3H9OA

Phosphoinositide-dependent protein kinase 1 (pdk-1) in complex with compound 9
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
285
structure length
275
Chain Sequence
RKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-phosphoinositide-dependent protein kinase 1
publication title Benzo[c][2,7]naphthyridines as inhibitors of PDK-1
pubmed doi rcsb
total genus 80
structure length 275
sequence length 285
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3h9oA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3h9oA01
3SKCA 4RWLA 3COHA 4X2NA 5M55A 3PJCA 3PVBA 2C1AA 3UIBA 3ATSA 2IO6A 4PDOA 4AAAA 4MBJA 4O0RA 5KMLA 2ZB1A 3RM6A 4FV2A 2QHMA 4CFFA 2VTJA 4XG6A 3OWKA 2O64A 2AC3A 2WTCA 5K9IA 4XOZA 3WOWA 3VVHA 2DS1A 4EOSA 4JRNA 3ZSIA 4L7FA 5DMZA 5IDNA 2NP8A 1BUHA 2PK9A 3NWWA 4M0YA 5IH5A 1WBWA 4C33A 4NIFB 3UQCA 3SQQA 4FT9A 3QCSA 2QKRA 3S00A 4A4XA 3WZJA 3D7ZA 5IDPA 4PL5A 1JOWB 4FSTA 4CV9A 4E6QA 2QCSA 3AT2A 3CY3A 3NYXA 2B9JA 3IGGA 4JT3A 2BAKA 1T46A 4EWHA 3BYOA 1FINA 5CI7A 4E73A 3KF4A 3RAKA 4QYGA 2CGUA 3ZUVA 3E93A 3I5ZA 5HORA 3OCTA 4P90A 5E8ZA 1V0PA 4RQKA 2ZOQA 3PDTA 2HY0A 2CHLA 1KE7A 4H58A 5BVEA 2CMWA 4CV8A 4F4PA 3REPA 4MNEA 3ZO1A 5DYJA 3PUPA 4D4SA 3O50A 4CZTA 1PYEA 2J9MA 4O2PA 3ENHA 3ZZEA 3HMPA 1U59A 1SVHA 2YDKA 1GIIA 4HCUA 4ASEA 5IUGA 4ZLZA 1LP4A 3HAMA 4PL4A 1XR1A 4RIYA 5ETIA 4PMPA 2BROA 2VX3A 4FR4A 3UNJA 5IEXA 3E3BX 5AP4A 3TJCA 5TE0A 1FPUA 2X7OA 2UW4A 3PSBA 1TVOA 3KXNA 3QAME 3HECA 4XNEA 1BI8A 5KBQA 1IEPA 3LQ5A 3LXKA 3BYMA 5M44A 2UW0A 2PULA 2QG7A 5DWRA 5EI2A 3R8UA 3GU7A 4EEVA 3QUDA 2IN6A 2PMIA 1IASA 3NR9A 4L3JA 4DEHA 3CGFA 4QTDA 5CEIA 4C02A 5HCYA 5A54A 5AUTA 5C1QB 2HY81 3OW3A 5F94A 5A4TA 5J5TA 1DAWA 2WMWA 4CFXA 3PIYA 4LGHA 2WTKC 2R5TA 3G2FA 4FKQA 4FSUA 3LM5A 5JFWA 4OBOA 3WF7A 4B4LA 1U4DA 1YXSA 2E2BA 2VTOA 2VWUA 4FA2A 4USFA 4PQNA 1GZNA 1YVJA 3IGOA 2B0QA 5IQEA 3MH0A 2ITPA 3RI1A 2OIDA 2PVJA 4FT7A 2O2UA 3W8LA 3FI4A 2V0DA 4JIAA 2IZTA 4YMJA 3QLFA 4MNEB 2IZUA 1KE5A 5A6NA 2HWOA 1JNKA 3TG1A 3QX2A 2WGJA 3Q2MA 2BZKB 3RJCA 3A7IA 4NFNA 5JK3A 1OBDA 2QOQA 2X0GA 4FGRA 1CSNA 1OVEA 5TF9A 5AADA 4PPBA 4RIYB 1Z5MA 3EMGA 1PXMA 5CF4A 1ZRZA 1H27A 4D2SA 4TL0A 4NJDA 3GXLA 3V5WA 3CLYA 4V04A 4XUFA 4TYJA 5GZ9A 4TRLA 1U5QA 3ROYA 4ANQA 3H9RA 4BF2A 4IFCA 4EOQA 4IJ9A 3CIKA 4DG3E 2JLDA 5HTCA 2YZAA 2W05A 1RW8A 4UB7A 4QMMA 2R3HA 4U41A 4WD5A 4EWQA 3CTJA 2X4FA 3BU3A 3KXXA 4FZDB 3RK9A 3RKBA 3SHEA 2JBPA 4H1MA 5D41A 3ZYAA 4USDA 4HVDA 4X7QA 5CALA 2QO2A 3ET7A 4FTLA 4QTEA 5JQ8A 3KVXA 3BBTB 2O8YA 4RWKA 2YWPA 4NM7A 4BTKA 4C8BA 4EL9A 1UWJA 4F1OA 3DDPA 4FNYA 3JR1A 2Z60A 4JNWA 5M56A 1U5RA 3EN7A 3LQ8A 4PV0A 4HVGA 1E9HA 5BVFA 5AFVA 4AZEA 4YHJA 3DKGA 2VTSA 4OTPA 4U9AA 2OJIA 3Q32A 4A4LA 2XK4A 4RJ5A 1J7LA 4FZ6A 4LYNA 3NNWA 3MJ1A 4X0MA 2C5XA 2IVSA 2J7TA 2OKRA 3GC9A 3MY5A 3PTGA 2I40A 2G2HA 3M1SA 5E8VA 1WBOA 2QOLA 3U87A 4HVHA 4AP7A 1UU3A 1YDSE 2W1EA 3DLSA 4IAFA 5CLPA 4L7SA 2R3FA 3NAYA 1ZOEA 4CXAA 1R0PA 3FPQA 5HLPA 4RJ4A 5AUXA 2C0IA 3RP9A 5K0XA 5L8JA 2J0LA 4I93A 4MWIA 3THBA 2CNQA 4I6BA 3AGLA 4QQCA 5A46A 4ZP5A 3QCQA 3OZ6A 2I1MA 4LRJA 3TZMA 2NO3A 4AT3A 5L8LA 2QR8A 5CANA 3T3VA 3UVRA 5HVKA 3DFCB 2XCKA 3UC3A 4F9WA 1WVXA 3E64A 4WOVA 3QTWA 3R0TA 5C03A 2C3LA 4D28A 5CSXA 3PA5A 2C6TA 4ANNA 2BHHA 3GC0A 2O63A 2X2LA 4IM3A 2VTNA 3SG8A 5ANDA 4DEGA 3E87A 3O8PA 4Q9SA 1GJOA 3I6UA 4W4VA 1A06A 1MRVA 2YACA 4XRLA 2HZ0A 2JFMA 4FI1A 5AEPA 2W17A 3RPRA 5KKRB 3NCZA 3DKFA 2ITXA 2QONA 4PDYA 3PIXA 1YHWA 3UZTA 4J96A 1FOTA 5BVKA 3WILA 3O2MA 4FSRA 3QQHA 3VBXA 3ZFMA 4CSVA 5HBEA 4EZ3A 3UG1A 4C3PA 3BWFA 1FQ1B 2UVYA 4FF8A 2JBOA 5G1XA 5HCXA 5FXRA 1A9UA 2BRNA 4PTEA 4TWNA 2RL5A 1M2QA 4FTIA 1OKZA 3P7CA 4IVBA 4RJ6A 2WQEA 5AMNA 3NS9A 3ZFXA 3QXPA 4EC8A 4HW7A 4DE4A 5IQDA 3KRLA 5E8TA 5AR4A 2YERA 3PWYA 4DG2E 2FGIA 3TUDA 4FVPA 4PF4A 3GENA 2B55A 2VTAA 4RMZA 4BBEA 5H9BA 4BBFA 5CU3A 3MFRA 5GIPE 4IAYA 3OXTA 4ZMEA 4IZ7A 3Q9YA 4UMTA 4HJOA 4K1BA 3MFTA 4ZS0A 3D5WA 2XNNA 3PXFA 3DFAA 1JKLA 4V05A 2C30A 1YOJA 1WVWA 1HCKA 4Q9ZA 3A61A 4XP0A 3SXRA 5J9ZA 2UW6A 3V5PA 3SW7A 3QC4A 2XBJA 1I44A 1H0WA 3VJOA 2YITA 5EQPA 2WQOA 4CTCA 3CJFA 3TV7A 2A4LA 2CJMA 5LVLA 3RCJA 4X6RA 2JFLA 4A06A 3O23A 2OIBA 2RFNA 4ENXA 1WBSA 2UVXA 3GEQA 4CD0A 2X4ZA 3NNUA 5HO7A 2EU9A 3PG3A 4BDFA 3GU6A 5DR9A 1OL7A 4JDIA 5FQDC 4KS7A 3MIAA 4O83A 3BKBA 2ITYA 3NLBA 4C4EA 4F65A 3GFEA 3ZO3A 3SG9A 3OXZA 4YZ9A 4EOOA 4BICA 3VS7A 2CCHA 1XH4A 2EWAA 2UW7A 3ZO4A 5CAQA 4M0ZA 1KE9A 4UMQA 3TZ8A 2XKDA 3P1AA 3TKUA 4ACCA 4FTUA 1MUOA 3EQRA 2YCSA 2ZB0A 4HPTE 4QTCA 4DFLA 4W4YA 4QMQA 3RALA 4C2VA 2VU3A 3LKMA 3U8WA 3G33A 5HEZA 3ACJA 3MVLA 4IXPA 3SC1A 5IA5A 5KUPA 4FMQA 3HV3A 1Q3DA 4FSQA 3BLHA 3TT0A 4D9UA 2QNJA 4EKLA 1ZY5A 3LFSA 2R3OA 2A19B 5JFVA 4DYMA 2XA4A 4YNEA 5JRSA 3HRFA 4J8MA 3OROA 1FMKA 4ZSLA 2CKQA 3F88A 2HAKA 2ITVA 3RCDA 4JQEA 4XG3A 3P86A 2XNEA 1LEZA 4L67A 3VQUA 4I94A 4FV6A 4QP6A 3FMMA 3OHTA 3EKKA 4L00A 2WTVA 5AUWA 1ATPE 1T45A 2AUHA 2VTPA 3PJ3A 3QTIA 4O0YA 4Y73A 2OFVA 3QTSA 3RTPA 3Q9WA 3Q6UA 5JKGA 2BPMA 3VUMA 2OIQA 4EBWA 4GT3A 4IM0A 4RBLA 4ZAUA 4HOKA 3R1SA 4OW8A 2J0MB 5J79A 4C4GA 2QURA 3R9DA 3RWQA 