4QYYA

Discovery of novel, dual mechanism erk inhibitors by affinity selection screening of an inactive kinase state
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
337
Chain Sequence
RGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKLDDLPKEKLKELIFEETARFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Discovery of Novel, Dual Mechanism ERK Inhibitors by Affinity Selection Screening of an Inactive Kinase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 108
structure length 337
sequence length 341
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2014-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qyyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qyyA01
4UN0C 5BYLA 2A27A 4NM5A 3RKBA 2R7IA 4HVHA 4DFUA 2C4GA 3PPZA 4DT8A 4I5CA 4AWIA 1OGUA 5HO7A 3FZTA 4QYEA 3R9DA 3R8ZA 1PXPA 1R3CA 2W7XA 2XNPA 2X81A 3PY0A 5CSHA 5T68A 5L8KA 1YXVA 1H07A 2I7QA 3ENHA 3OXTA 4NKSA 4PV0A 1TQPA 3LCOA 3RNYA 3V8WA 3BBTB 4EYMA 5LQFA 2JKKA 1MP8A 4MH7A 4LOPA 4V01A 4RRVA 2R0UA 5C27A 3IONA 4J96A 1H24A 2WU7A 2X4FA 4YPSA 4AOIA 4G16A 5D10A 4NUSA 4ZTMA 3KB7A 3P23A 3HMIA 4OTRA 2G2FA 3LE6A 1A48A 3PXRA 3O51A 4DN5A 4NEUA 5DH3A 5HEZA 3TJCA 5CENA 5BNJA 3PSDA 1WBPA 4OLIA 3N9XA 2PVNA 3OS3A 3QYZA 4AZEA 4FOCA 2WQEA 2UZLA 5F1ZA 3PXKA 4IDTA 3P78A 4TYHB 2PSQA 3K3JA 4IB3A 3H4JA 4MNEA 4RA4A 4TY1A 3TACA 2WEVA 2FA2A 2PK9A 3R7IA 3ZCLA 5CU0A 4KIKA 4N57A 2RGPA 3BGZA 4J52A 3E93A 4O91A 1U54A 3QKKA 3EN6A 4GU6A 4LV5A 1ZMWA 5DOSA 4ZIMA 4E6QA 3A8WA 1JKLA 4H3BA 5A6NA 3RMFA 4GFMA 4OT6A 4YURA 2I0EA 5EFQA 1CKPA 3DFAA 2GHMA 2FUMA 2UZBA 2XZSA 3QRKA 2WXVA 5E91A 5HLNA 4ZLOA 4FGRA 1YXSA 3PJ3A 3R04A 4YLLA 4DGMA 1Y6AA 4DBXA 2C68A 1FVRA 4FA2A 4PNIA 2PMNX 4RIXA 3ZO1A 2B9FA 5K4JA 3OOMA 1W83A 2WTKB 3ZUTA 1WMKA 1WBSA 3FKOA 3O8UA 4RQKA 3U8WA 3V51A 2FB8A 3RM7A 2W1IA 3CQUA 4NCTA 4EUUA 1RW8A 2W5AA 4YHJA 5A14A 2GTMA 5M4CA 5KMMA 3MFRA 5JGDA 5DVRA 2BILB 4GL9A 3BWFA 2YM3A 4YLKA 4E73A 2X8EA 5J7BA 4QP3A 5BYYA 4LG4A 4K8AA 3HX4A 2QOFA 3CPBA 4I23A 3ZC6A 3QALE 2YM5A 1LEWA 1XO2B 1UU7A 5B2MA 3BV2A 3PXFA 4Y95A 3PIYA 3F3UA 2RFNA 4I21A 4AW2A 4KABA 1L8TA 2HENA 4L3PA 2HXLA 4AN9A 1YQJA 4JI9A 2PUIA 4MXAA 3NNXA 4EK5A 3IS5A 4FUYA 3H10A 4YU2A 2J90A 2WHBA 4O7TA 2QHNA 1CTPE 4L46A 4FK6A 4R5SA 4WD5A 4D0XA 5KMLA 5IQCA 4AA0A 5TT7A 4LGHA 3PRIA 5FGKA 4Q5EA 4E4XA 3MV5A 3D94A 3MFSA 2BMCA 2X7GA 3BU3A 4M13A 4QP1A 5HICA 5L2QA 3S95A 3W2QA 3RALA 3ZXZA 3W18A 1RE8A 5FXRA 2B52A 4RFMA 4FV7A 3AC5A 2PVKA 4RIYB 4C0TA 1PYXA 4U8ZA 4FSUA 4X3JA 4H58A 4L45A 4F9AA 1PKDA 1KE8A 2UZVA 4QYYA 4ZTNA 3W33A 4Y46A 4MQ1A 1H4LA 3ZBXA 4O81A 3LVPA 3UC3A 4E26A 3DT1A 5BMMA 5BMSA 5M08A 3ORKA 4EQUA 4LOOA 3NZ0A 4PMSA 4WOVA 4G6LA 2QHMA 4C7TA 4GIHA 4USDA 1BLXA 2W17A 3PP1A 4HZSA 4XCUA 4YSMA 4R78A 1YWVA 2F9GA 4DA5A 4EUTA 2VO0A 2I0VA 2VTRA 3QYWA 2JDTA 2PVMA 3FPMA 3VNTA 4BCOA 4NH1A 1UV5A 2XKDA 4KKGA 4BZDA 1Z9XA 4U9AA 4O7LA 5KUPA 5BUIA 3OBGA 1CKIA 3ZSGA 3G6HA 4TTHB 4FKVA 4O21A 2Z7SA 3R7EA 4B99A 3O71A 3G0FA 3PUPA 5D9HA 5CEMA 5JN2A 5T3QA 2FSMX 5AUTA 3TUBA 3BE2A 3FY2A 3FKNA 5I9UA 3V6SA 4AZTA 4O7VA 3CJFA 3F69A 4NW5A 5AX9A 2JDOA 5CSWA 3IDBA 3E3PA 3R8PA 1XH7A 3CKWA 4TN6A 4YUQA 4FEXA 2W1GA 2ITTA 3QZIA 3TTJA 3VS5A 5C01A 4FR4A 3UYTA 5I9VA 4V0GA 5KBQA 1NT2A 5C8NA 4TKSA 4BDAA 3ORPA 3QGYA 3AXWA 3TJDA 2QOBA 3EQRA 1GIIA 2A19B 3S0OA 4FV4A 4IZYA 4HGLA 4BHNA 2C5YA 2YCQA 4O22A 3AQVA 4YJVA 4AZVA 1JQHA 2DYLA 1PXOA 3OCTA 4I24A 2J0IA 4KIQA 2Y6OA 5DIAA 4ZEGA 3Q9WA 4O0YA 4HYSA 3VWAA 5HTCA 5E8WA 4D4RA 3Q9YA 3GOPA 4EKLA 4YSJA 3H9OA 2VWIA 3V04A 3KVXA 4MXYA 3UBDA 3SOCA 3ZZWA 4D58A 2BIKB 3ALOA 4R3CA 2OJ9A 2WD1A 1GIJA 1V0OA 4FV8A 4EBWA 3P86A 4F09A 4F0FA 3GU5A 5AA9A 4H05A 2XNEA 2CNUA 2PULA 3QCYA 5LMKA 4M97A 2VTPA 1F5QA 4FTOA 3WBLA 3CY3A 4YZBA 2PE2A 3TV4A 4ID7A 5AA8A 5HD7A 2R7BA 2HOGA 3F88A 3ERKA 4MD9E 2VV9A 4QMLA 3OMVA 3FY0A 4LRMA 5HG7A 4D2VA 2DS1A 3BGQA 5KMJA 1O6YA 3DDPA 4Z9LA 4EOJA 3ZMMA 3MH2A 4USFA 5KHXA 4I5HA 1WBWA 1R78A 2XA4A 1K3AA 1LUFA 2GNGA 5DG5A 3T8OA 4J95A 1OITA 1REJA 3EN5A 4IVCA 2VTAA 4X2NA 3Q32A 3KQ7A 2O64A 2VO6A 1OPKA 4GVAA 2LAVA 3VBXA 2AYPA 3KU2A 3UGCA 3VJNA 4EOQA 3R73A 4DGLC 5BVOA 3CKXA 3QLGA 2WMVA 2O65A 3CD8A 3DBDA 3A7HA 4KRDA 4XG7A 3L8XA 5IQEA 1Q8ZA 4GFOA 3SVVA 4L3JA 3DAKA 2X2LA 4DCEA 4FEUA 2XKFA 2OH0E 2X9EA 4QMSA 3MPAA 3RK9A 3CEKA 4FSZA 4IACA 4TWOA 2VWZA 1BYGA 2PZPA 1YI3A 3ZTXA 1V0PA 4FKIA 1NVQA 2VTMA 4ZJIA 5L6OA 3OC1A 4JOAA 4XLIA 3H3CA 2JFMA 3R21A 4FEWA 2I40A 1YRPA 1T46A 4Q5HA 3SQQA 1PMEA 4L9IA 3BYVA 5LVNA 3BLQA 1XJDA 3W2PA 4KBAA 5A9UA 4FIHA 3NGAA 3R71A 4R3RA 5EOBA 3V8SA 4BYIA 2YA9A 4QO9A 4ZLYA 1OIQA 5ACKA 3ZLWA 4U3ZA 5FQDC 4O6EA 1GIHA 1BX6A 2A2AA 3Q53A 4QYHA 2OFVA 3PLSA 4BYJA 4RSSA 3O96A 3F2AA 3GC8A 4XRJA 4D2SA 4CRSA 4FG7A 2BKZA 4PY1A 4LL0A 4IX4A 4DH3A 3MB6A 2XVDA 4C4IA 2OK1A 4EZ5A 4YC3A 5AV4A 3VQHA 4AF3A 4FBXA 1OMWA 4TPTA 3GCQA 4LMUA 4AXAA 2GQGA 4FTLA 3WE8A 2B4SB 3TCPA 4EH9A 2H6DA 2ZV7A 4BZOA 2R3KA 4FKPA 4DLIA 3F5GA 3OD6X 3IW4A 4DT9A 4IBMA 2YJSA 3QTXA 4E4NA 3ZSIA 2GQRA 4ENXA 4FTMA 4ALWA 3POZA 3QUDA 3QWJA 1XH5A 1U4DA 2WNTA 2QR7A 3DBFA 3OVVA 3OWKA 3FZPA 2J5EA 3ZS5A 5DRBA 3KRLA 2R3JA 