 1QCFA 4FKRA 4C4GA 1OBGA 1WBNA 4R77A 2PVYA 4CFMA 5M4UA 4UWBA 3PA3A 3MTLA 4RPVA 5AR7A 3LM0A 4G3GA 3HVCA 5AP1A 4HVDA 2O63A 1PYEA 2OU7A 5DBXA 4U0IA 5HE0A 2C0TA 3PY3A 3TUBA 3PXQA 4P5QA 4RIYB 5FWKK 2VO7A 4A4OA 1MQ4A 1STCE 2PVKA 2BZKB 2C30A 2H6DA 3LVPA 4TPTA 5E92A 3OXZA 3QTRA 5I9UA 2VV9A 4C61A 2ACXA 4CZYB 3FMHA 3GC9A 2V0DA 1B6CB 1FQ1B 2YITA 3F2AA 1ZOGA 4XG3A 2Y4PA 5DR9A 3GU8A 5FEDA 3R9DA 1ZZ2A 4IB3A 3GP0A 5HI2A 1H28A 3FMJA 3ZZWA 4FTOA 4F6SA 3MVLA 4UB7A 4RLLA 3ZLSA 2VWIA 2ITWA 3ZBFA 3QBNA 3BHVA 3HUBA 1OKVA 3R9RA 2GSFA 2R3RA 4DG3E 4EORA 5IQFA 3MFSA 2IO6A 4FTNA 4L6QA 3ORXA 2FVDA 2JIVA 2OO8X 3RHKA 3DLSA 4QPSA 4PUZA 4XG6A 5E8SA 1JKTA 4C34A 5B0XA 5DOSA 4J96A 2JDVA 4YO4A 4H05A 4EHGA 5ANJA 2B4SB 2XEZA 4RVMA 1PW2A 4H3BA 5AV0A 2AC3A 4A9UA 4N57A 2R3FA 4EH4A 4YJOA 3R8PA 4EOQA 4RX8A 1VEBA 5EW9A 3GI3A 1FGIA 1WVYA 1JBPE 2QR8A 4KAOA 4I6FA 2WQNA 4RC2A 2GFSA 4HPTE 3U9NA 3R7UA 4E73A 4J71A 5CAUA 2O0UA 2PK9A 4O7VA 2QOOA 3R9OA 5A46A 3ORIA 3LFAA 5GZAA 4I3ZA 3ORMA 1JWHA 2J50A 2W1EA 3SV0A 1JKLA 3MFRA 2QONA 3QRTA 3QTQA 3CBLA 3G5DA 3AC3A 3NW6A 4FIIA 2E9NA 5CSWA 1A06A 1Q8WA 1UNLA 3F3WA 4ZZMA 3V6SA 4L68A 5EG3A 3LIJA 2JDOA 4FUXA 4CT2A 2W4OA 3CPBA 4DG2E 1PKGA 2F4JA 4ENXA 1BI8A 2YIRA 2XVDA 2WMQA 3VS6A 2C3LA 3EFJA 4X3FC 4FK6A 3EL8A 4K11A 4IAFA 4IX5A 5HICA 4CMUA 5KMMA 3EQRA 5JGBA 2X8DA 3ZSGA 4U7ZA 3ZXZA 1REKA 2W5BA 3PVWA 3Q2MA 2OJIA 4JS8A 4BY9E 3KEXA 4WBOA 5HG7A 3KXGA 1A48A 2WTIA 4G6NA 3VO3A 4CEGA 2OH0E 3FLSA 3ROCA 1J7UA 3QQLA 1XH6A 1WZYA 3DBEA 4G2FA 4XEYA 3VUHA 5AUTA 4L43A 3THBA 4FTTA 1BI7A 2F57A 4MXCA 2BZJA 3D83A 4OTDA 3RMFA 4AFEA 4DEIA 1IEPA 3NYVA 3UGCA 3W55A 4NTTA 2HIWA 3FUPA 1OITA 3NCGA 3QHWA 3QYZA 4E6CA 4O0YA 5FDXA 3C4FA 5G1XA 2UVYA 4A4LA 2C5NA 3VC4A 3U54A 1YXXA 3H3CA 2Z7LA 3OEFX 3ZDUA 2I0VA 2JDSA 3DCVA 3HRBA 1U54A 5HE3A 4DFLA 1YOJA 3NYOA 4BL1A 4RC4A 5IQDA 1WBPA 1L8TA 4FV1A 4E4XA 5LQFA 2YIYA 4E6DA 5DHJA 3BGQA 3A4OX 3PY1A 1PXPA 2PE2A 4GVJA 4JOAA 3W2PA 3E87A 4UZHA 4JBPA 3Q4TA 3N4UA 5AAEA 3PRFA 4M12A 4EKLA 2WAJA 3LXNA 5DRBA 1BKXA 4Y95A 3FKNA 5DH3A 3ZXTA 3KMUA 5IU2A 2C5XA 4TT7A 5KMKA 1BX6A 4NT4A 3PJ2A 1WBWA 4H1MA 4AA0A 3GC7A 5DEYA 5A4TA 5IUGA 3VRZA 1U46A 3VVHA 3FLNC 3FSFA 1UVRA 4QQCA 3DXPA 2X8IA 5EW8A 1SYKA 3GC0A 5AP4A 3P7AA 2ZYBA 5E90A 4XJ0A 3HAVA 4GH2A 3VS7A 4G3CA 2FSTX 5T68A 1VJYA 4S34A 5HD7A 3BQCA 3BBWA 4YLJA 1XHAA 3ENMA 5BVOA 2XIKA 5AX9A 3NGAA 4ZK5A 4S30A 3G90X 2WZJA 4YP8A 3K5UA 4D58A 3JVRA 1OL1A 4FODA 4YPSA 5ETCA 1ZYJA 2QO2A 4JIKA 4U42A 5EYKA 3GU7A 2BRNA 4OR5A 3M1SA 5HG8A 4D4YA 4F65A 3UZTA 1KE8A 4FSNA 3ITZA 3R04A 4E5BA 3N4VA 2WB8A 4K6ZA 4FKUA 5AIRA 1PXJA 3K3IA 3ZS5A 2IZTA 3FL5A 4L8MA 4RWLA 3KK8A 4MCVA 1XJDA 3D94A 3RBWA 1PXIA 2WTVA 3QCQA 4OUCA 1UA2A 3K5VA 3D5WA 2V7AA 4WRGA 4EC8A 4CG9A 3QX2A 3F82A 4D4RA 3NZ0A 4J53A 4FKPA 3HZTA 3N4TA 3CR0A 3IPHA 3LQ3A 3NNXA 2C47A 1OM1A 4RA5A 5AP5A 2GTNA 4HZRA 3TKHA 3R8LA 4C4JA 5HEZA 4C7TA 4EOPA 4N70A 4QP2A 5LVNA 2G1TA 3SXRA 3FMKA 2WTCA 4XG4A 1PJKA 1OKYA 3W2CA 2A1AB 2BCJA 3O23A 4PQNA 4ALVA 4BCNA 4E1ZA 4F7SA 5IDPA 3PJ1A 2QHMA 4J7BA 3HMOA 5CSHA 5IDNA 2QI8A 4KB8A 3NMUF 3FLWA 2BKZA 2WQMA 5ITAA 4F9CA 5AUWA 2J5EA 1TQIA 3EFKA 2FB8A 2PU8A 1K2PA 3DZOA 2EB3A 1KE7A 4ZTLA 5IPJA 4ZSLA 4MXAA 3A62A 3W2QA 4FI1A 5C1QB 5JFXA 1KV2A 4FZ6A 3DY7A 5CZIA 4XNEA 2GHMA 3FI8A 3PVGA 4QNYA 4O7LA 3MY1A 4AN9A 4NM0A 4FVQA 3TACA 3ZBXA 3TT0A 2OF4A 3A60A 3CSVA 4LGHA 1Z9XA 4PPBA 5BUJA 2YACA 3G9NA 3R0TA 5AUZA 2ZDUA 3B8QA 4EH3A 5L8KA 4FUYA 2HZ0A 2P33A 4JAIA 4LOOA 5J5TA 4DN5A 3PPKA 4YJVA 4O0VA 5KZIA 3ZH8A 3CTHA 3NAYA 2F2CB 3FI3A 4PL4A 4O2PA 5D7AA 3LFQA 3QX4A 1E1VA 4RFMA 3VBYA 4C4FA 4Z9LA 5CQUA 2WTKC 1KOAA 4D2SA 2R7IA 2JITA 4OTPA 4CCUA 3W16A 4FR4A 2C5YA 2C3KA 2C5OA 2HXQA 3TJCA 1Z57A 3BCEA 3QWKA 4OTGA 2Y7JA 5D7VA 4O0TA 1NXKA 3FXWA 5JGAA 4JRNA 2YCQA 5EYDA 4IC8A 3FMNA 3EOCA 2XZSA 4HVGA 3KVWA 5AEPA 3PYYA 5M08A 2W9ZB 3VS3A 5FDPA 2Z2WA 2XS0A 4FSWA 3CXWA 1LP4A 1R39A 1OL7A 2HXLA 4O0UA 2R7BA 3HRCA 1U5QA 5AR2A 2IVSA 2VAGA 3I60A 3DNEA 4GCJA 2WGJA 5EDPA 5CI6A 4DCAA 3TNHA 3NR9A 3TZ7A 4BVUA 4XRLA 3C13A 5A4EA 1P4FA 3AQVA 2KULA 5KZ0A 3R02A 1ND4A 1ZYCA 3WF6A 3R1QA 5C4KA 3ZONA 2PSQA 4HGEA 3OWKA 5TE0A 3UC4A 3D14A 