4DCEA 4BDDA 3VBYA 4BWKA 2RFDA 2OU7A 4K33A 3HMNA 4FG8A 4N6ZA 3PXKA 2YIYA 5JQ5A 4BDGA 4XP3A 2WU6A 5M4UA 3NYOA 3DA6A 4F08A 4FYNA 2BRBA 4F0GA 3QWJA 4ZLYA 3TUCA 4BGQA 4JX7A 4L68A 5JSMA 3PPKA 5BVOA 4KRDA 1VJYA 3R9HA 4ZTSA 1YHSA 3BCEA 4IB5A 2GTNA 3FI2A 3TNPC 3EQBA 4U8ZA 1PW2A 1VR2A 4AZSA 5BQ0A 4O7VA 2YLEA 3GBZA 3IPHA 3PY0A 1SVGA 2C0OA 3LFBA 5M51A 3LJ2A 4WRGA 5DFPA 5E1SA 5JGBA 1XWSA 3W2CA 2CGXA 2BTRA 3I7BA 5FBOA 2F57A 2YISA 1CM8A 4YJTA 4DH3A 1Y6BA 3QUPA 3C9WA 4Z9LA 4CTBA 2BHEA 2IPXA 1Q8UA 2OBJA 3U9CA 3NVMB 4P4CA 5TO8A 4FIEA 4WKQA 3MY1A 4BZNA 3HNGA 4IAZA 2J90A 1U54B 2CGVA 4L3LA 3TL8A 3EH9A 3MPTA 3W1FA 3TUBA 2PVKA 3BYSA 2HW7A 5C9CA 3SD0A 4Y85A 4GVJA 1Q8TA 5FG8A 4X3FA 5CENA 5IH6A 3R8ZA 2WQMA 3UIMA 5AV4A 5GINE 2HXQA 4DBXA 4MX9A 1XH6A 3EQDA 4TWOA 3CPBA 3W2SA 4ANMA 4D5KA 4WSYA 4DGMA 5HD7A 1H25A 3OWLA 4O86A 5G6VA 4LMNA 1F3MC 2B1PA 5HVJA 4KSPA 2R7IA 5L6PA 3ACKA 4LMUA 4J99A 4WBBB 2REIA 1AD5A 5HE0A 4E20A 5HBJA 4UX9A 4FKRA 3COIA 3ZHPC 2QO7A 4F0IA 3LMIA 5AP6A 1YI6A 3QF9A 4C36A 5JH6A 3CQUA 1RJBA 3RNYA 2CKOA 4BI2A 1XBAA 2XIKA 1ZYSA 2XP2A 3K5VA 3W2RA 4KIQA 1CKIA 4I6FA 5CX9A 4C4FA 3K2LA 4DHFA 3CKXA 3PVGA 5A4LA 2CKEA 4U43A 2VTIA 1YOLA 2VZ6A 3DB6A 4KKHA 5L6OA 3TTJA 4EOIA 4IZ5A 4G6LA 3BE2A 5EYCA 3QA8A 4GYGA 4HYUA 2X1NA 3WF5A 3VS1A 1NVSA 4DN5A 2IWIA 4P5ZA 4CQGA 5EDQA 3KGAA 4JBQA 4AZTA 5AIRA 5D7AA 3W2PA 3IW8A 2C3KA 3WE4A 5KHXA 3Q4ZA 4S33A 1NXKA 3UP2A 1OM1A 2Y0AA 2Z8CA 3PSDA 3MJ2A 5CEPA 4RWJA 3FJQE 2VO0A 3FLYA 3LZBA 3Q3BA 3UBDA 1WMKA 4X3FB 1H1WA 5C27A 4A4OA 4DAWA 2YIQA 4FKJA 2KTYA 3AQVA 3QQUA 1P4OA 4NW6A 2PSQA 4FKTA 4IB3A 2PZYA 4NKAA 3HVCA 5BMMA 4QMOA 3MTLA 3WF8A 3RWPA 2OK1A 1RE8A 2JAMA 3L8XA 3QKKA 3N4UA 3KCFA 3ORNA 4FV7A 4G34A 2W1FA 4V0GA 3ZH8A 3EQPA 4DH5A 2V62A 4JQ7A 4OBQA 4G6OA 4PTCA 5J1VA 4ZMFA 5AUVA 3NSZA 4P7EA 3CXWA 2PPQA 1J3HA 3PZHA 4CG9A 4G3DA 5IUIA 3F82A 4ZTQA 2C6DA 4BCMA 4GMYA 4O0TA 4QMYA 5AR3A 4U81A 4X2KA 3ZM9A 2ITZA 3LHJA 2R4BA 4WG3A 2BIYA 3R8VA 4MBIA 2QLUA 4QNAA 5EQYA 3DZOA 3KK9A 5K3YA 3VUDA 4QP4A 4FT0A 4UWYA 2WTDA 4YJSA 2W5AA 4F70A 2Q83A 1P4FA 3HYHA 2JDTA 5J9LA 3R2BA 4WO5A 1YW2A 2ITOA 2QOKA 4ZTHA 4RSSA 4X21A 4S31A 3VS6A 4M14A 1OBGA 2VV9A 2UVZA 4JDKA 3V6SA 4C61A 1JSTA 3MTFA 3OTUA 4AOTA 4C34A 2C6EA 4O27B 2QOIA 3GCVA 2O5KA 2XK7A 5M57A 5CT7A 5E92A 2ZV7A 5IQFA 2C68A 5K4JA 3I7CA 1J7IA 5B2LA 2RG6A 3RINA 4O0SA 1ZOGA 1UKIA 3RVGA 4MXOA 1ZMWA 4Y5QA 2XK8A 2ONLC 5HIDA 4DGGA 4V0GB 3PY3A 5GHVA 2JKOA 4FSZA 2ERZE 4F9YA 4AA4A 1OUYA 4XV1A 3KMUA 3BEGA 4QMUA 3PRFA 3FAAA 4B6LA 4L43A 4BYIA 3FBVA 3TEIA 3TXOA 2H6DA 3NUSA 4D55A 4DFNA 4FV9A 5J7HA 2IVVA 2VWVA 2J51A 1H26A 4ID7A 4RFYA 4EQMA 2PUPA 5AP7A 1J7UA 2VTRA 2XZSA 4AUAA 2JD5A 3MFUA 1O6LA 3G6GA 4MXXA 5CVGA 5GNKA 4JAJA 3W8QA 3QWKA 1E1XA 3EOCA 4BZOA 2J5EA 1PMUA 2CGWA 5FGKA 4CZYB 3MPAA 4O7SA 3B2TA 4FYOA 5HLNA 4YJPA 2XIXA 4TPTA 5F20A 3LFDA 1IAJA 3K3JA 4BHZA 3TACA 3QD2B 4TY1A 3E8EA 5JEBA 4FIHA 2PVNA 3FZ1A 3R1QA 2W99B 2EB2A 1Q4LA 5AP0A 1H1QA 2O3PA 2BIKB 2W1IA 2Z7QA 4GK3A 3OCBA 3JVRA 4L9IA 4MBLA 4MF1A 4PX6A 5C8MA 4BYJA 4D1SA 4CKJA 1JAMA 3FKOA 2OO8X 4FBXA 2B53A 3CY2A 4LUDA 5ANKA 4UMRA 3R8LA 4GS6A 4C2WA 5E8WA 3BQRA 4WG4A 2UV2A 4NSTA 4U7ZA 4ARKA 4ZK5A 4HCVA 4O21A 4CGAA 2UZLA 3RM7A 3AC3A 4ZLOA 5EHYA 4IWPA 4DFYA 3TV4A 2WHBA 2XK3A 2P3GX 3DPKA 4DEDA 4WNKA 3PJ8A 4BB4A 3HAVA 5HHWA 3WF9A 5M06A 4AG8A 3S2PA 1KV1A 2BKZA 2OF4A 2R9SA 3NEWA 4E6AA 3NUNA 3G51A 5L2IA 1GOLA 4FZ7A 4KIKA 4G3EA 2X81A 1OPJA 3HKOA 3A62A 5FWKK 3IW6A 5LMKA 3G6HA 4EH7A 3LMGA 3U55A 3FHIA 4L44A 3R9NA 2PVMA 2PVYA 4JOAA 4DT9A 2FSTX 3WARA 2XIRA 4LV8A 4L8MA 3R1NA 1PXKA 2G2IA 2QR7A 4FKWA 3V8WA 5HZNA 4RC4A 3CE3A 2ITWA 4IE9A 2BFXA 1JVPP 3ALNA 4BI0A 3MWUA 3POOA 4BVUA 1H1RA 3ANQA 5CY3A 3VO3A 5I4NA 3UQFA 4KIOA 3ZLYA 2BZJA 2WMUA 3LLTA 5HO8A 4F99A 2J0IA 3U6JA 4YZDA 3FMDA 2BAJA 4M15A 4EYMA 3BU5A 1KOBA 2JKKA 2ZV9A 3BGPA 4HPUE 2YFXA 3FLNC 2RF9A 4O7ZA 5ETFA 3W2OA 2FSLX 3VW8A 4KINA 4X6QC 4EK6A 4Q2AA 4I6QA 1K3AA 5I9WA 1XQZA 3RAIA 2A0CX 4Y95A 3KXZA 2WNTA 4U5JA 1OL1A 5LCJA 3MIYA 3ZM4A 3KRJA 2PWLA 4AS0A 4RX8A 2OSCA 2WMBA 5J95A 3FI3A 4E26A 5KMOA 3LVPA 2YM6A 4PPAA 4I22A 4QT1A 5DEYA 2J50A 4IADA 2XS0A 4D2WA 5IQAA 4KIKB 3PY1A 2X7FA 3FMNA 3O96A 3GGFA 4YNOA 3IDBA 5HTBA 1IAHA 3QRIA 3TIYA 5ETCA 4TYGA 1IA8A 3VN9A 4E4XA 3HUBA 4MXZA 3HV6A 4F9AA 2Y6MA 3EQCA 4UXLA 5I9VA 3QYZA 4C4IA 1P14A 3SDJA 1WBVA 3FZPA 3KXHA 4G17A 4XH6A 3OY3A 2GPHA 5ACBC 3H0ZA 3QRKA 4EQUA 4BWPA 4FKLA 3FE3A 3E8CA 3GQIA 3JVSA 1UA2A 4MH7A 4BBMA 4YUQA 1YWRA 1ZLTA 3DT1A 4U6RA 1UNHA 4HVSA 4XG7A 5DPVA 5L4QA 2BDWA 3AXWA 4AW0A 3MVMA 3T9TA 2R0UA 1OGUA 5JT2A 4Y5HA 4D4RA 3VS0A 5AWMA 3DU8A 4ACHA 4O7NA 1K2PA 2ZJWA 5CAVA 3NUYA 2PE2A 2VAGA 3EQGA 3QZFA 4QPMA 3ODZX 3DK7A 4XOYA 3Q60A 4H3BA 4JJRA 4MD9E 2J0JA 3OWPA 3TCPA 2EVAA 4OT5A 5IQBA 3RGFA 4F7SA 4CRLA 4WUNA 4O6EA 4AQCA 4BTJA 1ZXEA 3OEFX 3R01A 3PJ2A 3R7YA 3KC3A 2ITNA 3QD0A 4FTNA 4UY9A 4Y72A 3U4WA 4C57A 2XRUA 3ORIA 3QD4A 4AN3A 1NVQA 2WMXA 3R1YA 4BI1A 4MVFA 3KF7A 5CQUA 2ESMA 4FSYA 1BL6A 1REKA 3FMJA 2ZDTA 1GNGA 3OC1A 2QI8A 4FEWA 4BR3A 4KD1A 3ULZA 3LCOA 5IQIA 2W4OA 2OFUA 3RZBA 3TNHA 1PMEA 2WFYA 4N4SA 1ZYLA 