5G1XA 1OPLA 4FYOA 5DN3A 2XIRA 3HA6A 3R8UA 4EZ3A 3N4VA 4FK3A 2JFLA 2BFYA 1Z5MA 5HZNA 2R64A 4KBCA 4KB8A 4IB5A 4MNFA 4EH4A 5BX0A 3NLBA 4IWDA 3RI1A 3PLAE 4OTIA 2Z02A 2YDJA 4AW0A 4ANOA 3F5UA 5M55A 3PY1A 4JX3A 4GEOA 2HAKA 3D4QA 4NK9A 2QD9A 4PUZA 4E3CA 5HE3A 2W4JA 4U3YA 4A06A 4CMOA 3ZFYA 4DEAA 3R7UA 3N4UA 4OTWA 1QPDA 4HPUE 3WYXA 2F2UA 4X21A 3BU5A 1M52A 3LAUA 1JSUA 3D7TA 1K9AA 2Y0AA 4QP2A 1L3RE 3H0YA 3IGOA 3LLTA 3Q9ZA 2E9PA 4O0SA 3R83A 1Q4LA 3RPOA 1J7LA 3ID6C 4EH2A 5AAFA 2C0TA 1W7HA 3ZU7A 4ZMFA 2ITYA 5KKRB 2C6DA 3AT4A 4LV8A 4WUAA 3ORIA 5DE2A 2CN5A 1JAMA 1G8SA 2OI4X 1UA2A 4JBOA 3FMHA 4F70A 2P2IA 4P2KA 3GCPA 3UVPA 4AT5A 3PDTA 3VAPA 3HUCA 4A9TA 4CSVA 3KMWA 3ZZEA 4CNHA 4FTJA 3PFQA 4BI0A 3JY0A 3F3ZA 3D83A 3C5UA 3BZ3A 4E5WA 5A54A 2VTNA 3HA8A 4L3LA 3T3VA 4FSQA 4OBPA 2B9HA 2OF4A 2WMBA 3E92A 5CNNA 3DKCA 3CD3A 4YZNA 3KMUA 4WRGA 3TUCA 3AMAA 2B7AA 2QKRA 2YABA 4KIPA 5EQEA 4IZ7A 2IZUA 4FL2A 4QMWA 4WBBB 4ZLZA 3V5JA 3THBA 1SNXA 3FMMA 4D0WA 5KX8A 4CFFA 5FTGA 3O7LD 3RAKA 4JXFA 4IWOA 4ASZA 3ROYA 5KMKA 4UYNA 2OH4A 3FWQA 4MBIA 3MVHA 5FBOA 3IK3A 2R3LA 5I3OA 2W1CA 2P3GX 3QD4A 4IAIA 4BDEA 3UZTA 3VVHA 4ANLA 3VS2A 4ANBA 4O2PA 3UYSA 3ZH8A 4FKTA 3KMMA 4NJ3A 1OL5A 4G6OA 2XS0A 3JPVA 1RJBA 3NNUA 5EDPA 2B53A 4Q2AA 3ANQA 3MA3A 2WFYA 3KVWA 1A9UA 3EQPA 3HRFA 4ALVA 2W1EA 4F9CA 4NW6A 3GFEA 4U81A 4D4SA 4GIIA 2XK7A 1ZOEA 1WCCA 5J95A 2YDIA 3DJ5A 3UVRA 3R8LA 3FSKA 2XRWA 3NVMB 3CGFA 3TZ8A 3NUXA 3DLZA 4GUEA 3UOKA 3HV3A 2GU8A 3K5UA 3S2PA 3CTQA 4AT3A 3DTCA 1Y8YA 4RZVA 2W06A 3NUPA 4X2GA 3BV3A 4ZTQA 2C0IA 3WILA 4DINA 3L9MA 4YTFA 5JFSA 5C1QB 3UO5A 3AC1A 4LUDA 2RIOA 4TYJA 4NYEA 3EOCA 4FEQA 2BTRA 3BE9A 3TI1A 5HKMA 5L3AA 1YKRA 4G34A 4LMNA 1YWNA 3FI4A 3HECA 3T3UA 5EI6A 3LCDA 4S32A 1OM1A 4DTAA 3DXPA 4W4VA 4JT3A 3SW4A 4C57A 3TIZA 4C4FA 4ZAUA 5DLSA 5AFVA 4ANMA 1CM8A 3QU0A 4BI2A 2XEZA 1OL2A 4NIFB 2WMUA 1PKGA 3QTUA 4CKRA 2JD5A 4RBLA 4C33A 2UW8A 2YITA 3OCSA 2QOIA 4HJOA 1Y57A 3ELJA 2HW7A 5ETFA 3FHIA 5FUTA 5LMAA 4PL4A 3FLYA 5A4LA 5M06A 2W1ZA 1HCKA 5IQDA 2XIZA 3O17A 1NW1A 1H1WA 2YM8A 3P1AA 5DR6A 4FT0A 4PP7A 3NRMA 5AP4A 2IG7A 4B9DA 3PYYA 2RFDA 4ITIA 1WBOA 4QMVA 5B0XA 3RPSA 4OBQA 4YC8A 5BVEA 4BWKA 3DCVA 5HLWA 5E1SA 4FVQA 1XQZA 4UWYA 5GZAA 3LFQA 4R7IA 2ERZE 3OZ6A 4HGTA 4BCKA 4FKSA 3SDJA 4FIIA 3LPBA 4JDKA 5D7AA 4OT5A 4AE9A 3KXZA 2H8HA 3QD0A 4ACGA 2W0JA 2O8YA 3P9JA 3BYSA 2CCHA 3VUIA 5EW8A 3HV5A 4MF1A 4O0RA 4OUCA 3W55A 3FEGA 1JSVA 4Y8DA 4H1MA 2W5HA 4W8DA 3R22A 1ZWSA 2E9OA 1PW2A 3FXZA 4RX8A 1PXJA 2FYSA 4A4LA 3ZO3A 4ZSAA 2CJMA 1GY3A 5EYKA 4EH3A 2VX1A 2VTQA 2PTKA 5K3YA 4ZY4A 3MPTA 4XG6A 4R1VA 5LXMA 5CAUA 5M4FA 1MRUA 3DPKA 3IOPA 2UZUE 1KE5A 4YJTA 5CEOA 3L8PA 3OROA 4IVDA 4WG3A 2PVYA 4ZMEA 3OT3A 1U5RA 2OZAB 2CGXA 3DY7A 5AUXA 3N51A 3ETAA 4XP3A 1VYZA 1M17A 1AD5A 4DEHA 4FKWA 2PPQA 1ZYJA 3BBWA 2P33A 4DGNA 3OUNB 3EB0A 4DFZE 4DEBA 2OW3A 1TKIA 4ERKA 3ZDUA 4IAYA 3LW0A 2F4JA 2WMRA 4FV2A 3OWJA 3G2FA 3PSBA 3FZ1A 4PDOA 3W2OA 4F1TA 5A46A 2Z8CA 3O0GA 4IZAA 1ZOHA 4XOZA 1JBPE 5J1WA 5IEXA 1QCFA 2BALA 4MVFA 4U7ZA 5DBXA 3D14A 5IDNA 3VRYA 3DKFA 5CX9A 3KKVA 4AUAA 4MQ2A 2IZSA 2ZJWA 3EMGA 3HZTA 3Q4TA 4XV2A 2R3MA 2QKWB 4R77A 3FQHA 4MWHA 5DPVA 4C2WA 5DYJA 5JH6A 3SRVB 3QC9A 4FV3A 1FVVA 3BHYA 4S31A 5HD4A 4U5JA 5DWRA 3RTPA 1XWSA 2BRGA 2UW0A 2C6EA 2Y8OA 3IW6A 4KUJA 3OT8A 5K4IA 3E5AA 3TXOA 3QQHA 4N6YA 4RWKA 2OLCA 4L6QA 1V0BA 4WNOA 5CSXA 4O7NA 1OZ1A 4YZ9A 2IW9A 4ALUA 5IH4A 3CE3A 2XNMA 4GYGA 4WT6A 1QPJA 1SVEA 3Q96A 4MXXA 2ZV9A 2YFXA 3PJ8A 1OIUA 3ALNA 5LARA 3FMNA 4QP6A 3G0EA 3KA0A 1DAWA 2C1BA 2YN8A 4JDJA 2Z7RA 4E6AA 5L4QA 5IQAA 4CFNA 3ZXTA 2UZOA 2XRUA 4F1MA 4O7YA 3C51A 5F94A 4KD1A 5HOAA 1Q8TA 3LFFA 4JAJA 5GJFA 5CLPA 5H3QA 3HNGA 4EC8A 1M7QA 3O7LB 2WQNA 1DS5A 4O27B 4P4CA 4IANA 4XP2A 4ZP5A 2C1AA 2ZYBA 1FPUA 3AD6A 2XB7A 4FTTA 4P90A 4FV6A 3EN9A 4XG3A 4E93A 3DBQA 3KXMA 3AOXA 3HVCA 5J9ZA 2GQSA 3RVGA 4D4YA 3NDMA 4QYFA 2J0LA 3ZFXA 3Q60A 4QTEA 5M57A 3U54A 3R1QA 5C4LA 4CG9A 5JFXA 5IEYA 3Q5ZA 4I93A 3CTJA 1Q3DA 3NCGA 1XH4A 3L8SA 3A7GA 2CMWA 4YR8A 5CF6A 3OUKA 5EQYA 4EOLA 3W2RA 4IAFA 5DR2A 2GS2A 3OG7A 4BCMA 2F7XE 2OGVA 3PTGA 4R8QA 4RIWA 5CAPA 1BKXA 3D2KA 5DFPA 4XS2A 3BLHA 4DEEA 4DYMA 5IQBA 3JUHA 4WRSA 2GNJA 2GS6A 5BQ0A 1S9IA 1YXTA 2IZTA 2QOKA 3SA0A 4F65A 3PRFA 3HDNA 1GZOA 3Q4CA 4IVAA 2XM9A 2EB2A 2W9ZB 2AC3A 4MEDA 4XBRA 1IEPA 3BYOA 2HELA 1PMVA 3FKLA 1DI8A 2NNWB 3U9CA 4BGGA 5IA1A 1VJYA 3RBWA 2HWOA 3QFVA 4EBVA 2VD5A 3PJ1A 4O1PA 3UZPA 5HLPA 3RWPA 3VUGA 4ACHA 4DTBA 3IOKA 4OTPA 1H8FA 3CBLA 4FZFB 3R01A 4GKHA 3RGFA 4GJ2A 5H2UA 4BWPA 5IQGA 1LPUA 3NYVA 3F3WA 4FTKA 5B7VA 5H8BA 2B1PA 4M69B 4QMOA 3ULIA 2I1MA 3NWWA 3WF9A 1IASA 3TT0A 3TNQB 4AA4A 2J0KA 4CCUA 3R9RA 3VS3A 3SG9A 2B9IA 5L6WL 3FZRA 3ZLXA 4C37A 4L44A 2YIWA 1UU3A 3K5VA 4J99A 4PP9A 4B4LA 1ZZLA 2GPHA 4JIAA 1H01A 2C30A 2WPAA 3ITZA 2UW5A 3MY1A 4BN1A 3G33A 4HVDA 3QQKA 5B2LA 3EL7A 3QAME 3HP5A 4NFMA 4UMPA 5EW9A 2GSFA 4AOJA 1IR3A 3O8TA 5HG8A 1ZRZA 2J5FA 4IX5A 4NT4A 3SAYA 1ZYLA 4AGDA 3EFWA 3HL7A 4PPBA 4PQNA 5E8VA 2QURA 4ACMA 5AUZA 2IN6A 5CNOA 5M53A 2JLDA 5EI8A 1YDSE 2YJRA 5TO8A 4TWCA 3FLWA 4FV1A 4F7LA 5DA3A 4EKKA 1KWPA 3AC4A 1A06A 