3OMVA

Crystal structure of c-raf (raf-1)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
276
structure length
264
Chain Sequence
b'YYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAF proto-oncogene serine/threonine-protein kinase
publication title RAF inhibitors prime wild-type RAF to activate the MAPK pathway and enhance growth.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 64
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3omvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3omvA01
3OT8A 4Y95A 3UPXA 4F09A 5DYJA 3MJ2A 4USEA 4YTCA 4U80A 5ICPA 1J1BA 1WVWA 3FLZA 2WTKB 5LJJA 1A06A 1OMWA 1QPDA 2J0MB 4L7FA 5CAQA 4FT5A 5D12A 1FVTA 4CCUA 2C3KA 2XCKA 3EN6A 5E8VA 2GNGA 5CNNA 2C5VA 4GCJA 4IX6A 3P9JA 3S1HA 3ORPA 1OKVA 2WQBA 2C5OA 4R3PA 4BWXA 2C1AA 3FMMA 5FEQA 3RMFA 4BCMA 4QMYA 2X7OA 1ZMWA 4FSNA 4CYIA 4NL0A 3OOMA 4TTHB 1JPAA 4XRJA 3R1YA 3R9HA 4D9TA 1MRYA 2GTMA 3KL8A 1M2QA 5IQIA 3BX5A 5IA1A 4QPAA 4E1ZA 1XH7A 5EI2A 2E2BA 3EKKA 3D14A 1YWNA 3OXZA 3VBYA 4A4OA 4DEHA 3KREA 3ITZA 4LGHA 1MRUA 4FNYA 5I0BA 1SM2A 1NY3A 2W1FA 2WEVA 4BKYA 3MS9A 3C4EA 4CTCA 3U6JA 3VUGA 3VS3A 4AA0A 3MFSA 4BIDA 3BU3A 2BDJA 2I0EA 2VTJA 2ZJWA 3PVGA 5CU6A 4X3JA 5FM2A 4BDCA 5CAUA 4FUXA 4IAZA 2CN8A 2R3FA 4GUBA 4G3DA 5E4HA 3LJ2A 2IZRA 4QTBA 4IM0A 2NNWB 1M7QA 4J98A 4QNYA 1QCFA 3RHKA 2WU6A 3NYOA 3DXNA 2YIRA 1V0OA 3FWQA 3G6GA 5DBXA 3R7EA 5HZNA 1T46A 1UNGA 1H8FA 3FZTA 3MH3A 2X39A 4TY1A 3UO5A 2H34A 5E90A 3QKKA 4QMXA 3DTCA 3V6RA 1KE9A 3VHKA 5HG8A 4HVHA 4NM3A 5KUPA 1MQ4A 4D1ZA 4M67A 3WI6A 4ITHA 4TYGA 3DAEA 4XRLA 3R8VA 5HGIA 2ONLC 3A7GA 1IAJA 4XEYA 4PTGA 2IZUA 3CPCA 1WBSA 4ZZNA 4DAWA 3GB2A 4RWKA 4A9TA 3IW5A 3OW3A 2EWAA 4U97A 4WA9A 3U9NA 4JAJA 5JGDA 3PTGA 3O96A 4FTIA 2XMYA 4FV5A 3G33A 4B8MA 2Z02A 4FTCA 3NNXA 1H4LA 3PXKA 3P23A 4GJ2A 3OF0A 3D5UA 4G6LA 4BIEA 5AUZA 4I21A 4RVTA 4E4LA 4F0GA 4K9YA 4AZSA 4YJUA 5M09A 3EZVA 2WTKC 1KOBA 4AGUA 4GYIA 2GSFA 2C6LA 4FZ7A 2JIVA 2P3GX 4WNMA 1URWA 1ZMUA 3CY3A 3E88A 4TNBA 4RX5A 2GQSA 4F08A 4WKQA 2R3PA 4F6WA 5AMNA 3FAAA 5C1QB 1H28A 4YSJA 2VNYA 2FA2A 5FP6A 4UWBA 5GJDA 3THBA 3FBVA 4U44A 4U40A 3PP0A 1Q8UA 4DH5A 2F7ZE 2X8IA 3SV0A 1YHVA 4IFGA 3TKUA 5AEPA 3QGYA 5HE0A 3C5IA 3QCYA 3NUNA 4C62A 4LFIA 4PL3A 3OCBA 3F3TA 5EI6A 3CR0A 2CNVA 4L67A 4AZVA 4L42A 3QUPA 5HI2A 4ZJVA 1YI3A 3RWQA 1PY5A 4DINA 1QPCA 5E1EA 4YLKA 3FMHA 5HNGA 2HAKA 4O0UA 3U6IA 4CEGA 4RPVA 4UMQA 3N4VA 3A7JA 3E63A 3UNZA 2BTRA 3R9DA 4LUDA 2C5YA 2XUUA 3HL7A 2ZV8A 4MNEA 4MQ1A 3QLGA 3HKOA 5AFVA 5DHJA 3ZO2A 1F5QA 3ZUTA 2B4SB 4M84A 3OP5A 4MNFA 2X4ZA 3FJQE 3FSKA 3QD0A 4BGHA 4MBIA 3ATTA 2YWPA 1WZYA 3MB6A 5AUYA 2VTIA 4R7BA 4RIXA 4BDHA 3DGKA 3SHEA 4AW1A 4GU6A 3OBGA 3NUSA 4OUCA 2W05A 4FV6A 4Z7GA 4FODA 3PXRA 3QC9A 3KVXA 3R8PA 3V6SA 5GJFA 2C6TA 4YTFA 4YJQA 1U59A 4AE9A 2I1MA 2UVXA 3F66A 3VRYA 5FQDC 2PUNA 4JDHA 3QQFA 3DZQA 5E91A 5FLFA 4LV8A 3TIYA 5KNJA 2BRMA 3A2CA 3EQIA 1RE8A 3RAKA 3WF8A 2WU7A 1LPUA 1NA7A 4R5YA 3RK5A 5AM6A 4EL9A 3ETAA 4EQCA 4AWIA 2PE1A 2WTCA 1UA2A 4L3LA 5DI1A 4JAIA 5HKMA 4CKIA 3I1AA 4CQGA 4ZAUA 2G9XA 5CAOA 4K6ZA 2KULA 2NPQA 4A9RA 3MBLA 4I22A 5KZ0A 1W0XC 2ACXA 4JJRA 3DXPA 3W2SA 2RFSA 3DT1A 1J7LA 1WBPA 5IKWA 4PWNA 4HVIA 3R28A 5AP2A 2PVLA 3FMLA 3DFAA 4FEVA 1UVRA 3DQXA 5BYZA 4HYIA 5EG3A 4DH7A 4YC6A 4E73A 5K4JA 4D2WA 5CSXA 4X0MA 3A8WA 3H4JA 5IA0A 3PE2A 4RC2A 3WF7A 4UYAA 2QOCA 3F3ZA 4YJVA 3FKOA 4FVRA 4DBXA 3BLHA 3A7FA 4HVSA 4D9UA 4E20A 4IVDA 4GRBA 4OBOA 3VUIA 4E6AA 1XH6A 3MI9A 3FYKX 1NXKA 5DR6A 2R64A 2W1HA 2AYPA 2OIDA 2X8EA 3G0EA 4JQEA 3RPRA 4APCA 4BDBA 4CFXA 2EB2A 3OEZA 2PMIA 2WMTA 2XP2A 3FZPA 3PJ8A 4D28A 3ODZX 1KV1A 3DBQA 3LCSA 4FKOA 4BCPA 4CGAA 4RIYA 4DE4A 2UW3A 4JDKA 4XH6A 5EKNA 3KC3A 4O84A 2JEDA 4IZYA 3EJ1A 3R7OA 1F3MC 2WGJA 3PY1A 3V5PA 4IAAA 2ETRA 1WAKA 2XNGA 4BGGA 5BVDA 2NRYA 3IK3A 5EM5A 5EYCA 1OPJA 3MIYA 3NX8A 5KO1A 4L45A 4LRKA 5CVGA 1Q99A 3R2YA 1BKXA 3FC1X 4NK9A 4Y83A 4BCJA 4CZTA 4DT8A 2OU7A 2JDSA 4I23A 3A99A 3GEQA 1FPUA 3R7YA 4GFMA 3V8SA 4LI5A 3KRJA 1NW1A 2QLUA 5H9BA 3MVLA 3ZMMA 4O21A 4ZS0A 2VTNA 5FBNC 4DT9A 1OIQA 2R3JA 5HEZA 3IS5A 4Q5HA 4IWDA 3VC4A 2Z2WA 3ORLA 4O2ZA 2V5QA 4TYJA 2XM9A 1QPEA 5E8XA 2YM3A 3DBEA 3O7LB 3AC3A 4O6EA 4K18A 3KN6A 3RNIA 3TT0A 1ZYCA 4ITIA 2DYLA 4BCNA 2ZV2A 4DLJA 1FGIA 1SVEA 2C30A 1EH4A 3LW0A 3OVVA 3UC4A 3TACA 3VS6A 5FG8A 4O7WA 3P7AA 4CFMA 4RFMA 5CEOA 3MA6A 4WG3A 3ALNA 3UJGA 3F5XA 3PLAE 2J4ZA 4NTTA 2F49A 3C4XA 3NZ0A 4XG3A 5BYLA 3EH9A 2C69A 3BEAA 4M3QA 2PU8A 4O1PA 2FSOX 2XEZA 1H1PA 3O51A 1OPKA 1RW8A 4DYMA 4FTMA 1JBPE 4QP8A 2XRWA 4RVKA 3MVMA 4JVGA 5HNBA 3JVSA 4LG4A 3T3UA 4PMPA 3R00A 2FB8A 1PXPA 4M7IA 4PMTA 4D4RA 3NVMB 2VNWA 5AV0A 4ACCA 3GXLA 4BRXA 2EB3A 2YDKA 2VTMA 3QQLA 4E5WA 4FSMA 4HVGA 1JSVA 3QUEA 4RZWA 4CD0A 5I3RA 4L68A 3KXZA 4QMOA 3G9NA 4C2WA 3OCTA 2VO7A 3LE6A 3MB7A 3Q6UA 4ZZOA 3LFSA 1DAWA 4ASZA 3K2LA 5L2IA 3QGWA 2BKKA 1ZYLA 1M2RA 2B1PA 2C6KA 2J5FA 2YCRA 4GSBA 4OTQA 2IO6A 2O63A 4KA3A 3EQRA 5ETAA 4EQMA 2J7TA 3PA3A 3MWUA 3PRIA 4NW5A 4XV2A 3S2PA 4XLIA 4JS8A 2VAGA 4O0SA 4IMYA 2BUJA 5ACBC 5T6KA 4FKTA 5ANOA 2VV9A 4ZSJA 4FZAB 2O3PA 3NYNA 2E9UA 2QOFA 1UU8A 