2VU3A 4AZVA 4BWPA 3MY0A 3UMXA 3ANRA 4R7HA 1H27A 3SQQA 5KBQA 2WMBA 1VYZA 3ETAA 1B38A 1OKZA 1ZMUA 2V5QA 2H8HA 4PRJA 3UNJA 4BKYA 4DEEA 4BGGA 4BTJA 1YHWA 4QTBA 4GU6A 4PDPA 1CSNA 5EI2A 3Q4CA 5CSXA 4ZSEA 3UVQA 4Q5HA 4W9XA 1M14A 4FG8A 2VZ6A 4IX4A 4NKAA 2WTDA 4BCJA 1CM8A 5I5ZA 2WIPA 4FSZA 2XNOA 3QGWA 3U9CA 4YJNA 1YWRA 2C68A 3I1AA 4R3CA 5FXRA 4NIFB 2RFDA 3L9MA 4R5SA 1I09A 2XYNA 5CU6A 3UE4A 4CV8A 4EEVA 1NVRA 3CJGA 2OK1A 2QOKA 3IKAA 4G6LA 4JQ7A 3BV3A 5TO8A 4GV1A 3BI6A 3C1XA 4EONA 4IZYA 3IW5A 2YJRA 4JDJA 2AUHA 2QOQA 4ITIA 3VJNA 3W10A 3E63A 2UW5A 2VWWA 4MEDA 3WF9A 3G6HA 3HV4A 3R63A 3R01A 4IVBA 2EUFB 3QA8A 1ZXEA 2HW6A 3KF4A 4AP7A 2Y6OA 4HCUA 3UYSA 4ZMFA 2UW7A 5AP2A 2W99B 3Q04A 3Q52A 4IAYA 4RMZA 4FZDB 4GFOA 3WYXA 4F0IA 4XV9A 1JAMA 3F3VA 4AZTA 3P23A 3QRIA 4QTDA 2OH4A 1J7LA 4JR3A 3COIA 4WBBB 3EQHA 4WT6A 3RHXA 3FQHA 4ASEA 4IHPA 2QNJA 4DTBA 2VGPA 1QPDA 2XEYA 3BHTA 1XR1A 3PPJA 2QU6A 4LGDA 3V8SA 5KX8A 5LMAA 3W8LA 3EN9A 2CNQA 3UIXA 3IW7A 1TQPA 4BDEA 3E3BX 3V01A 4FZ7A 3PA5A 3DJ6A 4LOQA 4JQ8A 4QYGA 2WTKB 4CRSA 4YMJA 4IVDA 3D2KA 4FMQA 3VUGA 3AD4A 5CU3A 3CQUA 4D5KA 5EKOA 3PP1A 3W2OA 4YHTA 2WXVA 3N51A 1DI9A 5HU9A 5I9YA 1G8AA 4G9RA 2IZUA 3S00A 4F08A 4ASZA 3R71A 1QL6A 4HPUE 1OUYA 3M11A 5AR8A 3JR1A 4QPAA 3EN5A 3DQWA 3V8TA 5JEBA 5JT2A 4AN2A 1K9AA 4E93A 2R3OA 5AUVA 4ASDA 4FGRA 3NX8A 4OTIA 2YIXA 2O8YA 2Y8OA 3F6XA 4KKEA 1W8CA 4MKCA 3SW4A 3VJOA 5IA2A 4TYHA 3LPBA 4AZWA 5HTIA 4L67A 2CCHA 2WFYA 4Y72A 3S2PA 4ZIMA 1H01A 3H9OA 3NRMA 3NDMA 3IOKA 4DH7A 4TYGA 3R2YA 4F63A 2C5VA 2XM8A 4F9WA 1GY3A 4IAZA 4TL0A 3MH1A 5J1VA 5FUTA 4EWQA 1YI3A 1OPKA 4NK9A 3RNYA 2UVXA 3A61A 4I0SA 2Y6MA 3B2WA 3C9WA 4QMTA 4AS0A 2YERA 4YTCA 3TJDA 2GQRA 4QMWA 3WZUA 2QO7A 3AT3A 3WARA 2B1PA 3ZMMA 4W9WA 2BTSA 1CTPE 2J7TA 2RIOA 2XKFA 4C2WA 5L2TA 4ZLYA 3GOKA 1CMKE 3S0OA 4I6HA 1H26A 1W83A 3BV2A 3W2SA 4FTJA 2C6IA 3R8MA 3HNGA 2WMSA 3QLFA 3R00A 5ACKA 3ACJA 2QHNA 2W1ZA 2LGCA 3FZSA 4PNKA 3U6HA 1OVEA 2QD9A 4YU2A 3DKFA 4IBMA 4D9TA 3BYMA 3QRKA 5EH0A 4RIXA 4NJ3A 4RSSA 2NRYA 3PZEA 3ORKA 4A4XA 3E8EA 4U3ZA 2UW0A 2XNGA 5TOZA 1TQMA 4CYJA 4D4SA 3MH0A 4CLIA 1P4OA 4WSQA 2UZBA 2Y4IC 4C37A 1AGWA 4TKSA 4U41A 4XV1A 4HYUA 4MHAA 1YHVA 4ALUA 4IVCA 5A3XA 3BYSA 2W9FB 5EK7A 4GSBA 3RPYA 4RA4A 5L8JA 4AE6A 4F70A 4EH9A 4FT9A 5EFQA 1JSTA 2R3GA 4S32A 3POOA 1JSVA 3BE2A 2XM9A 5IQIA 3LM5A 2ZV2A 4EH8A 4HW7A 4YJSA 3WE8A 2JDRA 3LLAA 5HBJA 3NYXA 2BAJA 2WNTA 4LL0A 5IQHA 3UYTA 1M7NA 3A7JA 4RC3A 3FLYA 4X6QC 5BX0A 2BKKA 3W2RA 5FM3A 1PXLA 5M06A 4LG4A 1P14A 5CVFA 4EQCA 3HKOA 3KB7A 4DGLC 3ODYX 4GKIA 4FZFB 3EQDA 1YDTE 2OWBA 4OT6A 4RJ8A 3V5LA 4A7CA 3VUKA 3OCSA 2PWLA 3FL4A 4WIHA 4X21A 3T8OA 3NCZA 1KOBA 4EZ5A 2E9OA 3PRIA 3R30A 2OIQA 1A9UA 2UV2A 1OL2A 4PX6A 4GFMA 4K18A 2XNBA 2W1DA 4XG2A 5JFWA 1IA8A 1OI9A 4F7JA 4L44A 3LJ0A 4FTAA 5HBEA 2PUPA 2JEDA 3KN5A 4JBOA 5T6KA 4E6QA 3UPZA 4ANBA 4BCKA 5FP6A 2VWXA 2ITYA 4NYEA 2BPMA 2HY0A 3IDPA 4YURA 2ERKA 3BWFA 4FV6A 5IA4A 3PTGA 5IEXA 1NVSA 3O7LD 1P5EA 3HL7A 4QP3A 2XNEA 3CTJA 2YEXA 2G01A 3PZHA 4HNIA 4IWDA 3DAEA 3V5QA 3ZDIA 4XV3A 1XO2B 4ACMA 4AZFA 4HVIA 1H4LA 3RZFA 3L8VA 4EQMA 4QMQA 3DXQA 3AD6A 2PVNA 5BVEA 3CKXA 4P5ZA 4QMYA 4RIWB 3I0QA 4EHVA 3WE4A 2YA9A 4FTUA 2P2HA 2JKQA 3OY3A 4O1OA 2UZUE 3FHIA 3OOMA 4JNWA 2GMXA 4GG5A 1Q8ZA 2YM3A 4YNEA 4E3CA 5IH4A 4EKKA 4ACDA 1JKKA 3VHEA 3DJ7A 4XHKB 3UNZA 4AWIA 4EJNA 3MTFA 4M69B 4AW2A 3E7VA 5AM6A 5CEMA 4CG8A 2BIYA 1FPUA 4MXXA 5E91A 4MWIA 3MV5A 3R7OA 4LRKA 3F5PA 4ZS0A 5ETFA 4BYJA 5HU3A 1JSUA 5A6OA 3NEWA 2I0YA 3NS9A 1LR4A 4H39A 4YTIA 2X0GA 1ZZLA 3KCKA 1K3AA 3UVRA 2R2PA 4C57A 3SG8A 4UXQA 5BUIA 3O8TA 4X2FA 5F20A 2YLFA 1H8FA 3B8RA 1OL6A 2UZDA 5HLPA 3R7GA 5KE0A 5K3YA 4AOTA 3JY0A 3NVMB 3ANQA 5JFVA 4D2VA 4L7SA 3KU2A 3L8XA 3UBDA 3MY5A 4BZNA 4FL1A 4IB0A 5HESA 5CF6A 2Y0AA 1H1SA 3QXPA 5JRQA 4HVHA 3UOKA 3OVVA 4AT5A 4FKVA 3Q9YA 1ZYSA 4K77A 4KKGA 3SVVA 3ULIA 3AC2A 2C1BA 3OG7A 3R21A 3CCNA 5E8WA 2YZLA 2WKMA 5GJDA 4PMMA 2JFMA 3AMBA 3MH3A 5AUXA 3UZRA 4WA9A 4WO5A 2W06A 4OTQA 2QKRA 4D2RA 2VO6A 2OSCA 3NUPA 4LRJA 4TYEA 4YC3A 2HZIA 5AAFA 4L3JA 4OT5A 5GHVA 1M7QA 4QPMA 2CLQA 3QUDA 3FZOA 3MVJA 3Q9WA 3VQHA 4EK3A 1V1KA 4GL9A 5CAVA 4BR3A 2G15A 3VS1A 