3OMVA

Crystal structure of c-raf (raf-1)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
276
structure length
264
Chain Sequence
YYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords RAF proto-oncogene serine/threonine-protein kinase
publication title RAF inhibitors prime wild-type RAF to activate the MAPK pathway and enhance growth.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3omvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3omvA01
3ACKA 2VWYA 4WUNA 3PUPA 4AZTA 1XQZA 2WOTA 4UN0C 4FKUA 4U7ZA 5AP3A 2Y7JA 2QHNA 5CU2A 3EFJA 1G8SA 2PK9A 1TVOA 5EG3A 3EWHA 1VEBA 2QOBA 3A7FA 5EHLA 3UMWA 3WZEA 3FBVA 3VUHA 3HECA 4IWPA 1ZMWA 3II5A 3UMXA 1WBTA 3ODZX 3PXRA 2B0QA 2Z60A 5FWKK 2Y9QA 1Q8TA 3COHA 4QP2A 4RX8A 4WA9A 4TXCA 4QTCA 4PDSA 3VJOA 3HMOA 3QZFA 3JPVA 4PV0A 1K9AA 2R0UA 2ZVAA 2GCDA 4B9DA 3CY2A 4IAKA 5AUZA 2XMYA 2RKUA 2QVSE 4BBFA 2OGVA 3BPRA 2CN8A 4KS7A 4IJPA 3D2IA 4OTHA 4BYIA 4JI9A 3OBJA 5HTBA 2LAVA 1R0EA 3DY7A 4R1VA 5J5SA 4YJNA 4DH1A 5IQBA 4PPBA 5KBRA 3O51A 3ATTA 5EI8A 2E9NA 3IW7A 1OKVA 4H39A 3P4KA 2CLQA 1U5RA 4A07A 2X9EA 2PU8A 2YM7A 4YZDA 4EOOA 4F0FA 4R7HA 3C5UA 5ITAA 4XJ0A 3AD6A 3UODA 3MB6A 3VC4A 2W9ZB 4PY1A 3GUBA 3UVPA 1W83A 2JBOA 3R30A 3FL4A 1PMNA 3E8DA 4HYIA 2XJ2A 4UMPA 3DQWA 2B52A 4CGAA 2CNUA 4QMMA 3FUPA 3UVRA 2C5XA 4U8ZA 5I4NA 2J7TA 3FWQA 4RWJA 3QD2B 5HHWA 3DJ5A 3ZO2A 3IOPA 3KQ7A 3IPHA 2AYPA 4IWDA 3UOHA 4FIHA 4BCJA 4C4FA 4D0XA 4U40A 3U6HA 5HG9A 2UVXA 3S1HA 3UP2A 4BWPA 4KS8A 2V62A 3QRJA 2WU7A 1PXIA 2I40A 4L7FA 4TYHA 2RIOA 5C03A 3IGGA 1I09A 3FLYA 4FK3A 4ZLYA 3VNTA 4KUJA 3M42A 2R2PA 4H3PA 4YJRA 2QCSA 3PJ1A 4CLIA 3BELA 3LXKA 4F1OA 3NCZA 2VTLA 4BGQA 2OI4X 4JDJA 3PRIA 3BBWA 1OI9A 4RX5A 