3QQHA 3VS5A 4NFNA 3ALOA 4MCVA 2RFNA 2RG6A 3I4BA 4JG7A 4NIFB 2XBAA 3GC0A 1G5SA 5HIEA 4AGWA 3ORKA 4BCFA 2JFLA 4IWOA 4BCIA 3G5DA 4NM0A 4PUZA 3RWPA 5ETCA 2Z7SA 2WQEA 3ZBFA 2OSCA 4CV9A 4I5MA 2IZSA 3DKCA 3GU7A 3W18A 4AG8A 2IW8A 1WVXA 2JIIA 4M69B 4R6VA 4P5QA 3RPVA 2ZAZA 3BWFA 4CG8A 5IQCA 4AUAA 3QRKA 4F9AA 3EN5A 4CRLA 3LXLA 2YDJA 3WIKA 2JIUA 3OEFX 3QRJA 4O0VA 3FMJA 1HOWA 4DEEA 3A7IA 2H96A 3K5VA 3BBTB 1GIIA 3EL8A 3EN9A 1U54A 2Y6MA 3PXQA 4I20A 2HXQA 3RINA 5M56A 4FVQA 4M97A 1ZYDA 4WBBB 3L8SA 1ZYSA 4DEDA 5C26A 4FC0A 2QNJA 3MV5A 4N70A 4UEUA 4OTGA 3QCXA 3CTHA 5CI6A 1Y6BA 4DFYA 3QQJA 4BCKA 1PXJA 5KHWA 3JUHA 3F82A 4WIHA 4MWHA 4QMUA 4DN5A 5A54A 5IDPA 3L9MA 2F2UA 2QVSE 4YTHA 2ZM3A 5TT7A 1Q61A 3SOAA 4BDIA 4JG8A 3IO7A 3Q4TA 2IW6A 5B2MA 4P7EA 5DT3A 1OUKA 5EKOA 3WZJA 2ZVAA 4EEVA 2AC3A 1HCLA 3BIZA 5EOLA 4AT3A 4D5KA 4O7RA 3VVHA 1UNLA 2QC6A 2H9VA 3EQDA 3F7ZA 5A4EA 2R2PA 4Q9ZA 2HIWA 2W1DA 3FXWA 3LLTA 4O6LA 4OTIA 4O7SA 3O8UA 4MVFA 4FTRA 5IG1A 4H1JA 3VF9A 4HZRA 4AZTA 2JKOA 3ULZA 1DAYA 3D2IA 3I7CA 5HCYA 3VF8A 2QG7A 2QONA 3FZSA 3ORZA 4ALUA 4KKGA 4FTTA 4E26A 5IMEA 3WILA 3HV5A 4ANSA 2KTYA 1OL2A 3IW6A 3BELA 3BBWA 2WFYA 3B8QA 5D9HA 3AQVA 4AFJA 5BVNA 5IA4A 5K5XA 3GU4A 3OT3A 4ZK5A 2JDRA 3KU2A 5IH6A 2GS7A 3V5JA 3PUPA 2WHBA 3AGLA 4APPA 2ITWA 5IQFA 4FZFB 1DI8A 2F2CB 5KBQA 4YC3A 5A4LA 5AR5A 4O0YA 3TV4A 4ASXA 2I40A 1XR1A 3QBNA 2GDOA 2Y9QA 4K11A 3UO6A 5CSWA 3F6XA 3MFUA 2OJFE 1OB3A 2BZKB 5FEDA 4QMQA 1S9IA 1BL7A 4RMZA 4YC8A 1XQZA 3LCOA 4U43A 2B9HA 3ZZWA 3ZM9A 3BI6A 3UPZA 2CLQA 2BHHA 4I6HA 4RBLA 4F6SA 1GZNA 3K5UA 2X2KA 4IM3A 5JFWA 3BPRA 3R01A 4EHGA 3HUBA 2R3HA 4NJ3A 3QC4A 3JVRA 3OUNB 3P08A 1U5RA 2ZMCA 5C4KA 3C0HA 2ONLA 5A4CA 3DPKA 4IB0A 3WE8A 4DG3E 3BEGA 5BUEA 5CI7A 3F3UA 2GS6A 4FZDB 4AZFA 4I93A 2UW4A 3ZONA 1P4FA 4AGDA 3Q96A 5JZNA 2PUPA 3DXQA 3F61A 2ZMDA 2YA9A 3TN8A 1YKRA 3CEKA 4S34A 5FTOA 1FINA 4O38A 4ZJIA 4BZNA 4ERKA 4FTQA 3VUHA 4S30A 1DM2A 3NLBA 4O2PA 4S31A 3GCVA 4I4FA 2OO8X 5HU3A 2HY81 3HRFA 5JGAA 4F7SA 4E7WA 5HE3A 4CV8A 1ND4A 2OH4A 2A4LA 4IVCA 4FIJA 2WMUA 2ZM4A 4F70A 4YP8A 3UQGA 4RFYA 3QD4A 2R3KA 3QQUA 4MD7E 1PF8A 4IXPA 3RPOA 5HHWA 2BVAA 4C4EA 4FE2A 5M08A 2BFYA 1Q41A 2RFDA 3NDMA 3OD6X 3ORTA 4LL5A 1QL6A 3CCNA 3JXWA 4QQJA 3MA3A 3RAWA 1IASA 2PVNA 3NPCA 3KN5A 4PNIA 2R7BA 4AS0A 4CFFA 4FT0A 5BVKA 4CVAA 4ASEA 5DMZA 3W2CA 1QMZA 4JG6A 4KRCA 5AAFA 3BU6A 3M11A 3COHA 3K3IA 5CWZA 4AA4A 2UZOA 4GVAA 4KBKA 4OR5A 4U42A 3AC2A 4W9XA 1Y57A 3Q9YA 3MFRA 2ESMA 1H25A 4KKEA 3F88A 5EDRA 5JSMA 5DVRA 4CLJA 4I0TA 3UVPA 4JL9A 5D10A 3LPBA 5L2WA 3Q60A 3H9RA 5I9ZA 2JC6A 4AP7A 5I9XA 4G9CA 4MXCA 2OW3A 2JKMA 2CLXA 2XEYA 3E7OA 4OTFA 2WEIA 2XS0A 3P7BA 1PXKA 3AT4A 5CVHA 3ODYX 2I7QA 3LJ0A 2VTSA 4UMRA 4F1MA 5JN2A 5LMAA 5IEXA 4F9BA 3PWDA 3EFJA 4LRJA 3QHWA 2PSQA 3G51A 3ZCLA 4YJNA 5GHVA 3RPSA 5EYKA 2W1ZA 4IANA 1OIYA 2YIXA 5HORA 1H24A 4GMYA 2XB7A 5BMMA 5H8GA 2XJ1A 4CKJA 5BPYA 4BCHA 3I6UA 5HQ0A 4F7JA 2J0KA 5FTQA 4H58A 4CKRA 3G90X 5E8YA 4P5ZA 5C8MA 4KD1A 4PV0A 3NRMA 1U5QA 4DFXE 2I0HA 3G6HA 4E6DA 5K5NA 4L3PA 1PMVA 1ZWSA 4L6QA 3IGOA 3DCVA 3H3CA 4FTJA 4ZTRA 5A3XA 5CF6A 2OJJA 3LCTA 2XNOA 5CENA 4AX8A 1YRPA 3R6XA 4O83A 4BB4A 1DS5A 2BR1A 4LYNA 5CYIA 4RJ5A 4IC8A 5J9LA 4CMTA 5AUTA 3BRBA 4QPSA 2PUIA 4U81A 2W1IA 2UUEA 3IKAA 3HV6A 3QTWA 2W4JA 4TWNA 3EQBA 3IOPA 5HO6A 4Z16A 4YBKA 1JNKA 4F6UA 3HMOA 3NUPA 4D4VA 4C7TA 2VWZA 4EOQA 3F5PA 4V01A 5EDPA 1YXUA 1OITA 3UOHA 3GFEA 3MH0A 5EW8A 3R8MA 3VQHA 4Q5EA 1E1XA 1ZYJA 2QO2A 3SA0A 1UKHA 4Y5HA 3LFAA 1G3NA 3ZS5A 2ZOQA 4AN9A 4BI0A 5FXSA 5AUWA 3R7UA 2VTQA 2P33A 2A19B 3D7ZA 3TM0A 4IADA 2GNIA 3OTVA 3R63A 4MD8E 4NM7A 3DFCB 3FLQA 5AM7A 3REPA 1BX6A 3LCKA 5CU4A 4ORKA 2CGWA 2UZWE 2RL5A 3E62A 4TW9A 4BBMA 5EM7A 4NJDA 2HZ4A 2XA4A 4TPTA 4EBVA 4EK3A 4FEWA 2G2HA 3HV3A 4U3YA 5DA3A 4C34A 3ROCA 1Y8GA 2CMWA 2J2IB 5G1XA 3P0MA 3QA0A 5IUIA 3TV6A 4YSMA 3U4WA 2OZOA 3GCUA 4PNKA 5BVWA 3D5WA 2QOHA 5TOZA 4AACA 4XG4A 2G2FA 4IWQA 3O71A 5EI8A 5I5ZA 4YJSA 2WMWA 3PDTA 1OI9A 3CP9A 4BZOA 3FMNA 1OECA 2WNTA 5LMKA 1H1WA 4QT1A 3II5A 4ANQA 4O0XA 4FEUA 1Q8TA 1JLUE 3PIZA 5CEPA 5F4NA 3N4TA 3EKNA 2C6OA 5ANJA 2UZUE 4IACA 3SOCA 3SQQA 1Z57A 4ZTHA 4EQUA 1WBVA 1TVOA 3KCKA 4TYEA 3ATSA 2NRUA 3QTZA 2OBJA 5JMSA 3A4PA 3TV7A 3ZLWA 4WT6A 1FBNA 3LMHA 2HK5A 2OZAA 1R3CA 1YXTA 3S0OA 4BY9E 1R0PA 4E8AA 4EC8A 5J1VA 4YZCA 3WOWA 3FMKA 2QKRA 4GJ3A 3DB6A 4J96A 3ZEWA 1XH4A 2VO3A 3KVWA 4GYGA 2C0OA 4BCOA 2EXMA 2P55A 3OG7A 2BRGA 2JBOA 5CSVA 5M4UA 2YM4A 3PJCA 5HX8A 3R22A 3HMPA 4QTDA 3WZEA 3ANQA 2WMSA 4S32A 4C57A 2CNUA 2R3IA 5LWMA 2V22A 2X8DA 2W5BA 2C3JA 3QXPA 2PVKA 2WMRA 3RZBA 1E1VA 4C8BA 3R73A 5KMKA 4JQ8A 4DG0E 2ITYA 5EHYA 1G8SA 4P90A 4JT3A 1J7UA 3U4UA 3UQCA 4RJ6A 4E5BA 3AG9A 5L2TA 2YACA 5D1JA 4FV4A 2BPMA 4IWPA 4M15A 2VD5A 4RWJA 3RM7A 3V5LA 2QCSA 4C2VA 3NR9A 4AF3A 2C5XA 3FY2A 4Z7HA 4BL1A 3H10A 3OFMA 3CIKA 5DIAA 3PXZA 5LMBA 1BL6A 4KABA 3QL8A 4JX7A 2F7XE 3R02A 5HTCA 4JR7A 3NVKI 3MY1A 2R5TA 5D41A 2CKOA 4MAOA 2PL0A 5J5SA 3EQPA 4KRDA 3ZDIA 5EQPA 3RP9A 1T45A 3GT8A 4BIBA 3IPHA 5H8EA 2UV2A 2FSLX 1YDSE 4GFOA 5TR6A 3SXSA 3ZHPC 3LHJA 4TWOA 4DFNA 5M57A 4O1OA 3FHRA 2EU9A 