3FHRA 3FKLA 3H9FA 3AMYA 4XV3A 4YJOA 5HNBA 3ZMMA 1UWHA 2C1BA 3R9OA 2HXLA 3PVWA 2OWBA 4FSWA 4YLKA 2A2AA 5CI6A 2XVDA 2Y8OA 4XV9A 1NA7A 2R64A 3POZA 1J91A 4FL3A 5EDRA 2YM3A 3UP7A 4KAOA 1R78A 4C4JA 3LCDA 3O7LB 3QCXA 4RVMA 4G3GA 3SX9A 3A4OX 4YJNA 4LUEA 2GQGA 4U79A 3O0GA 2SRCA 3FYJX 4IAIA 4ASXA 4FK6A 3VNTA 3IS5A 4FKSA 4G5PA 3LCSA 2CN5A 2VWIA 4G5JA 2PE0A 4YTCA 5LXMA 4W4XA 1WBPA 3B8RA 4FNWA 3DZQA 3F3VA 5FTQA 4IFGA 3DJ7A 2VUWA 3Q52A 4U80A 3KMMA 3I5NA 5KNJA 3FKNA 2X8EA 1HOWA 2C0TA 4E6CA 5HGIA 1Q99A 3AG9A 3Q53A 3BV3A 3R7UA 3HLLA 3CSVA 4EH8A 3S95A 1ERKA 1UKHA 4K2RA 5AAFA 4ANLA 4C7TA 3QRTA 4D1XA 3MGYA 4TKSA 3FUPA 3AD4A 3EN9A 3F3UA 3NNXA 2GQRA 5LVMA 3UDBA 2XNGA 2I0HA 3PWDA 4PPCA 4DFXE 2DUVA 5I3OA 5BYYA 4E5AX 3BHTA 2QOCA 5HESA 4ERWA 2WMTA 3DS6A 3K54A 3FXXA 3AD6A 4K9YA 5E8SA 3ODYX 4N6YA 4MCVA 2IW6A 2IZRA 5IUHA 2JDSA 4RIWA 5D10A 1XJDA 4OTDA 1PY5A 5DR6A 4D9TA 4BY9E 1OB3A 2OG8A 3R22A 4J1RA 3P4KA 4NM0A 4AA5A 4JDJA 2W96B 3QQLA 4OGRA 5CU4A 3UOLA 4H36A 4BKJA 3PA3A 3VC4A 4O91A 4O6LA 5M4CA 2OICA 3IG7A 4IH8A 2UZTA 2RKUA 3SXFA 3TNQB 3OXIA 4F7LA 2YIRA 4FKUA 1QCFA 3HRBA 2BRHA 4IX5A 2UW8A 3I60A 2I0YA 4Y46A 2H8HA 3KN5A 4O96A 1ND4A 2IVUA 2OH0E 5DE2A 1MP8A 2P2IA 2OZOA 4LGGA 2ITUA 4F64A 3S0OA 4DFUA 1Y91A 2GNHA 4EK5A 5A14A 4IB0A 4DEAA 3G0EA 3Q9XA 3ENMA 3BHUA 5K4IA 4PMMA 4RVTA 3FLZA 2WTIA 2YM5A 4GL9A 4DGOA 4J7BA 2X2KA 2C4GA 3KKVA 4AOIA 3ZLWA 3FQSA 4BCNA 2UW3A 4ZXTA 3MH3A 1JKTA 1OPLA 2P33A 5HTIA 1MRYA 3TDWA 3ZEPA 2UUEA 3MB7A 1H0VA 3V6RA 4A9TA 4BHNA 1LEWA 4PNIA 4QMPA 4UYNA 2BUJA 2R3QA 4I4FA 1GZOA 3P5KA 3GCSA 4I24A 3CD3A 2B9FA 2YDIA 3OWJA 2VO7A 4GH2A 3ELJA 3SV0A 2VWWA 4GT4A 4CG8A 1SVEA 1HCLA 1L8TA 4F1TA 2IVTA 3D0EA 4O0XA 5CVFA 3RAHA 3KXMA 2HIWA 2BRMA 3GI3A 1J1BA 4U44A 3V3VA 1ZY4A 4EJNA 1LUFA 2XKCA 2Z7SA 4NUSA 4QQ5A 1CDKA 3CGOA 4TWCA 2A1AB 4BDBA 5J87A 1BX6A 2RFSA 3JPVA 2XK6A 4GRBA 4ZJJA 3ZDIA 2VO3A 3NUXA 4FKVA 3GVUA 2JKMA 4C38A 4OAUC 3F2NA 3KY2A 5CSWA 4MYGA 3GOPA 2F9GA 4KBAA 5LVOA 4E4LA 3LW0A 1F0QA 4XBRA 3FQHA 1H1PA 4L01A 4D0WA 4MD8E 5I9UA 4ALWA 3CTHA 1EH4A 3M11A 2C3JA 4U45A 5B7VA 4AE9A 3EFWA 3MSSA 4D4VA 1ZZ2A 4MD7E 1RDQE 3LMHA 3E5AA 4FNXA 3PG1A 4IVDA 3F3WA 1ZYJA 4O0UA 3NYNA 4ALUA 4DGNA 3EKNA 3O71A 4O82A 2XNOA 3O7LD 4FIIA 1GY3A 4BCJA 3FZSA 2XF0A 5EG3A 4ZSEA 4FZAB 3C1XA 4EZ7A 4EJ7A 2P2HA 5DOSA 4MHAA 1FBNA 5EK7A 5A9UA 2WMAA 3D83A 2YABA 5DBXA 4BDJA 5JGAA 2CLXA 4EH2A 2C69A 4LM5A 3AT3A 3NMUF 2FYSA 2WMRA 3IW5A 3KFAA 4LRMA 4YC8A 3F3TA 4XG8A 4YC6A 1R3CA 3PXRA 1ZOHA 1BL7A 4E4MA 4R78A 4DEBA 4X2JA 3MYGA 4C4HA 4YBJA 2CN8A 2QD9A 3MA3A 1CMKE 4A7CA 3PP1A 1MQBA 2OJ9A 4WRSA 4PDSA 1W82A 4RFZA 4HGSA 4IVCA 4W9XA 4B8LA 3FXZA 4EHZA 2OXYA 4BC6A 2PTKA 4B0GA 5AAEA 1M17A 5AR5A 4DFZE 4RLKA 4QMTA 1M2RA 4ZIMA 4NCTA 3DXNA 3PLSA 3LQ3A 4FG7A 2ZM4A 4M12A 4F6SA 4HVIA 5ANGA 3MI9A 2H34A 4BCFA 3E88A 5T3QA 2Y4IB 3UTOA 5CAOA 2VNWA 4IX3A 2WZJA 4UV0A 5JFSA 3R63A 2X8IA 3OP5A 3EFLA 1CKJA 1H28A 3O17A 3NIEA 3FEGA 2V7OA 2HELA 5CNOA 5CU2A 4HCTA 3VS4A 2ETRA 3RMFA 4QYYA 3GP0A 4IEBA 3TKHA 2PZRA 2DWBA 3UPZA 3W55A 2W1ZA 2OJGA 4QP1A 5D11A 2JKQA 3E63A 2F2UA 2W5HA 4OUCA 5C4KA 5BUEA 5AX3A 1UU7A 3UMXA 3UZPA 4FL1A 3LFEA 5T6KA 5KHWA 5IA0A 4A9RA 2WKMA 2KULA 3HV7A 1Q41A 4E6DA 4JQ8A 2VX0A 4ZJIA 3KN6A 2GSFA 3WIKA 3HP5A 2RG5A 2F7XE 2VWZA 2XYUA 4CFMA 4RA4A 1SZMA 1JSVA 3EIDA 3KRRA 4YO6A 4YPDA 3L8PA 5HG7A 2C6KA 5D12A 3PE2A 5BYZA 2V5QA 4RJ8A 4JL9A 4GKIA 4JBVA 4O1OA 4C37A 4MEDA 5CXZA 4X2GA 4YZMA 4TTHB 1W0XC 1W83A 2OXDA 2UW9A 4XCUA 4CLIA 2BDFA 5GZ8A 3QALE 5DLSA 1B6CB 1VZOA 1O6YA 3GC8A 5DVRA 5HX6A 4EQCA 3RK5A 4FX3A 4PY1A 4C58A 2ITQA 4HYIA 4HGLA 4IVAA 5I9XA 4O0VA 4R3CA 2R3PA 2R3NA 3KB7A 4BCQA 5A6OA 3EN5A 2ZM1A 4O7LA 1G3NA 1H01A 3Q9ZA 1QL6A 2PVHA 4IW0A 3A7HA 4R1VA 5CSVA 4YHFA 5B2KA 5BUIA 1VEBA 3EWHA 5DRBA 5DRDA 4L53A 3M2WA 3UOKA 4XX9A 3CPCA 3DB8A 2VTMA 2CLQA 2QOHA 3VRYA 4BIBA 2YAKA 4GFGA 3HV5A 4CFWA 5EW9A 4E93A 1AQ1A 4JG7A 2WMVA 3VS5A 3O8UA 2R7BA 3U54A 4B99A 4TXCA 4BDCA 4M66A 3N4TA 1F5QA 4F09A 5H8EA 2QOFA 2GTMA 2UW5A 4FSNA 3GCQA 4JLCA 4JR7A 2PMOX 4XBUA 2XNBA 3UC4A 3DXQA 2W0JA 1PMNA 4J52A 4GG5A 4NL0A 2VTTA 4M8TA 3VWAA 3P0MA 4KNBA 5ANOA 5FXSA 4RA5A 3TI1A 2NPQA 2HYYA 5AA9A 4QQTA 1OZ1A 4GU9A 3Q6WA 1S9IA 3QGYA 4BTMA 4I5PA 3SOAA 3ORLA 4ANSA 2WMQA 3FZTA 1M14A 5HU9A 3NZ0A 3IOPA 4B8MA 3TNIA 4P5QA 4IACA 4CCBA 2YLFA 4Q5HA 4I20A 3A7GA 1DI9A 3VBWA 1TQIA 1Q61A 3BLRA 5IA2A 4DH8A 4JG6A 2Y7JA 3C0HA 3QGWA 4CMUA 4PNKA 1YWNA 4L46A 5L3AA 4ITJA 3QKLA 2UZNA 2V22A 4HYSA 4JX3A 3PRIA 3LJ1A 4FIJA 3HDNA 4XV2A 3F5PA 5HNGA 4D58A 4AF3A 3PSCA 1PKGA 5J1WA 4D5HA 4IAAA 2IW8A 2Z02A 2GHGA 3K5UA 3VBVA 1GZKA 1H4LA 2VWXA 3IO7A 3OOMA 3NUUA 4LL5A 3PJ1A 5AP5A 4BN1A 4EYJA 2XMYA 3AT4A 3HDMA 3EL7A 4ITIA 2XNMA 1IG1A 5AUUA 3L9PA 2FSOX 3CQWA 2UZOA 4EKKA 3OVVA 2E9VA 4DCAA 4A07A 4NWMA 3V51A 1NW1A 4D1ZA 4EH6A 3WZUA 4R3PA 3CKWA 3OBGA 4G16A 4ZY6A 4OTGA 3EQHA 4TNBA 1KOAA 3DCVA 3AC8A 5AAGA 5JGDA 2PU8A 5F4NA 3R8PA 5IZFA 2WXVA 5CTPA 3NPCA 2R3MA 4OLIA 5CEOA 3P7AA 1K9AA 4CKIA 1YKRA 2GHMA 1S9JA 5AIKA 3ZLSA 1W7HA 4GK4A 3QZHA 1KE8A 4QMNA 5LVPA 4R5YA 3NYVA 5ETAA 4RVKA 3DV3A 3BZ3A 3A7FA 3KK8A 3NW5A 