4KINA 5BYYA 3I7CA 2DS1A 4J1RA 5B2LA 3PVBA 5CEIA 4IZ5A 5AV4A 2EVAA 3ORTA 4JR7A 5CF5A 5HQ0A 3Q6WA 5LVPA 3KXZA 3PUPA 4FTIA 1SVEA 4NCTA 3EQGA 2ITTA 4NFMA 5ANDA 2JKMA 4Y85A 3F5XA 3PY0A 2W7XA 3KXNA 3W1FA 3IO7A 2I6LA 5K0KA 3VN9A 4CFVA 5IQGA 3R7IA 1Y8GA 1NY3A 2J0JA 4C3PA 5HX6A 3O8PA 2BRGA 3OW4A 2GNGA 1NVQA 3AT4A 1WMKA 4PNIA 2OIDA 4G31A 4JBQA 2X2LA 4F7NA 4O7TA 3E7OA 3IG7A 3R1NA 3AT2A 3EN4A 3PVUA 3E8CA 4F6UA 1H08A 3FYJX 5CLPA 3A7HA 2BILB 3HV3A 3ORZA 1KE5A 3RWPA 2Y9QA 5CASA 5IZFA 4FYOA 4L00A 4QYHA 3CY3A 4D2WA 4FV8A 1OIYA 2GHGA 4CZUA 5J79A 3ATTA 2X81A 2W4JA 3C5UA 4IH8A 3KRXA 4RJ6A 4Q5EA 4DYMA 2UW9A 3OF0A 4BTMA 4AUAA 4YTHA 2UW3A 2JD5A 4IMYA 4M0YA 1URWA 4OLIA 4WG4A 3VULA 4BDFA 5ETAA 3EQFA 4UV0A 4QMPA 3QUEA 3Q4ZA 2OXYA 2CGXA 4BBFA 4TYIA 4KABA 4XX9A 3HRFA 1QPEA 3FMEA 3MB6A 3E8DA 1HOWA 2YDKA 2BR1A 5CWZA 2WMRA 4Q9SA 4ACGA 1OIQA 2YDIA 3C50A 3FSKA 3KCFA 3P0MA 3ZM9A 4UALA 3U4UA 5HX8A 4Q2AA 2E9VA 4PMPA 3PSDA 4D5HA 4HJOA 4FSRA 5CT0A 5KO1A 4X6RA 2XKDA 2G2IA 5CY3A 4R1VA 3A8WA 4UY9A 5EOBA 4ZS4A 5D11A 4AA4A 1F5QA 2F2UA 1T45A 3GUBA 3Q9ZA 2BDFA 5DVRA 4CLJA 3FC1X 1UKIA 4XOZA 3TEIA 4FZAB 5AP6A 4PV0A 1CKPA 3TL8A 5AM7A 4C62A 1R1WA 4GK2A 3T3VA 3F3UA 5EM6A 4NH1A 3RM6A 2WEIA 4RJ7A 3ACKA 1UNHA 5FM2A 2R3KA 4KSQA 3AG9A 3UIBA 4J52A 5C27A 2X9EA 5L2SA 4IC7A 4V04A 1OMWA 2DUVA 2WHBA 2OJFE 3DBFA 4RQKA 3NAXA 2FYSA 1MQBA 4ERKA 5M56A 4GFGA 2ITUA 3TN8A 2OXDA 3BHHA 3DBQA 3LAUA 4FL2A 3ZFYA 5B2KA 1GIHA 3T9IA 5AWMA 3M42A 3KC3A 4YHFA 4IAIA 3HV6A 2FSMX 3VIDA 4UMRA 5A6NA 3PLAE 4MF1A 3NNVA 4ANOA 5LOHA 2VWYA 3PSCA 3CIKA 3R8ZA 3GU5A 4XLVA 1U59A 1YWVA 3ZO2A 5A14A 2OJJA 4WUAA 1NW1A 2VX1A 2BUJA 3W8QA 4FT7A 3GFEA 4BI0A 1MUOA 5EM7A 2HYYA 4XBRA 3P79A 3DPKA 1W98A 5LJJA 4D0XA 4AT4A 2GU8A 3LJ2A 4P90A 4MTAA 5CEOA 4O91A 4FKGA 4Y83A 5L6WL 5GIOE 3JY9A 4X2KA 4UMQA 4IFCA 5LVMA 3JPVA 3MIAA 3SW7A 2BRMA 3GXLA 4NZWB 3GT8A 3ZSIA 5IA0A 4J95A 3MFUA 4V0GA 4ZY5A 2GNIA 2PE0A 4TYHB 1TVOA 1W0XC 3PJ8A 1YOLA 3Q5ZA 2EXEA 4GVAA 1YHSA 3LFBA 4QD6A 4E4LA 3JUHA 3G15A 4GG7A 4USEA 1AD5A 5DA3A 5CALA 4ZP5A 4I1ZA 3UTOA 5C26A 4CFNA 2A2AA 4IXPA 2J0KA 2CHLA 2UZNA 4IX6A 2GS2A 3BGPA 1ZARA 2REIA 5HORA 4O0RA 4EUUA 2ESMA 2J2IB 3CEKA 1WBTA 3O0GA 2B9IA 2ITNA 4LV5A 5ACBC 3KQ7A 2R3MA 2O3PA 2P4IA 4FIEA 2WTJA 1ZAOA 4FT5A 4U40A 4WHZA 2A19B 1MRYA 2ERZE 3MH2A 4FTKA 5CQWA 3QLGA 2C1AA 3UJGA 5M55A 2X7GA 4UWYA 3TTJA 3L9NA 2WMTA 2RFEA 4FV2A 3MVMA 1BMKA 5IKWA 2B54A 4R7BA 4QO9A 4ZJIA 2RSVA 4FKQA 3PWDA 4BDBA 4FIFA 4YZDA 2QOHA 4O2ZA 4EK6A 3TDWA 2CPKE 2PVFA 5LXMA 4W4WA 3LCTA 4XMOA 3MPTA 4B99A 5BYLA 3EHAA 3Q96A 1YW2A 2QURA 5AR4A 3DBDA 4YUQA 3C4ZA 1UKHA 4IZ7A 2B53A 1XBCA 1XH8A 2AC5A 1YOMA 4EQUA 4IAKA 2X1NA 1P2AA 1MP8A 2X2KA 3CP9A 3FV8A 4IE9A 4RIXB 3UG1A 3IW6A 3LQ8A 4C8BA 5GINE 4IM3A 2X39A 5AA9A 4YJTA 4DLJA 3LQ5A 4ZTSA 4QMSA 3TZMA 3F3ZA 2C6DA 2F7EE 4KBCA 5HIDA 4Y8DA 3QALE 3MW1A 4YZCA 2WQOA 3PIZA 4CYIA 3QQFA 5B7VA 3UQCA 4M66A 4ANNA 2J9MA 3D9VA 3DK3A 3FQSA 1UU9A 3PE1A 3GCUA 3SXFA 5M53A 2XRUA 4H3PA 4EYJA 2WMVA 2EWAA 2BHEA 4I24A 4E4MA 4G5JA 4M15A 2CGVA 4I92A 2VTJA 2XIZA 3K2LA 4FEWA 4DE4A 4LFIA 2QG7A 4MAOA 3OFMA 1WVWA 4R3PA 1OZ1A 4UWCA 2UZLA 3F88A 2EU9A 4GKHA 4X3FB 3WBLA 4DFXE 4BHZA 5JGDA 5HIBA 4ANLA 3QU0A 4Y73A 3HA6A 4DH8A 5KCVA 1PHKA 3POZA 3QL8A 5CI7A 3T3UA 2ZJWA 3C51A 5F95A 4NU1A 3SLSA 1OL5A 5C03A 3RNIA 3F5GA 1UV5A 3LE6A 2UW8A 2WELA 3QAME 3VS4A 2XF0A 4F9YA 4KIPA 1KE9A 3CS9A 3DNDA 4JDKA 3ENHA 3SX9A 4BWXA 3EYHA 5L8LA 2X4FA 1RE8A 2Q0NA 4GJ2A 3BYVA 4IWPA 4V05A 4YGAA 4F9AA 1BL6A 3QKLA 4U6RA 3EIDA 4U97A 3F2NA 5FG8A 1V0BA 4D1ZA 3F7ZA 2XK4A 4FNZA 3LJ1A 3TUCA 2IWIA 5A54A 3BHUA 2CNUA 5M07A 3EN7A 4GU9A 1GIIA 2LAVA 4EZ3A 4R6VA 4G16A 4CKJA 5CVHA 4A9YA 3E64A 3UMWA 4I20A 3O2MA 2WOTA 4S33A 4IEBA 3QZGA 4BDCA 1H1WA 2VTAA 3DA6A 3G51A 4NCTC 3PSBA 1GZ8A 5EYCA 5HVKA 4O83A 4GT3A 4PP7A 4F1MA 2UZOA 4AACA 2GNFA 4QRCA 3BLRA 2XBAA 4RWKA 2BFYA 2VN9A 4EOSA 3PFQA 3QTIA 5HVYA 1IAHA 5EKNA 3EB0A 2QU5A 1E9HA 5FBOA 5FTQA 3SAYA 1M17A 4BIEA 5JRSA 4O22A 1ZMWA 4EK5A 2HELA 2WQBA 3RAWA 4J8MA 4FNYA 4B7TA 1SVHA 2VTOA 3QQKA 4RVKA 3AMAA 5FXQA 5HNIX 3QHRA 3ERKA 5CXZA 1Q97A 4FF8A 4EH5A 5CEQA 2JIIA 2R0IA 3KGAA 3N9XA 2PZYA 4OTRA 2IVVA 