2VX0A 3HV6A 4AZSA 2QLUA 1FGKA 4F0IA 5HTIA 4LUEA 5I9YA 5LCJA 2GNFA 2HIWA 3IPHA 5M4IA 2YWVA 4PL3A 3E8NA 4E4MA 3BLRA 5GINE 1M14A 2CPKE 2PZIA 2ZDUA 4IAZA 2JKOA 4M66A 4TNBA 3VS4A 2RF9A 4YJUA 5KMIA 4ZSEA 3TEIA 3WOWA 2R3IA 3LFDA 3UMWA 2PE0A 4O0XA 4A4XA 4MD8E 2XH5A 3BQRA 5HCYA 1BUHA 3R02A 4FODA 4IWQA 3OWPA 1OUKA 4L8MA 2A0CX 3HMNA 2R3HA 5J79A 2XK3A 5LJJA 3LMIA 2AUHA 5HNGA 2YWPA 4ITJA 5M07A 1Z57A 1CSNA 5IA2A 5F20A 2UUEA 1O6KA 3MVLA 3FC1X 5I5ZA 2W1FA 3FUPA 2VWUA 5FEDA 5FWKK 3C4ZA 1NXKA 1P5EA 3QCQA 4M14A 4D9TA 3KRJA 1Y8GA 1OKYA 3WARA 2X7FA 4TWNA 4TRLA 4WHZA 1Q61A 2DUVA 3QRJA 4MXCA 2XKEA 2QVSE 4IJPA 5KNJA 3UIBA 2ZB0A 4E7WA 2W99B 4Y85A 2HZ0A 5FBNC 2PZRA 4HOKA 4S34A 5JT2A 4QMZA 4RZWA 2HK5A 3A4OX 2ACXA 3RK5A 3FMLA 4ZZOA 3RWQA 3VJOA 3D0EA 2RFSA 4QPAA 4J97A 4ASEA 3F5XA 4PMTA 3TNHA 3U87A 4GKIA 4B8MA 2C47A 4L42A 4FSMA 3WZUA 3PJ2A 5BUEA 3OTUA 5IISA 2OXDA 3EFLA 1TVOA 4ZTRA 3D15A 2E9VA 4FL1A 1Q8WA 3I81A 4UMUA 5CAOA 4BKZA 4XBUA 3MS9A 3DAJA 4LL5A 5EM8A 1CMKE 5CZIA 3FSFA 4RWLA 3FMKA 4QP7A 3CLYA 3DFCB 4M69A 1VZOA 4J8NA 4DG2E 2R2PA 5EHYA 5BVDA 3EZRA 3SKCA 1P2AA 1J1CA 2OJIA 2XK4A 1PRYA 3PWYA 5C4KA 4Z16A 4I6QA 4JBVA 3MY0A 2BAQA 2OU7A 4L7SA 5IQIA 2EU9A 2OKRA 3HAVA 4P5ZA 5IQHA 2ITVA 5A3XA 2ETMA 5DT3A 3ATTA 3ORXA 2PWLA 4DBNA 1MQBA 4RJ8A 3V5PA 4I4EA 4QMNA 2R9SA 2CKOA 5KBRA 3KGAA 3H9FA 3ET7A 3FJQE 3NUYA 4CFVA 4QTCA 3D2IA 3HV4A 4U42A 3K2LA 3ULZA 3DNDA 4CTBA 1DI9A 4JQEA 2UZDA 3HGKA 4E5BA 2GMXA 2BZKB 3BQCA 4EK3A 2GFSA 4PRJA 4EK4A 2OICA 4TYHA 3AMBA 3PSCA 4UWCA 2QNJA 3A7IA 4P5QA 3KFAA 5HGIA 1UNHA 3QKMA 1WFCA 2Z7QA 3R7OA 2ZM4A 2NRUA 1E1VA 3MA6A 3SW7A 3R7GA 2VWWA 1ZMUA 2OJFE 5M51A 3GVUA 4I5PA 4U41A 3NNWA 5J1VA 4BGHA 4FGBA 3WYYA 5AUVA 3Q2MA 1CKJA 4U40A 4XJ0A 2J2IB 1KUTA 4RT7A 2YHVA 4EWHA 1OIYA 3EJ1A 3OTVA 5KKRC 3FMDA 4WKQA 2VTLA 4BL1A 5DEYA 3LZBA 3TKIA 4AOTA 4C4GA 2E9NA 3PPKA 5DGZA 2UZTA 4DEDA 3KY2A 2UVYA 4TW9A 1FOTA 4WUNA 5KE0A 3KULB 5CZHA 5HCXA 2JDRA 4FIGA 3DBEA 3VF8A 3BHUA 3ENMA 3EHAA 2WIPA 4YZCA 3PWDA 5JZNA 5AR5A 3FLNC 2JIUA 1YXXA 2XF0A 4WA9A 1IAHA 1OL6A 4JR7A 2YIYA 1P4OA 3KEXA 4PF4A 2G15A 4BICA 3MIAA 5CXZA 5F4NA 3A4PA 4CZYB 1WBVA 4KSPA 2C69A 4XG2A 4RJ3A 3UVQA 3WZEA 4CMUA 4I6BA 1HCLA 3ORNA 3E7OA 3T9IA 3AC8A 4D2PA 2HCKA 2XIXA 2XMYA 4EJ7A 4YHTA 3R1SA 2WTDA 4ZK5A 2JC6A 2WTVA 4NM0A 4RIOA 3TM0A 5JKGA 2J7TA 1Q99A 1H27A 3MFTA 3C0HA 4QQJA 5AP5A 3MTLA 4A07A 3U9NA 5I9XA 4X6QC 3KN5A 1KOBA 3NUAA 3C4WA 3QBNA 5AR4A 4APCA 4C4HA 3A7FA 3B2WA 5CVHA 3PZHA 5M44A 3MIYA 4KA3A 3VUMA 5CU3A 4RIYA 3R7VA 3K3IA 5D1JA 5EQPA 4JQ7A 4FIJA 3B8QA 3Q9XA 4QMTA 3COHA 5LWMA 3RZBA 5HQ0A 3DK3A 4C35A 2BFXA 3RZFA 2WMWA 5AUWA 3NMUF 1SYKA 2SRCA 4IC7A 4I0TA 5D7VA 4CEGA 1FINA 3DA6A 3JXWA 3O23A 4JQ8A 4C58A 4I92A 5CAQA 3KF4A 5FRIA 3KRWA 3MW1A 5JZJA 4U45A 3GNIB 4B0GA 3ZEWA 2PVLA 4MBLA 4AS0A 5AAGA 2V5QA 3QZHA 2IW8A 4U43A 5FXSA 1URCA 2F49A 3WI6A 3FMJA 2B55A 4EOPA 3V5LA 4DH7A 2VWXA 3FI2A 2B0QA 4CG8A 2X8DA 3OEZA 3DJ7A 5E8UA 3R2BA 4BCGA 4BZNA 3TDWA 2VTTA 4IAKA 3LJ1A 4ANQA 1UNLA 1IRKA 4JG6A 1P4FA 2YISA 3AD4A 4W4YA 5TF9A 3JR1A 1LEZA 2WTWA 2ZDTA 3C50A 4G3FA 3BYMA 5EM5A 3V01A 5I9WA 2PHKA 5CQWA 4YO4A 1H00A 2JAMA 5HE2A 4AACA 1J7UA 1B38A 1R0PA 2Q0BA 5LVPA 2P0CA 4RLKA 4XRLA 5IMXA 2Q0NA 3C4XA 4Q9ZA 3SGCA 5AMNA 4ANSA 1YOMA 1IG1A 2YIRA 3UG1A 5E8XA 3NS9A 4FIFA 3P7AA 1UWHA 5CT7A 5I9ZA 3U6HA 4N0SA 4YTIA 1ND4A 2WQBA 2O0UA 4KKEA 2WQOA 4K18A 5JFVA 3AC2A 1Y91A 2OBJA 3R1YA 1JKTA 3PG3A 4PPCA 3FLQA 1H1SA 3UPZA 2J51A 4JL9A 3DOGA 2IZRA 3KXNA 2HWPA 3GQLA 4BDFA 5IU2A 1W84A 2C6IA 1XHAA 2WTIA 4J1RA 2JITA 4DC2A 4ORKA 2VRXA 2QU5A 4IWPA 3UNKA 2YAAA 2NO3A 2C6KA 3MTFA 1NVRA 2B54A 4IHPA 4NKAA 4BGQA 3LM0A 1GNGA 3LXKA 4L68A 3GU7A 1T45A 3PJCA 5CT0A 2WIHA 3HUBA 3IO7A 3R7YA 1PXIA 2I0YA 4RJ7A 2FGIA 2W05A 4FVPA 4XOYA 3VUDA 3F9NA 3DNEA 4AN2A 3LFNA 2FO0A 2H34A 2ZB1A 5FD2A 4FSRA 5HG5A 2C5VA 5AP1A 2ITNA 5IA0A 5IH6A 4FNWA 2FSLX 3F3VA 3EWHA 3L8VA 3LFAA 5AADA 3NX8A 3KK9A 4EOMA 2RFEA 4K6ZA 2REIA 2UW9A 5ETCA 4A9YA 5I4NA 3C0GA 3QZFA 2VWVA 2PY3A 3ACJA 3Q04A 3MDYA 1ERKA 3LFEA 5LVMA 1DAYA 4I41A 4WIHA 5GJDA 3ZONA 4K33A 4AQCA 3KL8A 5FTQA 4I94A 3U4WA 3LQ8A 4QOXA 5DI1A 5HHWA 1UKHA 1YHVA 3GCVA 3ZBFA 3HRCA 3V6RA 4ZY6A 3EIDA 5G6VA 3TN8A 1YOLA 3CPCA 1JPAA 2QO2A 4J71A 5E4HA 4RFYA 3QLFA 4E6DA 3OOGA 3QTZA 3LM5A 4EJNA 5HTBA 2YDKA 4FZAB 3WF6A 3NW7A 3SOAA 2EXEA 3II5A 4F9BA 5IF1A 4DFLA 3FXWA 3BPRA 3BX5A 4RJ4A 5AR8A 2GS7A 4RC2A 3C4FA 4LRJA 5ANJA 4QQ5A 2JIVA 3GEQA 1Q41A 2BZJA 1R0EA 4HNIA 3OXZA 3HDMA 3ACKA 4L67A 4M68A 4GK4A 2XNBA 4NZWB 4ZJJA 5CAVA 3NCZA 4JRVA 5AV1A 2BRHA 1I44A 4IADA 5F95A 4ONAA 3JY9A 4AZWA 4BKJA 5DHJA 2CHLA 2P55A 3EFKA 5AV3A 1LP4A 5ANEA 1W0XC 2UW6A 2XUUA 1OIRA 3HMPA 4IE9A 1KE7A 3D5WA 2VNWA 2YEXA 4BIBA 4PMMA 3MVMA 3R9OA 5FTOA 1KOAA 3OXIA 5EOLA 3AGMA 1M2PA 4OR5A 1Q8YA 3QX4A 3KF7A 5CWZA 2WB8A 3UJGA 5KZIA 5ETAA 3ANRA 1XBCA 2UVZA 3M42A 5D11A 3Q6UA 3U55A 3KXXA 4M84A 5FM2A 4QNAA 2UVXA 4C3PA 5KMOA 4BTJA 4YO6A 3OFMA 4GK3A 5CVGA 4AAAA 3MPMA 1KSWA 4AGUA 3VS1A 2ZMDA 4GG5A 4P7EA 5CI7A 1REKA 4ACDA 2R3NA 4IM2A 2OFUA 4BDIA 3ZHPC 2IO6A 4TWPA 4XG9A 2YLEA 1PY5A 3AGLA 4X2FA 4MXOA 4JIKA 2GDOA 1H1PA 4QP4A 4O7SA 