2PUIA 5M07A 3O51A 3E7VA 5DNRA 4FV1A 1ZWSA 4KBCA 5FEQA 1Q3WA 4QTAA 3V04A 3ZSGA 4NYEA 3P23A 3ZU7A 4QP8A 4LL0A 3R02A 2RSVA 3QZIA 4DF3A 1PYXA 4QMSA 4RIXA 4F7JA 5KKRC 3NX8A 3VUIA 4AOJA 2C6IA 3UG2A 3ROCA 3LAUA 3AMBA 5AP2A 3SOCA 3G9LX 3QQKA 3QTUA 5FP6A 3WZEA 5L2SA 1JQHA 3KQ7A 3UVQA 3LXLA 4TYEA 5E4HA 1YDRE 3AC5A 4IMYA 3F2AA 2BKKA 3QCYA 2X39A 2GCDA 4FTOA 2EB3A 3CCNA 3QFVA 4HNIA 2XYNA 1OKYA 3LXPA 4FG9A 3RK7A 3MN3A 2Y9QA 3BI6A 3E92A 4FIGA 5EFQA 5IKWA 3BX5A 4OBPA 3R83A 4EOKA 2WPAA 3ZXTA 1Z57A 5T68A 2FSMX 4RIOA 4QOXA 3JY0A 2DQ7X 5IMXA 3VS2A 3FMKA 2JIVA 4FTCA 1URCA 4W8DA 4BL1A 3C7QA 4D0XA 4BCGA 4J8NA 5GJGA 3U51A 5EHOA 3R2YA 5IA3A 3SGCA 2F2CB 4NEUA 2C5YA 1AGWA 4JAIA 2CSNA 4GK2A 4GIIA 4WG5A 2XEYA 4RX9A 2OI4X 4AGUA 3PXZA 3WBLA 5IU2A 3BU6A 5CQWA 5GZAA 2YIXA 3QTRA 3ZOSA 3SAYA 2CCIA 1W8CA 4KRCA 3IW4A 4CVAA 3E7OA 4BDEA 4IB1A 2B52A 5AP1A 4RIXB 4DH7A 3BWJA 5ANIA 2OZAA 3UOHA 2UZVA 3UIUA 4G9CA 4BRXA 1FVRA 3KA0A 4HYHA 5AV3A 5IA1A 3UO6A 2W1GA 2YIWA 5LMAA 1VYWA 3A7JA 3HA8A 4MWHA 4XJ0A 1DAYA 4PUZA 2E9UA 2XK9A 3JYAA 5EYKA 3VUHA 5I9ZA 4K18A 4UWBA 4FNZA 4K0YA 4BGHA 5JN2A 3GFWA 4J95A 4EH3A 1XO2B 4KABA 2I0EA 2JIIA 2QLQA 3GNIB 4LI5A 5KMNA 3VJNA 5KBRA 4YSMA 4W8EA 3FYKX 3UJGA 4JS8A 5CF8A 4A9YA 4CCUA 4JI9A 1Q24A 5KZ0A 5K5NA 3EYGA 3EFJA 3KXGA 3L9MA 3V8SA 3FLSA 2HZ4A 4PL3A 3G90X 3OS3A 4AN2A 4BDHA 2OW3A 1QPCA 2BR1A 3ORPA 3R7GA 1Y8YA 4I41A 5ICPA 5M4FA 2CDZA 4Y8DA 4YC3A 5KCVA 1M7NA 3MY0A 4MXCA 4QPSA 1OL6A 1CKPA 4FV0A 4QMLA 4EC9A 1A48A 4FTJA 2ETKA 4ZJVA 3QA0A 4WSQA 4KS8A 4NCTC 3V5TA 4LGDA 3QUEA 4NM3A 5KX8A 1V0OA 3S1HA 4ACMA 3ID6C 2HZNA 1ZYCA 3GT8A 5HG9A 2OZAB 3T9IA 5EHLA 1GIHA 4EK8A 3RPSA 1ZARA 3A99A 1V0BA 4FUXA 1JWHA 5BVDA 3Q4UA 4QMZA 4YHTA 5M53A 2PUNA 1JKSA 4R1YA 3ZONA 5DT0A 4RX5A 3L8SA 3MESA 4BTFA 3DTCA 1H08A 5LWNA 3E8DA 5CYIA 3WYYA 1XBBA 1B39A 1DI8A 4YO4A 4NU1A 5IA4A 2ZMCA 1JSUA 2BDJA 5CZIA 5HE2A 4R7BA 4ZY4A 3HMMA 4IZYA 5DHJA 3FXWA 4QYFA 3EB0A 3LXNA 4HGEA 4DG0E 4USEA 3Q96A 4X2FA 1OI9A 4GUBA 3QZGA 4PP9A 4RJ7A 5D7VA 3PPZA 4DH1A 1OIYA 4O1PA 4ZY5A 3R9RA 4ZS4A 2GHLA 1NVRA 2F49A 5CU0A 1O9UA 4FEQA 2VTLA 5CU6A 3GU4A 5EI8A 4Z16A 4GYIA 5F1ZA 3R6XA 2FB8A 4EZ5A 3QTQA 4RG0A 4KBKA 3UGCA 2X2MA 5IISA 2JC6A 5JRQA 5EI6A 1XH7A 1PHKA 3CD8A 4QPAA 2RIOA 5LARA 4D2PA 1OL2A 3WF6A 2I0VA 4K77A 5BVNA 2YCRA 3HV4A 5AV1A 5HI2A 5HOAA 5CEKA 3QHRA 4O22A 4E8AA 5HQ0A 3LCKA 1SMHA 4H3PA 3DJ5A 4DEEA 4N70A 4CLJA 2PUUA 4IANA 2VGOA 2VTHA 4IDTA 3W16A 5KMJA 4YPSA 3NUPA 3P78A 4RWIA 4NIFA 1GZ8A 3D14A 1R0EA 3LFFA 3QX4A 2G15A 4RQVA 2UZDA 3IDCA 4Z7GA 3ZBXA 1YQJA 2FUMA 5HVYA 1FMOE 4FTMA 4XG2A 2ZV8A 3PPJA 2YA9A 2E9OA 4YZBA 3R7VA 3FL4A 2G1TA 1Q8YA 2X6DA 3TDVA 5CXHA 5FDXA 4DGLC 2WEVA 4R8QA 2BILB 4NZWB 3KL8A 4XYFA 4ZEGA 2V55A 4E1ZA 2QQ7A 3C50A 5FTGA 2PMNX 4FKPA 3SXSA 2VD5A 4ONAA 4RVLA 1JPAA 2FO0A 1OKWA 2GMXA 3OF0A 2I6LA 4YZCA 4QP9A 3UOJA 4LG4A 5I0BA 1UU8A 3V5JA 5TR6A 4QTBA 3MH2A 1W84A 2JDVA 4LOOA 4PWNA 3PXYA 5M09A 3D2IA 3TV6A 1J1CA 4CT2A 3JUHA 3BIZA 3R7EA 1Z9XA 3FPMA 1UV5A 5HE1A 3C13A 3KRWA 3MFSA 1PF8A 4RLLA 4O38A 1JLUE 1Q8ZA 2W5BA 3JXWA 4ACGA 1STCE 4QYEA 4O7TA 4OR5A 4O7WA 3QHWA 4NFMA 4FE2A 4I1ZA 2UZUE 5AR2A 3V5LA 2QG5A 5CEMA 3CC6A 2B4SB 5AV0A 3ZUUA 2UZWE 4GIHA 3P7BA 4M67A 4LOQA 3SA0A 1PJKA 3V01A 2CKPA 1KUTA 3OBJA 4GU6A 3OW4A 1TQPA 3MV5A 4X3FC 1YXTA 2Z7LA 3ANRA 3P9JA 4MF0A 3A2CA 3BPRA 3FDNA 4N0SA 4UZDA 3HZTA 5AA8A 3FSKA 3ZRKA 3ZS5A 5J8IA 3PA4A 3D9VA 3RAWA 4FEVA 3ETAA 3TZ9A 3RHXA 3UYSA 3HRCA 5JMSA 1PXPA 3KRXA 4N57A 1XH8A 4I0TA 5FEDA 2BMCA 4EOMA 5CASA 1G8AA 4J53A 2YZLA 4IQ6A 4IIRA 4IDVA 2H96A 5I5ZA 4RX7A 4AW1A 3D7TA 3KU2A 3SVVA 4MNFA 1M7QA 3Q2JA 2J2IB 2QC6A 1FGIA 2HENA 3DQWA 3EQFA 3ZC5A 1JKKA 4CNHA 3UZRA 3LJ0A 1Q62A 3BELA 2F7EE 2JEDA 2PVFA 4S32A 4FKOA 2XCHA 4MK0A 4DITA 4YJQA 1H00A 4JR3A 3DTWA 1FVVA 3LPBA 2NNWB 5GJFA 4KUJA 2J4ZA 5LJJA 3S4QA 3GCPA 4XG4A 4ZSAA 4DT8A 5JFXA 3OOGA 3ZFYA 2HCKA 4XRJA 5BMSA 3N9XA 1LPUA 4HZSA 3HA6A 5EM5A 3CP9A 5DT3A 5HO6A 4BIDA 4RGJA 3CJGA 5FTOA 3WIGA 2ZVAA 2QOBA 2W1CA 3H10A 3DBDA 3PFQA 5EYDA 4WNMA 3TJDA 2WAJA 5IEVA 3TM0A 2P0CA 1OITA 4F0FA 2WMSA 4CMOA 5ACKA 3KREA 4JVGA 4FV3A 2GDOA 5C8KA 4R6VA 3I6WA 2X9FA 4YTIA 5B2MA 3KULA 3F6XA 3VS3A 2HZIA 2W1HA 5FDPA 3Q5ZA 3OG7A 3CR0A 1GAGA 3C5UA 4I5MA 5E91A 2R3KA 1SNXA 3QRUA 4HNFA 4KWPA 4M69A 4P2KA 2XNPA 3NNVA 4MAOA 5ANEA 5KMKA 2Y6OA 1PXIA 3I4BA 1MQ4A 3FZOA 4U42A 3FI8A 4YSJA 5A3XA 4NKSA 5BUJA 2PHKA 2IW9A 3W10A 3D7TB 2B9HA 5GIOE 5CZHA 5KZIA 4IWDA 3FC1X 5CVHA 3R73A 5BNJA 2V7AA 4ASZA 1UVRA 2EXMA 4ERKA 4IBMA 4KB8A 3SLSA 3GQLA 5HD4A 4NTSA 3PE1A 4MQ1A 5AR8A 4XLVA 3PIZA 5TT7A 3D5XA 3DAEA 4I5CA 4XMOA 3QQGA 4EORA 2QOOA 3WZKA 1APME 4AXAA 1P2AA 2F7ZE 4TNDA 3T3UA 2WB8A 1IRKA 5EH0A 2XBAA 2EXEA 3LLAA 3NGAA 5CEQA 1RQQA 2WIPA 5EW8A 3DKCA 2QODA 4FV5A 3M42A 4APPA 3ZBFA 2YEXA 5CSPA 4MTAA 1Y57A 3OEZA 4W9WA 5HBHA 2PZ5A 4U0IA 4DINA 2WELA 2XUUA 4FVRA 1OUKA 3KULB 4AT4A 4V01A 5A4QA 3C4FA 4M97A 4O7RA 4L3PA 4UZHA 5EKNA 4OT6A 4GJ2A 4EK3A 3E62A 2GFCA 2VRXA 4YLLA 4DTAA 3ZEWA 4YP8A 4M69B 2YM8A 5HG8A 3QTXA 4AW2A 4LOPA 1YXXA 2UZEA 4ZSGA 4C35A 4U40A 3ATTA 5KMIA 4QP2A 4BFMA 3UO4A 3KEXA 3MPMA 4PMTA 