5FEEA 4DBNA 3S1HA 3UIMA 1PMUA 1Q99A 4GT5A 3WILA 2F49A 4AW5A 5IF1A 2OJ9A 2Z02A 3OTVA 3HGKA 3JYAA 3AC8A 3QQUA 2RFSA 4G1WA 3FZTA 3PPZA 3QD3A 3TV7A 5BNJA 3QQHA 5HNGA 3TIZA 5KNJA 1FBNA 4O0WA 5JMSA 3F2RA 4ZOGA 5JZJA 4YR8A 2PYWA 4DFYA 4M97A 5DGZA 5GJGA 3IGGA 5M51A 2ZVAA 4QQTA 4MD7E 3BHYA 4MWHA 4Y5HA 3VBVA 2XNPA 3PXKA 1DS5A 5ANEA 5GZ8A 4GK3A 3GC8A 3OEZA 4NM7A 2QOIA 4CTCA 2PZ5A 3OUNB 4I4EA 4LUDA 1S9JA 3GEQA 3C5IA 2W1IA 2YM7A 3VF8A 3D5VA 3DU8A 2H9VA 4ZTMA 5CU0A 5HLWA 4FG9A 3LKMA 2W1GA 3O7LB 4G5PA 5BVWA 3FAAA 3Q53A 5I9WA 3JVSA 4MXOA 2H96A 2GS6A 2Z60A 3R1SA 4ZTRA 4E26A 3F61A 4IWQA 2UW6A 2JKOA 2XH5A 1ZYLA 4N6YA 2RG5A 3OW3A 3RAHA 2OBJA 4AGUA 2ZV9A 4BKZA 4DF3A 2R3JA 4WRSA 2C0IA 3LFDA 4CNHA 1OGUA 1MRVA 2HCKA 4UXLA 5I3RA 2ZOQA 5EW3A 5A4QA 4TWPA 4BWKA 2XYUA 2YM8A 5ANIA 4XRJA 5CF4A 3DQXA 2R3IA 4U5JA 5ANKA 3V8WA 5LWNA 5E7RA 4FTQA 3EFLA 3P78A 3ORNA 4TRLA 3EQPA 4M68A 4A07A 3QZHA 4UYNA 2BAKA 4U79A 5HOAA 3UVPA 5JH6A 1Q61A 2QC6A 4L53A 2XK6A 4RX7A 4UX9A 1SMHA 3EZRA 3AC1A 3ZFMA 4UMTA 4C4IA 2VTHA 4EK8A 1Y6AA 3KN6A 3TXOA 3W32A 3GU4A 4Y5QA 3RZBA 5EQPA 2WOUA 4C2VA 3HV7A 5JQ5A 4MXZA 4QP9A 2ZB1A 2QOLA 4QP8A 3MA3A 3CE3A 4W4YA 1Z5MA 2CDZA 2GNHA 4JIAA 4G34A 4KNBA 4FE2A 1PXNA 3S4QA 4B8LA 4IFGA 5BPYA 3VRYA 2JKKA 3P86A 2OXXA 4GUBA 4DEBA 4MQ1A 4M84A 1J1CA 4HYIA 1O9UA 1MRUA 3FKOA 5IA1A 3REPA 1DAYA 2VTMA 2OZAA 3PXZA 5DT3A 2PZIA 2V55A 1FVRA 5HTCA 4MD8E 2W0JA 2J5FA 3P7CA 4TXCA 3RAKA 2DQ7X 1YKRA 3FMMA 1VYWA 4L3PA 2W1CA 3RPRA 5CEPA 3SG9A 2JC6A 2FA2A 3GQIA 3MB7A 4U45A 2XP2A 3H9FA 4B4LA 4OAVB 4XP2A 3ALNA 3MI9A 1UWJA 2J90A 5L2QA 4DEAA 4D1SA 4QTEA 3L9PA 3DK7A 4F9BA 2CKPA 1WBSA 2UZEA 3BKBA 4KWPA 4BYIA 4ERWA 4RLKA 4BCIA 4MK0A 3U51A 4XUFA 4NL0A 4FKWA 3EQIA 4MNFA 5BUEA 4DGNA 4RZWA 1Q5KA 2YISA 5CTPA 2QG5A 5AJQA 5EM5A 3D7TA 2XB7A 5GNKA 3IQ7A 4O82A 4ZTQA 4BCOA 3O17A 4NJDA 5AUUA 4PDOA 1U4DA 4ZTHA 3RINA 4AXAA 4BDIA 3R9HA 3VUDA 3HAMA 2YIQA 3L1SA 1TKIA 3KXHA 5I9VA 4TWNA 2H34A 4HYSA 3Q2JA 3V5PA 1SNUA 2OJGA 2P55A 4O0XA 4FTCA 4BZDA 4FEVA 1HCKA 3OS3A 2OIBA 2VX3A 1Q62A 2ZV8A 4L3LA 3UOJA 1ATPE 1YXTA 1CKJA 3E88A 3H0YA 4GIIA 3H4JA 4GRBA 4O7SA 1BL7A 3DFAA 4BHNA 5GJFA 2C6LA 2PZPA 3KULA 3QKMA 4NWMA 2NP8A 3FZRA 4IZAA 4QMNA 2C6OA 4FT3A 4RT7A 3FEGA 3KVXA 4EOLA 2XNMA 4EC9A 1XQZA 3GCPA 2OKRA 5IMXA 3KF7A 2G9XA 3KXMA 3PLSA 2R9SA 3L8PA 3ODZX 3OMVA 4FK3A 4O21A 4DGOA 4RG0A 3VBXA 5I9ZA 4O81A 3D2IA 4FSUA 4M13A 2PHKA 3NW5A 4YC8A 1UU3A 2C4GA 5DG5A 3PA4A 3RK7A 5HO8A 3VW8A 4QMVA 2IVTA 3FLZA 1GOLA 4UBAA 5I3OA 4PTCA 2VRXA 2JAVA 5HIEA 3EL7A 1RW8A 4AX8A 3F7WA 3HMMA 4CMOA 4QMOA 3R8UA 4XBUA 3ZRMA 5BVDA 1F3MC 4O84A 2UW4A 1YXSA 4C38A 4FBXA 4FOCA 4FEUA 4G3FA 4BC6A 5L6OA 3WF5A 3VF9A 4YZBA 4YZMA 2P0CA 5DWRA 3PIXA 3ZUVA 4KS7A 3CY2A 5LMBA 3MA6A 4OTWA 1PYXA 3Q6UA 4FEQA 5ANGA 4DA5A 3DGKA 2OF2A 3DDPA 3OWLA 4LL5A 4MH7A 1BLXA 4DBXA 3WYYA 4FSYA 3FZ1A 3AOXA 4JI9A 3JS2A 4O7NA 3Q4UA 5IQBA 3A8XA 4CZTA 4HCVA 5IMEA 4FV7A 2ZDTA 3B2TA 4TNBA 4L52A 5EI8A 1U54B 3OT3A 3VS2A 3LMHA 4H1JA 3DBCA 4UEUA 4XP3A 5EI6A 2UZTA 3ALOA 5FGKA 3I79A 3VUMA 3W18A 4IW0A 3CJFA 4X2NA 4BCGA 3KXXA 4I5MA 4MNEA 5EHYA 3NUNA 2I7QA 1UU8A 2ITPA 2XKEA 4FKOA 4YSMA 3ID6C 3IW8A 2B55A 1Q3WA 3DTCA 5IUIA 3CTQA 1WCCA 4FTRA 4I0TA 1KV1A 5ANOA 4F1OA 4NEUA 4C0TA 3R83A 4TTHB 2FSLX 4P4CA 5E8TA 3EZVA 5E8VA 4CFFA 2JGZA 3F3TA 4TYJA 5DEWA 4R78A 4Z16A 4N0SA 2YCFA 3QTZA 4BDAA 1REJA 2CN8A 3FY2A 1PF8A 2HWOA 2X7OA 5HCZA 1GZKA 4QP4A 1Q41A 2I40A 3Q60A 1YXVA 2XUUA 2CKEA 4I5HA 4I5CA 3FZPA 2IZRA 4ID7A 2G2FA 2SRCA 4ZAUA 4BDKA 4KUJA 1ZOHA 4L42A 4AU8A 4B6LA 5KMLA 1XKKA 5L2IA 4I6BA 4AW0A 3JXWA 4QT1A 5D10A 3TKIA 2QOCA 1JLUE 4BCQA 3BLQA 4BKJA 2RG6A 3V5JA 2ZM1A 2CSNA 2VO0A 3LCOA 4C35A 3L8SA 3O51A 4ZZNA 2W5AA 4IDTA 4GS6A 2XNNA 2PMLX 3NIZA 4FKTA 4KSPA 3PP0A 2I0EA 5DMZA 3TV6A 4B8MA 4D2TA 5K5NA 4DFUA 5KMOA 2XK3A 4LQMA 3S95A 4FGBA 3KRLA 4HGLA 3DFCB 3WZDA 3FQEA 1FVVA 2B9HA 4J8NA 1KWPA 4PPCA 1NA7A 2Y4IB 2YWPA 2NRUA 4YJRA 3FJQE 5IUHA 2HZ4A 2W05A 3A7FA 3IONA 3UO6A 4BDGA 2VTQA 4O7YA 5CS6A 5K4JA 2IG7A 4CTBA 4RBLA 3ZLYA 2CNVA 4GYIA 3RCDA 5L4QA 1LUFA 2WTWA 3BU5A 4PTGA 3HECA 4G6OA 5E1SA 3TG1A 4EWHA 4PY1A 1Q3DA 4JX3A 3LXPA 3FI2A 3RCJA 2C69A 4F0GA 