2WTIA 3R00A 4QQCA 4CYJA 3QZHA 1XHAA 4IB1A 1R3CA 4JNWA 3PXKA 4XS2A 4BCQA 3ETAA 3CCNA 3FHIA 3GFEA 5H8GA 5EOBA 4HVIA 4ZJVA 1OIYA 2WOUA 3PE1A 2QO2A 3H4JA 3NDMA 4B6LA 4GRBA 2WMVA 4M3QA 4BTMA 5KKRC 5M07A 2WXVA 4QMUA 4I6HA 4FE2A 2YCFA 4TW9A 2HIWA 3FI2A 5FM2A 5AWMA 4TWNA 5HD7A 5IA2A 3R1NA 4O7TA 2OK1A 3EL7A 3QRKA 4GJ2A 3TNQB 4NYEA 1PRYA 2VTTA 4UMTA 2CPKE 2HZ4A 3FYJX 4R1YA 1J3HA 4DFXE 1VYZA 2R3LA 4UYNA 3NNWA 3P7BA 5AV3A 3ZO3A 3BYUA 4F6SA 4JOAA 4OBOA 5M56A 2X8DA 3DDPA 4MNEA 3GQIA 1ZXEA 3DS6A 3W18A 3BHVA 3I7BA 3L9PA 3QTXA 2FVDA 4W4WA 5CX9A 3VUDA 4LL5A 1A9UA 2OICA 3VS4A 3RHKA 5TKDA 4FIIA 3V5LA 4RRVA 2QKWB 4NKSA 2J51A 4QTDA 1WBPA 4AZFA 2BCJA 4FBXA 2B1PA 4BCIA 4MYGA 1ERKA 3Q5IA 2P2HA 4J96A 3QCQA 4A9TA 4IJ9A 5HICA 4D58A 4YUQA 4O7WA 4X2JA 2VX1A 4AX8A 3GCPA 1Z9XA 4L53A 4IC8A 4GMYA 2HZIA 4I20A 4D1XA 3VUTA 2X7GA 3DKCA 4FK6A 4M14A 3HV6A 4RZWA 5TO8A 2NO3A 4GL9A 3ZC6A 4ZTMA 4DBNA 2GS6A 2I0HA 2W4KA 3HP2A 3KF4A 4FG8A 3R7UA 2C1AA 2QU6A 4C59A 1H8FA 2EB3A 4YTFA 4GYGA 2BRMA 5AEPA 3Q9XA 3LKMA 1JQHA 3H30A 4GU6A 1JKTA 4J97A 3CGOA 4AE6A 4AFJA 3O0GA 1T45A 2HYYA 3CQEA 2NRUA 3R8PA 5JRSA 2BVAA 5E1EA 5T3QA 5EDRA 2A27A 4AOIA 2YCQA 3KMMA 2JIVA 4CCUA 2FH9A 4YNEA 4EKLA 4DE4A 5BMMA 4D4RA 4AGUA 2W5BA 5H3QA 3RK9A 3OXIA 3O23A 4QP9A 3VBVA 1H1QA 2XEYA 1DM2A 4CCBA 5L2WA 5HE0A 5HVYA 3WF9A 2WELA 3MS9A 3MY1A 3MY5A 4F63A 3QGYA 4X0MA 4D9UA 2Y6MA 5IPJA 5TR6A 3ZRLA 4PRJA 4N57A 3VRZA 4K2RA 3ZRMA 4AE9A 4ASEA 4ANSA 4FSZA 3Q4TA 3BU6A 5AAFA 4E4XA 4FSNA 4BDJA 4I4EA 4CKRA 2FSMX 3E3BX 4HPUE 3HV3A 4L44A 4U80A 5CF5A 3SG8A 4BIDA 3OROA 1U54A 2YDJA 4QMSA 2YIWA 2ITNA 2R3MA 2B9FA 4AG8A 5I0BA 4BDAA 2YERA 2WQOA 4JG8A 1DAWA 2UUEA 5LARA 4BBMA 2XB7A 1YRPA 2VN9A 3ORPA 3G9LX 