3UQGA 4G2FA 4AW5A 4OTWA 1YHVA 4UEUA 5AP3A 4NH1A 4GG7A 3AD5A 2E9NA 1R39A 3LFAA 4YGAA 3NVKI 1U46A 4LV5A 4ZZMA 4FV8A 3VBTA 4IC8A 1XH5A 1URWA 2BTSA 3OCGA 1PRYA 4OAVB 5E8XA 3DNDA 4RIWB 3U6HA 2PE1A 3ITZA 4I3ZA 4O81A 3LOKA 3ULIA 4XG9A 4QQJA 4E3CA 2FVDA 1PXLA 1PXJA 1X8BA 2XJ2A 5EM6A 4CKRA 2JIUA 4GEOA 5E7RA 4EOLA 1KV2A 3FLWA 3QBNA 5AM7A 4IM2A 4CQEA 3BGZA 3MVJA 4GW8A 4QRCA 4KSQA 2GS7A 5CAPA 2C5VA 5DI1A 5E90A 4DLIA 1G5SA 5AM6A 3FMLA 2ETMA 3EJ1A 3CBLA 3IK3A 4IX6A 4PP7A 5K0KA 1O6KA 3C4ZA 4C3FA 1Y6AA 2YHVA 5CF6A 4ORKA 3TN8A 1SNUA 2BCJA 3LFQA 2OLCA 3COMA 2WTWA 5ITAA 2YCQA 3MB6A 2C5OA 3FMHA 4HGTA 5GJDA 2NRUA 4AGCA 4K6ZA 2QO9A 3ZXZA 4GT5A 3VBQA 4AZFA 4Z7HA 3DK6A 5C26A 5LVNA 5IQGA 1LR4A 5CNNA 4CT1A 4MXYA 4AACA 4O7YA 1OIRA 2W06A 4S30A 4JBPA 4FKGA 2W9FB 3C5IA 4QMWA 4DFBA 3DQXA 4R3RA 4MQ2A 4L45A 3QLGA 3S3IA 2W4KA 4E7WA 2OF2A 1FVTA 2OGVA 2VWYA 2G2FA 4FT5A 2YWVA 4CYIA 2H9VA 3G9NA 5AUYA 3NIZA 1H8FA 4XHKB 2Z7RA 5K5XA 2XH5A 2R3LA 2ONLA 3UNKA 3DBEA 3VF8A 5LMKC 3FLQA 3BQCA 3W18A 3DXPA 1FGKA 4FL2A 4RT7A 3NDMA 2HK5A 4PMSA 5CAUA 2R0IA 4I21A 2XJ0A 5CS6A 4BIEA 4ANBA 2GFSA 3F69A 1XH9A 3F5GA 4FUYA 2YCFA 4UBAA 4J98A 1YXUA 4XP2A 2PZPA 2EUFB 4Y83A 4F6UA 3ORXA 1M2PA 2JGZA 3NUAA 1OL5A 2C3IB 2YAAA 2IZSA 3KMWA 2WO6A 4Z3VA 4GFOA 2BRGA 5C4LA 4ZTNA 4RZVA 4BDKA 4LFIA 4M84A 3EHAA 3GU8A 4AGWA 3IKAA 2G9XA 3BEAA 3HGKA 2W1DA 3IDPA 4L52A 3R7OA 3VULA 5HCZA 3OUKA 4DLJA 3CEKA 3AGMA 4O2ZA 4FODA 4EI4A 5KE0A 4AT5A 3DDQA 3I1AA 4FOBA 4I23A 4M13A 3L8VA 3FMEA 3IOKA 4ZZNA 2CNUA 1TQMA 5L6WL 1XKKA 4KKGA 4DA5A 3C51A 4WIHA 1QPJA 4YZNA 4C0TA 5DG5A 3NCGA 3ORMA 4QP3A 3VW6A 1NY3A 3CS9A 2VN9A 3QD3A 4FKIA 2XIYA 4ITHA 4R77A 2YJRA 3H3CA 3F7WA 1BYGA 4B9DA 3H0YA 4GFMA 2DYLA 4NJ3A 3II5A 4MKCA 4M7IA 3PYYA 3C0IA 3BHYA 4OTHA 4EHEA 4F6WA 3ZTXA 2RGPA 5LOHA 2I7QA 5HE3A 4H05A 4PDPA 1G8SA 5IQHA 3AC1A 3ZUTA 3LIJA 4OTRA 2C47A 1TKIA 5CF5A 1QPEA 5L2TA 3OTVA 4BZDA 5HLWA 2Y4PA 4I0SA 4QD6A 3P79A 4CZUA 3IW7A 4BDIA 5HNIX 4OTIA 4DC2A 4NK9A 1YI3A 2Q0BA 2ZV2A 3R28A 4W4WA 1PXNA 2Q0NA 2QU5A 2ZDUA 4TN6A 2XM8A 2HOGA 5L2QA 3VRZA 1PXOA 4BCKA 5H2UA 5HG5A 5A4EA 3VHEA 1L3RE 3SRVA 3VUKA 3DNEA 3IQ7A 3LE6A 4NT4A 2GNLA 5FD2A 4EHGA 5IH4A 3DJ6A 3BRBA 3GCUA 4FZFB 2WOUA 2XKEA 3T8OA 4I4EA 3EN4A 3ERKA 3DOGA 3H9OA 2WU7A 4RC2A 3RPVA 4QMVA 5AR7A 2LAVA 3C4XA 3WE8A 4WT6A 5C01A 5IEYA 3N4VA 3WZDA 2BFYA 5EM8A 3ZRMA 4FEUA 3EN6A 2XB7A 5CWZA 1PKDA 3QL8A 1M52A 3A8XA 4FTTA 3FZRA 4QMXA 4BKYA 3AOXA 4CFUA 4XLIA 2ZM3A 3UODA 4DEIA 3VUGA 3I79A 4RFMA 3TNWA 2W9ZB 3UNZA 4EUTA 3ZLXA 2UZBA 2WQNA 2Z2WA 5DR2A 3A8WA 3K3IA 3LCTA 1U54A 3TIZA 4AGDA 3MA6A 1XBCA 4U3ZA 3ZO2A 2WD1A 4E5WA 2P4IA 4YJRA 4KKEA 4IWOA 4R5SA 3RNIA 5E9EA 4C59A 3DGKA 2C6LA 4D4YA 3DY7A 1DM2A 4APCA 3L9NA 4RZWA 1IA9A 1BMKA 1WBTA 2ERKA 2GNIA 1KE6A 3FV8A 4BGGA 4TZRA 4EH9A 3RBWA 2JITA 2PMLX 2OJFE 1CTPE 1QMZA 3V8TA 4UWCA 4ZSJA 3C4CA 3DBQA 4G6NA 4AX8A 5EDPA 1SYKA 5L8KA 3MH1A 3RZFA 3KVWA 3QQFA 3OY1A 4FT3A 3SRVB 4UN0C 4YLJA 4A9UA 4AFEA 4E5BA 2ZYBA 3G0FA 5HX8A 4GJ3A 4F1MA 3ZSHA 4IJPA 2WIHA 2G01A 4WA9A 5HIBA 3PP0A 5AJQA 3PVUA 3G5DA 5ANJA 2GU8A 1WZYA 5FRIA 5AX9A 5HICA 3ZDUA 3OCSA 4AZWA 4RPVA 3CQEA 5F95A 3ALOA 5TKDA 4GSBA 3R8MA 3C4WA 1OECA 4YJVA 2OXXA 4BCHA 1ZYDA 4FV4A 3FY0A 4QO9A 3E8NA 3F5UA 5B0XA 4BCPA 2ZMDA 5IG1A 2XKFA 5EW3A 5FM2A 4PRJA 3IECA 2PVRA 3D5UA 3MVHA 1NT2A 4IAKA 4YBKA 4D2RA 5J5SA 4YU2A 4F7NA 4F9CA 3U6IA 2X7GA 3W33A 2PVLA 2F4JA 1OIUA 5AV2A 4CMTA 3TTIA 4G9RA 2GNGA 4O0WA 5BVWA 4CRSA 4UXQA 4XEYA 3BGQA 4PTGA 4BCIA 3DBFA 3UVPA 2XJ1A 3ORKA 2YM4A 3IONA 4J97A 4EBVA 5J7BA 5FEEA 1KSWA 3B2WA 3EFKA 3HUCA 2R3IA 2XM9A 4JDHA 4RC3A 5LMBA 3FSFA 4TW9A 4I0RA 3ZCLA 2O65A 4TT7A 4YTFA 5BPYA 2BVAA 5M4IA 3PLAE 4CFNA 5H3QA 4NTTA 4JBOA 2AYPA 2VGPA 5E1EA 5DN3A 5AUZA 4DTBA 3DAKA 2YJSA 3Q4CA 1I09A 4D2VA 1Y8GA 3HL7A 4S34A 4B7TA 3F61A 4U97A 5IF1A 3RHKA 4F9BA 3R00A 3DBCA 4FTKA 2LGCA 2WOTA 2O0UA 5EYMA 3OT3A 4ANOA 3G15A 5DGZA 5I3RA 2A27A 3F2RA 3FQEA 3UIXA 2OH4A 2PYWA 3HMIA 1BLXA 4FOCA 4I5HA 1YXVA 4AFJA 2BAQA 3EYHA 5HKMA 1REJA 1W98A 4K11A 4S2ZA 5D1JA 2IJMA 3JS2A 4FK3A 4IC7A 5JZNA 3ZRLA 4GVAA 3UYTA 3ZC6A 1H1SA 2JAVA 2PY3A 1OIQA 3PZEA 4JXFA 1UNGA 2AC5A 3L1SA 2FA2A 4IX4A 2VWBA 2NRYA 3QRJA 1ZAOA 3JY9A 2E9PA 3ORZA 2QVSE 4ZOGA 2C5NA 4LRKA 2HWPA 3TWJA 4FICA 4BCOA 2GQSA 2JDRA 4WNOA 3EL8A 2B7AA 2XEZA 3GB2A 1UU9A 2C6MA 1ZZLA 1P5EA 2J0KA 3RPOA 4TWPA 2WEIA 1IR3A 3U9NA 1Q97A 3MDYA 5H8BA 1WBNA 3KCKA 1BKXA 3HMOA 2PL0A 4ALVA 5DA3A 3GOKA 4E4NA 1BI7A 1YWVA 2XRWA 2YM7A 3MS9A 3QYWA 5CT0A 4DBNA 4FIFA 3F9NA 4GKHA 3VAPA 3TZ7A 5BYLA 3QXOA 1PMVA 2X8DA 2XIZA 5HIEA 3QU0A 3F5XA 3QKMA 3HP2A 1OKVA 1UNLA 2Y4IC 3BHVA 4RRVA 4CEGA 5HU3A 5LWMA 4TYIA 5EM7A 4HZRA 4BKZA 3U4UA 2IG7A 2WTKB 4G1WA 4ZTLA 3QC9A 4MXAA 2GS6A 3I0QA 3ORTA 2W4JA 4QNYA 3MBLA 2ITTA 3MW1A 4K8AA 5EOLA 4EHVA 3FC2A 4ASDA 5EOBA 1Q8WA 1H07A 3BHHA 1YRPA 3BYUA 4RJ3A 3HEGA 4FTQA 4XS2A 5FXQA 4AWIA 4QP7A 1YI4A 4NM5A 4AE6A 4R7HA 3GC7A 4X3JA 2OJJA 3FWQA 3F66A 4ACDA 5LQFA 3UO5A 3VIDA 3CTQA 3W2QA 4AZVA 4C3RA 2QKWB 3A4PA 3D5VA 3UE4A 4OTQA 4A9SA 4G3CA 4WBOA 5EKOA 2B54A 3FY2A 3DAJA 5C8NA 2VTQA 2BZIB 3VF9A 4ZTRA 2GNFA 4J71A 