4F99A 3UIUA 1ZY4A 3HEGA 5BMSA 2OI4X 3EKKA 3GQLA 4USFA 4ITHA 1T46A 4FEXA 3ZU7A 2W96B 4WNPA 1OB3A 1G8SA 5FRIA 2CLXA 3P7BA 1ZY5A 4C02A 2R3HA 3NVKI 4RX5A 2F9GA 1GAGA 5C8MA 2IPXA 2Z7SA 3MJ1A 4DEDA 3FLQA 3GENA 3O71A 2WQEA 2XK8A 3AGMA 5IG1A 5J9ZA 4FT0A 3WF8A 5KBRA 4C36A 3F69A 3KRRA 2VTNA 3DKCA 3OCTA 4AA5A 3HMNA 4GUEA 1XWSA 2JBOA 2VNWA 3UODA 3LOKA 4PPAA 2WU7A 1YDSE 3QZIA 2GS7A 4KIQA 3HDNA 1JNKA 3FMLA 2ITVA 2VGOA 5H8GA 3OROA 4FV3A 4HGSA 3R2BA 4CGAA 1LPUA 4I23A 2BAQA 3A99A 5AP0A 4USDA 1FINA 4NIFA 4NSTA 1YWNA 4O6LA 3KL8A 1YQJA 4P7EA 4AE9A 5BVFA 4L7FA 4I0RA 5F94A 5FLFA 5J9LA 4QQJA 3SGCA 3COHA 4F6WA 3D5UA 1O6YA 1BYGA 4NM5A 5EYMA 2XK7A 3E5AA 3QTWA 3DXNA 4RFYA 2QVSE 3LFCA 4FKSA 4D0WA 3QWJA 4EOIA 4OBPA 4XG7A 4YLLA 5AADA 2PVJA 4DHFA 3CPCA 5LCJA 3VW6A 3LFFA 4IB5A 4EBWA 4YZ9A 4KIOA 3OWPA 3P1AA 5H3QA 1KE6A 4TWCA 5E1EA 1H25A 2VNYA 4C4HA 4IANA 1SNXA 5M4FA 3MJ2A 3LHJA 4JL9A 4DITA 5IEVA 3KMWA 3EJ1A 4AQCA 3TKUA 4BDDA 4Z7GA 4DGGA 5LVLA 3U55A 4BGHA 3QTSA 4XCUA 1ZMVA 1NT2A 2HWPA 2IN6A 1PXOA 3EH9A 3R1YA 3OT8A 5JZNA 3M2WA 4JQEA 4OBOA 4BCPA 5K9IA 3WOWA 3COKA 5IA5A 3H30A 2PUUA 3DB8A 4BZOA 4K1BA 3AMYA 4M7IA 5DT4A 4BI2A 4BB4A 2GTMA 4FKJA 4X2GA 2BDWA 5HVJA 4IJPA 4DG0E 4CVAA 5HO7A 5LMKC 1H24A 4I21A 2BHHA 1Y91A 3FWQA 3FPMA 4D4VA 2PVLA 4C33A 4FV4A 2XCKA 4KRDA 1R78A 3NPCA 4BF2A 1YVJA 4IACA 2PULA 4G9CA 4ZJVA 3ZO4A 4KRCA 3C0GA 4IM2A 5E8YA 3I7BA 5D9HA 4E8AA 3VQUA 3FXXA 2YLEA 5L3AA 3K54A 4LMNA 4KS8A 4BDJA 2XCHA 4EHZA 2JIUA 2XJ1A 3UO4A 4G3DA 3TDVA 5CANA 1H07A 3KRWA 3IW4A 5AP3A 3HP5A 5FP5A 4H3QA 4AG8A 1GNGA 3FYKX 5CSPA 3Q32A 4IJ9A 4IM0A 1OIRA 4QYYA 4U9AA 4O6EA 4ZY4A 5K0XA 5TF9A 3UQFA 5EQYA 4QYEA 3II5A 3MVHA 4ARKA 4PF4A 2CMWA 4O38A 2PZRA 3WZJA 2PMOX 4P2KA 4RFZA 4WG3A 4ZLOA 2OZAB 4FICA 4J99A 5HGIA 3CQWA 4QOXA 3HMPA 2ZB0A 2XIRA 4GW8A 3TI1A 1G3NA 2F7XE 3QFVA 1PMNA 5CXHA 2O5KA 3VAPA 1CDKA 3ZC6A 3ZM4A 4UN0C 4DH5A 4F64A 2YFXA 2J0LA 3P5KA 3QXOA 3ULZA 1Y8YA 4AFJA 4F4PA 3LW0A 4JJRA 4U81A 3MIYA 1OIUA 3QCYA 3V51A 4E20A 2JDTA 4DFBA 2PE1A 3CGOA 4LUEA 2HENA 2X6EA 4W4XA 3IDBA 3HV5A 4A9RA 3O8UA 4EL9A 2FH9A 3TUDA 3C4XA 4ANQA 5E4HA 3FY0A 4IWOA 1JVPP 5BYZA 2R3QA 3E93A 4C3FA 4X7QA 4TWOA 1I44A 1FMOE 3BRBA 3A2CA 3NNWA 3PE2A 1LEZA 3COMA 4AOJA 1VR2A 2R5TA 5JQ8A 5IQAA 1URCA 2EB2A 2V22A 5TR6A 2J51A 3BBTB 1DI8A 1W84A 2B52A 1GZOA 3D7TB 4M8TA 2G2HA 4CXAA 2YIWA 2A27A 2YCSA 4PTEA 3BZ3A 5CZHA 3ET7A 4RZVA 1JQHA 4ALWA 2Z7RA 2CN5A 3UP2A 5FTGA 2C3JA 3RM7A 5J1WA 3LZBA 1WFCA 3IGOA 4XYFA 4F09A 3VWAA 4XG8A 2GQGA 4S2ZA 4U80A 5HCYA 5EQEA 5EDQA 3P9JA 3E3PA 1XBBA 1U5RA 2CKOA 5DN3A 3EWHA 4H58A 3SRVA 5BVKA 3GBZA 1BUHA 4UYAA 3SOAA 2WEVA 4NUSA 1YDRE 4AZEA 5HE2A 4EOJA 3KULB 4I94A 3QUPA 1Y57A 3RTPA 2HK5A 3LCSA 3MBLA 4ANMA 2ETRA 3RPSA 4CKRA 3OCGA 4IIRA 4ANSA 5L6PA 4TY1A 3PWYA 3DKOA 1HCLA 3QTUA 4GMYA 3C0IA 2ZMDA 4MBLA 2CGUA 4R7IA 3RWQA 2VWZA 3H9RA 2OGVA
chains in the Genus database with same CATH superfamily
3R73A 2CJMA 4RGJA 3A7GA 4ITJA 1YRPA 3VUIA 2CGWA 1Q8UA 1ZLTA 5H9BA 4EZ7A 1PRYA 1H0WA 4YJUA 4JDHA 4PMTA 5DE2A 2W1HA 5M4CA 2B7AA 4FTLA 1B39A 2YHVA 3ZLXA 4FSMA 3UOLA 3GB2A 3LXKA 2J6MA 3GFWA 4R1YA 4YPDA 2ZAZA 5CAOA 4DFZE 4EI4A 2YJSA 1XH5A 3TWJA 4IAAA 1W82A 3GVUA 2VTPA 5JKGA 4PDYA 4BCFA 2XKCA 2C3IB 3KA0A 3WZEA 3A4PA 4U3YA 4YJPA 5C01A 5I0BA 4QP7A 1EH4A 3U6IA 5IQCA 2NO3A 5AMNA 3D15A 4L9IA 3Q3BA 1Q24A 3TZ9A 2RF9A 1IAJA 3ZO3A 4R5YA 3AC4A 3WIGA 4J97A 3RK5A 3NNUA 4RIWA 4PMSA 5AV1A 3ORLA 2EXMA 4FKIA 3Q5IA 3UP7A 3NUSA 4V01A 4DAWA 3CGFA 4MVFA 4RVLA 2C6TA 2P2IA 4B9DA 5LCKA 4WG5A 5CX9A 4OTFA 4RIOA 2Q83A 4MNEB 3ZSHA 3BELA 3MS9A 3IS5A 4M69A 2E9PA 1KSWA 3ORPA 2WMXA 1XH4A 4S31A 4ZSJA 3D4QA 5F4NA 2F7ZE 4CCBA 5BQ0A 4FSQA 2PMIA 5JFSA 4FV5A 2WMUA 3BU3A 5HTBA 5IQEA 1V0OA 2BRHA 3Q9XA 3OY1A 3EQCA 3ZLWA 3U6JA 1ERKA 3PXFA 2GNJA 2RL5A 2OG8A 3OBJA 4WOVA 4DH1A 5DR6A 5E9EA 4ZMEA 3FKLA 3UZPA 2ONLA 4JLCA 5FQDC 3PDTA 2FUMA 5DYJA 3CD8A 2R4BA 4MF0A 2QR7A 3MYGA 5F1ZA 3BIZA 3D5XA 4YHJA 5ICPA 3P08A 4BTFA 4EOMA 2V7OA 4HOKA 4C58A 3BE9A 4FSTA 4MBIA 2O2UA 4XLIA 2W17A 2R0UA 5DRDA 3O50A 4I93A 2CKQA 2RGPA 1R3CA 4MX9A 1PKDA 2PY3A 4IDVA 3RKBA 3QF9A 4I5PA 4N4SA 4NFNA 2IZSA 3TTIA 5CF8A 3UC3A 4WUNA 4WNKA 