4K9YA 4L7SA 4YMJA 3TJCA 4H36A 4GV1A 4KRDA 2PUIA 5EI2A 4K8AA 1H28A 1S9IA 4CLJA 2ZOQA 3OEZA 3OW4A 4LQMA 4PL5A 3E8CA 3FQHA 4MXCA 4QP1A 3VBQA 2ITTA 2XNMA 2PVHA 3M2WA 4HVGA 3AC2A 5FDXA 4CMOA 1OUKA 2WU6A 5F94A 1OM1A 3LZBA 3PVBA 1Z57A 3LCTA 1IR3A 2XZSA 3HDMA 4IFCA 4FTKA 1DAYA 3MBLA 1QPJA 3JY0A 4IVDA 5DT3A 4LV5A 1WBVA 2RGPA 3KN5A 5DLSA 4S34A 4AZWA 3QUDA 1M17A 2PVYA 4C3PA 3K3JA 5LMAA 2XK7A 1G3NA 3UTOA 3S00A 1YI4A 3B2WA 4R8QA 3PXFA 2C47A 2P3GX 3LFQA 3BEGA 4ZAUA 4GG5A 3Q53A 3FEGA 3ZDIA 2UW4A 4ENXA 5IUIA 3QC9A 1ZY4A 1CSNA 2OO8X 3FMNA 1OIRA 2EWAA 2XVDA 3NVMB 4P2KA 4QMVA 3A4PA 4AA5A 4ERKA 2CMWA 3TNWA 4GFGA 5J7BA 4EZ5A 2WFYA 2JKMA 3GCQA 5EDPA 1UWJA 5LOHA 2PUPA 4F9BA 3W2QA 1GOLA 5CSHA 1V0BA 1MRUA 2BDJA 3BKBA 5GNKA 2HW7A 3DAEA 4ANMA 3UNKA 2WMTA 3OCSA 5KKRB 4O38A 4Z7GA 4EK3A 2WEIA 3QA8A 3DKOA 3OC1A 4F7SA 4ZJJA 3UG1A 4L8MA 5KMJA 3D83A 1V1KA 5JT2A 3QALE 4ALUA 3JVRA 2X4ZA 4IW0A 5KZ0A 4LV8A 3HMMA 4HYSA 4PMSA 3RBWA 2G9XA 3QHRA 4TNDA 4ZTLA 2JDRA 3FSFA 3FZSA 3LXNA 2C5NA 3Q9WA 4CRSA 1J7UA 1A48A 3BV3A 2O5KA 4O84A 4FKQA 3UP7A 4DEDA 4F99A 4ACMA 1LPUA 1YXSA 4OTPA 5DEYA 3KKVA 3PWDA 4IVCA 3GVUA 2ZM1A 4FKIA 4LUDA 5FXQA 3UZPA 2OG8A 3GOKA 3WF8A 5AADA 4PDOA 3Q4UA 2AC5A 4WBOA 5LVLA 3RMFA 1ND4A 4DH3A 4MD9E 4X2FA 2W96B 2WB8A 3F9NA 2P55A 2F4JA 2WQBA 4FNWA 4PDYA 4OT6A 2ZM4A 2UW6A 3FMMA 2BRGA 3LFNA 3NPCA 3CR0A 2A2AA 3KMWA 1XH4A 4U41A 2Y4PA 2VTMA 1P4FA 5HG8A 4MH7A 1H01A 3NNXA 2OXXA 2CCHA 4R5YA 2IZUA 2VZ6A 3SLSA 3ZO4A 3EFWA 5HU9A 3R1SA 4JIKA 2PWLA 4O6LA 3KFAA 1QPDA 4YJOA 2O63A 4I6FA 4A4OA 4M69B 2PZRA 2UZNA 1PJKA 4GIIA 3IOKA 4RFYA 4EYJA 3QXOA 2XJ1A 4YGAA 3QA0A 1Q99A 4RZVA 5BVOA 4WIHA 3NIZA 4O0XA 2GQRA 4BKJA 1OL2A 5CZIA 3MH2A 5HE1A 5M4IA 3NNVA 4FVQA 