2WAJA 3DLZA 4RRVA 3UNJA 5BMSA 1XH8A 4DEIA 1XWSA 2O8YA 1PRYA 1YHSA 4FKSA 1JOWB 2HENA 5IPJA 2W9ZB 4HVDA 4AAAA 1Y6AA 5CQUA 3MVHA 4ASDA 4PRJA 3NIZA 2O5KA 1IEPA 5A4TA 2JLDA 4BCGA 3BKBA 3ZTXA 4XG2A 4FKPA 4L00A 4F1TA 1LP4A 2PTKA 3ACJA 3BYMA 3DJ6A 4YUQA 4H1MA 4YMJA 5C27A 2WOUA 2VTHA 1RJBA 3E92A 4KINA 1Q5KA 1GY3A 4PMMA 2PWLA 4RJ4A 3BGZA 3QWKA 3HNGA 3UYTA 3GGFA 3ET7A 5KZIA 4EYMA 4QMNA 5HU9A 5M4IA 3POZA 3VS0A 3OWJA 3HMNA 2GHLA 3V3VA 4FIEA 1TQIA 3V04A 1YXSA 5J9YA 3MN3A 5AX3A 4FTLA 3V5WA 4C3RA 4IEBA 3LCDA 2GNHA 2Y8OA 1V0PA 3KGAA 2QHNA 3QCQA 3QU0A 4G2FA 3CXWA 1H08A 2HCKA 3ROYA 3ZO4A 4NW6A 4ANOA 3H30A 3LLAA 4F7LA 3HRCA 3QYWA 5JH6A 4L52A 5HTBA 4MBJA 4KBAA 3DA6A 4HJOA 3E5AA 2JGZA 4ZS4A 3ZYAA 4QP4A 5E8SA 2SRCA 4YR8A 3E87A 3TG1A 4DBNA 4C33A 3HZTA 4V05A 2GQRA 4HCUA 3E8DA 2UZBA 4WBOA 2VX1A 5CU0A 2WD1A 3IDCA 4WG5A 4BDKA 3NEWA 3PVWA 4FR4A 2OWBA 4X21A 2J50A 3MJ1A 2Q83A 3DK6A 3NUXA 3BWJA 5G6VA 1ZXEA 3BZ3A 4NSTA 4X3FB 4OAVB 3ZFYA 1YQJA 4U7ZA 2RKUA 3HLLA 3FLNC 5F94A 4J52A 4AZWA 4YZMA 5T3QA 2QOKA 4AXAA 1GIHA 4QMLA 4RQVA 5H3QA 4DGLC 2J9MA 3ZFXA 2VWIA 3NCZA 4ARKA 1VYWA 4MQ2A 5CXZA 4NU1A 2VWWA 2WMVA 4MXYA 3FQHA 4MH7A 4B4LA 4NT4A 4DGNA 2V55A 2OIQA 3I5ZA 4FVPA 3E64A 4QRCA 5FDXA 1OVEA 3I0OA 1E9HA 4FT9A 1IRKA 3E3BX 4FA2A 5C4LA 5CXHA 2ITUA 2ZDTA 2C47A 2GQGA 4YJRA 3QTQA 1IG1A 4OTDA 2RG5A 3D2KA 4YZBA 5I9UA 4LRMA 4N6ZA 4XP0A 3FZ1A 3GP0A 5HICA 2YDIA 3COKA 3ZEPA 4FNZA 5L4QA 5E9EA 4BTKA 2NO3A 5DNRA 3U6HA 4AT5A 5M44A 1XHAA 3I79A 3AMAA 3QXOA 4A7CA 3BCEA 3E3PA 3OW4A 3T3VA 3PVUA 4F4PA 4UMPA 4UB7A 3MESA 5AR3A 5L8JA 3LIJA 3QLFA 1LEZA 4G34A 4BKJA 4YURA 3Q4UA 4P2KA 5LQFA 4NIFA 3VBQA 4FF8A 4EZ5A 2VTTA 4ZY4A 5GZAA 5IEYA 4FNWA 3ENMA 3NW7A 3GVUA 3QTUA 3TKHA 4FYOA 2GNJA 2OG8A 4FUYA 2JAMA 2W4OA 3PXYA 3D15A 4A06A 4I0RA 5ANDA 3Q3BA 3RNYA 2HZIA 5EFQA 1M7NA 3QYZA 5J5TA 4FTKA 4M69A 3BHUA 4GT4A 4FZ6A 5LOHA 4KKHA 4OTPA 1MP8A 4WHZA 2VWBA 4AT4A 3HMMA 4XBRA 4QP1A 5LMKC 4HPUE 1S9JA 3BQCA 3VJNA 4GIHA 3PSCA 1O9UA 2JKQA 2HZ0A 3GCPA 5HVJA 1Q4LA 3NYXA 4OBPA 4MXAA 2VWUA 2PY3A 4HCVA 4LUEA 3AD6A 3Q32A 4DH3A 5CANA 4KUJA 4IFCA 1QPJA 5FRIA 3V01A 3KULA 3ZUUA 3RAIA 4G1WA 4NKSA 4EOOA 3DAKA 5T68A 5CAVA 2QOQA 4MF1A 3QTXA 2W7XA 4TRLA 1RQQA 1UKIA 2OXXA 5ANKA 4GS6A 4YJOA 1JQHA 3UP2A 4O7ZA 4O7NA 2QOIA 3A61A 5HG5A 4OT6A 4XJ0A 4EOJA 3OBJA 5LVNA 4WRGA 2A2AA 3UIXA 5KMMA 3M2WA 5EK7A 1J91A 1CSNA 4KBCA 4M13A 4NFMA 3VS7A 4K33A 1LEWA 3DOGA 5J9ZA 4U5JA 5HVKA 2YITA 2YISA 4TWPA 2HYYA 5HLPA 2C4GA 2CKPA 4X6RA 4HNFA 4K2RA 1ZOGA 2YHVA 2CPKE 5E8UA 4EH9A 3DK7A 3C0GA 4EK4A 1FGKA 2X2LA 3IW8A 3NUAA 4OGRA 4RLLA 4D2RA 2HW6A 3DBDA 5HG9A 3Q9WA 2I0YA 4GG5A 4O0RA 1OBDA 3QAME 4DH1A 3AD5A 2FH9A 4I24A 4OLIA 3R8ZA 3UG2A 4F1OA 1VEBA 1XH9A 1Z5MA 2OXYA 4X2JA 5FEEA 4ACGA 4FV9A 2B7AA 3FQEA 2UZTA 4B99A 4ZIMA 5K3YA 3UDBA 4L7SA 3ZC6A 4RJ8A 2O2UA 2PZPA 3TZ7A 3JPVA 5F20A 4ZP5A 5B2KA 4W4YA 3AOXA 4DHFA 2VTAA 2JDTA 2W9FB 3W33A 2BFXA 4NYEA 1PXNA 2X6EA 2ITQA 4QP2A 5IQDA 2UW9A 4NKAA 2VZ6A 1W8CA 4IB1A 2XNPA 3BE2A 1WFCA 2Q0BA 3UZPA 1KE7A 3VUKA 1OUYA 5FP5A 4F64A 3T8OA 4RIWB 5C8NA 4H39A 4W8DA 5CZHA 3TNHA 3ZSGA 2YABA 3ZO1A 1ZLTA 4O82A 1YOLA 4GV1A 5IUGA 1A9UA 3FYJX 5H8BA 3D5XA 1PKGA 5CNOA 4FV3A 4J97A 4I5HA 5JFVA 4TT7A 2DS1A 3RALA 3IW4A 5DT4A 5M53A 4MXZA 1YDTE 2OFUA 1SVGA 2GS2A 4F9WA 3U87A 3TUBA 4QYEA 3TZMA 3U51A 3M1SA 1Q97A 3D83A 4QTEA 2B53A 3O8PA 3QRTA 4FSRA 5LWNA 2HXLA 4PF4A 4K77A 3E8NA 4I41A 1R39A 3QRUA 4CFVA 3RK7A 2VTPA 2OK1A 2XK9A 3A7HA 4ITJA 4N6YA 1ZRZA 4R7IA 2XIZA 4M14A 3QTSA 3TNWA 1R0EA 4L44A 3VAPA 3CTQA 4J71A 5A6OA 5FD2A 5E8ZA 3O0GA 2XKEA 4DEBA 2FSTX 3DU8A 1V1KA 4RQKA 4B0GA 4Y73A 3UP7A 3R1SA 4FSYA 3FPMA 5CY3A 5CF5A 4RJ7A 2PZ5A 2ITNA 5M4FA 1GIJA 1KUTA 2GFCA 3CJFA 5A4QA 4FK6A 1M2PA 3LXPA 2ETMA 2DWBA 3IONA 5HLWA 4BCQA 4FGRA 2QOBA 4F63A 5CAPA 3E93A 4BICA 4BF2A 3KXGA 5GIOE 4YU2A 2Z60A 4BDJA 3KK8A 3KXXA 4MXXA 4AW0A 3IG7A 4C4JA 3NNUA 5HIBA 4EWHA 4RWIA 1FVRA 1YOJA 4GK3A 4YPDA 3OCSA 3TCPA 4BKZA 5BVFA 2GNLA 3B2WA 1Q3DA 4QYFA 4FIHA 5L8KA 2QO7A 3EZRA 2A1AB 3TUDA 2BAJA 2FUMA 4YBJA 2GPHA 5HCZA 3AMBA 5IA5A 4E93A 3VS2A 3KMMA 3O8TA 4DFBA 3UOLA 4BFMA 4CNHA 3OCGA 4GT5A 1KWPA 4IDTA 5M07A 3SW7A 4RX9A 4WSQA 5AUXA 4CSVA 5I9WA 3IOKA 5F9EA 1GZKA 5CX9A 1OPLA 5GZ9A 5FWKK 2VN9A 2WMXA 2XYNA 3DQWA 4JXFA 1NVSA 4HGSA 2B55A 5BVEA 4C3FA 4IVAA 3NUYA 2VUWA 4E4XA 5IA2A 3E7VA 5LCKA 4ZSEA 4BYJA 3F7WA 3R71A 4EK8A 2FSMX 1L8TA 3LQ3A 3QX2A 5KMNA 1CDKA 2YM7A 4X7QA 5I4NA 4O7LA 3CGOA 4MF0A 4PL4A 1REKA 3LFCA 1UU3A 1PYEA 2C6IA 4M68A 3VW8A 4DEGA 4BDFA 5FDPA 4IW0A 4ZLYA 2BRBA 5KMIA 3NW5A 3ZH8A 4KIKB 4JLCA 4JOAA 3SLSA 4UV0A 2X9FA 1HCKA 2IZTA 2OFVA 4AGCA 2BHEA 3R21A 2XIKA 4PDOA 4GT3A 4G3CA 3UTOA 3KCFA 5ANEA 2C68A 5IH4A 5ANGA 4NCTC 3GC8A 4JBPA 4MWIA 3RM6A 4BWKA 4GK4A 4RLKA 3PP1A 1JWHA 2AUHA 3WBLA 4D0WA 3HV4A 2A0CX 3DDPA 2YERA 4C3PA 2UW7A 3FC2A 4JRNA 5AV1A 4U41A 3T9TA 5JQ5A 2OF2A 5KHXA 3RAHA 5K9IA 4YZNA 2BRNA 2OKRA 2XF0A 1P5EA 2F7EE 4QPMA 2WO6A 2WOTA 4RFZA 4FV7A 1G8AA 1FVVA 4U79A 2GCDA 5CU3A 3EFKA 4AOIA 3UE4A 4MD9E 4ZTQA 5BNJA 4CG9A 3FI3A 3OXTA 2B9FA 5M4CA 1JKLA 2P0CA 2CDZA 1CM8A 3WF6A 5GIPE 4XV9A 2WTWA 3HMIA 4C37A 