3CR0A 4M15A 5TR6A 1WZYA 2BRBA 4DHFA 1UU9A 4DEGA 2OF2A 3UOHA 5M4UA 4A9UA 2G2HA 2FSTX 3SHEA 5DMZA 2NPQA 3V3VA 2QOHA 5LWNA 4E1ZA 3O8PA 3P5KA 4M8TA 3MBLA 4QMMA 4CFWA 3NNVA 4FTRA 5IA4A 5ITAA 3F2RA 3LQ5A 3FXXA 3UODA 4FE2A 3GU4A 1ZLTA 2XK8A 3NYXA 4CXAA 4W9XA 4L00A 2ERKA 4IMYA 3FL5A 2YCRA 3BHTA 4QT1A 1URWA 3COMA 4HZRA 3HP2A 2EB3A 3IECA 4JVGA 3RINA 4NCTC 3D5XA 2YZLA 3ATSA 3AG9A 2F57A 2O5KA 1XR1A 4DEIA 3NIEA 4OTDA 4LQMA 5AP0A 3EQIA 1YWRA 3QA0A 3MJ2A 3RHKA 3BHHA 5BUJA 2R3PA 2J6MA 3I4BA 5A4CA 3NUSA 2IVVA 2V7OA 3FQSA 5CTPA 3ZDIA 4UX9A 4JAIA 2HY81 4PL5A 5LVLA 2JKQA 3VO3A 3VS7A 2C5XA 5JMSA 3QL8A 4WG4A 4QRCA 2BRNA 2ZOQA 3UMXA 5JRQA 3UQFA 3M1SA 4XG8A 2GFCA 4IC8A 2G9XA 4FZ6A 4JS8A 1FGIA 4XV3A 2HYYA 3FV8A 3GUBA 4Z3VA 4BDGA 2ZVAA 2UW4A 4UMTA 2C6LA 4FTCA 3DGKA 3QQLA 4HGSA 4YZMA 4EQCA 3PIZA 3KCKA 2XNGA 2IVTA 4YJSA 3GCSA 5CU2A 5EHOA 3OEFX 4G17A 1M7NA 2XBJA 2IVUA 1JSTA 2J0JA 4PMPA 2X6DA 4FKUA 4A9RA 1PF8A 4GMYA 3S4QA 4R7HA 4ITHA 4HYUA 5AR3A 4II5A 4DFNA 5FG8A 4FG9A 3QUEA 4BVUA 5KHWA 3ZRLA 3I5ZA 2JDVA 1XH6A 4ANNA 3QXPA 3I0OA 4ZOGA 2NP8A 3I1AA 3UQCA 4RVTA 1OL7A 3B8RA 4S33A 3OW4A 4RJ6A 4EQMA 4USEA 3RNIA 4HYHA 3OW3A 2QC6A 4X3FB 5FP5A 3LIJA 4A4OA 5AR7A 5JGAA 5BPYA 5AX3A 3MGYA 5AP7A 1FQ1B 2X2KA 3F82A 5I3RA 3F6XA 4RA5A 3L9PA 1JNKA 4H3QA 3VS0A 5HORA 4BTFA 2BZIB 4G6NA 5HI2A 3CCNA 4CMTA 4FX3A 4FIEA 2X9FA 5ANOA 3A61A 4D4VA 3FZOA 2AC5A 2JKMA 3KCFA 1ZY5A 5J7HA 3QA8A 4EH5A 3VN9A 3O50A 4UB7A 3ZM9A 2QQ7A 3Q6WA 3MWUA 4RLLA 3QQJA 5AR2A 3PE2A 2UV2A 4MF0A 1PYEA 3R63A 2YIXA 3QTIA 4FV9A 4GUBA 3VBTA 4AE6A 3QC4A 4CLIA 4IM0A 1W98A 4IDVA 5AJQA 3TTIA 1OECA 2CLQA 4WNMA 4HVGA 3NVKI 4FT5A 5CY3A 4NTTA 3G15A 4FC0A 3HLLA 3N4TA 2ZM1A 3TG1A 4D1XA 4BDKA 4H36A 5HIEA 3LXLA 2PL0A 4B8LA 3LCSA 3LHJA 4NFNA 2C0OA 4KBKA 4L53A 4B7TA 1E1XA 2CCIA 4FICA 4MYGA 4NIFA 2RSVA 4F6SA 4F6UA 4W4WA 2X2MA 3EN7A 4Y5QA 3IG7A 3QQFA 4QTBA 1MRVA 2GNHA 3P7BA 4CTCA 3F2NA 5C9CA 4PPAA 3VBQA 4JG7A 3TZ9A 4CT1A 3MJ1A 4YTCA 1U5QA 2X8IA 3U4UA 2O63A 5HIBA 3CGOA 5HBHA 3QQUA 5BVWA 4X0MA 3BEGA 1O6LA 1SVHA 2CN8A 4C8BA 4CQGA 4LI5A 4EC9A 4GVJA 4HPTE 2PMOX 4YMJA 4CKJA 1OPJA 2PZ5A 1G3NA 2QOCA 1F3MC 4MNEB 3DJ6A 3MB7A 3Q4ZA 5EH0A 5BYZA 4G31A 2QLQA 4KIKB 4D2TA 4I4FA 2J0MB 3WE4A 1OKWA 2WZJA 5K0XA 3EKKA 1U54B 4YNEA 2Y4IC 4EOSA 4C38A 5GZ9A 4KINA 3ZO2A 3POOA 3HAMA 4M3QA 3SG8A 5CASA 5C8MA 3DB6A 1JKKA 1ZYSA 2B9JA 3EL8A 4G3EA 2VUWA 4RC3A 4FNZA 4TL0A 3GC9A 2IVSA 3GI3A 3MH1A 2HY0A 3E87A 2VU3A 4RX9A 1M2QA 4D9UA 4RIXB 5EM6A 3FDNA 4FSYA 3GCUA 5I0BA 1OB3A 4BCFA 1WBNA 5J9LA 3VUTA 2CGWA 2YM4A 3P7CA 4O38A 4OTHA 5AIKA 1GZNA 3R9NA 3LLAA 4O96A 1QL6A 2OZAA 4N6ZA 4UZDA 4GG7A 2YLFA 3ODZX 4QMYA 4WSYA 5L8LA 5K5NA 4DH1A 4BCJA 4FVRA 5C03A 2C3IB 4O7RA 1KE9A 3LCTA 4XV1A 5HO8A 4O0WA 3M11A 4AA5A 1B6CB 4BCIA 4FTQA 1J7IA 3GXLA 3RCDA 4H3PA 5IA5A 4EOKA 3C4EA 2ONLC 3QZGA 3E8EA 1QPCA 4K77A 3KN6A 2VX3A 2V0DA 3CSVA 3JVSA 5HIDA 1J3HA 4EH8A 2ESMA 2UZWE 4BCNA 4QYGA 4GFGA 1P14A 3LOKA 5E1EA 1YDRE 2GHLA 4Y73A 4ZZNA 3DK7A 4CZTA 3KC3A 4F99A 4FL3A 3OCGA 4K0YA 4BHZA 2XIKA 3DDQA 4C3RA 3F3TA 3I79A 4DE4A 4WNKA 2C3JA 3R9HA 3GT8A 4O86A 3D5UA 4ZY5A 4FZDB 4L52A 2X1NA 2VO7A 3EQDA 3F7ZA 2DQ7X 3SRVA 4AU8A 3EKNA 4X7QA 4XNEA 2BZHB 1Q8UA 3G9LX 3TV6A 5HESA 1H1RA 5CF5A 1FMOE 3U6IA 1YOJA 4CVAA 5CEQA 4CV9A 4W9WA 2R4BA 4C3FA 4ZSGA 1NVSA 4RWIA 2BRMA 2WQMA 4GYIA 3QUPA 5JEBA 4D1ZA 1U59A 2CGVA 2QI8A 3DZQA 3M2WA 4RMZA 4EI4A 3R8VA 1EH4A 2OWBA 4ZTHA 2YM7A 3CS9A 3HMOA 3VW8A 1XH9A 3C4CA 2V7AA 3AMYA 3JS2A 3NUUA 4K1BA 1BI7A 3FE3A 5EG3A 2ETKA 3VUHA 3VS6A 3R30A 1ZAOA 3DLSA 1ZZ2A 2ZV2A 3MSSA 2WMXA 4N70A 4UMQA 4ERWA 4F08A 1VEBA 2BR1A 4RVMA 4FT7A 4R1YA 2EXMA 4RC4A 3HKOA 4FKQA 2F2CB 2PVJA 3RCJA 4V05A 3UE4A 3OP5A 3AD5A 2JGZA 4RVLA 3P4KA 3CTHA 5E8YA 3O2MA 5IEVA 3WIGA 5CEIA 2XNOA 3ZFMA 4E4LA 4IB0A 3BU6A 2OO8X 4FEVA 4O83A 4BFMA 3BHVA 3D7ZA 4NTSA 3K54A 3SLSA 4Z7GA 3FAAA 1W8CA 2QODA 2F7ZE 3L1SA 5E92A 4UZHA 2FVDA 4XYFA 4YHFA 5KMNA 3UIMA 4I6FA 4F9YA 4FKLA 1XBAA 3QGWA 3MH3A 4HCUA 3DB8A 3C5IA 3CY2A 5T6KA 2A4LA 5J9YA 4RPVA 4V0GB 5AAEA 4QPSA 2GTNA 4FKRA 4MTAA 3L9LA 3I6WA 2QOOA 2XKCA 4BI1A 4C61A 5IH5A 3R2YA 4CGAA 1J91A 4GV1A 4ENYA 4MK0A 5AWMA 3W8QA 1ZYCA 1H0WA 3UPXA 2CKEA 5CS6A 4ZTSA 2KULA 2BIYA 5TOZA 5HX8A 3FL4A 4FOBA 4X6RA 4E8AA 2VGPA 5E7RA 4HVSA 4YPDA 3PPJA 3TKUA 1JLUE 4O7WA 4G3DA 4L43A 4I22A 3VBWA 3RHXA 3MI9A 3W1FA 2R3FA 1OUYA 3HRBA 4BCHA 5CALA 3ORLA 3EN4A 1AGWA 4YBKA 5AP3A 3RPYA 1UU8A 5JK3A 5KO1A 1VR2A 2W1HA 4QMUA 4QP8A 4D5HA 1S9JA 2BDWA 4OBOA 3TV7A 3Q5IA 3OBJA 5A4QA 4R7BA 5AUUA 4XH6A 3FLSA 3GQIA 4TZRA 4PDYA 2Y4IB 3HEGA 2HW6A 2OIBA 3P0MA 3QRIA 4C2VA 1KE6A 3VIDA 4MCVA 4DGGA 3RPRA 3L9NA 4HW7A 3UZRA 4F9WA 5A4TA 3SX9A 2C6MA 2LGCA 5ANIA 4KKHA 4AFJA 4IAAA 5FM3A 4G3GA 2EXCX 4NJDA 2J50A 5AUYA 3UNZA 4IIRA 5DEWA 1QPEA 2IW6A 4Z55A 4K9YA 3ZM4A 4FUXA 4TXCA 5AV0A 3E63A 4GS6A 4WBOA 5AM7A 3EYGA 2BROA 1XKKA 2PE1A 3DXNA 3EQHA 3QTRA 4JNWA 5EYDA 3LMGA 2YACA 4GK2A 4DFYA 2C3KA 3UC4A 1FBNA 4E6CA 1G8AA 5J8IA 3LFCA 4AZFA 3LJ2A 5HNBA 2W4OA 2XNNA 3QTQA 3AT2A 2ITPA 3VW6A 3NAYA 4OAVB 5AM6A 2QU6A 1PXLA 2ITXA 2XK9A 4O82A 3I7CA 3BIZA 2BDFA 2VN9A 3RK7A 4EK6A 4FV5A 5LCKA 4ASXA 