4WG4A 3GC8A 2WMXA 2H34A 5AM7A 2P33A 1SNUA 3DV3A 3KULB 3QC4A 5AV2A 5JSMA 3GXLA 4X7QA 3CJFA 3SOAA 4JJRA 2XIXA 4C36A 4UWBA 2C68A 2ZV2A 2C0IA 4RIWA 3W2RA 4X6QC 2OIQA 1FMKA 4RWKA 4FG9A 2E9PA 4OUCA 3MGYA 5CEIA 1J7LA 3RI1A 1GZOA 2HENA 2REIA 2IVTA 1ZYSA 5EKOA 3UO4A 3WZKA 4QP4A 1HOWA 2XK8A 3DB8A 3HUCA 4EUTA 2E9UA 4XP3A 1FGKA 3MVHA 4J8NA 4FUYA 3VUIA 1H00A 2GS2A 5J79A 5L6OA 4FV5A 3OTUA 4FTIA 4QMZA 5AX9A 3UNZA 3RCJA 3FYKX 3FL5A 2I0VA 1WZYA 2W7XA 3I0QA 3MFSA 3BI6A 1XH7A 3W1FA 5BMSA 4L3JA 3IW5A 2VO3A 4ZZOA 3VBYA 1U5QA 1BKXA 4RQVA 4Y95A 5DI1A 3FLWA 4U9AA 1PHKA 5A6OA 4DFUA 2X0GA 3MVJA 1F3MC 4HNFA 2YA9A 2XNOA 1U59A 4O86A 2PZPA 4EWQA 2J0MB 3F3ZA 5L6PA 1ZZLA 2OXDA 3F69A 3QZGA 4ZXTA 1FGIA 2VTSA 5E8TA 4U3YA 2YN8A 3R6XA 4DEEA 4CKJA 4X2NA 5K0KA 4KIPA 5A3XA 3PPZA 2A0CX 2J6MA 3UC4A 4CEGA 1PXNA 1J7IA 4DH8A 4EK6A 4PL4A 5CF4A 2JKKA 2R64A 2VO6A 5CQUA 2J4ZA 1WBWA 4F0GA 4EH7A 4AOTA 3WIGA 2YLEA 4HPTE 3DZQA 3FC1X 1YWNA 2J5FA 4YZ9A 2R7BA 5A6NA 4DH5A 2JDTA 3RNIA 3BHTA 3VF8A 4EJNA 4AN3A 3O71A 3NR9A 3DKFA 2IW9A 3F3WA 3RAWA 5M08A 4XV9A 3RHXA 5KNJA 3NX8A 4YSJA 5AUWA 4ACHA 4U97A 4U81A 3OTVA 5KE0A 4ANBA 3OZ6A 2VTHA 3ZXTA 5A14A 4XP0A 5L6WL 1AD5A 3MH1A 3V5WA 3ZYAA 5AA8A 1I44A 4RFMA 3EOCA 4DC2A 5CVFA 5FG8A 4C57A 1ZMVA 4JQ8A 3ENMA 4L3LA 3K5UA 4U44A 4ASZA 4L3PA 4UMRA 4RLLA 5E8SA 3D4QA 4FMQA 4XUFA 3Q4CA 2BZHB 4I3ZA 5EM7A 4YC6A 3A7JA 4LOOA 4QRCA 4XRJA 3C1XA 4YBJA 5F20A 3ZU7A 4ANNA 5AAGA 3MFRA 3DB6A 5CT0A 4AGCA 4IZAA 4HYHA 4XHKB 5BVFA 3LAUA 2X39A 3N51A 4ZMFA 5AIRA 3LFSA 3KXZA 5M57A 4IIRA 3MSSA 4DGMA 1UNLA 2OZAA 3G9NA 3G6HA 5JQ8A 4TN6A 3GQLA 5IZFA 5JK3A 2C6TA 3FMHA 3HA8A 1W82A 4RX9A 4EHGA 2ETKA 3KRXA 5ANIA 5IQCA 3MFUA 3LQ3A 2CLXA 3D5VA 4GEOA 5DNRA 