4C38A 3ZXTA 2ITOA 4O0WA 3LM5A 3C51A 4RT7A 4XLVA 3SX9A 4EJ7A 3GI3A 3OY1A 4CQEA 3R30A 4TNDA 2ZV7A 3F2RA 4E4MA 4ZZMA 3GCSA 4BTJA 5ANIA 3NCGA 1PXLA 1I09A 2XKFA 4CYJA 1STCE 5DN3A 3C4FA 4CFWA 1H26A 1TQPA 1W98A 2IVSA 3F5GA 2XM8A 3AT2A 4JRVA 1REJA 3D0EA 2XIRA 4BBFA 3F2NA 5ETFA 2WB8A 3UZRA 3RZFA 5K0KA 2RFEA 2R3GA 2FVDA 3D94A 4Y85A 3VJOA 3UZTA 3PSDA 1M52A 4C0TA 2C0TA 3UQFA 3FL4A 3EQHA 3DAJA 3S4QA 3CTJA 4Y8DA 3UMWA 3I0QA 1W83A 3L8VA 3PPJA 1BI8A 4EKKA 3LXNA 2ITTA 2JDOA 3EOCA 4E6CA 3W8QA 3TZ8A 2QI8A 3DJ7A 5AWMA 3L8XA 3HDMA 4YHFA 5C03A 2OGVA 2BIYA 3EQCA 3GNIB 4G16A 4FV1A 2GHMA 3BLQA 2FO0A 3UODA 5CEKA 4KWPA 4R1YA 3ORIA 1ZARA 4Z9LA 4R78A 3UOJA 5JT2A 3HP2A 4FNXA 3AXWA 4LGDA 3BE9A 2BIKB 3EB0A 4KNBA 5AP4A 4AA5A 4EOPA 2Y0AA 4D55A 3DLSA 1XKKA 4IX3A 3MFTA 4XS2A 3QX4A 1CMKE 2GNFA 4XP2A 5DLSA 4IAKA 1GOLA 3FXXA 1BYGA 3P5KA 3FZRA 4G9RA 3D4QA 4V04A 3TEIA 2G2IA 4G5JA 3NAXA 4L01A 4ZTMA 3EL7A 3EYGA 5I3OA 3RCJA 2H6DA 2VTOA 3NYVA 4RG0A 4K0YA 2IN6A 1K9AA 5EOBA 1J3HA 3K3JA 2BZHB 2UW6A 5AAGA 4PPAA 1ERKA 3CSVA 1PXMA 3BHHA 2UZLA 2XIYA 4L53A 5AUVA 2UZEA 3HA6A 1OGUA 3QZGA 1H0VA 4FKGA 4FOCA 2XK7A 5M55A 3OROA 3R9RA 5CT0A 4K8AA 4Y46A 3MH2A 4CT1A 3U55A 3OWPA 1PMNA 4IDVA 3R8LA 3ZUVA 2WXVA 5GZ8A 5IQEA 2CNQA 1WVYA 5EM6A 3OHTA 5HBEA 4EH7A 4WD5A 3FDNA 4IB3A 1MRVA 2WQOA 4HGLA 3ANRA 3AC1A 4FKWA 4MEDA 2J0JA 3VS1A 4BN1A 4QMSA 3FPQA 2UW0A 5DE2A 2J0LA 4EYJA 4BDAA 4BC6A 4WSYA 3JY0A 1A48A 2QOOA 2W4KA 3PE1A 4PQNA 2ITZA 4FSUA 3DKGA 4BHNA 4DF3A 5L3AA 3KF4A 1OL7A 3LOKA 4A4XA 4EZ3A 4L46A 5DFPA 5D7AA 3C50A 3TKIA 2WTJA 5JQ8A 2I0VA 3P86A 4QQ5A 4WUNA 3JY9A 4KS8A 3JR1A 2YZAA 4YLJA 1VR2A 4B7TA 2ZV9A 4JDIA 3HA8A 4KAOA 4KIPA 4H05A 2R3QA 4E5AX 3UMXA 4AQCA 3UYSA 5CSHA 5AR8A 2YEXA 3F9NA 5IZFA 1PW2A 3G0FA 2V7OA 3PY3A 3KFAA 5KMJA 5JGBA 4RSSA 4G3GA 2YJRA 4J8NA 3U8WA 4YHJA 3AT3A 1SVHA 4EWQA 2REIA 4O7VA 2BZIB 2W0JA 2XK8A 5CQWA 1WBOA 2W17A 2W1EA 3W2QA 3WIGA 4W9WA 5DT0A 3QD2B 1W84A 2O0UA 2ZM1A 4FV2A 4CZYB 2C6EA 2C6MA 2PMOX 3BGQA 4HYUA 1ZAOA 3TXOA 4EOIA 5FXRA 1UV5A 4ZY5A 2BTSA 4DGMA 4JBVA 4O81A 1VZOA 2EVAA 3SG8A 3HP5A 2XNEA 3AC5A 3LM0A 2VU3A 3PIXA 1WBNA 4U9AA 3PXFA 4J8MA 2AC5A 2ZDUA 3DV3A 3HDNA 5J95A 2Y7JA 4A9YA 4YJTA 5HTIA 3VBXA 2C3LA 2W06A 3C4WA 4EK5A 2ITVA 2C0IA 3RTPA 3HVCA 3NS9A 5HX6A 3EIDA 1IR3A 3PJ2A 4TKSA 3ZU7A 4AOTA 2PVRA 3HGKA 3R8UA 4F9CA 3EMGA 2O64A 3C4CA 2Z7QA 4BHZA 4U0IA 1YOMA 4C4HA 4OW8A 4PDYA 4IHPA 2ZB0A 3C9WA 3EN7A 3KXMA 2CKEA 3R83A 3FQSA 4U3ZA 4EK6A 4QOXA 3ZLYA 2BILB 3BYSA 4IJ9A 4X2GA 2BMCA 3RHXA 3DBCA 4MX9A 3ZLSA 3G9LX 3BYVA 3FUPA 4JIAA 4ANLA 4H3BA 5I9YA 1TKIA 1XBBA 2ERKA 1WBWA 2XH5A 3GENA 3R1NA 4N4SA 4PPCA 4RC4A 4TYIA 4XOYA 4AW2A 3LXKA 3W10A 2WTIA 2C6DA 5IA3A 1ZZLA 5CVFA 3LMIA 3Q52A 3RK9A 3HX4A 4UYNA 4WO5A 3TL8A 1LR4A 3C1XA 3EQGA 2EXCX 5CT7A 4A4LA 3MW1A 2GTNA 1VJYA 3LQ8A 1SMHA 4DTAA 2BZJA 1H00A 5IMXA 3HAMA 5E8TA 1VYZA 4D4SA 3LAUA 4YNEA 3ZRKA 3VUMA 1OL5A 3W55A 3Q9XA 3IDPA 3PZEA 3EWHA 3VNTA 2PE2A 5LVMA 3DZOA 3NWWA 2QR8A 3A4OX 2E9PA 4RVMA 5GNKA 5IQBA 4IX5A 5FGKA 4TN6A 3PSBA 5KE0A 3JS2A 4FSTA 4YZDA 2WTVA 3ERKA 5KBRA 4FMQA 3VQUA 4A9SA 3NUUA 1XH5A 2QURA 4J95A 4W4XA 4CRSA 5L6OA 2WQMA 3QZHA 2G1TA 3SD0A 2C3IB 3KKVA 3HEGA 3V8TA 2PVHA 4QQCA 2YAAA 5HG7A 4XV1A 1XO2B 4W4WA 1MQBA 4D4YA 2PZRA 4FG8A 3BGPA 3MTLA 4Z55A 4B8LA 3Q53A 4IBMA 1XBAA 1TQMA 3VIDA 4BI2A 3MVJA 2LAVA 3CY2A 3PG3A 3TTJA 4II5A 4FL3A 5HD7A 4KIOA 3SRVB 3BU5A 2JDVA 2XRUA 3PRFA 3MPAA 3VBVA 2NP8A 4FKVA 5B0XA 4TYHB 3DTWA 3Q4CA 5H2UA 4D2PA 4IQ6A 2B9IA 3GOKA 2OIBA 2Z7LA 3GU6A 3PLSA 4NTSA 5K4IA 4ZTNA 4D1SA 3PA5A 5BQ0A 2Y4IB 3F69A 4F99A 3DK3A 2R0UA 4FX3A 4I94A 3RPYA 5DEWA 3H0YA 2WMQA 3KB7A 4JQ7A 5C8KA 3P78A 3RKBA 3U9CA 4D2SA 1J7IA 2O65A 2E9NA 4EOMA 2XZSA 2DUVA 4YZ9A 3TNQB 3WZKA 3C13A 4ZSLA 3VUTA 4E4NA 2C1BA 2XCHA 4EORA 4N0SA 2JKKA 2XNNA 3F3WA 5L6WL 5JZJA 1X8BA 2PVJA 2BDFA 4DCEA 3AC4A 3I7BA 3FI8A 5AUUA 4WUAA 5J1WA 4L9IA 5AA8A 3I5NA 1IAHA 3KEXA 1Q24A 1B6CB 2HZNA 4GK2A 1YXVA 2R3NA 2WIPA 4JIKA 4BDDA 2UW5A 3KA0A 2BALA 4YPSA 3DS6A 1V0BA 4HOKA 3BV2A 4IAFA 3LFDA 1NVRA 1YWRA 1Q8WA 2J0IA 4RA5A 3FV8A 3G2FA 3UIMA 3QA8A 4PDSA 3PY0A 5IDNA 1H1SA 5TE0A 3QQKA 3EN4A 5E1SA 1CKIA 4BTFA 3WYXA 2J90A 1H1RA 3PPZA 2LGCA 4OTWA 5CEMA 4QO9A 5HCXA 1Z9XA 3POOA 5M51A 3SG9A 3BHYA 4V0GB 2UVZA 4LMUA 1WCCA 2YAKA 3Q5IA 3KY2A 4FKLA 3LJ1A 5DGZA 5AP6A 3S95A 3D7TB 2BAQA 4CMUA 4EBWA 4QYYA 4D5HA 3HV7A 4M0ZA 1H1QA 2Q0NA 4X2NA 1Q62A 4J1RA 2YLEA 4C4GA 1UU9A 1OKWA 4LOOA 1GZOA 3O2MA 4FSWA 4S2ZA 5JRQA 3LFBA 5EH0A 4ANMA 2GMXA 2ETKA 3FLWA 4UXQA 5AAEA 4MBLA 1JAMA 2R4BA 3WF5A 1O6LA 1PYXA 1Q8ZA 4FEQA 1ZZ2A 2VX3A 5FUTA 2H8HA 3UGCA 3P7CA 1PHKA 5A6NA 2YIYA 3LFEA 1ATPE 5AX9A 5AJQA 2IJMA 3HRBA 3WF9A 5CLPA 3H0ZA 3HUCA 2RIOA 3IGGA 3CBLA 3RJCA 2X6DA 4YTIA 4C36A 4EHEA 3C0IA 4O22A 5AIRA 4DLIA 5ITAA 4NZWB 2OJ9A 3Q4ZA 4FBXA 4USFA 4XV3A 3R9NA 4A07A 3P79A 4O27B 4JBOA 3FI2A 4OT5A 5DWRA 3MYGA 2XNBA 5DOSA 3ZRMA 1AQ1A 5JK3A 2BDWA 4FV8A 2Y4IC 3KF7A 3UVRA 3K54A 5KKRB 1OZ1A 4EHZA 2XK3A 4I3ZA 5CU2A 1UNHA 2R0IA 4L3JA 5AP1A 1BMKA 2P2HA 5E8WA 5AV2A 5EM8A 4AW5A 2YCSA 2YN8A 4KSPA 5ACKA 4RIWA 4PL5A 2IG7A 5JRSA 3S00A 5DRBA 4OAUC 