5DIAA 1H24A 3D4QA 5A4CA 4R7IA 4GCJA 4M68A 4C62A 4DTKA 4QYHA 4UMUA 5E8YA 5E8UA 5KMMA 3C4EA 3EZVA 3H30A 3F3ZA 3RPYA 1SM2A 3QTZA 4ENYA 4O84A 3I0OA 3B8QA 3R71A 4JIKA 4JG8A 4YR8A 3BE9A 3D94A 2BZHB 2JDOA 5J9YA 4I92A 4EUUA 2CNVA 1KWPA 4OTFA 1OPKA 2VO6A 4ZZOA 3E3PA 4YJUA 4GUEA 5FUTA 2GS2A 2R3JA 2VNYA 1JBPE 2R3RA 3OD6X 2QU6A 4H39A 3NW6A 2WQBA 1ZMUA 1QPDA 3FL5A 5L2WA 4FTAA 4IZAA 1WCCA 2YN8A 4YURA 3I81A 3A60A 4LQMA 3D2KA 3R21A 5D9HA 4M3QA 3TKIA 3C0GA 4AA0A 2HW6A 3EQIA 4D2TA 3NRMA 4EK4A 3NAXA 5JZJA 3H4JA 2R2PA 2BALA 1WAKA 4AN9A 3EZRA 5I9YA 4L6QA 3D15A 1YDTE 2ACXA 3SW4A 1Q5KA 4BWXA 2X9EA 3PXQA 5IQCA 5FLFA 4IWQA 3R30A 2GNJA 5TOZA 1DS5A 3DKOA 4EONA 3GUBA 4BDAA 1VYZA 4EH5A 5H8GA 4UYAA 1V1KA 4TYHA 3Q4TA 4NW5A 3OT8A 4ZTMA 3BV2A 1B38A 3BBWA 4EH4A 4H1JA 3N51A 3LFCA 5FBNC 3DLZA 4UALA 5CSHA 4Q5EA 4KIPA 4UMPA 2YDJA 1ZMVA 3DK3A 3UMWA 4WNPA 5DH3A 4G3FA 3V5QA 4CFVA 5IMEA 2X6EA 4YTHA 4IHPA 5EQEA 2WTJA 4Z55A 2J6MA 4L42A 4KA3A 4WHZA 3COKA 1R1WA 2C6OA 2FH9A 2QHNA 3GU5A 3VHKA 2RFEA 3R04A 5F9EA 1E1VA 3R7IA 4U3YA 4EOPA 4WUAA 4FGBA 5DT4A 3W32A 3QQJA 3BYVA 3UPXA 3AMAA 2VX1A 3F7ZA 3LFNA 2ZAZA 4FC0A 3OFMA 2PZIA 4I6HA 2R3GA 3O8TA 4FTRA 5KO1A 1XHAA 4II5A 3VUTA 4CYJA 4AU8A 2W7XA 2CPKE 4F63A 5FP5A 4JRVA 3VQHA 3WYXA 5FM3A 1YOMA 5IPJA 1OMWA 3AC4A 3L9LA 3OUNB 3WI6A 4FEXA 3Q5IA 2J5FA 5DEWA 1WFCA 4EOJA 1MRUA 4GV1A 3OMVA 5BX0A 3BLQA 3NW7A 4FSMA 4G31A 3P08A 3LM0A 1WVYA 3AC2A 4TYHB 4FVQA 4H3QA 3Q04A 2P55A 5M08A 2EXCX 3ZZWA 5LCKA 1GIJA 2B9IA 3HX4A
chains in the Genus database with same CATH superfamily
3SKCA 4RWLA 3COHA 4X2NA 5M55A 3PJCA 3PVBA 2C1AA 3UIBA 3ATSA 2IO6A 4PDOA 4AAAA 4MBJA 4O0RA 5KMLA 2ZB1A 3RM6A 4FV2A 2QHMA 4CFFA 2VTJA 4XG6A 3OWKA 2O64A 2AC3A 2WTCA 5K9IA 4XOZA 3WOWA 3VVHA 2DS1A 4EOSA 4JRNA 3ZSIA 4L7FA 5DMZA 5IDNA 2NP8A 1BUHA 2PK9A 3NWWA 4M0YA 5IH5A 1WBWA 4C33A 4NIFB 3UQCA 3SQQA 4FT9A 3QCSA 2QKRA 3S00A 4A4XA 3WZJA 3D7ZA 5IDPA 4PL5A 1JOWB 4FSTA 4CV9A 4E6QA 2QCSA 3AT2A 3CY3A 3NYXA 2B9JA 3IGGA 4JT3A 2BAKA 1T46A 4EWHA 3BYOA 1FINA 5CI7A 4E73A 3KF4A 3RAKA 4QYGA 2CGUA 3ZUVA 3E93A 3I5ZA 5HORA 3OCTA 4P90A 5E8ZA 1V0PA 4RQKA 2ZOQA 3PDTA 2HY0A 2CHLA 1KE7A 4H58A 5BVEA 2CMWA 4CV8A 4F4PA 3REPA 4MNEA 3ZO1A 5DYJA 3PUPA 4D4SA 3O50A 4CZTA 1PYEA 2J9MA 4O2PA 3ENHA 3ZZEA 3HMPA 1U59A 1SVHA 2YDKA 1GIIA 4HCUA 4ASEA 5IUGA 4ZLZA 1LP4A 3HAMA 4PL4A 1XR1A 4RIYA 5ETIA 4PMPA 2BROA 2VX3A 4FR4A 3UNJA 5IEXA 3E3BX 5AP4A 3TJCA 5TE0A 1FPUA 2X7OA 2UW4A 3PSBA 1TVOA 3KXNA 3QAME 3HECA 4XNEA 1BI8A 5KBQA 4DHJA 1IEPA 3LQ5A 3LXKA 3BYMA 5M44A 2UW0A 2PULA 2QG7A 5DWRA 5EI2A 3R8UA 3GU7A 4EEVA 3QUDA 2IN6A 2PMIA 1IASA 3NR9A 4L3JA 4DEHA 3CGFA 4QTDA 5CEIA 4C02A 5HCYA 5A54A 5AUTA 5C1QB 2HY81 3OW3A 5F94A 5A4TA 5J5TA 1DAWA 2WMWA 4CFXA 3PIYA 4LGHA 2WTKC 2R5TA 3G2FA 4FKQA 4FSUA 3LM5A 5JFWA 4OBOA 3WF7A 4B4LA 1U4DA 1YXSA 2E2BA 2VTOA 2VWUA 4FA2A 4USFA 4PQNA 1GZNA 1YVJA 3IGOA 2B0QA 5IQEA 3MH0A 2ITPA 3RI1A 2OIDA 2PVJA 4FT7A 2O2UA 3W8LA 3FI4A 2V0DA 4JIAA 2IZTA 4YMJA 3QLFA 4MNEB 2IZUA 1KE5A 5A6NA 2HWOA 1JNKA 3TG1A 3QX2A 2WGJA 3Q2MA 2BZKB 3RJCA 3A7IA 4NFNA 5JK3A 1OBDA 2QOQA 2X0GA 4FGRA 1CSNA 1OVEA 5TF9A 5AADA 4PPBA 4RIYB 1Z5MA 3EMGA 1PXMA 5CF4A 1ZRZA 4O4DA 1H27A 4D2SA 4TL0A 4NJDA 3GXLA 3V5WA 3CLYA 4V04A 4XUFA 4TYJA 5GZ9A 4TRLA 1U5QA 3ROYA 4ANQA 3H9RA 4BF2A 4IFCA 4EOQA 4IJ9A 3CIKA 4DG3E 2JLDA 5HTCA 2YZAA 2W05A 1RW8A 4UB7A 4QMMA 2R3HA 4U41A 4WD5A 4EWQA 3CTJA 2X4FA 3BU3A 3KXXA 4FZDB 3RK9A 3RKBA 3SHEA 2JBPA 4H1MA 5D41A 3ZYAA 4USDA 4HVDA 4X7QA 5CALA 2QO2A 3ET7A 4FTLA 4QTEA 5JQ8A 3KVXA 3BBTB 2O8YA 4RWKA 2YWPA 4NM7A 4BTKA 4C8BA 4EL9A 1UWJA 4F1OA 3DDPA 4FNYA 3JR1A 2Z60A 4JNWA 5M56A 1U5RA 3EN7A 3LQ8A 4PV0A 4HVGA 1E9HA 5BVFA 5AFVA 4AZEA 4YHJA 3DKGA 2VTSA 4OTPA 4U9AA 2OJIA 3Q32A 4A4LA 2XK4A 4RJ5A 1J7LA 4FZ6A 4LYNA 3NNWA 3MJ1A 4X0MA 2C5XA 2IVSA 2J7TA 2OKRA 3GC9A 3MY5A 2XAMA 3PTGA 2I40A 2G2HA 3M1SA 5E8VA 1WBOA 2QOLA 3BLAA 3U87A 4HVHA 4AP7A 1UU3A 1YDSE 2W1EA 3DLSA 4IAFA 5CLPA 4L7SA 2R3FA 3NAYA 1ZOEA 4CXAA 1R0PA 3FPQA 5HLPA 4RJ4A 5AUXA 2C0IA 3RP9A 5K0XA 5L8JA 2J0LA 4I93A 4MWIA 3THBA 2CNQA 3W0RA 4I6BA 3AGLA 4QQCA 5A46A 4ZP5A 3QCQA 3OZ6A 2I1MA 4LRJA 3TZMA 2NO3A 4AT3A 5L8LA 2QR8A 5CANA 3T3VA 3UVRA 5HVKA 3DFCB 2XCKA 3UC3A 4F9WA 1WVXA 3E64A 4WOVA 3QTWA 3R0TA 5C03A 2C3LA 4D28A 5CSXA 3PA5A 2C6TA 4ANNA 2BHHA 3GC0A 2O63A 2X2LA 4IM3A 2VTNA 4I6LA 3SG8A 5ANDA 4DEGA 3E87A 3O8PA 4Q9SA 1GJOA 3I6UA 4W4VA 1A06A 1MRVA 2YACA 4XRLA 2HZ0A 2JFMA 4FI1A 5AEPA 2W17A 3RPRA 5KKRB 3NCZA 3DKFA 2ITXA 2QONA 4PDYA 3PIXA 1YHWA 3UZTA 4J96A 1FOTA 5BVKA 3WILA 3O2MA 4FSRA 3QQHA 3VBXA 3ZFMA 4CSVA 5HBEA 4EZ3A 3UG1A 4C3PA 3BWFA 1FQ1B 2UVYA 4FF8A 2JBOA 5G1XA 5HCXA 5FXRA 1A9UA 2BRNA 4PTEA 4TWNA 2RL5A 1M2QA 4FTIA 1OKZA 3P7CA 4IVBA 4RJ6A 2WQEA 5AMNA 3NS9A 3ZFXA 3QXPA 4EC8A 4HW7A 4DE4A 5IQDA 3KRLA 5E8TA 5AR4A 2YERA 3PWYA 4DG2E 2FGIA 3TUDA 3W0OA 4FVPA 4PF4A 3GENA 2B55A 2VTAA 4RMZA 4BBEA 5H9BA 4BBFA 5CU3A 3MFRA 5GIPE 4IAYA 3OXTA 4DDGA 4ZMEA 4IZ7A 3Q9YA 4UMTA 4HJOA 4K1BA 3MFTA 4ZS0A 3D5WA 2XNNA 3PXFA 3DFAA 1JKLA 4V05A 2C30A 1YOJA 1WVWA 1HCKA 4Q9ZA 3A61A 4XP0A 3SXRA 5J9ZA 2UW6A 3V5PA 3SW7A 