4MD7E 4CQEA 5IMEA 2W5BA 1H28A 3GBZA 2OSCA 4DLJA 3VRZA 2HXQA 3A99A 4HCVA 3PXZA 4BIEA 3TZMA 4U44A 3EFJA 4IJ9A 3LXNA 3EQCA 4XG4A 4YJQA 2X4ZA 1GZ8A 4HGEA 3ZYAA 1BMKA 4NM3A 4AG8A 1Q5KA 2YERA 1ZOGA 4K2RA 2BHEA 1YDTE 3BCEA 5EYMA 4FKJA 3WZDA 4U0IA 2RL5A 4CT2A 5EKOA 3TKHA 3EZVA 4EHGA 4UMRA 3IW5A 3H30A 3VBYA 3LMHA 1U46A 3GOKA 5JQ5A 2IJMA 4DTKA 1OBDA 3A8XA 3CQWA 4JRNA 4FYNA 4BDJA 4XX9A 3V5QA 4APPA 2XK6A 3ROCA 2R0IA 3E8CA 5HBEA 3ORZA 2W4KA 2CDZA 3KREA 5CANA 3NPCA 3B2TA 4KS8A 3TNIA 3UQGA 3E64A 2PU8A 2OIQA 4BKYA 4AGWA 3REPA 2ETRA 1IA8A 4QNYA 1NY3A 4M12A 5FDPA 4UY9A 3FPQA 4DITA 2OZOA 4CLJA 2XBAA 5IUGA 1FVTA 5B2KA 2I6LA 2CSNA 3RJCA 3GFWA 4FNYA 4E20A 3OY3A 3I0QA 2WOTA 1Y6BA 2WMTA 4M0ZA 4TT7A 5H9BA 3SV0A 4BCQA 3W8LA 4O7ZA 2BCJA 5ANGA 2QO9A 4JDHA 4BBMA 3SXSA 2VTSA 3C0IA 3DK6A 2OXYA 3BRBA 1OI9A 2VTJA 1SVGA 2BHHA 3VULA 2XIYA 3SXRA 4XLVA 3QTSA 2ITQA 2Y6MA 3UP7A 3KRRA 5HVKA 4IZ5A 4NWMA 5CU6A 5CVFA 4L7FA 4XP0A 5BVKA 3DAEA 4I1ZA 5FXQA 4EZ7A 3PE1A 2WU6A 3KXGA 2E9UA 4O0UA 4D2WA 1SM2A 4IXPA 4QP9A 2UZEA 4CD0A 3ZLYA 1R1WA 3D7TB 3PVGA 5L2SA 1SZMA 1YXUA 2UZNA 3NSZA 3R00A 3RP9A 4FKOA 4M7IA 2WKMA 3DQXA 4YJPA 5IUIA 1RDQE 3BI6A 4YBJA 2G1TA 5HVJA 4Y72A 4I20A 4HCTA 5DNRA 1DM2A 1H08A 3G9NA 3F61A 3HV7A 3MH0A 4GU9A 4BB4A 4FT3A 3G6GA 3W32A 2OXXA 3UO4A 3DKGA 4NM7A 3P08A 1H25A 3GU6A 4QD6A 3NW5A 3ZOSA 3CIKA 5GHVA 3QCXA 2PUUA 2WMAA 3GC0A 4W4XA 4YLJA 3ZEPA 2R3QA 2JEDA 3NIZA 4BC6A 4HVIA 5K5XA 3MYGA 1G5SA 4O0TA 4BR3A 5EK7A 1KV2A 3AT3A 2QG5A 2PVHA 3COKA 5HG9A 5HVYA 1Q3WA 4C59A 4ZS4A 1BL6A 4ZXTA 1E9HA 3BKBA 3OHTA 3PA3A 3WZJA 4ZJVA 1BI8A 4X2JA 2ITOA 3COIA 5LOHA 5H8GA 4FG8A 2ONLA 1B39A 1O9UA 2JBPA 1WVYA 3QHWA 1VYWA 4Y83A 3GC7A 4IVBA 2WMQA 5GJGA 3FMEA 4R6VA 2YM6A 3FYJX 4KRCA 4GH2A 4PX6A 4FKGA 3FBVA 4BIDA 2X39A 3DZOA 3PY3A 3VQUA 5HNIX 2QO7A 1PXMA 4YJRA 4RGJA 5ICPA 2Y4PA 4EORA 3V8TA 4LGGA 1MRYA 3KXHA 4YNOA 4MKCA 3QRTA 2RG5A 1XH8A 4IX3A 3WIKA 3I7BA 3NEWA 4LM5A 2R3OA 1ZY4A 4B6LA 1OL1A 4UYAA 4IB1A 2XYNA 4FTNA 4ACCA 5ACBC 3F66A 1J1BA 3OF0A 3R28A 4F7JA 3W2SA 4CFMA 1GZKA 4KWPA 3QD3A 5TKDA 3UIUA 5EM7A 3EQGA 5GIPE 3ZRKA 2R3GA 4XEYA 4YJOA 5IDPA 4J7BA 5E8ZA 3KULA 3VHKA 4XV9A 5J5SA 2XP2A 3UO6A 2V55A 3QRUA 2VWBA 3ZO4A 3FHRA 2XEYA 2ZV8A 2YIQA 2GHGA 5EDQA 4H1JA 4LOQA 4WNPA 2C6OA 4O0VA 4Y5HA 5DRDA 1H26A 4GT5A 4KAOA 4BDBA 5IZFA 4UWBA 4ZS0A 3TUDA 4AN3A 3LFSA 3PA4A 4JLCA 3UG2A 3PVUA 2UW3A 5H8EA 3MN3A 4GT3A 2E2BA 3ODYX 3VF9A 4Q9SA 4XHKB 3SXFA 4EWQA 3I60A 2XM8A 3E7VA 4BDHA 4F4PA 4FTAA 3W16A 2PUPA 4CYJA 4TYIA 4YGAA 3W10A 4L01A 3BWJA 4TYGA 5HO6A 1X8BA 3QQGA 2J4ZA 4MAOA 4F6WA 5A4EA 1YVJA 5EKNA 3QF9A 5IPJA 1UKIA 3GU8A 3DQWA 5EYCA 3RAWA 3WF5A 4F63A 3LJ0A 1IAJA 1F0QA 3QCSA 3PG1A 3IGGA 3TNPC 4E5AX 4EH6A 4JBPA 4CV8A 5CSPA 4EYJA 4O1OA 4MWIA 4M67A 3R8MA 4S2ZA 5IG1A 2VNYA 3OCBA 4ZTLA 5L2WA 4G3CA 3UP2A 2H96A 2VWYA 5E90A 3UNJA 4X3FC 2O2UA 4F64A 5HBJA 2X6EA 2O3PA 4EL9A 3QWKA 2NRYA 5E8TA 1ZXEA 2P4IA 2KTYA 2UW7A 3C7QA 4S30A 4NL0A 4I0RA 4BRXA 1YI6A 2X0GA 4OAUC 3EQFA 2ITWA 3NAXA 2OJGA 2XJ2A 3P79A 4RG0A 4I5MA 4PWNA 5FEEA 5L2TA 3BYUA 2FH9A 2VZ6A 4GCJA 4ASDA 4UALA 2GNIA 3GENA 4G2FA 4WSQA 5AP6A 2XYUA 5DR9A 2VTHA 1W82A 4U6RA 4PDPA 4DAWA 3WF8A 2CLXA 2BPMA 3QD2B 4D1SA 1ZYDA 3DU8A 4UBAA 4F0GA 3VHEA 4RWJA 1UVRA 3BELA 4V04A 5HU3A 3GGFA 4C4JA 1AQ1A 4DG3E 4MXZA 2P2HA 2BAKA 5EI2A 3IKAA 3OY1A 1CDKA 4G9CA 3EYHA 2OIDA 1GAGA 4ZSLA 4BBEA 4A7CA 1STCE 3BGPA 4AGCA 2PMLX 2BKKA 3MFUA 4LFIA 3S1HA 1QMZA 4RVKA 4AT4A 2R5TA 5EDRA 5GNKA 3W2CA 4MHAA 5CSVA 1KV1A 4F7SA 1TQIA 2BAJA 2OJJA 3FYKX 4LYNA 3LCKA 3QTWA 4G5JA 3CP9A 3ZLSA 3ZSHA 4GJ3A 2JBOA 3F7WA 4G5PA 1GOLA 3NUNA 4RJ5A 1UNGA 4UXQA 3C13A 3EQBA 3G5DA 5E9EA 1TQMA 4IX6A 5CEPA 3PXQA 4FSWA 4LRKA 3QX2A 2Y9QA 4JJRA 5K9IA 1JVPP 2PYWA 4EOIA 3BEAA 5LMBA 2W9FB 3Q2JA 2J9MA 4FNXA 1WVWA 2PVRA 1JWHA 2ZAZA 2PMIA 4NSTA 4RX7A 5GZ8A 5CI6A 4FZ7A 4FTIA 5ETIA 4I6HA 1PJKA 5CU4A 1OBGA 4DH8A 4FI1A 5DT0A 4AW1A 5IA3A 4BBFA 4K11A 3JYAA 1JKSA 2BDJA 3A7JA 3PXYA 4J8MA 4EHZA 5IQFA 4TYEA 5K0KA 1K2PA 3AC3A 5JQ8A 4D5KA 3IW8A 3S3IA 3UTOA 2X7OA 5HCZA 4U97A 3RAIA 2QOLA 5JRSA 1BL7A 4DCAA 3C9WA 4YJNA 2WGJA 3E88A 5ANDA 3NR9A 3PIXA 3DXQA 4FT9A 3CQEA 5FEQA 5L6PA 4JG8A 1APME 1WVXA 3LXPA 5JFWA 4BDCA 4I3ZA 2CKPA 3R6XA 4BTMA 4EHVA 4BCPA 2QG7A 1H1QA 3CJGA 3FI3A 2JAVA 4HYIA 3LKMA 2EWAA 3E8DA 1YHWA 1Q97A 2ZMCA 4F1OA 1M2RA 3IDCA 1XBBA 2WOUA 1PMNA 4X2KA 3NYOA 3TNWA 3MESA 4NU1A 2R3RA 3KRXA 2XJ1A 5D41A 5E8SA 5TE0A 3TWJA 3CC6A 4BY9E 1WBTA 2EVAA 4R3PA 3Q3BA 4BDDA 5BVNA 3R1NA 3LQ3A 1LR4A 1PHKA 3IQ7A 4FSTA 4Z7HA 4ARKA 1Q62A 2XCHA 4OTQA 5KZ0A 3TZ7A 4O84A 1OKZA 1OVEA 4H39A 3VBVA 3FI8A 1ZARA 2PVFA 4WO5A 2YZAA 4O2ZA 3RPVA 2QOQA 4OTGA 4CRLA 2CGUA 5JSMA 1ATPE 2HZ4A 1PMUA 4XUFA 2VGOA 2ITZA 4MBJA 2BTSA 2G2IA 2H9VA 2QCSA 4FTUA 4QTDA 4HNFA 3ORMA 4I0SA 3VC4A 3ZC5A 3QHRA 1YHSA 2Z7LA 1IA9A 3DTWA 4G9RA 2ITUA 3CXWA 2CNVA 2JDSA 3FZSA 4KS7A 3WF7A 4AP7A 3R0TA 4RIWB 3FC2A 3IW7A 5M09A 2WO6A 4EHEA 4EOOA 2CKQA 3A60A 4N4SA 2PUNA 1PXNA 3H9RA 4IQ6A 5GIOE 3PA5A 3G90X 3FQEA 4JX7A 4A9SA 4TNDA 4OW8A 4D2RA 1YW2A 4EK8A 3F5PA 1I09A 4BF2A 3ZUVA 1FMKA 3UIXA 3U6JA 2QR8A 3G51A 2YAKA 4RQVA 5A6OA 4UV0A 