3DJ5A 2WPAA 3ZC5A 4IVBA 3HECA 3OMVA 2P4IA 4FK3A 5D7VA 4FG9A 4HNIA 4K1BA 4ANBA 4B9DA 4YO4A 3V51A 1L3RE 1PJKA 4J7BA 4FOBA 3SXRA 3MSSA 5BVOA 1GNGA 5IUHA 5J7BA 3ORXA 4NCTA 3FXZA 3LMGA 3GC7A 1OL1A 4BI1A 4EH8A 2OLCA 1KE6A 2OZAB 3ZXZA 3QKMA 4HGEA 5A46A 4RX8A 3SVVA 4XG6A 4XG7A 2V0DA 1H27A 3LQ5A 2XBJA 4YLLA 3SKCA 4RGJA 4ZLOA 1OM1A 2Y6OA 1K2PA 5IQAA 4TWCA 4G31A 3TJCA 4RJ3A 4EZ7A 4DG2E 4W4VA 1H07A 5A14A 2GHGA 5KX8A 2W99B 5CSPA 2HOGA 4I5CA 4IB5A 2UZVA 2G15A 4Z3VA 5AR7A 4YHTA 3CD3A 4JDJA 3FMEA 3O50A 3R04A 4FG7A 5AR2A 4GKHA 2JITA 3PG1A 2FYSA 1SZMA 3I60A 4M0YA 4USDA 3PYYA 1BI7A 4QD6A 5AADA 3QTIA 1AGWA 4GKIA 4IC7A 2IPXA 2QU6A 3NSZA 4DEAA 3T9IA 3NGAA 2RF9A 4N57A 2YLFA 3FKLA 4U45A 5BUJA 1M17A 2UZDA 4FI1A 4UXLA 5CF8A 2CN5A 3LFNA 3UIBA 3LFFA 4R5SA 4CT2A 3F5UA 4EONA 4OTHA 5JFSA 3KRLA 4WRSA 4AE6A 2WKMA 2WMBA 3ZZEA 4ZXTA 3RCDA 3FE3A 3ACKA 2CGXA 2CHLA 1AD5A 3QCSA 4CXAA 5AA9A 5KCVA 4G6OA 4IX4A 2E9OA 5HO8A 2PVFA 4UBAA 5L2QA 4L8MA 3WYYA 3QTRA 5HO7A 1OIRA 3QQGA 3KXNA 4QMVA 3WARA 1UU7A 2RSVA 5CTPA 1YXXA 5DR9A 5LVLA 4IZ7A 4ZLZA 3KXHA 1FOTA 4IIRA 5DR2A 3OXIA 3LKMA 4ZMFA 4X3FC 4BWPA 2PMNX 2XYUA 3GOPA 4IAIA 3AMYA 4Q9SA 5KKRC 3ZBXA 4FKRA 4ENXA 3UC3A 3L9LA 3QUDA 4DA5A 5AP0A 3Q9ZA 5HBHA 2YWVA 5GINE 5CEIA 4IE9A 5DPVA 1SNXA 1B39A 4QQTA 3VWAA 4AOJA 1KSWA 2VRXA 5L8LA 5HLNA 3CGFA 1R1WA 4KIKA 3S3IA 4B6LA 2IVVA 3L8PA 4UWCA 5F1ZA 4RVLA 4E6QA 3BHTA 4D1XA 5C9CA 4FEXA 3Q5ZA 4GFGA 4CMOA 3R9OA 2CGUA 3IECA 3N4UA 2WIHA 5B2LA 3E8EA 3KRWA 4MTAA 5IEVA 1P4OA 1CTPE 3VN9A 3ZSHA 3JYAA 4EH6A 4UN0C 4BBEA 5F95A 4QP9A 4I92A 4EH2A 1OL6A 4QP7A 2F57A 4FT7A 4GW8A 4KSQA 2GFSA 4FKJA 2QQ7A 5HESA 5TKDA 4PP7A 3FI4A 4BGQA 3FLSA 3AD4A 4GU9A 3G15A 4LM5A 3L9NA 4IJPA 4ZTLA 2J5EA 4D2VA 4W8EA 3D9VA 2PVYA 4ANNA 5J8IA 4X2FA 4NWMA 3BYUA 1DI9A 4JR3A 3PFQA 3DY7A 1W7HA 1Q8YA 5BUIA 3OS3A 2YM5A 2QU5A 3RGFA 4O96A 4HYHA 3ZM4A 4C35A 2W5HA 1K3AA 4GEOA 2X81A 4QP3A 2OJGA 2Z7RA 5L6PA 1CKPA 2HELA 3CC6A 4HCTA 4MNEB 3R7IA 3OC1A 3TI1A 4E3CA 3CKWA 4NM5A 2PHKA 2X7GA 3P4KA 2XJ2A 3W8LA 2ZYBA 5KMOA 3ORMA 4EHVA 1UWJA 3BHVA 4NH1A 4ALWA 1P2AA 5E7RA 4Q2AA 5AR4A 4HW7A 5BYYA 3NMUF 2WMAA 4RIXB 4FIGA 4BDEA 3KMUA 4XP3A 2X1NA 2A27A 3MY5A 3H9FA 4A9UA 2IWIA 4DCAA 4GL9A 3RI1A 5HNIX 4M12A 2BCJA 4CFUA 2YIWA 3EHAA 5HBJA 2X9EA 2CGVA 2Z8CA 4D58A 4U8ZA 3ENHA 3SC1A 5CALA 1P14A 3QKLA 4BYIA 4FKQA 4XMOA 2J51A 4F0FA 2HWPA 4G3EA 4JBQA 3QF9A 3FY0A 3NAYA 3I81A 4GUEA 1ZOHA 3Q6WA 4AU8A 1H0WA 2VWVA 2F4JA 2GU8A 3FKNA 3NW6A 4EOSA 4UMUA 3ID6C 3GU8A 4Y72A 2YJSA 1Q3WA 5DG5A 3VS4A 3COIA 4FGBA 5M06A 4DITA 1XJDA 4DTBA 2XNMA 4PPBA 5DRDA 4ONAA 3ZLXA 4QNAA 3Q2JA 4CLIA 3TTIA 3W32A 1Y91A 2W1GA 3TNPC 3W16A 3TZ9A 4ZEGA 1O6KA 2VO0A 3O17A 4G3FA 4XBUA 4XNEA 4ZMEA 3EFWA 3VRZA 4LMNA 3N51A 1YDRE 2VGOA 4WNOA 4DTKA 4GG7A 4IAYA 2HWOA 3UOKA 2OXDA 2FGIA 1XBCA 4TXCA 1U4DA 3PA4A 3B2TA 2XK6A 2WZJA 3OOGA 4H36A 3V8WA 4LGGA 2UW8A 4X6QC 5FBOA 3B8RA 3CPBA 5IU2A 5J7HA 1NT2A 4C61A 3OUKA 1GZ8A 5EQEA 2BRHA 4GH2A 4BDGA 3DDQA 4UMTA 3CJGA 4C59A 4DC2A 5CEQA 5FM3A 3NNVA 2Y4PA 2W1CA 4YGAA 3VUDA 2PPQA 2HW7A 3VBTA 3ZFMA 4R1VA 2DQ7X 2P2IA 5EQYA 4DH8A 1W82A 4C4IA 4JNWA 3KRRA 2G01A 2VTLA 4XG9A 4EOKA 2UVYA 3Q2MA 2PE0A 2XVDA 4XOZA 3FZOA 4EKLA 2YIQA 4ENYA 3WE4A 3VW6A 4ZY6A 2EXEA 3W2OA 3O7LD 1PXOA 4FIFA 4I4EA 4PMSA 4O86A 3GQLA 5TO8A 4R8QA 2QLQA 3SW4A 1GAGA 1J1CA 3ZSIA 4QYGA 5HD4A 1YWVA 4RIYB 3KULB 5GJGA 4KB8A 5HE1A 2JAVA 2R3OA 4S33A 4PP9A 3DKFA 4PY1A 3QFVA 4WOVA 3UVQA 4GIIA 4EUTA 3R2BA 3ULIA 4EH5A 2V7AA 4EOLA 4MXOA 3BV3A 1PXIA 3OWKA 4TZRA 3PPKA 4EC9A 4ACHA 4CCBA 2VGPA 4HGTA 2W5AA 3MPTA 1GJOA 5HVYA 5IF1A 5KMLA 4EH4A 2BROA 1SYKA 2CCHA 3GQIA 4PTCA 1JSUA 4XYFA 5FTGA 5LVOA 2PYWA 3KQ7A 4R77A 4FV0A 4L43A 4RX7A 3QZFA 3AC8A 2ERZE 3FLYA 5C01A 4C58A 4LL0A 5EYDA 1KOAA 2PUUA 2R3LA 1BLXA 3QRIA 3SAYA 2OICA 5EW3A 1B38A 3GCQA 3MDYA 4FSQA 4FTUA 3PWYA 5LARA 1ZMVA 4NUSA 2X0GA 5I9VA 3TNIA 3GBZA 4C02A 4MKCA 2XK4A 2QO9A 3KRXA 3QD3A 4OBQA 4QMPA 5AV4A 3A60A 4R3RA 4O0TA 2PZIA 3RVGA 2E9VA 5IH5A 4D0XA 4DFZE 4BVUA 4RWLA 2C5NA 3WZUA 3TDWA 3TJDA 4I6QA 3C7QA 4QMMA 2BKZA 2WQNA 3W1FA 4ZSAA 3C4ZA 3FL5A 5AP3A 4QTAA 4R3CA 5HE2A 4TL0A 5EW9A 4NEUA 5LVPA 4AN3A 2R3RA 3TDVA 3UNKA 2VO6A 3M42A 4FICA 4M8TA 3RBWA 1BUHA 3PZHA 4QTCA 5B7VA 2B54A 3DNEA 1RDQE 4I0SA 4JI9A 5DEYA 4RZVA 3H9OA 1YI6A 1ZY5A 3FMDA 1R78A 5IISA 2PK9A 3BQRA 4JX3A 3BLRA 4QMTA 5CS6A 3EYHA 2F9GA 4YO6A 4YNOA 5ETIA 4F7NA 3VHEA 3BYOA 3D5VA 4I5PA 3C5UA 3MIAA 5IQGA 4M66A 1APME 3CKXA 3NNWA 4XX9A 5JEBA 2QHMA 2QR7A 4FYNA 5EHLA 5JFXA 4RC3A 3QALE 3U54A 3OY3A 3ZDUA 3FEGA 4BR3A 3VBWA 3CQWA 4DFUA 3A8XA 4XHKB 3UIUA 3DKOA 3COMA 1JVPP 4RA4A 5EHOA 4FT3A 4Y5QA 4AFEA 3PJ1A 2CJMA 2QODA 1ZOEA 4FIIA 4ACMA 5J87A 2XKDA 3UO4A 1YHWA 4FTOA 1SNUA 1WMKA 2B9JA 5A9UA 4GVJA 4D2TA 4G17A 3A62A 5CZIA 1U46A 3GU5A 3TUCA 1O6YA 2YM6A 2J6MA 3CQEA 3L1SA 4QMWA 4IH8A 5LXMA 4O7YA 1JKKA 5HOAA 3V5QA 2HY0A 4ID7A 5CF4A 4I6BA 4F9YA 3MGYA 4ERWA 2ITPA 3LFQA 1JKSA 1ZY4A 5EDQA 3IQ7A 1JKTA 5TF9A 2CKQA 2XIXA 3ZOSA 3MTFA 4WNKA 2VWXA 3MPMA 4EI4A 3GC9A 3CE3A 3KK9A 3FSFA 5BX0A 4UX9A 4G6NA 4BTMA 2QG5A 4HZSA 5AP5A 2V62A 2WTDA 4MYGA 2X7FA 4ACDA 3N9XA 