5H8BA 3I5ZA 3SDJA 1H1RA 3ZC5A 3V6RA 4RX9A 1ZWSA 4LI5A 3V04A 4IB1A 4KKHA 3BQRA 3FBVA 3K3JA 2PTKA 5DNRA 4KIKA 4DDIA 3MN3A 1OBDA 1M2RA 5H2UA 3MESA 4JXFA 4L01A 4NW5A 1OUKA 3SOCA 4O27B 4QMZA 4DH3A 5CU2A 2OW3A 4OGRA 4EOOA 5CAPA 2XRWA 5I4NA 4F1TA 2WMAA 1DAWA 2JAMA 4O1PA 3R9NA 5HD4A 5LWMA 2A98A 2GPHA 5AR3A 4AGWA 4YTFA 2J4ZA 2QKWB 3LMGA 3DV3A 2E2BA 3W0OA 1XH9A 3I6UA 4I41A 3NIEA 4CFUA 2R3LA 3QA0A 5IA3A 2EXCX 2I0HA 3GCQA 4JVGA 3EMGA 1SZMA 1W7HA 4R3RA 5AR5A 4GK4A 2E9UA 3FC2A 5CENA 4J98A 3UOHA 3ZUTA 2J0IA 3E8NA 2WMWA 3DB6A 4K2RA 4AXDA 2ZMCA 3GU6A 5IISA 5KUPA 3SC1A 3RALA 2VTLA 2YN8A 4JDIA 4K8AA 4HVSA 2XBJA 3DTWA 4RRVA 1OKWA 3R22A 4EJ7A 3ELJA 3NW7A 3FDNA 3AD5A 1Q8YA 2BVAA 3GCSA 1JOWB 1ZOEA 5B2MA 2BTRA 3BLHA 3BEAA 4LRMA 2BZIB 2C0OA 5AAGA 1M2PA 3BWJA 3QD2B 3PJ3A 1J7IA 5C4LA 4FJVA 2BFXA 4RIYA 2GNLA 2AYPA 2YM5A 4BIDA 3P5JC 4BN1A 3AC5A 4CD0A 2HW7A 4XS2A 2VTRA 5BVNA 2YWVA 5HO6A 3BYUA 3W0RA 3KREA 4JBVA 5G6VA 3G6GA 4EYMA 1H00A 3H10A 3W33A 1FOTA 5HBHA 1JPAA 3IECA 1J1BA 3RP9A 2WO6A 3EKNA 4PWNA 5CVGA 4CKIA 4FTMA 5IEYA 4TW9A 2OZOA 2PL0A 1UU7A 4X2JA 4XH6A 3S3IA 4A9SA 4YJQA 4ZTNA 4X3JA 1Q8TA 2BROA 4CQEA 3ROYA 3DK6A 3QC4A 5AA8A 4G17A 4DINA 3D7ZA 5KMNA 4DFNA 4X0MA 4GYGA 1WVXA 3LMIA 2VUWA 4QP1A 4RJ5A 4ZJJA 3NUAA 2R3NA 3AGLA 3D0EA 5CU4A 5AUYA 3QRJA 4WD5A 3G0FA 4E6AA 2XJ2A 3DS6A 4ZZOA 5M44A 3WZKA 3QD0A 3CQEA 3SHEA 4BICA 4NM3A 3ZFXA 3DKGA 1IG1A 2GCDA 2Q0BA 3UO5A 4EH2A 4RWJA 2ITQA 3KY2A 3DZQA 2XIXA 4XP0A 4Y46A 5J95A 4O7ZA 4II5A 5K4IA 5EM8A 3DLZA 3TNQB 3I81A 1O6LA 2JBPA 4I6QA 4OBQA 5DT0A 4DTAA 2QCSA 5CEKA 4GT4A 4KBKA 4ACHA 2X6DA 3BEGA 3RJCA 4ZSAA 4HGTA 3HLLA 5ETIA 5HG5A 4EH7A 3PG3A 3CLYA 4AT3A 4FYNA 4LOPA 4AN3A 5M09A 3LLTA 4FL3A 4AGDA 5C9CA 4D28A 1ZRZA 5TKDA 3FHRA 3FI4A 5FEQA 1DM2A 3BU6A 4EHEA 3DDQA 4DLIA 4G3EA 5C8NA 5E8XA 5CYIA 3EYGA 4I4FA 5FD2A 3V5TA 3QZFA 4FNXA 2UZVA 4WNOA 5EHOA 4RQVA 1E1XA 2XMYA 3CC6A 5H8EA 4CRLA 3GOPA 4E4NA 2OLCA 4D9UA 4EUTA 3VBTA 2B9JA 1UNGA 3WI6A 4MBJA 4IQ6A 3VBQA 3NUYA 4GIHA 4JG7A 4RVTA 5E8UA 3E62A 1RJBA 3P4KA 2IW9A 1XH7A 4B0GA 2XA4A 3C4EA 5M4IA 4DHIB 3I0OA 5GZ9A 3RVGA 4GEOA 1APME 3VBWA 4H36A 3SA0A 3OCBA 4AZSA 3OOGA 4C3RA 4YSJA 3F9NA 4HYHA 1M2QA 2QOBA 4OTHA 2P3GX 5KHXA 4M0ZA 4NW6A 5A9UA 2O64A 3ZEWA 3GGFA 4O7RA 3MWUA 3HUCA 4BTKA 4FIHA 3KFAA 4UMUA 3VUTA 2FO0A 4NKSA 4QTAA 3EN6A 3SD0A 4FKLA 2HAKA 1L3RE 3AKLA 4LV7A 4CT1A 3UG2A 2X8EA 1OECA 4JAJA 4YNOA 5KMIA 4ASXA 2BZHB 3PXRA 3ZRKA 5A4CA 2V62A 3BPRA 2PPQA 3NSZA 4BJJB 4ORKA 3BX5A 4BCHA 1GZNA 3IDCA 3RAIA 5LMKA 4O4BB 4NTSA 3BLAA 4TN6A 5CNNA 5K5XA 2YABA 4QQ5A 2VWUA 5D41A 5J87A 4DDGA 5E8ZA 2HY81 2X4ZA 4LGGA 5L2WA 3R28A 3VHKA 2RFNA 2X9FA 4YLKA 2X7FA 3I4BA 2QLQA 3QQGA 4QTCA 2GQSA 2DWBA 1UWHA 3OP5A 5KHWA 4W4VA 3FE3A 1X8BA 4DC2A 2YM4A 4ENYA 5IH6A 4DT8A 4ZSGA 4ZXTA 1GJOA 1H1PA 1IA9A 3E92A 3GCVA 3LXLA 3RPOA 3TNWA 1AQ1A 2BALA 2ETMA 4FX3A 4L45A 3OBGA 3ZZEA 4DT9A 1PXMA 2NPQA 4BRXA 3QKKA 1YXUA 2YAAA 3ZEPA 4MQ2A 4QYFA 5EHLA 5LVOA 3OC1A 2UZWE 3TZ8A 3EFWA 2W5HA 1JKSA 1Q4LA 2W1FA 4AAYA 1F0QA 2OFUA 3BGZA 3ZTXA 3UNKA 3SKCA 4YO6A 1FVTA 3LCKA 2OICA 3QGYA 4HNFA 4V0GB 4BCMA 4D55A 5FXSA 3TCPA 3FPQA 2UUEA 4RJ4A 3V5WA 2A0CX 2PMNX 1FMKA 5AP7A 4JX7A 5DIAA 2X2MA 2VO3A 1PY5A 4XG9A 2C6MA 3UDBA 2PUNA 3RI1A 5I9XA 5FBNC 4O0SA 4BDHA 4LMUA 2ONLC 4QMLA 2XK9A 2BMCA 2IW8A 2QODA 3DOGA 3T9TA 2R64A 3NUUA 3A7IA 5IH5A 5GIPE 1QPJA 3OD6X 5D12A 4PL5A 3R6XA 4GJ3A 4FV0A 4L46A 3LFNA 4XV2A 4O96A 4AGCA 3LFSA 4DCEA 5KMJA 4CQGA 1PMVA 2I1MA 4X3FA 4BIBA 2C6KA 4EH6A 3TMOA 4D2PA 1PXKA 4ONAA 4A06A 4E5AX 2HOGA 2VTTA 4LV8A 4MD9E 3SRVB 4LYNA 4FG7A 5HLNA 4CFWA 2IVUA 3C7QA 4W8EA 3VNTA 3G2FA 5KKRC 1OPJA 2GFCA 2ETKA 3KKVA 2XIYA 4K9YA 3CKWA 4K0YA 4FC0A 4O7WA 3QTXA 3AXWA 4PL3A 3ZHPC 3HA8A 2Z7QA 2YM6A 2PVMA 2RKUA 1IASA 4MYGA 1WAKA 3MFTA 1H0VA 5J9YA 3I5NA 2IJMA 3OHTA 4Z7HA 4LM5A 5J7BA 3ATSA 3U87A 1J3HA 3G0EA 2PVHA 2PUIA 1S9IA 3OWJA 2PVRA 4QMMA 2WPAA 5JK3A 2J0MB 5DR2A 3G33A 4JG6A 5DI1A 4KA3A 2ITOA 4C59A 3MSSA 1H1QA 3EQBA 2ZM3A 4FIGA 3TIYA 4E7WA 3ZO1A 3F5UA 3OZ6A 4OAUC 4ZEGA 3OUKA 4YBKA 5AIKA 4QMUA 4O86A 5HG9A 2FGIA 3L9LA 2JFLA 3ZYAA 4YBJA 3QYWA 1PMEA 4I22A 4IADA 4Q9ZA 2VTIA 4BI1A 3O96A 3QCXA 