5J5TA 2VTOA 4GSBA 4RX5A 2QONA 3EH9A 3A2CA 4KIOA 4QTAA 3PP0A 5AV2A 3NYNA 5F9EA 3U51A 3KK8A 3E62A 4G1WA 5HE0A 2Q83A 3DBCA 4JBQA 2IPXA 4O6LA 3FLZA 4CFUA 2A1AB 4OTFA 3QXOA 1SNUA 3HYHA 4YZDA 4QQTA 3S00A 2G01A 2WTJA 3GB2A 4J53A 2W1DA 4FSNA 4IW0A 4FV0A 3Q52A 5AP2A 3ZRMA 4AW5A 4C36A 5JGBA 3UOJA 2Y7JA 4EONA 4AX8A 4U79A 3SD0A 5AEPA 4CKIA 2WAJA 3HMMA 4YTHA 2WMSA 3A62A 2EUFB 2FSOX 1HOWA 1Q24A 2JIIA 3I5NA 4JDIA 4QMPA 4DF3A 4IFGA 2BUJA 1RQQA 3DV3A 5HX6A 3JVRA 4KSQA 2V22A 4QMQA 5CEKA 5FLFA 5M56A 5CF4A 4CCBA 4WG5A 5L8JA 4D28A 4PTCA 5EHLA 3RAHA 5LVOA 3I6UA 2DWBA 2GNLA 3D5VA 4YC6A 2WTKC 5ANKA 1ZMVA 5AIRA 2CNQA 1R39A 1NA7A 4C34A 5CF8A 3V5WA 4PTEA 4QPMA 2C5NA 4GT4A 4KNBA 4J98A 5CYIA 2VAGA 4ZSJA 5J87A 4JR3A 4LGDA 2YCFA 4AFEA 4PNKA 3WZKA 5KCVA 5HE1A 5LMKC 2W96B 4IFCA 4C62A 5L2IA 2HZIA 1PXKA 5BVFA 4PDSA 3VUKA 3TDVA 2C6TA 3T9TA 2C3LA 1UWJA 3NW6A 5HU9A 4RFZA 1YI4A 4C02A 3DS6A 4W8EA 3C1XA 4XMOA 5EW3A 1MQ4A 4IH8A 4CFXA 4CYIA 4PTGA 4IEBA 4DGOA 1V1KA 2XJ0A 3RM6A 3TL8A 4UXLA 4C4EA 5CXHA 3UDBA 3H0ZA 4YP8A 3DKOA 3SC1A 2VTIA 4DG0E 5C8KA 2WELA 2V62A 4BTKA 2ZM3A 2VO3A 1GJOA 4MX9A 3ZUUA 3PVWA 4R5YA 4BWXA 2HZNA 4QMXA 4U80A 4UEUA 3PVBA 4FMQA 2RG6A 2YCSA 1SMHA 5CQUA 5C26A 4IM3A 2F7EE 5D12A 5DT4A 4F7NA 4GW8A 4X3FA 4FF8A 2WEIA 3MY5A 5FP6A 1JOWB 4D55A 2C5OA 1OKVA 2WTCA 4GRBA 1H0VA 3E3BX 4DFXE 2XCKA 1WAKA 3OWLA 2GCDA 3QKLA 4EEVA 3MVJA 3TIYA 4DFBA 3Q4UA 1MUOA 3UOLA 4ZZMA 3LFBA 5FDXA 3ORTA 4EH7A 4M0YA 2Z60A 4CZUA 2RKUA 2PZYA 2I0HA 2IWIA 3IDPA 4OGRA 4QQCA 5IUHA 2OG8A 3GP0A 3PZEA 2BVAA 2Z2WA 5IKWA 4DH5A 3D9VA 3V5TA
chains in the Genus database with same CATH superfamily
4UN0C 5BYLA 2A27A 4NM5A 3RKBA 2R7IA 4HVHA 4DFUA 2C4GA 3PPZA 4DT8A 4I5CA 4AWIA 1OGUA 5HO7A 3FZTA 4QYEA 3R9DA 3R8ZA 1PXPA 1R3CA 2W7XA 2XNPA 2X81A 3PY0A 5CSHA 5T68A 5L8KA 1YXVA 1H07A 2I7QA 3ENHA 3OXTA 4NKSA 4PV0A 1TQPA 3LCOA 3RNYA 3V8WA 3BBTB 4EYMA 5LQFA 2JKKA 1MP8A 4MH7A 4LOPA 4V01A 4RRVA 2R0UA 5C27A 3IONA 4J96A 1H24A 2WU7A 2X4FA 4YPSA 4AOIA 4G16A 5D10A 4NUSA 4ZTMA 3KB7A 3P23A 3HMIA 4OTRA 2G2FA 3LE6A 1A48A 3PXRA 3O51A 4DN5A 4NEUA 5DH3A 5HEZA 3TJCA 5CENA 5BNJA 3PSDA 1WBPA 4OLIA 3N9XA 2PVNA 3OS3A 3QYZA 4AZEA 4FOCA 2WQEA 2UZLA 5F1ZA 3PXKA 4IDTA 3P78A 4TYHB 2PSQA 3K3JA 4IB3A 3H4JA 4MNEA 4RA4A 4TY1A 3TACA 2WEVA 2FA2A 2PK9A 3R7IA 3ZCLA 5CU0A 4KIKA 4N57A 2RGPA 3BGZA 4J52A 3E93A 4O91A 1U54A 3QKKA 3EN6A 4GU6A 4LV5A 1ZMWA 5DOSA 4ZIMA 4E6QA 3A8WA 1JKLA 4H3BA 5A6NA 3RMFA 4GFMA 4OT6A 4YURA 2I0EA 5EFQA 1CKPA 3DFAA 2GHMA 2FUMA 2UZBA 2XZSA 3QRKA 2WXVA 5E91A 5HLNA 4ZLOA 4FGRA 1YXSA 3PJ3A 3R04A 4YLLA 4DGMA 1Y6AA 4DBXA 2C68A 1FVRA 4FA2A 4PNIA 2PMNX 4RIXA 3ZO1A 2B9FA 5K4JA 3OOMA 1W83A 2WTKB 3ZUTA 1WMKA 1WBSA 3FKOA 3O8UA 4RQKA 3U8WA 3V51A 2FB8A 3RM7A 2W1IA 3CQUA 4NCTA 4EUUA 1RW8A 2W5AA 4YHJA 5A14A 2GTMA 5M4CA 5KMMA 3MFRA 5JGDA 5DVRA 2BILB 4GL9A 3BWFA 2YM3A 4YLKA 4E73A 2X8EA 5J7BA 4QP3A 5BYYA 4AAYA 4LG4A 4K8AA 3HX4A 2QOFA 3CPBA 4I23A 3ZC6A 3QALE 2YM5A 1LEWA 1XO2B 1UU7A 5B2MA 3BV2A 3PXFA 4Y95A 3PIYA 3F3UA 2RFNA 4I21A 4AW2A 4KABA 1L8TA 2HENA 4L3PA 2HXLA 4AN9A 1YQJA 4JI9A 2PUIA 4MXAA 3NNXA 4EK5A 3IS5A 4FUYA 3H10A 4YU2A 2J90A 2WHBA 4O7TA 2QHNA 1CTPE 4L46A 4FK6A 4R5SA 4WD5A 4D0XA 5KMLA 5IQCA 4AA0A 5TT7A 4LGHA 3PRIA 5FGKA 4Q5EA 4E4XA 3MV5A 3D94A 3MFSA 2BMCA 2X7GA 3BU3A 4M13A 4QP1A 5HICA 5L2QA 3S95A 3W2QA 3RALA 3ZXZA 3W18A 1RE8A 5FXRA 2B52A 4RFMA 4FV7A 3AC5A 2PVKA 4RIYB 4C0TA 1PYXA 4U8ZA 4FSUA 4X3JA 4H58A 4L45A 4F9AA 1PKDA 1KE8A 2UZVA 4BJJB 4QYYA 4ZTNA 3W33A 4Y46A 4MQ1A 1H4LA 3ZBXA 4O81A 2IF8A 3LVPA 3UC3A 4E26A 3DT1A 5BMMA 5BMSA 5M08A 3ORKA 4EQUA 4LOOA 3NZ0A 4PMSA 4WOVA 4G6LA 2QHMA 4LDTA 4C7TA 4GIHA 4USDA 1BLXA 2W17A 3PP1A 4HZSA 4XCUA 4YSMA 4R78A 1YWVA 2F9GA 4DA5A 4EUTA 2VO0A 2I0VA 2VTRA 3QYWA 2JDTA 2PVMA 3FPMA 3VNTA 4BCOA 4NH1A 1UV5A 2XKDA 4KKGA 4BZDA 1Z9XA 4U9AA 4O7LA 5KUPA 5BUIA 3OBGA 1CKIA 3ZSGA 3G6HA 4TTHB 4FKVA 4O21A 2Z7SA 3R7EA 4B99A 3O71A 3G0FA 3PUPA 5D9HA 5CEMA 5JN2A 5T3QA 2FSMX 5AUTA 3TUBA 3BE2A 3FY2A 3FKNA 5I9UA 3V6SA 4AZTA 4O7VA 3CJFA 3F69A 4NW5A 5AX9A 2JDOA 5CSWA 3IDBA 3E3PA 3R8PA 1XH7A 3CKWA 4TN6A 4YUQA 4FEXA 2W1GA 2ITTA 3QZIA 3TTJA 3VS5A 5C01A 4FR4A 3UYTA 5I9VA 4V0GA 5KBQA 1NT2A 5C8NA 4TKSA 4BDAA 3ORPA 3QGYA 3AXWA 3TJDA 2QOBA 3EQRA 1GIIA 2A19B 3S0OA 4FV4A 4IZYA 4HGLA 4BHNA 2C5YA 2YCQA 4O22A 3AQVA 4YJVA 4AZVA 1JQHA 2DYLA 1PXOA 3OCTA 4I24A 2J0IA 4KIQA 2Y6OA 5DIAA 4ZEGA 3Q9WA 4O0YA 4HYSA 3VWAA 5HTCA 5E8WA 4D4RA 3Q9YA 3GOPA 4EKLA 4YSJA 3H9OA 2VWIA 3V04A 3KVXA 4MXYA 3UBDA 3SOCA 3ZZWA 4D58A 2BIKB 3ALOA 4R3CA 2OJ9A 2WD1A 1GIJA 1V0OA 4FV8A 4EBWA 3P86A 4F09A 4F0FA 3GU5A 5AA9A 4H05A 2XNEA 2CNUA 2PULA 3QCYA 3BLAA 5LMKA 4M97A 2VTPA 1F5QA 4FTOA 3WBLA 3CY3A 4YZBA 2PE2A 3TV4A 4ID7A 5AA8A 5HD7A 2R7BA 2HOGA 3F88A 3ERKA 4MD9E 2VV9A 4QMLA 3OMVA 3FY0A 4LRMA 5HG7A 4D2VA 2DS1A 3BGQA 5KMJA 1O6YA 3DDPA 4Z9LA 4EOJA 3ZMMA 3MH2A 4USFA 5KHXA 4I5HA 1WBWA 1R78A 2XA4A 1K3AA 1LUFA 2GNGA 5DG5A 3T8OA 4J95A 1OITA 1REJA 3EN5A 4IVCA 2VTAA 4X2NA 3Q32A 3KQ7A 2O64A 2VO6A 1OPKA 4GVAA 2LAVA 3VBXA 2AYPA 3KU2A 3UGCA 3VJNA 4EOQA 3R73A 4DGLC 5BVOA 3CKXA 3QLGA 2WMVA 2O65A 3CD8A 3DBDA 3A7HA 