4CZUA 3FHIA 4HPTE 4WNPA 1LUFA 2VX0A 4P4CA 5HIDA 1KE5A 4DGGA 4AN2A 2PMLX 2YCFA 1U54B 5AV3A 2IW9A 5AIKA 3W2RA 3O23A 3QHRA 3SRVA 1IA8A 3DNDA 3LVPA 3UG1A 2OI4X 1KV2A 1OKZA 3NIEA 3UBDA 1IA9A 3Q04A 4TYHA 3OZ6A 2R9SA 3GFWA 4QP6A 1PKDA 3E8CA 4O7TA 4XG8A 2PZYA 2QOLA 2VTRA 2XJ0A 4LQMA 1M14A 3PIYA 5D11A 5IQHA 4J99A 3SDJA 4KS7A 4DGOA 4ZSGA 1YVJA 4G5PA 4R7HA 4YJPA 1WBTA 2EUFB 4U6RA 3WZDA 2B0QA 2VWYA 4FTAA 4AZEA 2BAKA 3OTUA 4LOPA 3DB8A 1FMOE 4XCUA 4MHAA 4ZOGA 3HAVA 4UY9A 4CTBA 5CASA 5K0XA 3F2AA 5JKGA 4FL1A 3L9PA 3R1QA 3VULA 4ZJJA 3AGMA 2UZNA 3GUBA 2XKCA 4QYHA 4EH3A 4F0IA 4UZDA 3HYHA 4I1ZA 2IVUA 4H3QA 4J53A 1KE8A 3VO3A 3OWLA 4EJNA 2OF4A 3CQUA 4OTRA 2IVTA 5J79A 2ITXA 3W2PA 4ALVA 1F0QA 3ZRLA 2CSNA 4WG4A 2R3MA 2X4FA 2YFXA 1MUOA 3P1AA 5AP7A 4UALA 4PTEA 4X2KA 3DBFA 2B52A 1FMKA 4MK0A 3R7GA 2JD5A 4DFLA 4H3PA 3V5TA 4V0GA 3SGCA 4HYSA 4RIOA 2RGPA 3ORNA 2W96B 4FSZA 2QD9A 1NVQA 3D7TA 4FL2A 2R7IA 4FKUA 4I6FA 3EFLA 3R7VA 4XUFA 3I6WA 3CLYA 1H01A 3ELJA 4LV5A 3QZIA 2CCIA 4PDPA 3CS9A 1FQ1B 1YW2A 1UWHA 4FTNA 2OH0E 4O91A 5EYMA 3SXFA 3ZO3A 4F65A 1Y8YA 3IDBA 3MH1A 2I6LA 4BZDA 3PJ3A 2WELA 3MY0A 4FKIA 5DH3A 2JBPA 3LZBA 3PVBA 4LOQA 3QWJA 1OKYA 4EUUA 4UZHA 1OBGA 1PMEA 2YCQA 2PULA 1PMUA 2OJIA 1YI4A 3TIZA 5LCJA 3EQFA 3CD8A 4QMZA 2YZLA 4UWYA 2PVMA 2ZB1A 1OIUA 3KMWA 3R0TA 1URCA 2YM8A 2X2MA 2QKWB 1CKJA 5L2SA 1I44A 4X3FA 4C4FA 1JSTA 3IW7A 2JFMA 4KIQA 4PX6A 5FXQA 3F3VA 4ZTSA 3TWJA 4IZAA 4IM2A 4CFNA 4IZ5A 5E92A
chains in the Genus database with same CATH superfamily
3OT8A 4Y95A 3UPXA 4F09A 5DYJA 3MJ2A 4USEA 4YTCA 4U80A 5ICPA 1J1BA 1WVWA 3FLZA 2WTKB 5LJJA 1A06A 1OMWA 1QPDA 2J0MB 4L7FA 5CAQA 4FT5A 5D12A 1FVTA 4CCUA 2C3KA 2XCKA 3EN6A 5E8VA 2GNGA 5CNNA 2C5VA 4GCJA 4IX6A 3P9JA 3S1HA 3ORPA 1OKVA 2WQBA 2C5OA 4R3PA 4BWXA 2C1AA 3FMMA 2X0QA 5FEQA 3RMFA 4BCMA 4QMYA 2X7OA 1ZMWA 4FSNA 4CYIA 4NL0A 3OOMA 4TTHB 1JPAA 4XRJA 3R1YA 3R9HA 4D9TA 1MRYA 2GTMA 3KL8A 1M2QA 5IQIA 3BX5A 5IA1A 4QPAA 4E1ZA 1XH7A 5EI2A 2E2BA 3EKKA 3D14A 1YWNA 3OXZA 3VBYA 4A4OA 4DEHA 3KREA 3ITZA 4LGHA 1MRUA 4FNYA 5I0BA 1SM2A 1NY3A 2W1FA 2WEVA 4BKYA 3MS9A 3C4EA 4CTCA 3U6JA 3VUGA 3VS3A 4AA0A 1ST4A 3MFSA 4BIDA 3BU3A 2BDJA 2I0EA 2VTJA 2ZJWA 3PVGA 5CU6A 4X3JA 5FM2A 4BDCA 5CAUA 4FUXA 4IAZA 2CN8A 2R3FA 4GUBA 4G3DA 5E4HA 3LJ2A 2IZRA 4QTBA 4IM0A 2NNWB 1M7QA 4J98A 4QNYA 1QCFA 3RHKA 2WU6A 3NYOA 4QDVA 3DXNA 2YIRA 1V0OA 3FWQA 3G6GA 5DBXA 3R7EA 5HZNA 1T46A 1UNGA 1H8FA 3FZTA 3MH3A 2X39A 4TY1A 3UO5A 2H34A 5E90A 3QKKA 4QMXA 3DTCA 3V6RA 1KE9A 3VHKA 5HG8A 4HVHA 4NM3A 5KUPA 1MQ4A 1XMLA 4D1ZA 4M67A 3WI6A 4ITHA 4TYGA 3DAEA 4XRLA 3R8VA 5HGIA 2ONLC 3A7GA 1IAJA 4XEYA 4PTGA 4AQKA 2IZUA 3CPCA 3NFGB 1WBSA 4ZZNA 4DAWA 3GB2A 4RWKA 4A9TA 3IW5A 3OW3A 2EWAA 4U97A 4WA9A 3U9NA 4JAJA 5JGDA 3PTGA 3O96A 4FTIA 2XMYA 4FV5A 3G33A 4B8MA 2Z02A 4FTCA 3NNXA 1H4LA 3PXKA 3P23A 4GJ2A 3OF0A 3D5UA 4G6LA 4BIEA 5AUZA 4I21A 4RVTA 4E4LA 4F0GA 4K9YA 4AZSA 3AKKA 4YJUA 5M09A 3EZVA 2WTKC 1KOBA 4AGUA 4GYIA 2GSFA 2C6LA 4FZ7A 2AEGA 2JIVA 2P3GX 4WNMA 1URWA 1ZMUA 3CY3A 3E88A 4TNBA 4RX5A 2GQSA 4F08A 4WKQA 2R3PA 4F6WA 5AMNA 3FAAA 5C1QB 1H28A 4YSJA 2VNYA 2FA2A 5FP6A 1VLRA 4UWBA 5GJDA 3THBA 3FBVA 4U44A 4U40A 4DDGA 3PP0A 1Q8UA 4DH5A 2F7ZE 2X8IA 3SV0A 1YHVA 4IFGA 3TKUA 5AEPA 3QGYA 5HE0A 3C5IA 3QCYA 3NUNA 4C62A 4LFIA 4PL3A 3OCBA 3F3TA 5EI6A 3CR0A 2CNVA 4L67A 4AZVA 4L42A 3QUPA 5HI2A 4ZJVA 1YI3A 3RWQA 1PY5A 4DINA 1QPCA 5E1EA 4YLKA 3FMHA 5HNGA 2HAKA 4O0UA 3U6IA 4CEGA 4RPVA 4UMQA 3N4VA 3A7JA 3E63A 3UNZA 2BTRA 3R9DA 4LUDA 2C5YA 2XUUA 3HL7A 2ZV8A 4MNEA 4MQ1A 3QLGA 3HKOA 5AFVA 5DHJA 3ZO2A 1F5QA 3ZUTA 2B4SB 4M84A 3OP5A 4MNFA 2X4ZA 3FJQE 3FSKA 3QD0A 4BGHA 4MBIA 3ATTA 2YWPA 1WZYA 3MB6A 5AUYA 2VTIA 4R7BA 4RIXA 4BDHA 3DGKA 3SHEA 4AW1A 4GU6A 3OBGA 3NUSA 4OUCA 2W05A 4FV6A 4Z7GA 4FODA 3PXRA 3QC9A 3KVXA 3R8PA 3V6SA 5GJFA 2C6TA 4YTFA 4YJQA 1U59A 4AE9A 2I1MA 2UVXA 3F66A 3VRYA 5FQDC 2PUNA 4JDHA 3QQFA 3DZQA 5E91A 5FLFA 4LV8A 3TIYA 5KNJA 2BRMA 3A2CA 3EQIA 1RE8A 3RAKA 3WF8A 2WU7A 1LPUA 1NA7A 4R5YA 3RK5A 5AM6A 4EL9A 3ETAA 4EQCA 4AWIA 2PE1A 2WTCA 1UA2A 4L3LA 5DI1A 4JAIA 5HKMA 4CKIA 3I1AA 4CQGA 4ZAUA 2G9XA 5CAOA 4K6ZA 2KULA 2NPQA 4A9RA 3MBLA 4I22A 5KZ0A 1W0XC 2ACXA 4JJRA 3DXPA 3W2SA 2RFSA 3DT1A 1J7LA 1WBPA 5IKWA 4PWNA 4HVIA 3R28A 5AP2A 2PVLA 3FMLA 3DFAA 4FEVA 1UVRA 3DQXA 5BYZA 4HYIA 5EG3A 4DH7A 4YC6A 4E73A 5K4JA 4D2WA 5CSXA 4X0MA 3A8WA 3H4JA 5IA0A 4AXFA 3PE2A 4RC2A 3WF7A 4UYAA 2QOCA 3F3ZA 4YJVA 3FKOA 4FVRA 4DBXA 3BLHA 3A7FA 4HVSA 4D9UA 4E20A 4IVDA 4GRBA 4OBOA 3VUIA 4E6AA 1XH6A 3MI9A 3FYKX 1NXKA 5DR6A 2R64A 2W1HA 2AYPA 2OIDA 2X8EA 3G0EA 4JQEA 3RPRA 4APCA 4BDBA 4CFXA 2EB2A 3OEZA 2PMIA 2WMTA 2XP2A 3FZPA 3PJ8A 4D28A 3ODZX 1KV1A 3DBQA 3LCSA 4FKOA 4BCPA 4CGAA 4RIYA 4DE4A 2UW3A 4JDKA 4XH6A 5EKNA 3KC3A 4O84A 2JEDA 4IZYA 3EJ1A 3R7OA 1F3MC 2WGJA 3PY1A 3V5PA 4IAAA 2ETRA 1WAKA 2XNGA 4BGGA 5BVDA 2NRYA 3IK3A 5EM5A 5EYCA 1OPJA 3MIYA 3NX8A 5KO1A 4L45A 4LRKA 5CVGA 1Q99A 3R2YA 1BKXA 3FC1X 4NK9A 4Y83A 4BCJA 4CZTA 4DT8A 2OU7A 2JDSA 4I23A 3A99A 3GEQA 1FPUA 3R7YA 4GFMA 3V8SA 4LI5A 3KRJA 1NW1A 2QLUA 5H9BA 3MVLA 3ZMMA 4O21A 4ZS0A 2VTNA 5FBNC 