3QC4A 2XBJA 1I44A 1H0WA 3VJOA 2YITA 5EQPA 2WQOA 4CTCA 3CJFA 3TV7A 2A4LA 2CJMA 5LVLA 3RCJA 4X6RA 2JFLA 4A06A 3O23A 2OIBA 2RFNA 4ENXA 1WBSA 2UVXA 3GEQA 4CD0A 2X4ZA 3NNUA 5HO7A 2EU9A 3PG3A 4BDFA 3GU6A 5DR9A 1OL7A 4JDIA 5FQDC 4KS7A 3MIAA 4LV7A 4O83A 3BKBA 2ITYA 3NLBA 4C4EA 4F65A 3GFEA 3P5JC 3ZO3A 3SG9A 3OXZA 4YZ9A 4EOOA 4BICA 3VS7A 3AKLA 2CCHA 1XH4A 2EWAA 2UW7A 3ZO4A 5CAQA 4M0ZA 1KE9A 4UMQA 3TZ8A 2XKDA 3P1AA 3TKUA 4ACCA 4FTUA 1MUOA 3EQRA 2YCSA 2ZB0A 4HPTE 4QTCA 4DFLA 4W4YA 4QMQA 3RALA 4C2VA 2VU3A 3LKMA 3U8WA 3G33A 5HEZA 3ACJA 3MVLA 4IXPA 3SC1A 5IA5A 5KUPA 4FMQA 3HV3A 1Q3DA 4FSQA 3PUFC 3BLHA 3TT0A 4D9UA 2QNJA 4EKLA 1ZY5A 3LFSA 2R3OA 2A19B 1G8KA 5JFVA 4DYMA 2XA4A 4YNEA 5JRSA 3HRFA 4J8MA 3OROA 1FMKA 4ZSLA 2CKQA 3F88A 2HAKA 2ITVA 3RCDA 4JQEA 4XG3A 3P86A 2XNEA 1LEZA 4L67A 3VQUA 4I94A 4FV6A 4QP6A 3FMMA 3OHTA 3EKKA 4L00A 2WTVA 5AUWA 1ATPE 1T45A 2AUHA 2VTPA 3PJ3A 3QTIA 4O0YA 4Y73A 2OFVA 3QTSA 3RTPA 3Q9WA 3Q6UA 5JKGA 2BPMA 3VUMA 2OIQA 4EBWA 4GT3A 4IM0A 4RBLA 4ZAUA 4HOKA 3R1SA 4OW8A 2J0MB 5J79A 4C4GA 2QURA 3R9DA 3RWQA 4DCEA 4BDDA 3VBYA 4BWKA 2RFDA 2OU7A 4K33A 3HMNA 4FG8A 4N6ZA 3PXKA 2YIYA 5JQ5A 4BDGA 4XP3A 2WU6A 5M4UA 3NYOA 3DA6A 4F08A 4FYNA 2BRBA 4F0GA 3QWJA 4ZLYA 3TUCA 4BGQA 4JX7A 4L68A 5JSMA 3PPKA 5BVOA 4KRDA 1VJYA 3R9HA 4ZTSA 1YHSA 3BCEA 4IB5A 2GTNA 3FI2A 3TNPC 3EQBA 4U8ZA 1PW2A 1VR2A 4AZSA 5BQ0A 4O7VA 2YLEA 3GBZA 3IPHA 3PY0A 1SVGA 1OGYA 2C0OA 3LFBA 5M51A 3LJ2A 4WRGA 5DFPA 5E1SA 5JGBA 1XWSA 3W2CA 2CGXA 3TYKA 2BTRA 3I7BA 5FBOA 2F57A 2YISA 1CM8A 4YJTA 4DH3A 1Y6BA 3QUPA 3C9WA 4Z9LA 4CTBA 2BHEA 2IPXA 1Q8UA 2OBJA 3U9CA 3NVMB 4P4CA 5TO8A 4FIEA 4WKQA 3MY1A 4BZNA 3HNGA 4IAZA 2J90A 1U54B 2CGVA 4L3LA 3TL8A 3EH9A 3MPTA 3W1FA 3TUBA 2PVKA 3BYSA 2HW7A 5C9CA 3SD0A 4Y85A 4GVJA 1Q8TA 5FG8A 4X3FA 5CENA 5IH6A 3R8ZA 2WQMA 3UIMA 5AV4A 5GINE 2HXQA 4DBXA 4MX9A 1XH6A 3EQDA 4TWOA 3CPBA 3W2SA 4ANMA 4D5KA 4WSYA 4DGMA 5HD7A 1H25A 3OWLA 4O86A 5G6VA 4LMNA 1F3MC 2B1PA 5HVJA 4KSPA 2R7IA 5L6PA 3ACKA 4LMUA 4J99A 4WBBB 2REIA 1AD5A 5HE0A 4E20A 5HBJA 4UX9A 4FKRA 3COIA 2ZFYA 3ZHPC 2QO7A 4F0IA 3LMIA 5AP6A 1YI6A 3QF9A 4C36A 5JH6A 3CQUA 1RJBA 3RNYA 2CKOA 4BI2A 1XBAA 2XIKA 1ZYSA 2XP2A 3K5VA 3W2RA 4KIQA 1CKIA 4I6FA 5CX9A 4C4FA 3K2LA 4DHFA 3CKXA 3PVGA 5A4LA 2CKEA 4U43A 2VTIA 1YOLA 2VZ6A 3DB6A 4KKHA 5L6OA 3TTJA 4EOIA 4IZ5A 4G6LA 3BE2A 5EYCA 3QA8A 4GYGA 4HYUA 2X1NA 3WF5A 3VS1A 1NVSA 4DN5A 2IWIA 4P5ZA 4CQGA 5EDQA 3KGAA 4JBQA 4AZTA 5AIRA 5D7AA 3W2PA 3IW8A 2C3KA 3WE4A 5KHXA 3Q4ZA 4S33A 1NXKA 3UP2A 1OM1A 2Y0AA 2Z8CA 3PSDA 3MJ2A 5CEPA 4RWJA 3FJQE 2VO0A 3FLYA 3LZBA 3Q3BA 3UBDA 1WMKA 4X3FB 1H1WA 5C27A 4A4OA 4DAWA 2YIQA 4FKJA 2KTYA 3AQVA 3QQUA 1P4OA 4NW6A 2PSQA 4FKTA 4IB3A 2PZYA 4NKAA 3HVCA 5BMMA 4QMOA 3MTLA 3WF8A 3RWPA 2OK1A 1RE8A 2JAMA 3L8XA 3QKKA 3N4UA 3KCFA 3ORNA 4FV7A 4G34A 2W1FA 4V0GA 3ZH8A 3EQPA 4DH5A 2V62A 4JQ7A 4OBQA 4G6OA 4PTCA 5J1VA 4ZMFA 5AUVA 3NSZA 4P7EA 3CXWA 2PPQA 3W0QA 1J3HA 3PZHA 4CG9A 4G3DA 5IUIA 3F82A 4ZTQA 2C6DA 4BCMA 4GMYA 4O0TA 4QMYA 5AR3A 4U81A 4X2KA 3ZM9A 2ITZA 3LHJA 2R4BA 4WG3A 2BIYA 3R8VA 4MBIA 2QLUA 4QNAA 5EQYA 3DZOA 3KK9A 5K3YA 3VUDA 4QP4A 4FT0A 4UWYA 2WTDA 4YJSA 2W5AA 4F70A 2Q83A 1P4FA 3HYHA 2JDTA 5J9LA 3R2BA 4WO5A 1YW2A 2ITOA 2QOKA 4ZTHA 4RSSA 4X21A 4S31A 3VS6A 4M14A 1OBGA 2VV9A 2UVZA 4JDKA 3V6SA 4C61A 1JSTA 3MTFA 3OTUA 4AOTA 4C34A 2C6EA 4O27B 2QOIA 3GCVA 2O5KA 2XK7A 5M57A 5CT7A 5E92A 2ZV7A 5IQFA 2C68A 5K4JA 3I7CA 1J7IA 5B2LA 2RG6A 3RINA 4O0SA 1ZOGA 1UKIA 3RVGA 4MXOA 1ZMWA 4Y5QA 2XK8A 2ONLC 5HIDA 4DGGA 4V0GB 4DHIB 3PY3A 5GHVA 2JKOA 4FSZA 2ERZE 4F9YA 4AA4A 1OUYA 4XV1A 3KMUA 3BEGA 4QMUA 3PRFA 3FAAA 4B6LA 4L43A 4BYIA 3FBVA 3TEIA 3TXOA 2H6DA 3NUSA 4D55A 4DFNA 4FV9A 5J7HA 2IVVA 2VWVA 2J51A 1H26A 4ID7A 4RFYA 4EQMA 2PUPA 5AP7A 1J7UA 2VTRA 2XZSA 4AUAA 2JD5A 3MFUA 1O6LA 3G6GA 4MXXA 5CVGA 5GNKA 4JAJA 3W8QA 3QWKA 1E1XA 3EOCA 4BZOA 2J5EA 1PMUA 2CGWA 5FGKA 4CZYB 3MPAA 4O7SA 3B2TA 4FYOA 3BL9A 5HLNA 4YJPA 2XIXA 4TPTA 5F20A 3LFDA 1IAJA 3K3JA 4BHZA 3TACA 3QD2B 4TY1A 3E8EA 5JEBA 4FIHA 2PVNA 3FZ1A 3R1QA 2W99B 2EB2A 1Q4LA 5AP0A 1H1QA 2O3PA 2BIKB 2W1IA 2Z7QA 4GK3A 3OCBA 3JVRA 4L9IA 4MBLA 4MF1A 4PX6A 5C8MA 4BYJA 4D1SA 4CKJA 1JAMA 3FKOA 2OO8X 4FBXA 2B53A 3CY2A 4LUDA 5ANKA 4UMRA 3R8LA 4GS6A 4C2WA 5E8WA 3BQRA 4WG4A 2UV2A 4NSTA 4U7ZA 4ARKA 4ZK5A 4HCVA 4O21A 4CGAA 2UZLA 3RM7A 3AC3A 4ZLOA 5EHYA 4IWPA 4DFYA 3TV4A 1W2DA 2WHBA 2XK3A 2P3GX 3DPKA 4DEDA 4WNKA 3PJ8A 4BB4A 3HAVA 5HHWA 3WF9A 5M06A 4AG8A 3S2PA 1KV1A 2BKZA 2OF4A 2R9SA 3NEWA 4E6AA 3NUNA 3G51A 5L2IA 3UDZA 1GOLA 4FZ7A 4KIKA 4G3EA 2X81A 1OPJA 3HKOA 3A62A 5FWKK 3IW6A 5LMKA 1XMMA 3G6HA 4EH7A 3LMGA 3U55A 3FHIA 4L44A 3R9NA 2PVMA 4AQKA 2PVYA 4JOAA 4DT9A 2FSTX 3WARA 2XIRA 4LV8A 4L8MA 3R1NA 1PXKA 2G2IA 2QR7A 4FKWA 3V8WA 5HZNA 4RC4A 3CE3A 2ITWA 4IE9A 2BFXA 1JVPP 3ALNA 4BI0A 3MWUA 3POOA 4BVUA 1H1RA 3ANQA 5CY3A 3VO3A 5I4NA 3UQFA 4KIOA 3ZLYA 2BZJA 2WMUA 3LLTA 5HO8A 4F99A 2J0IA 3U6JA 4YZDA 3FMDA 2BAJA 4M15A 4EYMA 3BU5A 1KOBA 2JKKA 2ZV9A 3BGPA 4HPUE 2YFXA 3FLNC 2RF9A 4O7ZA 5ETFA 3W2OA 2FSLX 3VW8A 4KINA 4X6QC 4EK6A 4Q2AA 4I6QA 1K3AA 5I9WA 1XQZA 3RAIA 