4Z55A 3OXTA 3R7EA 4YZNA 4N6ZA 5DPVA 5J5SA 5AFVA 2VWVA 4FVPA 4R8QA 3QC9A 3DAKA 2UVZA 5HKMA 5F9EA 3LCDA 3H0ZA 3QRUA 2KTYA 2YZAA 3KK9A 3LFEA 3VS0A 2B9FA 2VTSA 3PG1A 4Z3VA 2O65A 3C0HA 3TM0A 5CSVA 3RPVA 3KMMA 4XOYA 4AAAA 4EOKA 5A4LA 2OFVA 3MDYA 4WSYA 3R7YA 3HMIA 1IRKA 3C4CA 1Y6BA 1RDQE 4QP6A 1WBVA 3QD4A 4UMPA 2W4KA 5T3QA 2QOFA 2YCRA 4FNWA 3NLBA 5AV3A 3FMDA 4YC6A 2BDJA 2ITXA 3IK3A 3KRJA 2VX0A 2ITZA 4PP9A 2WIHA 4FVRA 4HCTA 5AX3A 3PJCA 5DFPA 3HP2A 2R3PA 2IF8A 3MGYA 2XAMA 1YI4A 2GDOA 2QO9A 3GNIB 2NNWB 2YAKA 1VZOA 4BBEA 4I6LA 2GHLA 3UPXA 5D1JA 4RWIA 4JRVA 4AF3A 4JT3A 5HNBA 2BIKB 3ZOSA 3RK9A 3HDMA 4AOIA 1IR3A 3OTUA 1OPLA 2CCIA 4EK4A 5HHWA 3NWWA 3DAJA 1G5SA 4E5WA 3DT1A 5TT7A 1FGKA 4W8DA 4FV9A 4KD1A 4PDSA 4WKQA 4CFXA 3R8VA 3PXYA 2YDJA 1R0EA 3QQJA 3U4WA 1V0PA 3WIKA 2DYLA 4DEGA 5LARA 3U8WA 2VWBA 3SXSA 4BFMA 5J8IA 2A4LA 2BRBA 4ZLZA 4K33A 5BMMA 1QPCA 1CKIA 2Z8CA 5JSMA 1YI6A 4IX3A 5FTOA 3I6WA 4AW1A 3ZUUA 4FOBA 4ACCA 3MPAA 4EBVA 3ZCLA 5CAQA 2QQ7A 5AV2A 5KKRB 3NUXA 4RJ3A 2IW6A 3HYHA 4DTKA 3V3VA 4QNAA 4U8ZA 4C4EA 3UQGA 2HZNA 2QLUA 4TNDA 4TZRA 5CT7A 4M67A 4BGQA 4KIKB 5HCXA 3NYNA 3ZRLA 1LEWA 4APPA 1O6KA 4APCA 3FXZA 4BBMA 5J7HA 3TV4A 4IVAA 4CV9A 3DJ5A 3RGFA 4A9TA 1TFFA 4WNMA 1RQQA 4DEHA 4OW8A 1R0PA 3PIYA 3CD3A 3QCSA 4JG8A 1W2FA 4F7LA 2JLDA 5EDRA 1KUTA 4ZY6A 2B0QA 3TNPC 4QMXA 1SVGA 4FIJA 1GIJA 5M57A 1XBAA 4M14A 4U44A 1SM2A 4F0FA 3TNIA 1M52A 4MXYA 4D1XA 3G9LX 1QMZA 4M3QA 4DGMA 5HE1A 3HX4A 4U43A 3WF7A 5JN2A 3F66A 3OXIA 5DLSA 1ZYDA 4HZSA 3BYOA 4CSVA 2FSOX 2WU6A 4KBAA 5C8KA 2ZV7A 5EOLA 2C6EA 2ZM4A 3R7VA 2XJ0A 2VD5A 4FA2A 4CMTA 1J91A 3IOPA 5HZNA 3MPMA 3C4WA 3VS5A 1WBOA 2WD1A 4UZDA 5CNOA 1QCFA 4FKRA 4C4GA 1OBGA 1WBNA 4R77A 2PVYA 4CFMA 5M4UA 4UWBA 3PA3A 3MTLA 4RPVA 5AR7A 3LM0A 4G3GA 3W0MA 3HVCA 5AP1A 4HVDA 2O63A 1PYEA 2OU7A 5DBXA 4U0IA 5HE0A 2C0TA 3PY3A 3TUBA 3PXQA 4P5QA 4RIYB 5FWKK 2VO7A 4A4OA 1MQ4A 1STCE 2PVKA 2BZKB 2C30A 2H6DA 3LVPA 4TPTA 5E92A 3OXZA 3QTRA 5I9UA 2VV9A 4C61A 2ACXA 4CZYB 3FMHA 3GC9A 2V0DA 1B6CB 1FQ1B 2YITA 3F2AA 1ZOGA 4XG3A 2Y4PA 5DR9A 3GU8A 5FEDA 3R9DA 1ZZ2A 4IB3A 3GP0A 5HI2A 1H28A 3FMJA 3ZZWA 4FTOA 4F6SA 3MVLA 4UB7A 4RLLA 3ZLSA 2VWIA 2ITWA 3ZBFA 3QBNA 3BHVA 3HUBA 1OKVA 3R9RA 2GSFA 2R3RA 4DG3E 4EORA 5IQFA 3MFSA 2IO6A 4FTNA 4L6QA 3ORXA 2FVDA 2JIVA 2OO8X 3RHKA 3DLSA 4QPSA 4PUZA 4XG6A 5E8SA 1JKTA 4C34A 5B0XA 5DOSA 4J96A 2JDVA 4YO4A 4H05A 4EHGA 5ANJA 2B4SB 2XEZA 4RVMA 1PW2A 4H3BA 5AV0A 2AC3A 4A9UA 4N57A 2R3FA 4EH4A 4YJOA 3R8PA 4EOQA 4QDEA 4RX8A 1VEBA 5EW9A 1VLRA 3GI3A 1FGIA 1WVYA 1JBPE 2QR8A 4KAOA 4I6FA 2WQNA 4RC2A 2GFSA 4HPTE 3U9NA 3R7UA 4E73A 4J71A 5CAUA 2O0UA 2PK9A 4O7VA 2QOOA 3R9OA 5A46A 3ORIA 3LFAA 5GZAA 4I3ZA 3ORMA 1JWHA 2J50A 2W1EA 3SV0A 1JKLA 3MFRA 2QONA 3QRTA 3QTQA 3CBLA 3G5DA 3AC3A 3NW6A 4FIIA 2E9NA 5CSWA 1A06A 1Q8WA 1UNLA 3F3WA 4ZZMA 3V6SA 4L68A 5EG3A 3LIJA 2JDOA 4FUXA 4CT2A 2W4OA 3CPBA 4DG2E 1PKGA 2F4JA 4ENXA 1BI8A 2YIRA 2XVDA 2WMQA 3VS6A 2C3LA 3EFJA 4X3FC 4FK6A 3EL8A 4K11A 4IAFA 4IX5A 5HICA 4CMUA 5KMMA 3EQRA 5JGBA 2X8DA 3ZSGA 4U7ZA 3ZXZA 1REKA 2W5BA 3PVWA 3Q2MA 2OJIA 4JS8A 4BY9E 3KEXA 4WBOA 5HG7A 3KXGA 1A48A 2WTIA 4G6NA 3VO3A 4CEGA 2OH0E 3FLSA 3ROCA 1J7UA 3QQLA 1XH6A 1WZYA 3DBEA 4G2FA 4XEYA 3VUHA 5AUTA 4L43A 3THBA 4FTTA 1BI7A 2F57A 4MXCA 2BZJA 3D83A 4OTDA 3RMFA 4AFEA 4DEIA 1IEPA 3NYVA 3UGCA 3W55A 4NTTA 2HIWA 3FUPA 1OITA 3NCGA 3UDTA 3QHWA 3QYZA 4E6CA 4O0YA 5FDXA 3C4FA 5G1XA 2UVYA 4A4LA 2C5NA 3VC4A 3U54A 1YXXA 3H3CA 2Z7LA 3OEFX 3ZDUA 1XMLA 2I0VA 2JDSA 3DCVA 3HRBA 1U54A 5HE3A 4DFLA 1YOJA 3NYOA 4BL1A 4RC4A 5IQDA 1WBPA 1L8TA 4FV1A 4E4XA 5LQFA 2YIYA 4E6DA 5DHJA 3BGQA 3A4OX 3PY1A 1PXPA 2PE2A 4GVJA 4JOAA 3W2PA 3E87A 4UZHA 4JBPA 3Q4TA 3N4UA 5AAEA 3PRFA 4M12A 4EKLA 2WAJA 3LXNA 5DRBA 1BKXA 4Y95A 3FKNA 5DH3A 3ZXTA 3KMUA 5IU2A 2C5XA 4TT7A 5KMKA 1BX6A 4NT4A 3PJ2A 1WBWA 4H1MA 4AA0A 3GC7A 5DEYA 5A4TA 5IUGA 3VRZA 1U46A 3VVHA 3FLNC 3FSFA 1UVRA 4QQCA 3DXPA 2X8IA 5EW8A 1SYKA 3GC0A 5AP4A 3P7AA 2ZYBA 5E90A 4XJ0A 2XARA 3HAVA 4GH2A 4O4CA 4G3CA 3VS7A 2FSTX 5T68A 1VJYA 4S34A 5HD7A 3BQCA 3BBWA 4YLJA 1XHAA 3ENMA 5BVOA 2XIKA 5AX9A 3NGAA 4ZK5A 4S30A 3G90X 2WZJA 4YP8A 3K5UA 1W2CA 3JVRA 1OL1A 