4KRDA 4XG7A 3L8XA 5IQEA 1Q8ZA 4GFOA 3SVVA 4L3JA 3DAKA 2X2LA 4DCEA 4FEUA 2XKFA 2OH0E 2X9EA 4QMSA 3MPAA 3RK9A 3CEKA 4FSZA 4IACA 4TWOA 2VWZA 1BYGA 2PZPA 1YI3A 3ZTXA 1V0PA 4FKIA 1NVQA 2VTMA 4ZJIA 5L6OA 4O4CA 3OC1A 4JOAA 4XLIA 3H3CA 2JFMA 3R21A 4FEWA 2I40A 1YRPA 1T46A 4Q5HA 3SQQA 1PMEA 4L9IA 3BYVA 5LVNA 3BLQA 1XJDA 3W2PA 4KBAA 5A9UA 4DHJA 4FIHA 3NGAA 3R71A 4R3RA 5EOBA 3V8SA 4BYIA 2YA9A 4QO9A 4ZLYA 1OIQA 5ACKA 3ZLWA 4U3ZA 5FQDC 4O6EA 1GIHA 1BX6A 2A2AA 3Q53A 4QYHA 2OFVA 3PLSA 4BYJA 4RSSA 3O96A 3F2AA 3GC8A 4XRJA 4D2SA 4CRSA 4FG7A 2BKZA 4PY1A 4LL0A 4IX4A 4DH3A 3MB6A 2XVDA 4C4IA 2OK1A 4EZ5A 4YC3A 5AV4A 3VQHA 4AF3A 4FBXA 1OMWA 4TPTA 3GCQA 4LMUA 4AXAA 2GQGA 4FTLA 3WE8A 2B4SB 3TCPA 4EH9A 4DHIB 2H6DA 2ZV7A 4BZOA 2R3KA 4FKPA 4DLIA 3F5GA 3OD6X 2A98A 3IW4A 4DT9A 4IBMA 2YJSA 3QTXA 4E4NA 3ZSIA 2GQRA 4ENXA 4FTMA 4ALWA 3POZA 3QUDA 3QWJA 1XH5A 1U4DA 2WNTA 2QR7A 3DBFA 3OVVA 3OWKA 3BL7A 3FZPA 2J5EA 3P5JC 3ZS5A 5DRBA 3KRLA 2R3JA 5G1XA 1OPLA 4FYOA 5DN3A 2XIRA 3HA6A 3R8UA 4EZ3A 3AKJA 4FK3A 3N4VA 2JFLA 2BFYA 1Z5MA 5HZNA 2R64A 4KBCA 4KB8A 4IB5A 4MNFA 4EH4A 5BX0A 3NLBA 4IWDA 3RI1A 3PLAE 4OTIA 2Z02A 2YDJA 4AW0A 4ANOA 3F5UA 5M55A 3PY1A 4JX3A 4GEOA 2HAKA 3D4QA 4NK9A 2QD9A 4PUZA 4E3CA 5HE3A 2W4JA 4U3YA 4A06A 4CMOA 3ZFYA 4DEAA 1VLRA 3R7UA 3W0SA 3N4UA 4OTWA 1QPDA 4HPUE 3WYXA 2F2UA 4X21A 3BU5A 1M52A 3LAUA 1JSUA 3D7TA 1K9AA 2Y0AA 4QP2A 1L3RE 3H0YA 3IGOA 3LLTA 3Q9ZA 2E9PA 4O0SA 3R83A 1Q4LA 3RPOA 1J7LA 3ID6C 4EH2A 4DHZA 5AAFA 2C0TA 1W7HA 3ZU7A 2XAOA 2ITYA 5KKRB 2C6DA 3AT4A 4LV8A 4FJVA 4ZMFA 4WUAA 3ORIA 5DE2A 2CN5A 1JAMA 1G8SA 2OI4X 1UA2A 4JBOA 3FMHA 4F70A 2P2IA 4P2KA 3GCPA 3UVPA 4AT5A 3PDTA 3VAPA 3HUCA 4A9TA 4CSVA 3KMWA 3ZZEA 4CNHA 4FTJA 3PFQA 4BI0A 3JY0A 3F3ZA 3D83A 3C5UA 3BZ3A 4E5WA 5A54A 2VTNA 3HA8A 4L3LA 3T3VA 4FSQA 4OBPA 2B9HA 2OF4A 2WMBA 3E92A 5CNNA 3DKCA 3CD3A 4YZNA 3KMUA 4WRGA 3TUCA 2XAMA 3AMAA 2B7AA 2QKRA 2YABA 4KIPA 5EQEA 4IZ7A 2IZUA 4FL2A 4QMWA 4WBBB 4ZLZA 3V5JA 3THBA 1SNXA 3FMMA 4D0WA 5KX8A 4CFFA 5FTGA 3O7LD 3RAKA 4JXFA 4IWOA 4ASZA 3ROYA 5KMKA 4UYNA 2OH4A 3FWQA 4MBIA 3MVHA 5FBOA 1ST4A 3IK3A 2R3LA 5I3OA 2W1CA 2P3GX 3QD4A 4IAIA 4BDEA 3UZTA 3VVHA 4ANLA 3VS2A 4ANBA 4O2PA 3UYSA 3ZH8A 4FKTA 3KMMA 4NJ3A 1OL5A 4G6OA 2XS0A 3JPVA 1RJBA 3NNUA 5EDPA 2B53A 4Q2AA 3ANQA 3MA3A 1W2CA 2WFYA 3KVWA 1A9UA 3EQPA 3HRFA 4ALVA 2W1EA 4F9CA 4NW6A 3GFEA 4U81A 4D4SA 4GIIA 2XK7A 1ZOEA 3UDTA 1WCCA 5J95A 2YDIA 3DJ5A 3UVRA 3R8LA 3FSKA 2XRWA 3NVMB 3CGFA 3TZ8A 3NUXA 3DLZA 4GUEA 3UOKA 3HV3A 2GU8A 3K5UA 3S2PA 3CTQA 4AT3A 3DTCA 1Y8YA 4RZVA 2W06A 3NUPA 4X2GA 3BV3A 4ZTQA 2C0IA 3WILA 4DINA 3L9MA 4YTFA 5JFSA 5C1QB 3UO5A 3AC1A 4LUDA 2RIOA 4TYJA 4NYEA 2X0QA 3EOCA 4FEQA 2BTRA 3BE9A 3TI1A 5HKMA 5L3AA 1YKRA 4G34A 4LMNA 1YWNA 3FI4A 3HECA 3T3UA 5EI6A 3LCDA 4S32A 1OM1A 4DTAA 3DXPA 4W4VA 4JT3A 3SW4A 4AXCA 4C57A 3TIZA 4C4FA 4ZAUA 5DLSA 5AFVA 4ANMA 1CM8A 3QU0A 4BI2A 2XEZA 1OL2A 4NIFB 2WMUA 1PKGA 3QTUA 4CKRA 3KIOC 2JD5A 4RBLA 4C33A 2UW8A 2YITA 3OCSA 2QOIA 4HJOA 1Y57A 3ELJA 2HW7A 5ETFA 3FHIA 4QEBA 5FUTA 5LMAA 4PL4A 3FLYA 5A4LA 5M06A 2W1ZA 1HCKA 5IQDA 2XIZA 3O17A 1NW1A 1H1WA 2YM8A 3P1AA 5DR6A 4FT0A 4PP7A 3NRMA 5AP4A 2IG7A 4B9DA 3PYYA 2RFDA 4ITIA 1WBOA 4QMVA 5B0XA 3RPSA 4OBQA 4YC8A 5BVEA 4BWKA 3DCVA 5HLWA 5E1SA 3NFGB 4FVQA 1XQZA 4UWYA 5GZAA 3LFQA 4R7IA 2ERZE 3OZ6A 4HGTA 4BCKA 4FKSA 3SDJA 4FIIA 3LPBA 4JDKA 5D7AA 4OT5A 4AE9A 3KXZA 2H8HA 3QD0A 4ACGA 2W0JA 2O8YA 3P9JA 3BYSA 2CCHA 3VUIA 5EW8A 3HV5A 4MF1A 4O0RA 4OUCA 3W55A 3FEGA 1JSVA 4Y8DA 4H1MA 2W5HA 4W8DA 3R22A 1ZWSA 2E9OA 1PW2A 3FXZA 4RX8A 1PXJA 2FYSA 4A4LA 3ZO3A 4ZSAA 2CJMA 1GY3A 5EYKA 4EH3A 2VX1A 2VTQA 2PTKA 5K3YA 4ZY4A 3MPTA 4XG6A 4R1VA 5LXMA 5CAUA 5M4FA 1MRUA 3DPKA 3IOPA 2UZUE 1KE5A 4YJTA 5CEOA 3L8PA 3OROA 4IVDA 4WG3A 2PVYA 4ZMEA 3OT3A 1U5RA 2OZAB 2CGXA 3DY7A 5AUXA 3N51A 3ETAA 4XP3A 1VYZA 1M17A 1AD5A 4DEHA 4FKWA 2PPQA 1ZYJA 3BBWA 2P33A 4DGNA 3OUNB 3EB0A 4DFZE 4DEBA 2NYAA 2OW3A 1TKIA 4ERKA 3ZDUA 4IAYA 3LW0A 2F4JA 2WMRA 4FV2A 3OWJA 3G2FA 3PSBA 3FZ1A 4PDOA 3W2OA 4F1TA 5A46A 2Z8CA 3O0GA 4IZAA 1ZOHA 4XOZA 1JBPE 5J1WA 5IEXA 1QCFA 2BALA 4MVFA 4U7ZA 5DBXA 3D14A 5IDNA 3VRYA 3DKFA 5CX9A 3KKVA 4AUAA 4MQ2A 2IZSA 3UDZA 2ZJWA 3EMGA 3HZTA 3Q4TA 4XV2A 2R3MA 2QKWB 3W0PA 4R77A 3FQHA 4MWHA 5DPVA 4C2WA 5DYJA 5JH6A 3SRVB 3QC9A 4FV3A 1FVVA 3BHYA 4S31A 5HD4A 4U5JA 5DWRA 3RTPA 1XWSA 2BRGA 2UW0A 2C6EA 2Y8OA 3IW6A 4KUJA 3OT8A 5K4IA 3TMOA 3E5AA 3TXOA 3QQHA 4N6YA 4RWKA 2OLCA 4L6QA 1V0BA 4WNOA 5CSXA 4O7NA 1OZ1A 4YZ9A 2IW9A 4ALUA 5IH4A 3CE3A 2XNMA 4GYGA 4WT6A 1QPJA 1SVEA 3Q96A 4MXXA 2ZV9A 2YFXA 3PJ8A 1OIUA 3ALNA 5LARA 3FMNA 4QP6A 3G0EA 3KA0A 1DAWA 2C1BA 2YN8A 4JDJA 2Z7RA 4E6AA 5L4QA 5IQAA 4CFNA 3ZXTA 2UZOA 2XRUA 4F1MA 1TFFA 4O7YA 3C51A 5F94A 4KD1A 5HOAA 1Q8TA 3LFFA 4JAJA 5GJFA 5CLPA 5H3QA 3HNGA 4EC8A 1M7QA 3O7LB 2WQNA 1DS5A 4O27B 4P4CA 4IANA 4XP2A 4ZP5A 2C1AA 2ZYBA 1FPUA 3AD6A 2XB7A 4FTTA 4P90A 4FV6A 3EN9A 4XG3A 4E93A 3DBQA 3KXMA 3AOXA 3HVCA 5J9ZA 2GQSA 3RVGA 4D4YA 3NDMA 4QYFA 2J0LA 3ZFXA 3Q60A 4QTEA 5M57A 3U54A 3R1QA 5C4LA 4CG9A 5JFXA 5IEYA 3Q5ZA 4I93A 3CTJA 1Q3DA 3NCGA 1XH4A 3L8SA 3A7GA 2CMWA 4YR8A 