4DT9A 1OIQA 2R3JA 5HEZA 3IS5A 4Q5HA 4IWDA 3VC4A 2Z2WA 3ORLA 4O2ZA 2V5QA 4TYJA 2XM9A 1QPEA 5E8XA 2YM3A 3DBEA 3O7LB 3AC3A 4O6EA 4K18A 3KN6A 3RNIA 3TT0A 1ZYCA 4ITIA 2DYLA 4BCNA 2ZV2A 4DLJA 1FGIA 1SVEA 2C30A 1EH4A 3LW0A 3OVVA 3UC4A 3TACA 3VS6A 5FG8A 4O7WA 3P7AA 4CFMA 4RFMA 5CEOA 3MA6A 4WG3A 3ALNA 3UJGA 3F5XA 3PLAE 2J4ZA 4NTTA 2F49A 3C4XA 3NZ0A 4XG3A 5BYLA 3EH9A 2C69A 3BEAA 4M3QA 2PU8A 3W0PA 4O1PA 2FSOX 4BJJB 2XEZA 1H1PA 3O51A 1OPKA 1RW8A 4DYMA 4FTMA 1JBPE 4QP8A 2XRWA 4RVKA 3MVMA 4JVGA 5HNBA 3JVSA 4LG4A 3T3UA 4PMPA 3R00A 2FB8A 4O4FA 1PXPA 4M7IA 4PMTA 4D4RA 3NVMB 2VNWA 5AV0A 4ACCA 3GXLA 4BRXA 2EB3A 2YDKA 2VTMA 3QQLA 4E5WA 4FSMA 4HVGA 1JSVA 3QUEA 4RZWA 4CD0A 5I3RA 4L68A 3KXZA 4QMOA 3G9NA 4C2WA 3OCTA 2VO7A 3LE6A 3MB7A 3Q6UA 4ZZOA 3LFSA 1DAWA 4ASZA 3K2LA 5L2IA 3QGWA 2BKKA 1ZYLA 2X0PA 1M2RA 2B1PA 2C6KA 2J5FA 2YCRA 4GSBA 4OTQA 2IO6A 2O63A 4KA3A 3EQRA 5ETAA 4EQMA 2J7TA 3PA3A 3MWUA 3PRIA 4NW5A 4XV2A 3S2PA 4XLIA 4JS8A 2VAGA 4AAYA 4O0SA 4IMYA 1W2CA 2BUJA 5ACBC 4FKTA 5ANOA 2VV9A 4ZSJA 5T6KA 4FZAB 2O3PA 3NYNA 2E9UA 2QOFA 1UU8A 3QQHA 3VS5A 4NFNA 3ALOA 4MCVA 2RFNA 2RG6A 3I4BA 4JG7A 4NIFB 2XBAA 3GC0A 1G5SA 5HIEA 3O5AA 4AGWA 3ORKA 4BCFA 2JFLA 4IWOA 4BCIA 3G5DA 4NM0A 4PUZA 3RWPA 5ETCA 2Z7SA 2WQEA 3ZBFA 2OSCA 4CV9A 4I5MA 2IZSA 3DKCA 3GU7A 3W18A 4AG8A 2IW8A 1WVXA 2JIIA 4M69B 4R6VA 4P5QA 3RPVA 2ZAZA 3BWFA 4CG8A 5IQCA 4AUAA 3QRKA 4F9AA 3EN5A 4CRLA 3LXLA 2YDJA 3WIKA 2JIUA 3OEFX 3QRJA 4O0VA 3FMJA 1HOWA 4DEEA 3A7IA 2H96A 3K5VA 3BBTB 1GIIA 3EL8A 3EN9A 1U54A 2Y6MA 3PXQA 4I20A 2HXQA 3RINA 5M56A 4FVQA 4M97A 1ZYDA 4WBBB 3L8SA 1ZYSA 4DEDA 5C26A 4FC0A 2QNJA 3MV5A 4N70A 4UEUA 4OTGA 3QCXA 3CTHA 5CI6A 1Y6BA 4DFYA 3QQJA 4BCKA 1PXJA 5KHWA 3JUHA 3F82A 4WIHA 4MWHA 4QMUA 4DN5A 5A54A 5IDPA 4QDEA 3L9MA 2F2UA 2QVSE 4YTHA 2ZM3A 5TT7A 1Q61A 3SOAA 4BDIA 4JG8A 3IO7A 3Q4TA 2IW6A 5B2MA 4P7EA 5DT3A 1OUKA 5EKOA 3WZJA 2ZVAA 4EEVA 2AC3A 1HCLA 3BIZA 5EOLA 4AT3A 4D5KA 4O7RA 3VVHA 1UNLA 2QC6A 2H9VA 3EQDA 3F7ZA 5A4EA 2R2PA 4Q9ZA 2HIWA 2W1DA 3FXWA 3LLTA 4O6LA 4OTIA 4O7SA 3O8UA 4MVFA 4FTRA 5IG1A 4H1JA 3VF9A 4HZRA 4AZTA 2JKOA 3ULZA 1DAYA 3D2IA 3I7CA 5HCYA 3VF8A 2QG7A 2QONA 3FZSA 3ORZA 4ALUA 4KKGA 4FTTA 4E26A 5IMEA 3WILA 3HV5A 4ANSA 2KTYA 1OL2A 3IW6A 3BELA 3BBWA 2WFYA 3B8QA 5D9HA 3AQVA 4AFJA 5BVNA 5IA4A 5K5XA 3GU4A 3OT3A 4ZK5A 2JDRA 3KU2A 5IH6A 2GS7A 3V5JA 3PUPA 2WHBA 3AGLA 4APPA 2ITWA 5IQFA 4FZFB 1DI8A 2F2CB 5KBQA 4YC3A 5A4LA 5AR5A 4O0YA 3TV4A 4ASXA 2I40A 1XR1A 3QBNA 2GDOA 2Y9QA 4K11A 3UO6A 5CSWA 3F6XA 3MFUA 2OJFE 1OB3A 2BZKB 5FEDA 4QMQA 1S9IA 1BL7A 4RMZA 4YC8A 1XQZA 3LCOA 4U43A 2B9HA 3ZZWA 3ZM9A 3BI6A 3UPZA 2CLQA 2BHHA 4I6HA 4RBLA 4F6SA 1GZNA 3K5UA 2X2KA 4IM3A 5JFWA 3BPRA 3R01A 4EHGA 3HUBA 2R3HA 4NJ3A 3QC4A 3W0MA 3JVRA 3OUNB 3P08A 1U5RA 2ZMCA 5C4KA 3C0HA 2ONLA 5A4CA 3DPKA 4IB0A 3WE8A 4DG3E 3BEGA 5BUEA 5CI7A 3F3UA 2GS6A 4FZDB 1TZDA 4AZFA 4I93A 2UW4A 3ZONA 1P4FA 4AGDA 3Q96A 5JZNA 2PUPA 3DXQA 3F61A 2ZMDA 2YA9A 3TN8A 1YKRA 3CEKA 4S34A 5FTOA 1FINA 4O38A 4ZJIA 4BZNA 4ERKA 3P5JC 4FTQA 3VUHA 4S30A 1DM2A 3NLBA 4O2PA 4S31A 3GCVA 4I4FA 2OO8X 5HU3A 2HY81 3HRFA 5JGAA 4F7SA 4E7WA 5HE3A 4CV8A 1ND4A 2OH4A 2A4LA 4IVCA 4FIJA 2WMUA 2ZM4A 4F70A 4YP8A 3UQGA 4RFYA 3QD4A 2R3KA 3QQUA 4MD7E 1PF8A 4IXPA 3RPOA 5HHWA 2BVAA 4C4EA 4FE2A 5M08A 2BFYA 1Q41A 2RFDA 3NDMA 3OD6X 3ORTA 4LL5A 1QL6A 3CCNA 3JXWA 2ZFYA 4QQJA 3MA3A 3RAWA 1IASA 2PVNA 3NPCA 3KN5A 4PNIA 2R7BA 4AS0A 4CFFA 4FT0A 5BVKA 4CVAA 4ASEA 5DMZA 3W2CA 1QMZA 4JG6A 4KRCA 5AAFA 3BU6A 3M11A 3COHA 3K3IA 5CWZA 4AA4A 2UZOA 4GVAA 4KBKA 4OR5A 4U42A 3AC2A 4W9XA 1Y57A 3Q9YA 3MFRA 2ESMA 1H25A 4KKEA 3F88A 5EDRA 5JSMA 5DVRA 4CLJA 4I0TA 3UVPA 4JL9A 5D10A 3LPBA 5L2WA 3Q60A 3H9RA 5I9ZA 2JC6A 4AP7A 3UDZA 5I9XA 4G9CA 4MXCA 2OW3A 2JKMA 2CLXA 2XEYA 3E7OA 4OTFA 2WEIA 2XS0A 3P7BA 1PXKA 3AT4A 5CVHA 3ODYX 2XALA 2I7QA 3AKJA 3LJ0A 2VTSA 4UMRA 4F1MA 5JN2A 5LMAA 5IEXA 4F9BA 3PWDA 3EFJA 4LRJA 3QHWA 2PSQA 3G51A 3ZCLA 4YJNA 5GHVA 3RPSA 5EYKA 2W1ZA 4IANA 1OIYA 2YIXA 5HORA 1H24A 4GMYA 2XB7A 5BMMA 5H8GA 2XJ1A 4CKJA 5BPYA 4BCHA 3I6UA 5HQ0A 4F7JA 2J0KA 5FTQA 4H58A 4CKRA 3G90X 5E8YA 4P5ZA 5C8MA 4KD1A 4PV0A 3NRMA 1U5QA 4DFXE 2I0HA 3G6HA 4E6DA 5K5NA 4L3PA 1PMVA 1ZWSA 4L6QA 3IGOA 3DCVA 3H3CA 4FTJA 4ZTRA 5A3XA 5CF6A 2OJJA 3LCTA 2XNOA 5CENA 4AX8A 1YRPA 3R6XA 4O83A 4BB4A 1DS5A 2BR1A 4LYNA 5CYIA 4RJ5A 4IC8A 5J9LA 4CMTA 5AUTA 3BRBA 3UDTA 4QPSA 2PUIA 4U81A 2W1IA 2UUEA 3IKAA 3HV6A 3QTWA 2W4JA 4TWNA 3EQBA 3IOPA 5HO6A 4Z16A 4YBKA 1JNKA 4F6UA 3HMOA 3NUPA 4D4VA 4C7TA 2VWZA 4EOQA 3F5PA 4V01A 5EDPA 1YXUA 1OITA 3UOHA 3GFEA 3MH0A 5EW8A 3R8MA 3VQHA 4Q5EA 1E1XA 1ZYJA 2QO2A 3SA0A 1UKHA 4Y5HA 3LFAA 1G3NA 3ZS5A 2ZOQA 4AN9A 4BI0A 5FXSA 5AUWA 3R7UA 2VTQA 2P33A 2A19B 3D7ZA 3TM0A 4IADA 2GNIA 3OTVA 3R63A 4MD8E 4NM7A 3DFCB 3FLQA 5AM7A 3REPA 1BX6A 3LCKA 5CU4A 4ORKA 2CGWA 2UZWE 2RL5A 3E62A 4TW9A 4BBMA 5EM7A 4NJDA 2HZ4A 2XA4A 4TPTA 4EBVA 4EK3A 4FEWA 2G2HA 3HV3A 4U3YA 5DA3A 4C34A 3ROCA 1Y8GA 1ST0A 2CMWA 2J2IB 5G1XA 3P0MA 3QA0A 5IUIA 3TV6A 4YSMA 3U4WA 2OZOA 3GCUA 4PNKA 5BVWA 3D5WA 2QOHA 5TOZA 4AACA 4XG4A 2G2FA 4IWQA 3O71A 5EI8A 5I5ZA 4YJSA 