2A0CX 4Y95A 3KXZA 2WNTA 4U5JA 1OL1A 5LCJA 3MIYA 3ZM4A 3KRJA 2PWLA 4AS0A 4RX8A 2OSCA 2WMBA 5J95A 3FI3A 4E26A 5KMOA 3LVPA 2YM6A 4PPAA 4I22A 4QT1A 5DEYA 2J50A 4IADA 2XS0A 4D2WA 5IQAA 4KIKB 3PY1A 2X7FA 3FMNA 3O96A 3GGFA 4YNOA 3IDBA 5HTBA 4QDVA 1IAHA 3QRIA 3TIYA 5ETCA 4TYGA 1IA8A 3VN9A 4E4XA 3HUBA 4MXZA 3HV6A 4F9AA 2Y6MA 3EQCA 4UXLA 5I9VA 3QYZA 4C4IA 1P14A 3SDJA 1WBVA 3FZPA 3KXHA 4G17A 4XH6A 3OY3A 2GPHA 5ACBC 3H0ZA 3QRKA 4EQUA 4BWPA 4FKLA 3FE3A 3E8CA 3GQIA 2XALA 3JVSA 1UA2A 4MH7A 4BBMA 4YUQA 1YWRA 1ZLTA 3DT1A 4U6RA 1UNHA 4HVSA 4XG7A 5DPVA 5L4QA 2BDWA 3AXWA 4AW0A 3MVMA 3T9TA 2R0UA 1OGUA 5JT2A 4Y5HA 4D4RA 3VS0A 5AWMA 3DU8A 4ACHA 4O7NA 1K2PA 2ZJWA 5CAVA 3NUYA 2PE2A 2VAGA 3EQGA 3QZFA 4QPMA 3ODZX 3DK7A 4XOYA 3Q60A 4H3BA 4JJRA 4MD9E 2J0JA 3OWPA 2XARA 3TCPA 2EVAA 4OT5A 5IQBA 3RGFA 2AQXA 4F7SA 4CRLA 4WUNA 4O6EA 4AQCA 4BTJA 1ZXEA 3OEFX 4O4BB 3R01A 3PJ2A 3R7YA 3KC3A 2ITNA 3QD0A 4FTNA 4UY9A 4Y72A 3U4WA 4C57A 2XRUA 3ORIA 3QD4A 4AN3A 1NVQA 2WMXA 3R1YA 4BI1A 4MVFA 3KF7A 5CQUA 2ESMA 4FSYA 1BL6A 1REKA 3FMJA 2ZDTA 1GNGA 3OC1A 2QI8A 4FEWA 4BR3A 4KD1A 3ULZA 3LCOA 5IQIA 2W4OA 2OFUA 3RZBA 3TNHA 1PMEA 2WFYA 4N4SA 1ZYLA 3FHRA 3FKLA 3H9FA 3AMYA 4XV3A 4YJOA 5HNBA 3ZMMA 1UWHA 2C1BA 3R9OA 2HXLA 3PVWA 2OWBA 4FSWA 4YLKA 2A2AA 5CI6A 2XVDA 2Y8OA 4XV9A 1NA7A 2R64A 3POZA 1J91A 4FL3A 5EDRA 2YM3A 3UP7A 4KAOA 1R78A 4C4JA 2A98A 3LCDA 3O7LB 3QCXA 4RVMA 4G3GA 3SX9A 3A4OX 4YJNA 4LUEA 2GQGA 4U79A 3O0GA 2SRCA 3FYJX 4IAIA 4ASXA 4FK6A 3VNTA 3IS5A 4FKSA 4G5PA 3LCSA 2CN5A 2VWIA 4G5JA 2PE0A 4YTCA 5LXMA 4W4XA 1WBPA 3B8RA 4FNWA 3DZQA 3F3VA 5FTQA 4IFGA 3DJ7A 1XMLA 2VUWA 3Q52A 4U80A 3KMMA 3I5NA 5KNJA 3FKNA 2X8EA 1HOWA 2C0TA 4E6CA 5HGIA 1Q99A 3AG9A 3Q53A 3BV3A 3R7UA 3HLLA 3CSVA 4EH8A 3S95A 1ERKA 1UKHA 4K2RA 5AAFA 4ANLA 4C7TA 3QRTA 4D1XA 3MGYA 4TKSA 3FUPA 3AD4A 3EN9A 3F3UA 3NNXA 2GQRA 5LVMA 3UDBA 2XNGA 2I0HA 3PWDA 4PPCA 4DFXE 2DUVA 5I3OA 5BYYA 4E5AX 3BHTA 2QOCA 5HESA 4ERWA 2WMTA 3DS6A 3K54A 3FXXA 3AD6A 4K9YA 5E8SA 3ODYX 4N6YA 4MCVA 2IW6A 2IZRA 5IUHA 2JDSA 4RIWA 5D10A 1XJDA 4OTDA 1PY5A 5DR6A 4D9TA 4BY9E 1OB3A 2OG8A 3R22A 4J1RA 3P4KA 4NM0A 4AA5A 4F78A 4JDJA 2W96B 3QQLA 4OGRA 5CU4A 3UOLA 4H36A 4BKJA 3PA3A 3VC4A 4O91A 4O6LA 5M4CA 2OICA 3IG7A 4IH8A 2UZTA 2RKUA 3SXFA 3TNQB 3OXIA 4F7LA 2YIRA 4FKUA 1QCFA 3HRBA 2BRHA 4IX5A 2UW8A 3I60A 2I0YA 4Y46A 2H8HA 3KN5A 4O96A 1ND4A 2IVUA 2OH0E 5DE2A 1MP8A 2P2IA 2OZOA 4LGGA 2ITUA 4F64A 3S0OA 4DFUA 1Y91A 2GNHA 1W2FA 4EK5A 5A14A 4IB0A 4DEAA 3G0EA 3Q9XA 3ENMA 3BHUA 5K4IA 4PMMA 4RVTA 3FLZA 2WTIA 2YM5A 4GL9A 4DGOA 4J7BA 2X2KA 2C4GA 3KKVA 4AOIA 3ZLWA 3FQSA 4BCNA 2UW3A 4ZXTA 3MH3A 1JKTA 1OPLA 2P33A 5HTIA 1MRYA 3TDWA 3ZEPA 2UUEA 3MB7A 1H0VA 3V6RA 4A9TA 4BHNA 1LEWA 4PNIA 4QMPA 4UYNA 2BUJA 2R3QA 4I4FA 1GZOA 3P5KA 3GCSA 4I24A 3CD3A 2B9FA 2YDIA 3OWJA 2VO7A 4GH2A 3ELJA 3SV0A 2VWWA 4GT4A 4CG8A 1SVEA 1HCLA 1L8TA 4F1TA 2IVTA 3D0EA 4O0XA 5CVFA 3RAHA 3KXMA 2HIWA 2BRMA 3GI3A 1J1BA 4U44A 3V3VA 1ZY4A 4EJNA 1LUFA 2XKCA 2Z7SA 4NUSA 4QQ5A 1CDKA 3CGOA 4TWCA 2A1AB 4BDBA 5J87A 1BX6A 2RFSA 3JPVA 2XK6A 4GRBA 4ZJJA 3ZDIA 2VO3A 3NUXA 4FKVA 3GVUA 2JKMA 4C38A 4OAUC 3F2NA 3KY2A 5CSWA 4MYGA 3GOPA 2F9GA 4KBAA 5LVOA 4E4LA 3LW0A 1F0QA 4XBRA 3FQHA 1H1PA 4L01A 4D0WA 4MD8E 5I9UA 4ALWA 3CTHA 1EH4A 3M11A 2C3JA 4U45A 5B7VA 4AE9A 3EFWA 3MSSA 4D4VA 1ZZ2A 4MD7E 1RDQE 3LMHA 3E5AA 4FNXA 3PG1A 4IVDA 3F3WA 1ZYJA 4O0UA 3NYNA 4ALUA 4DGNA 3EKNA 3O71A 4O82A 2XNOA 3O7LD 4FIIA 1GY3A 4BCJA 3FZSA 2XF0A 5EG3A 4LDTA 4ZSEA 4FZAB 3C1XA 4EZ7A 4EJ7A 2P2HA 5DOSA 4MHAA 1FBNA 5EK7A 5A9UA 2WMAA 3D83A 2YABA 5DBXA 4BDJA 5JGAA 2CLXA 4EH2A 2C69A 4LM5A 3AT3A 3NMUF 2FYSA 2WMRA 3IW5A 3KFAA 4LRMA 4YC8A 3F3TA 4XG8A 4YC6A 1R3CA 3PXRA 1ZOHA 1BL7A 4E4MA 4R78A 4DEBA 4X2JA 3MYGA 4C4HA 4YBJA 2CN8A 2QD9A 3MA3A 1CMKE 4A7CA 3PP1A 1MQBA 2OJ9A 4WRSA 4PDSA 1W82A 4RFZA 4HGSA 4IVCA 4W9XA 4B8LA 3FXZA 4EHZA 2OXYA 4BC6A 2PTKA 4B0GA 5AAEA 1M17A 5AR5A 4DFZE 4RLKA 4AXEA 4QMTA 1M2RA 4ZIMA 4NCTA 3DXNA 3PLSA 3LQ3A 4FG7A 2ZM4A 4M12A 4F6SA 4HVIA 5ANGA 3MI9A 2H34A 4BCFA 3E88A 5T3QA 2Y4IB 3UTOA 5CAOA 2VNWA 4IX3A 2WZJA 4UV0A 5JFSA 3R63A 2X8IA 3OP5A 3EFLA 1CKJA 1H28A 3O17A 3NIEA 3FEGA 2V7OA 2HELA 5CNOA 5CU2A 4HCTA 3VS4A 2ETRA 3RMFA 4QYYA 3GP0A 4IEBA 3TKHA 2PZRA 2DWBA 3UPZA 3W55A 2W1ZA 2OJGA 4QP1A 5D11A 2JKQA 3E63A 2F2UA 2W5HA 4OUCA 5C4KA 5BUEA 5AX3A 1UU7A 3UMXA 3UZPA 4FL1A 3LFEA 5T6KA 5KHWA 5IA0A 4A9RA 2WKMA 2KULA 3HV7A 1Q41A 4E6DA 4JQ8A 2VX0A 4ZJIA 3KN6A 2GSFA 3WIKA 3HP5A 2RG5A 2F7XE 2VWZA 2XYUA 4CFMA 4RA4A 1SZMA 1JSVA 3EIDA 3KRRA 4YO6A 4YPDA 3L8PA 5HG7A 2C6KA 5D12A 3PE2A 5BYZA 2V5QA 4RJ8A 4JL9A 4GKIA 4JBVA 4O1OA 4C37A 4MEDA 5CXZA 4X2GA 4YZMA 4TTHB 1W0XC 1W83A 2OXDA 2UW9A 4XCUA 4CLIA 2BDFA 5GZ8A 3QALE 5DLSA 1B6CB 1VZOA 3W0PA 1O6YA 3GC8A 5DVRA 4FRFA 5HX6A 4EQCA 3RK5A 4FX3A 4PY1A 4C58A 2ITQA 4HYIA 4HGLA 4IVAA 5I9XA 4O0VA 4R3CA 2R3PA 2R3NA 3KB7A 4BCQA 5A6OA 3EN5A 2ZM1A 4O7LA 1G3NA 1H01A 3Q9ZA 1QL6A 2PVHA 4IW0A 3A7HA 4R1VA 5CSVA 4YHFA 5B2KA 5BUIA 1VEBA 3EWHA 5DRBA 5DRDA 4L53A 3M2WA 3UOKA 4XX9A 3CPCA 3DB8A 2VTMA 2CLQA 2QOHA 3VRYA 4BIBA 2YAKA 4GFGA 3HV5A 4CFWA 5EW9A