4FODA 4YPSA 5ETCA 4D58A 1ZYJA 2QO2A 4JIKA 4U42A 5EYKA 3GU7A 2BRNA 4OR5A 3M1SA 5HG8A 4D4YA 4F65A 3UZTA 1KE8A 4FSNA 3ITZA 3R04A 4E5BA 3N4VA 2WB8A 4K6ZA 4FKUA 5AIRA 1PXJA 3K3IA 3ZS5A 2IZTA 3FL5A 2X0QA 4L8MA 4RWLA 3KK8A 4MCVA 2XALA 1XJDA 3D94A 3RBWA 1PXIA 2WTVA 3QCQA 4OUCA 1UA2A 3K5VA 3D5WA 2V7AA 4WRGA 4EC8A 4CG9A 3QX2A 3F82A 4D4RA 3NZ0A 4J53A 4FKPA 3HZTA 3N4TA 3CR0A 3IPHA 3LQ3A 3NNXA 2C47A 1OM1A 4RA5A 5AP5A 2GTNA 4HZRA 3TKHA 3R8LA 4C4JA 5HEZA 4C7TA 4EOPA 4N70A 4QP2A 5LVNA 2G1TA 3SXRA 3FMKA 2WTCA 4XG4A 1PJKA 1OKYA 3W2CA 2A1AB 2BCJA 3O23A 4PQNA 4ALVA 4BCNA 4E1ZA 4F7SA 5IDPA 3PJ1A 2QHMA 4J7BA 3HMOA 5CSHA 5IDNA 2QI8A 4KB8A 3NMUF 3FLWA 2BKZA 2WQMA 5ITAA 4F9CA 5AUWA 2J5EA 1TQIA 3EFKA 2FB8A 2PU8A 1K2PA 3DZOA 2EB3A 1KE7A 4ZTLA 5IPJA 4ZSLA 4MXAA 3A62A 3W2QA 4FI1A 5C1QB 5JFXA 1KV2A 4FZ6A 3DY7A 5CZIA 4XNEA 2GHMA 3FI8A 3PVGA 4QNYA 4O7LA 3MY1A 4AN9A 4NM0A 4FVQA 3TACA 3ZBXA 3TT0A 4JMQA 2OF4A 3A60A 3CSVA 4LGHA 1Z9XA 4PPBA 5BUJA 2YACA 4AQKA 3G9NA 3R0TA 5AUZA 2ZDUA 3B8QA 4EH3A 5L8KA 4FUYA 2HZ0A 2P33A 4JAIA 4LOOA 5J5TA 1G8KA 4DN5A 3PPKA 4YJVA 4O0VA 5KZIA 3ZH8A 4AXEA 3CTHA 3NAYA 2F2CB 3FI3A 4PL4A 4O2PA 5D7AA 3LFQA 3QX4A 1E1VA 4RFMA 3VBYA 4C4FA 4Z9LA 5CQUA 2WTKC 1KOAA 4O4FA 2R7IA 2JITA 4OTPA 4CCUA 4D2SA 3W16A 4FR4A 2C5YA 2C3KA 2C5OA 2HXQA 3TJCA 1Z57A 3BCEA 3QWKA 4OTGA 2Y7JA 5D7VA 4O0TA 1NXKA 3FXWA 5JGAA 4JRNA 2YCQA 5EYDA 4IC8A 3PFYA 3FMNA 3EOCA 2XZSA 4HVGA 3KVWA 5AEPA 3PYYA 5M08A 2W9ZB 3VS3A 5FDPA 2Z2WA 2XS0A 4FSWA 1LP4A 1R39A 3CXWA 1OL7A 2HXLA 4O0UA 3BL7A 2R7BA 3HRCA 1U5QA 5AR2A 2IVSA 2VAGA 3I60A 3DNEA 4GCJA 2WGJA 5EDPA 5CI6A 4DCAA 3TNHA 3NR9A 3TZ7A 4BVUA 4XRLA 3C13A 5A4EA 1P4FA 3AQVA 2KULA 5KZ0A 3R02A 1ND4A 1ZYCA 3WF6A 3R1QA 5C4KA 3ZONA 2PSQA 4HGEA 3OWKA 5TE0A 3UC4A 3D14A 2VU3A 4AZVA 4BWPA 3MY0A 3UMXA 3ANRA 4R7HA 1H27A 3SQQA 5KBQA 2WMBA 1VYZA 3ETAA 1B38A 1OKZA 1ZMUA 2V5QA 2H8HA 4PRJA 3UNJA 4BKYA 4DEEA 4BGGA 4BTJA 1YHWA 4QTBA 4GU6A 4PDPA 1CSNA 5EI2A 3Q4CA 5CSXA 4ZSEA 3UVQA 4Q5HA 4W9XA 1M14A 4FG8A 2VZ6A 4IX4A 4NKAA 2WTDA 4BCJA 1CM8A 5I5ZA 2WIPA 4FSZA 2XNOA 3QGWA 3U9CA 4YJNA 1YWRA 2C68A 3I1AA 4R3CA 5FXRA 4NIFB 2RFDA 3L9MA 4R5SA 1I09A 2XYNA 5CU6A 3UE4A 4CV8A 4EEVA 1NVRA 3CJGA 2OK1A 2QOKA 3IKAA 4G6LA 4JQ7A 3BV3A 5TO8A 4GV1A 3BI6A 3C1XA 4EONA 4IZYA 3IW5A 2YJRA 4JDJA 2AUHA 2QOQA 4ITIA 3VJNA 3W10A 3E63A 2UW5A 2VWWA 4MEDA 3WF9A 3G6HA 3HV4A 3R63A 3R01A 4IVBA 2EUFB 3QA8A 1ZXEA 2HW6A 3KF4A 4AP7A 2Y6OA 4HCUA 3UYSA 4ZMFA 2UW7A 5AP2A 2W99B 3Q04A 3Q52A 4IAYA 4RMZA 4FZDB 4GFOA 3WYXA 4F0IA 4XV9A 1JAMA 3F3VA 4AZTA 3P23A 3QRIA 4QTDA 2OH4A 1J7LA 4JR3A 3COIA 4WBBB 3EQHA 4WT6A 3RHXA 3FQHA 4ASEA 1ST0A 4IHPA 2QNJA 4DTBA 2VGPA 1QPDA 2XEYA 3BHTA 1XR1A 3PPJA 2QU6A 4LGDA 3V8SA 5KX8A 5LMAA 3W8LA 3EN9A 2CNQA 3UIXA 3IW7A 1TQPA 4BDEA 3E3BX 3V01A 4FZ7A 3PA5A 3DJ6A 4LOQA 4JQ8A 4QYGA 2WTKB 4CRSA 4YMJA 4IVDA 3D2KA 4FMQA 3VUGA 3AD4A 5CU3A 3CQUA 4D5KA 5EKOA 3PP1A 3W2OA 4YHTA 2WXVA 3N51A 1DI9A 5HU9A 5I9YA 1G8AA 4G9RA 2IZUA 3S00A 4F08A 4ASZA 3R71A 1QL6A 4HPUE 1OUYA 3M11A 5AR8A 3JR1A 4QPAA 3EN5A 3DQWA 3V8TA 5JEBA 5JT2A 4AN2A 1K9AA 4E93A 2R3OA 5AUVA 4ASDA 4FGRA 3NX8A 4OTIA 2YIXA 2O8YA 2Y8OA 3F6XA 4KKEA 1W8CA 4MKCA 3SW4A 3VJOA 5IA2A 4TYHA 3LPBA 4AZWA 5HTIA 4L67A 2CCHA 2WFYA 4Y72A 3S2PA 4ZIMA 1H01A 3H9OA 3NRMA 3NDMA 3IOKA 4DH7A 4TYGA 3R2YA 4F63A 2C5VA 2XM8A 4F9WA 1GY3A 4IAZA 4TL0A 3MH1A 5J1VA 5FUTA 4EWQA 1YI3A 1OPKA 3UDZA 4NK9A 3RNYA 2UVXA 3A61A 4I0SA 2Y6MA 3B2WA 3C9WA 4QMTA 4AS0A 2YERA 4YTCA 3TJDA 2GQRA 4QMWA 3WZUA 2QO7A 3AT3A 3WARA 2B1PA 3ZMMA 4W9WA 2BTSA 1CTPE 2J7TA 2RIOA 2XKFA 4C2WA 5L2TA 4ZLYA 3GOKA 1CMKE 3S0OA 4MUQA 4I6HA 1H26A 1W83A 3BV2A 3W2SA 4FTJA 2C6IA 3R8MA 3HNGA 2WMSA 3QLFA 3R00A 5ACKA 3ACJA 2QHNA 2W1ZA 2LGCA 3FZSA 4PNKA 3U6HA 4QDVA 1OVEA 2QD9A 4YU2A 3DKFA 4IBMA 4D9TA 3BYMA 3QRKA 5EH0A 4RIXA 4NJ3A 4RSSA 2NRYA 3PZEA 3ORKA 4A4XA 3E8EA 4U3ZA 2UW0A 2XNGA 5TOZA 1TQMA 4CYJA 4D4SA 4QEBA 3MH0A 3TYKA 4CLIA 1P4OA 4WSQA 2UZBA 2Y4IC 4C37A 1AGWA 4TKSA 4U41A 4XV1A 4HYUA 4MHAA 1YHVA 4ALUA 4IVCA 5A3XA 3BYSA 2W9FB 5EK7A 4GSBA 3RPYA 4RA4A 5L8JA 4AE6A 4F70A 4EH9A 4FT9A 5EFQA 1JSTA 2R3GA 4S32A 3POOA 1JSVA 3BE2A 2XM9A 2NYAA 5IQIA