2WMWA 3PDTA 1OI9A 3CP9A 4BZOA 3FMNA 1OECA 2WNTA 5LMKA 1H1WA 4QT1A 3II5A 4ANQA 4O0XA 4FEUA 1Q8TA 1JLUE 3PIZA 5CEPA 5F4NA 3N4TA 3EKNA 2C6OA 5ANJA 2UZUE 4IACA 3SOCA 3SQQA 1Z57A 4ZTHA 4EQUA 1WBVA 1TVOA 3KCKA 4TYEA 3ATSA 2NRUA 3QTZA 2OBJA 5JMSA 3A4PA 3TV7A 3ZLWA 4WT6A 1FBNA 3LMHA 2HK5A 2OZAA 1R3CA 1YXTA 3S0OA 4BY9E 1R0PA 4E8AA 4EC8A 5J1VA 4YZCA 3WOWA 3FMKA 2QKRA 4GJ3A 3DB6A 4J96A 3ZEWA 1XH4A 2VO3A 3KVWA 4GYGA 2C0OA 4BCOA 2EXMA 2P55A 3OG7A 2BRGA 2JBOA 5CSVA 5M4UA 2YM4A 3PJCA 5HX8A 3R22A 3HMPA 4QTDA 3WZEA 3ANQA 2WMSA 4S32A 4C57A 2CNUA 2R3IA 5LWMA 2V22A 2X8DA 2W5BA 2C3JA 3QXPA 2PVKA 2WMRA 3RZBA 1E1VA 4C8BA 3R73A 5KMKA 4JQ8A 4DG0E 2ITYA 5EHYA 1G8SA 3W0QA 4P90A 4JT3A 1J7UA 3U4UA 3UQCA 4RJ6A 4E5BA 3AG9A 5L2TA 2YACA 5D1JA 4FV4A 2BPMA 4IWPA 4M15A 2VD5A 4RWJA 3RM7A 3V5LA 2QCSA 4C2VA 3NR9A 4AF3A 2C5XA 3FY2A 4Z7HA 4BL1A 3H10A 3OFMA 3CIKA 5DIAA 3PXZA 5LMBA 1BL6A 4KABA 3QL8A 4JX7A 2F7XE 3R02A 5HTCA 3W0NA 4JR7A 3NVKI 3MY1A 2R5TA 5D41A 2CKOA 4MAOA 2PL0A 5J5SA 3EQPA 4KRDA 3ZDIA 5EQPA 3RP9A 1T45A 3GT8A 4BIBA 3IPHA 5H8EA 2UV2A 2FSLX 1YDSE 4GFOA 5TR6A 3SXSA 3ZHPC 3LHJA 4TWOA 4DFNA 5M57A 4O1OA 3FHRA 2EU9A 2WAJA 3DLZA 4RRVA 3UNJA 5BMSA 1XH8A 4DEIA 1XWSA 2O8YA 1PRYA 1YHSA 4FKSA 1JOWB 2HENA 5IPJA 2W9ZB 4HVDA 4AAAA 1Y6AA 5CQUA 3MVHA 4ASDA 4PRJA 3NIZA 2O5KA 1IEPA 5A4TA 2JLDA 4BCGA 3BKBA 3ZTXA 4XG2A 4FKPA 4L00A 4F1TA 1LP4A 2PTKA 3ACJA 3BYMA 3DJ6A 4YUQA 4FRFA 4H1MA 4YMJA 5C27A 2WOUA 2VTHA 1RJBA 3E92A 4KINA 1Q5KA 1GY3A 4PMMA 2PWLA 4RJ4A 3BGZA 3QWKA 3HNGA 3UYTA 3GGFA 3ET7A 5KZIA 4EYMA 4QMNA 5HU9A 5M4IA 3POZA 3VS0A 3OWJA 3HMNA 2GHLA 3V3VA 4FIEA 1TQIA 3V04A 1YXSA 5J9YA 3MN3A 5AX3A 4FTLA 3V5WA 4C3RA 4IEBA 3LCDA 2GNHA 2Y8OA 1V0PA 3KGAA 2QHNA 3QCQA 3QU0A 4G2FA 3CXWA 1H08A 2HCKA 3ROYA 3ZO4A 4NW6A 4ANOA 3H30A 3LLAA 4F7LA 3HRCA 3QYWA 5JH6A 4L52A 5HTBA 4MBJA 4KBAA 3DA6A 4HJOA 3E5AA 2JGZA 4ZS4A 3ZYAA 4QP4A 5E8SA 2SRCA 4YR8A 3E87A 3TG1A 4DBNA 4C33A 3HZTA 4V05A 2GQRA 4HCUA 3E8DA 2UZBA 4WBOA 2VX1A 5CU0A 2WD1A 3IDCA 4WG5A 4BDKA 3NEWA 3PVWA 4FR4A 2OWBA 4X21A 2J50A 3MJ1A 2Q83A 3DK6A 3NUXA 3BWJA 5G6VA 1ZXEA 3BZ3A 4NSTA 4X3FB 4OAVB 4BJJA 3ZFYA 1YQJA 4U7ZA 2RKUA 3HLLA 3FLNC 5F94A 4J52A 4AZWA 4YZMA 5T3QA 2QOKA 4AXAA 1GIHA 4QMLA 4RQVA 5H3QA 4DGLC 2J9MA 3ZFXA 2VWIA 3NCZA 4ARKA 1VYWA 4MQ2A 5CXZA 4NU1A 2VWWA 2WMVA 4MXYA 3FQHA 4MH7A 4B4LA 4NT4A 4DGNA 3BL7A 2V55A 1TFFA 2OIQA 3I5ZA 4FVPA 3E64A 4QRCA 5FDXA 1OVEA 3I0OA 1E9HA 4FT9A 1IRKA 3E3BX 4FA2A 5C4LA 5CXHA 2ITUA 2ZDTA 2C47A 2GQGA 4YJRA 3QTQA 1IG1A 4OTDA 2RG5A 3D2KA 4YZBA 5I9UA 4LRMA 4N6ZA 3TYKA 4XP0A 3FZ1A 3GP0A 5HICA 2YDIA 3COKA 3ZEPA 4FNZA 5L4QA 5E9EA 4BTKA 2NO3A 5DNRA 3U6HA 4AT5A 5M44A 1XHAA 3I79A 3AMAA 3QXOA 4A7CA 3BCEA 3PUFC 3E3PA 3OW4A 3T3VA 3PVUA 4F4PA 4UMPA 4UB7A 3MESA 5AR3A 5L8JA 3LIJA 3QLFA 1LEZA 4G34A 4BKJA 4O4CA 4YURA 3Q4UA 4P2KA 2XAOA 5LQFA 4NIFA 3VBQA 4FF8A 4EZ5A 2VTTA 4ZY4A 5GZAA 5IEYA 4FNWA 3ENMA 3NW7A 3GVUA 3QTUA 3TKHA 4FYOA 2GNJA 2OG8A 4FUYA 2JAMA 2W4OA 3PXYA 3D15A 4A06A 4I0RA 5ANDA 3Q3BA 3RNYA 4LV7A 2HZIA 5EFQA 1M7NA 3QYZA 5J5TA 4FTKA 4M69A 3BHUA 4GT4A 4FZ6A 5LOHA 4KKHA 4OTPA 1MP8A 4WHZA 2VWBA 4AT4A 3HMMA 4XBRA 4QP1A 5LMKC 4HPUE 1S9JA 3BQCA 3VJNA 4GIHA 3PSCA 1O9UA 2JKQA 2HZ0A 3GCPA 5HVJA 1Q4LA 3NYXA 4OBPA 4MXAA 2VWUA 2PY3A 4HCVA 4LUEA 3AD6A 3Q32A 4DH3A 5CANA 4KUJA 4IFCA 1QPJA 5FRIA 3V01A 3KULA 3ZUUA 3RAIA 4G1WA 4NKSA 4EOOA 3DAKA 5T68A 5CAVA 2QOQA 4MF1A 3QTXA 2W7XA 4TRLA 1RQQA 1UKIA 2OXXA 5ANKA 4GS6A 4YJOA 1JQHA 3UP2A 4O7ZA 4O7NA 2QOIA 3A61A 5HG5A 4OT6A 4XJ0A 4EOJA 3OBJA 5LVNA 4WRGA 2A2AA 3UIXA 5KMMA 3M2WA 5EK7A 1J91A 1CSNA 4KBCA 4M13A 4NFMA 3VS7A 4K33A 1LEWA 3DOGA 5J9ZA 4U5JA 5HVKA 2YITA 2YISA 4TWPA 2HYYA 5HLPA 2C4GA 2CKPA 4X6RA 4HNFA 4K2RA 1ZOGA 2YHVA 2CPKE 5E8UA 4EH9A 3DK7A 3C0GA 4EK4A 1FGKA 2X2LA 3IW8A 3NUAA 4OGRA 4RLLA 4D2RA 2HW6A 3DBDA 5HG9A 3Q9WA 2I0YA 4GG5A 4O0RA 1OBDA 3QAME 4DH1A 3AD5A 2FH9A 4I24A 4OLIA 3R8ZA 3UG2A 4F1OA 1VEBA 1XH9A 1Z5MA 2OXYA 4X2JA 5FEEA 4ACGA 4FV9A 2B7AA 3FQEA 2UZTA 4B99A 4ZIMA 5K3YA 3UDBA 4L7SA 3ZC6A 4RJ8A 2O2UA 2PZPA 3TZ7A 3JPVA 5F20A 4ZP5A 5B2KA 4W4YA 3AOXA 4DHFA 2VTAA 2JDTA 2W9FB 3W33A 2BFXA 4NYEA 1PXNA 2X6EA 2ITQA 4QP2A 5IQDA 2UW9A 4NKAA 2VZ6A 1W8CA 4IB1A 2XNPA 3BE2A 1WFCA 2Q0BA 3UZPA 1KE7A 3VUKA 1OUYA 2IEWA 5FP5A 4F64A 3T8OA 4RIWB 5C8NA 4H39A 4W8DA 5CZHA 3TNHA 3ZSGA 5BV3A 2YABA 3ZO1A 1ZLTA 4O82A 1YOLA 4GV1A 5IUGA 1A9UA 3FYJX 5H8BA 3D5XA 1PKGA 5CNOA 4FV3A 4J97A 4I5HA 5JFVA 4TT7A 2DS1A 3RALA 3IW4A 5DT4A 5M53A 4MXZA 1YDTE 2OFUA 1SVGA 2GS2A 4F9WA 3U87A 3TUBA 4QYEA 3TZMA 3U51A 3M1SA 1Q97A 3D83A 4QTEA 2B53A 3O8PA 3QRTA 4FSRA 5LWNA 2HXLA 4PF4A 4K77A 3E8NA 4I41A 1R39A 3QRUA 4CFVA 3RK7A 2VTPA 2OK1A 2XK9A 3A7HA 4ITJA 4N6YA 1ZRZA 4R7IA 2XIZA 4M14A 3QTSA 3TNWA 1R0EA 4L44A 3VAPA 3CTQA 4J71A 5A6OA 5FD2A 5E8ZA 3O0GA 2XKEA 4DEBA 2FSTX 3DU8A 1V1KA 4RQKA 4B0GA 4Y73A 3UP7A 3R1SA 4FSYA 3FPMA 5CY3A 5CF5A 4RJ7A 2PZ5A 2ITNA 5M4FA 1GIJA 1KUTA 2GFCA 3CJFA 5A4QA 4FK6A 1M2PA 3LXPA 2ETMA 2DWBA 3IONA 5HLWA 4BCQA 4FGRA 2QOBA 4F63A 5CAPA 3E93A 4BICA 4BF2A 3KXGA 4AXDA 5GIOE 4YU2A 2Z60A 4BDJA 3KK8A 3KXXA 4MXXA 4AW0A