5CF6A 3OUKA 5EQYA 4EOLA 3W2RA 4IAFA 5DR2A 2GS2A 3OG7A 4BCMA 2F7XE 2OGVA 3PTGA 4R8QA 4RIWA 5CAPA 1BKXA 3D2KA 5DFPA 4XS2A 3BLHA 4DEEA 4DYMA 5IQBA 3JUHA 4WRSA 2GNJA 2GS6A 5BQ0A 1S9IA 1YXTA 2IZTA 2QOKA 3SA0A 4F65A 3PRFA 3HDNA 1GZOA 3Q4CA 4IVAA 2XM9A 2EB2A 2W9ZB 2AC3A 4MEDA 4XBRA 1IEPA 3BYOA 2HELA 1PMVA 3FKLA 1DI8A 2NNWB 3U9CA 4BGGA 5IA1A 1VJYA 3RBWA 2HWOA 3QFVA 4EBVA 4O4EA 2VD5A 3PJ1A 4O1PA 3UZPA 5HLPA 3RWPA 3VUGA 4ACHA 4DTBA 3IOKA 4OTPA 1H8FA 3CBLA 4FZFB 3R01A 4GKHA 3RGFA 4GJ2A 5H2UA 4BWPA 5IQGA 1LPUA 3NYVA 3F3WA 4FTKA 5B7VA 5H8BA 2B1PA 4M69B 4QMOA 3ULIA 2I1MA 3NWWA 3WF9A 1IASA 3TT0A 3TNQB 4AA4A 2J0KA 4CCUA 3AKLA 3R9RA 3VS3A 3SG9A 2B9IA 5L6WL 3FZRA 3ZLXA 4C37A 4L44A 2YIWA 1UU3A 3K5VA 4J99A 4PP9A 4B4LA 1ZZLA 2GPHA 4JIAA 1H01A 2C30A 2WPAA 3ITZA 2UW5A 3MY1A 4BN1A 3G33A 4HVDA 3QQKA 5B2LA 3EL7A 3QAME 3HP5A 4NFMA 4UMPA 5EW9A 2GSFA 4AOJA 1IR3A 3O8TA 5HG8A 1ZRZA 2J5FA 4IX5A 4NT4A 3SAYA 1ZYLA 4AGDA 3EFWA 3HL7A 4PPBA 4PQNA 5E8VA 2QURA 4ACMA 5AUZA 2IN6A 5CNOA 5M53A 2JLDA 5EI8A 1YDSE 2YJRA 5TO8A 4TWCA 3FLWA 4FV1A 4F7LA 5DA3A 4EKKA 1KWPA 3AC4A 1A06A 2VX0A 3HV6A 4AZSA 2QLUA 1FGKA 4F0IA 5HTIA 4LUEA 5I9YA 5LCJA 2GNFA 2HIWA 3IPHA 5M4IA 2YWVA 4PL3A 3E8NA 4E4MA 3BLRA 5GINE 1M14A 2CPKE 2PZIA 2ZDUA 4IAZA 2JKOA 4M66A 4TNBA 3VS4A 2RF9A 4YJUA 5KMIA 4ZSEA 3TEIA 3WOWA 2R3IA 3LFDA 3UMWA 2PE0A 4O0XA 4A4XA 4MD8E 2XH5A 3BQRA 5HCYA 1BUHA 3R02A 4FODA 4IWQA 3OWPA 1OUKA 3BL9A 4L8MA 2A0CX 3HMNA 2R3HA 5J79A 2XK3A 5LJJA 3LMIA 2AUHA 5HNGA 2YWPA 4ITJA 5M07A 1Z57A 1CSNA 5IA2A 5F20A 2UUEA 1O6KA 3MVLA 3FC1X 5I5ZA 2W1FA 3FUPA 2VWUA 5FEDA 5FWKK 3C4ZA 1NXKA 1P5EA 3QCQA 4M14A 4D9TA 3KRJA 1Y8GA 1OKYA 3WARA 2X7FA 4TWNA 4TRLA 4WHZA 1Q61A 2DUVA 3QRJA 4MXCA 2XKEA 2QVSE 4IJPA 5KNJA 3UIBA 2ZB0A 4E7WA 2W99B 4Y85A 2HZ0A 5FBNC 3O5AA 2PZRA 4HOKA 4S34A 5JT2A 4QMZA 4RZWA 2HK5A 3A4OX 2ACXA 3RK5A 3FMLA 4ZZOA 3RWQA 3VJOA 3D0EA 2RFSA 4QPAA 4J97A 4ASEA 3F5XA 4PMTA 3TNHA 3U87A 4GKIA 4B8MA 2C47A 4L42A 4FSMA 3WZUA 3PJ2A 5BUEA 3OTUA 5IISA 2OXDA 3EFLA 1TVOA 2XANA 4ZTRA 3D15A 2E9VA 4FL1A 1Q8WA 3I81A 4UMUA 5CAOA 4BKZA 4XBUA 3MS9A 3DAJA 4LL5A 5EM8A 1CMKE 5CZIA 3FSFA 4RWLA 3FMKA 4QP7A 3CLYA 3DFCB 4M69A 1VZOA 4J8NA 4DG2E 2R2PA 5EHYA 5BVDA 3EZRA 3SKCA 1P2AA 1J1CA 2OJIA 2XK4A 1PRYA 3PWYA 5C4KA 4Z16A 4I6QA 4JBVA 3MY0A 2BAQA 2OU7A 4L7SA 5IQIA 2EU9A 2OKRA 3HAVA 4P5ZA 5IQHA 2ITVA 5A3XA 2ETMA 5DT3A 3ATTA 3ORXA 2PWLA 4DBNA 1MQBA 4RJ8A 3V5PA 4I4EA 4QMNA 2R9SA 2CKOA 5KBRA 3KGAA 3H9FA 3ET7A 3FJQE 3NUYA 4CFVA 4QTCA 3D2IA 3HV4A 4U42A 3K2LA 3ULZA 3DNDA 4CTBA 1DI9A 4JQEA 2UZDA 3HGKA 4E5BA 2GMXA 2BZKB 3BQCA 4EK3A 2GFSA 4PRJA 4EK4A 2OICA 4TYHA 3AMBA 3PSCA 4UWCA 2QNJA 3A7IA 4P5QA 3KFAA 5HGIA 1UNHA 3QKMA 1WFCA 2Z7QA 3R7OA 2ZM4A 2NRUA 1E1VA 3MA6A 3SW7A 3R7GA 2VWWA 1ZMUA 2OJFE 5M51A 3GVUA 4I5PA 4U41A 3NNWA 4JMQA 5J1VA 4AXFA 4BGHA 4FGBA 3WYYA 5AUVA 3Q2MA 1CKJA 4U40A 4XJ0A 2J2IB 1KUTA 4RT7A 2YHVA 4EWHA 1OIYA 3EJ1A 3OTVA 5KKRC 3FMDA 4WKQA 2VTLA 4BL1A 5DEYA 3LZBA 3TKIA 4AOTA 4C4GA 2E9NA 3PPKA 5DGZA 2UZTA 4DEDA 3KY2A 2UVYA 4TW9A 1FOTA 4WUNA 5KE0A 3KULB 5CZHA 5HCXA 2JDRA 4FIGA 3DBEA 3VF8A 3BHUA 3ENMA 3EHAA 2WIPA 4YZCA 3PWDA 5JZNA 5AR5A 3FLNC 2JIUA 1YXXA 2XF0A 4WA9A 1IAHA 1OL6A 4JR7A 2YIYA 1P4OA 3KEXA 4PF4A 2G15A 4BICA 3MIAA 5CXZA 5F4NA 3A4PA 4CZYB 1WBVA 4KSPA 2C69A 4XG2A 4RJ3A 3UVQA 2XALA 3WZEA 4CMUA 4I6BA 1HCLA 3ORNA 3E7OA 3T9IA 3AC8A 4D2PA 2HCKA 2XIXA 2XMYA 4EJ7A 4YHTA 3R1SA 2WTDA 4ZK5A 2JC6A 2WTVA 4NM0A 4RIOA 3TM0A 5JKGA 2J7TA 1Q99A 1H27A 3MFTA 3C0HA 4QQJA 5AP5A 3MTLA 4A07A 3U9NA 5I9XA 4X6QC 3KN5A 1KOBA 3NUAA 3C4WA 3QBNA 5AR4A 4APCA 4C4HA 3A7FA 3B2WA 5CVHA 3PZHA 5M44A 3MIYA 4KA3A 3VUMA 5CU3A 4RIYA 3R7VA 3K3IA 5D1JA 1W2FA 5EQPA 4JQ7A 4FIJA 3B8QA 3Q9XA 4QMTA 3COHA 5LWMA 3RZBA 5HQ0A 3DK3A 4C35A 2BFXA 4O4BB 3RZFA 2WMWA 5AUWA 3NMUF 1SYKA 2SRCA 4IC7A 4I0TA 5D7VA 4CEGA 1FINA 3DA6A 3JXWA 3O23A 4JQ8A 4C58A 4I92A 5CAQA 3KF4A 5FRIA 3KRWA 3MW1A 5JZJA 3W0NA 4U45A 3GNIB 4B0GA 3ZEWA 2PVLA 4MBLA 4AS0A 5AAGA 2V5QA 3QZHA 2IW8A 4U43A 5FXSA 1URCA 2F49A 3WI6A 3FMJA 2B55A 4EOPA 3V5LA 4DH7A 2VWXA 3FI2A 2B0QA 4CG8A 2X8DA 3OEZA 3DJ7A 5E8UA 3R2BA 4BCGA 4BZNA 3TDWA 2VTTA 4IAKA 3LJ1A 4ANQA 1UNLA 1IRKA 4JG6A 1P4FA 2YISA 3AD4A 4W4YA 5TF9A 3JR1A 1LEZA 2WTWA 2ZDTA 3C50A 4G3FA 3BYMA 5EM5A 3V01A 5I9WA 2PHKA 5CQWA 4YO4A 1H00A 2JAMA 5HE2A 4AACA 1J7UA 1B38A 1R0PA 2Q0BA 5LVPA 2P0CA 4RLKA 4XRLA 5IMXA 2Q0NA 3C4XA 4Q9ZA 3SGCA 5AMNA 4ANSA 1YOMA 1IG1A 2YIRA 3UG1A 5E8XA 3NS9A 4FIFA 3P7AA 1UWHA 5CT7A 5I9ZA 3U6HA 4N0SA 4YTIA 1ND4A 2WQBA 2O0UA 4KKEA 2WQOA 4K18A 5JFVA 3AC2A 1Y91A 2OBJA 3R1YA 1JKTA 3PG3A 4PPCA 3FLQA 1H1SA 3UPZA 2J51A 4JL9A 3DOGA 2IZRA 3KXNA 2HWPA 3GQLA 4BDFA 5IU2A 1W84A 2C6IA 1XHAA 2WTIA 4J1RA 2JITA 4DC2A 4ORKA 2VRXA 2QU5A 4IWPA 3UNKA 2YAAA 2NO3A 2C6KA 3MTFA 1NVRA 2B54A 4IHPA 4NKAA 4BGQA 3LM0A 1GNGA 3LXKA 4L68A 3GU7A 1T45A 3PJCA 5CT0A 2WIHA 3HUBA 3IO7A 3R7YA 1PXIA 2I0YA 4RJ7A 2FGIA 2W05A 4FVPA 4XOYA 3VUDA 3F9NA 3DNEA 4O4FA 4AN2A 3LFNA 2FO0A 2H34A 2ZB1A 5FD2A 4FSRA 5HG5A 2C5VA 5AP1A 2ITNA 4F78A 5IA0A 5IH6A 4FNWA 2FSLX 3F3VA 3EWHA 3L8VA 3LFAA 5AADA 3NX8A 3KK9A 4EOMA 2RFEA 4K6ZA