3D7TB 5A54A 5AA9A 2QO7A 4XYFA 2BR1A 3I7CA 4OBQA 3PVGA 3LCOA 4EZ3A 3UZTA 2PL0A 4K11A 2PTKA 4GUBA 3R01A 5E4HA 4C7TA 1O9UA 3OCBA 1KE7A 5CLPA 4YJSA 3POOA 4DCEA 4YZBA 5DR2A 1YWVA 4EK4A 4EQUA 1ZYCA 2BZJA 3H9RA 2GHLA 1URCA 4IADA 2YJRA 3IECA 3P78A 1YW2A 4XX9A 3RWPA 4D55A 2X6EA 2G1TA 3FKNA 2Z7RA 4EBWA 4E6QA 4E1ZA 4YNOA 2QO9A 3TNHA 4CT2A 4RJ7A 3TTJA 5CU0A 2OFUA 4C4HA 2R3GA 5IMEA 3GB2A 2YHVA 2CDZA 4JT3A 5CSVA 5JGDA 4KINA 4PX6A 1H1PA 2KULA 4ZS0A 4ANOA 3EQIA 3MDYA 4HYUA 4FYNA 5CTPA 4PTGA 4ZSGA 2ZV8A 5EYMA 4CV9A 2PSQA 4I92A 1YHVA 5IEXA 1KE8A 3R21A 4ERWA 4NL0A 3U55A 3F2RA 5F4NA 1ZOGA 2GPHA 4GK3A 5E92A 3V51A 2WTDA 3RCDA 3S4QA 3EYGA 3LFFA 4QMWA 4W9WA 4Y46A 2C1BA 4MXZA 1JSUA 4Q9SA 4ZTNA 4BIBA 3ZHPC 3BGQA 4XRLA 1PXKA 2BTRA 1FVVA 3MB7A 3TUCA 4GSBA 4RC4A 2HAKA 4MBIA 3ORIA 2WZJA 4LMNA 2H6DA 5E1SA 3GFWA 1KE5A 2HZNA 3FZRA 4O0TA 3ZSHA 4QYYA 4U6RA 5HLNA 4OTQA 3PE2A 3UQCA 5HKMA 3HV5A 4I5PA 2GNFA 3EYHA 3TDVA 3SAYA 3BX5A 5K4IA 4YLJA 4AOJA 1Q8WA 4QPMA 3T3UA 4NUSA 3R73A 3UG2A 2G15A 4BTFA 1GJOA 1ZLTA 2YDIA 3D94A 3DK3A 3HYHA 5DOSA 3TIZA 3KXGA 2W1HA 3TIYA 3NGAA 3CS9A 4ZTSA 4BDGA 4D5HA 4DG2E 5HQ0A 4C3RA 5CYIA 3W2OA 2VD5A 4ANLA 5AAEA 2WEVA 5CANA 2HWPA 4MVFA 3ZFYA 4G9CA 4LI5A 5DGZA 2ITZA 3PP1A 1M2PA 3V5PA 4EH8A 1GY3A 5AV1A 3MTLA 4X3FC 2UVYA 4RJ4A 4TYIA 5JQ5A 3DBFA 4D9TA 4I5CA 4PPCA 2PE1A 2ZB1A 2GFCA 4QP8A 1B38A 5HE3A 4D2VA 5DMZA 5GIOE 4WNOA 5H2UA 4ACCA 2IZTA 2VTRA 4J53A 3LFDA 3TG1A 4WBBB 4V05A 3LXLA 3TXOA 1LEWA 3JYAA 4OR5A 4C02A 4L67A 2WD1A 2UZUE 3HVCA 4G3DA 4II5A 2QQ7A 2G2HA 2R5TA 4EK5A 4FIGA 4L9IA 2XM8A 2X2MA 4AAAA 3OUNB 5GJGA 2PMOX 4H3BA 4CYIA 3V6SA 3C4XA 3OXTA 4E20A 4FV3A 3FPQA 3CTQA 1R39A 4YTCA 4GS6A 2RL5A 3ROYA 2V5QA 3TV6A 1KV1A 1RQQA 4RIWB 3NRMA 3R8ZA 3ZMMA 5ICPA 3PXQA 2WHBA 4JAIA 4F6UA 4XLVA 3S0OA 2PUNA 4A9UA 2X4FA 5HVKA 4RGJA 4O7NA 4ZEGA 4BDIA 3H9FA 1W98A 5FD2A 3QRTA 4G5JA 1M2RA 5M51A 4HJOA 5AJQA 1YHSA 2GTNA 2QR8A 3IONA 4IAYA 4MCVA 2IW8A 2HZ0A 3PIZA 5HEZA 2JDVA 3BZ3A 3RPYA 3VS0A 4E4LA 3PLAE 1YOMA 4NTSA 2R3NA 3ZUUA 4RVMA 2QG5A 1ZARA 4F65A 3GP0A 4QMXA 2VU3A 5DEWA 5EM5A 2ZV9A 4JRNA 3A62A 5E8ZA 4BVUA 2G2IA 3AC1A 4F1TA 4FKOA 3EQPA 4CG8A 4AZEA 1WVYA 2W05A 3TL8A 2VTPA 4IWOA 4CRLA 5CU4A 4C38A 4FT3A 3QF9A 4NIFA 3Q60A 2ZMCA 4UZDA 5D7VA 4FT9A 1XKKA 4S33A 2F7ZE 4GUEA 3R8UA 2GSFA 4WNKA 4XP2A 4LM5A 4EOSA 2HCKA 3PY1A 4A4LA 4FF8A 3NNUA 3OD6X 3PZHA 5JGAA 5BUIA 4YP8A 4FI1A 3LJ2A 1CDKA 4AXAA 3OUKA 4ITHA 3T3VA 1Y8YA 3W10A 1SVGA 2YIQA 3I0OA 3NYOA 4K6ZA 4OLIA 4BZNA 2PVFA 2YAAA 2ITXA 5DN3A 3N9XA 3QFVA 4E93A 4TYHB 3I5NA 4ZZMA 3VWAA 4O0SA 1DI8A 4ORKA 1UWHA 3RP9A 4F9AA 4ZSJA 4XMOA 3R7GA 1BI8A 4XV3A 3EQGA 2P4IA 4G6OA 4WRGA 5C26A 3NVKI 3MY0A 2X1NA 1JNKA 2H96A 3MVMA 1XJDA 2W1DA 4S31A 4FTOA 3Q2JA 3R8LA 2FO0A 3HEGA 3FMLA 1Y6BA 4BB4A 4G1WA 3DK7A 2GNLA 3SHEA 4BCMA 4CZYB 3CPBA 1MRVA 4FKVA 5KBQA 2NRYA 3D5WA 5TE0A 4B0GA 4JAJA 2R3RA 2PVRA 4MQ2A 3LE6A 3MA3A 4I6QA 4FSYA 3T8OA 5LMKA 4F0IA 4XEYA 1UU9A 5CSPA 4ZK5A 4D2RA 4BICA 3Q04A 4EOIA 3WZDA 3MPTA 2CKOA 4JDHA 3KRJA 2A4LA 1OPJA 2XYNA 3PRFA 3OXZA 4R78A 4S30A 5HGIA 3V01A 2F57A 3U6JA 3FE3A 5JEBA 3CQWA 2IVVA 2WMWA 3QQJA 1XH8A 2JC6A 4MNEB 4I93A 2J0JA 2I6LA 4BF2A 3I6WA 3W55A 3E8EA 5E9EA 3C0IA 2J0IA 3BYOA 2QOIA 2JEDA 3R1QA 5B2LA 2QOOA 3FXWA 3VBXA 5CXHA 2YIRA 1T46A 3PVWA 3OS3A 4IDTA 2JBPA 5IUGA 5FBOA 5HOAA 3BWJA 5JFVA 1KV2A 3PWYA 4AZVA 2LGCA 4FEUA 4QQ5A 1PW2A 2OU7A 4FV4A 1SVEA 2ITQA 4J52A 4PQNA 3OW3A 3R9NA 3KXNA 4FV9A 1FPUA 5IQEA 2IWIA 3EB0A 4LOPA 2E9VA 4FGRA 4F9CA 3QUPA 1H0WA 3IW6A 4X3FB 3BGPA 1JBPE 2QLUA 4M12A 4CVAA 3CKWA 2WTKC 4QMYA 2C4GA 3TKIA 2BAQA 4IAAA 2FA2A 3C4CA 4JG6A 4P90A 4IX5A 2C5VA 5KMIA 3CJGA 3RTPA 4NK9A 3R9HA 3LFAA 4YR8A 3W8LA 2XH5A 2VTQA 2JIUA 4K0YA 2WPAA 3VS2A 1NVRA 5AP6A 4KWPA 5L2SA 4RA4A 3OWLA 5K3YA 3QTIA 4M0YA 2O65A 5ETFA 4CNHA 2O3PA 3FMJA 5AP0A 4J71A 3A4OX 3AG9A 4JDIA 4I41A 3LFEA 4WKQA 2C6IA 3LCKA 4XLIA 4IACA 4ENYA 2QOKA 4QYFA 3Q9ZA 4F70A 2C6EA 3ZCLA 4GH2A 4KD1A 3FDNA 3UJGA 4L00A 3A7HA 2BAJA 3JVSA 3RK7A 4JX3A 2R3OA 2IVSA 3DXQA 3E62A 2YM4A 3VIDA 3SVVA 1YHWA 3FKOA 3ORNA 1YWRA 2RF9A 3EQFA 5JN2A 5KMLA 4ARKA 4ZJIA 3MPAA 3LPBA 3LW0A 1ZYDA 4FODA 4CFWA 2EVAA 4KKEA 2HXQA 2W4JA 5HBJA 4EOJA 2BDWA 2DS1A 4YSMA 1IAHA 1FMOE 1YKRA 2Z7SA 3ANQA 4RIOA 4RIYA 4WT6A 5CF6A 3FJQE 3Q96A 1YXUA 4I21A 2ITUA 3AT3A 1U54B 4L42A 3L8XA 4FZAB 4C34A 5EQYA 4QTEA 5LCKA 2YFXA 3W33A 3IDPA 3OF0A 3ZXZA 3EQHA 2XA4A 4FNXA 4IMYA 1Y8GA 4Q5EA 3WF6A 2QODA 3QQGA 4X3FA 4F9WA 1OIQA 3ALOA 5BYYA 2QD9A 5EKNA 2VWIA 3FC2A 4BZOA 1L3RE 4NM0A 4NU1A 5AR7A 4L52A 5HO6A 4BCKA 4DEAA 5ANDA 2X2LA 1X8BA 2OJGA 1IG1A 3VO3A 3ZH8A 2OZOA 3V8SA 5HVJA 2JITA 1QPEA 3U4WA 3NAYA 4DTAA 5CVGA 4QMOA 4L46A 4E3CA 4FTUA 4PF4A 1OBGA 4NZWB 4AT4A 2XK9A 4O0UA 4W4XA 4BCGA 4F6WA 4WRSA 1NVSA 3HGKA 1R0PA 4I4FA 5IQAA 1P2AA 3LVPA 4D1SA 1J91A 2WMSA 3UPXA 3VW6A 3UQFA 4WSYA 3EH9A 4FGBA 3VUKA 2XKFA 3QWJA 3DAKA 4DTKA 4F7JA 2W1GA 5LXMA 3MA6A 5EK7A 3FZPA 4M84A 3ZOSA 4JVGA 5CQWA 3VBWA 2XIYA 4O7SA 5D41A 1RE8A 3QX2A 5AR3A 3SXSA 4FSQA 3F3TA 5CNNA 5E7RA 5M06A 4Y5HA 1V0OA 3UYSA 2YM8A 2J0LA 2V7AA 3G90X 4FT0A 3RAKA 3CY3A 2PZIA 2PPQA 4FKWA 3PP0A 3COIA 4MBJA 1WAKA 3TN8A 3HUBA 3SDJA 3UYTA 1S9JA 3PJ3A 3DFAA 3ZSGA 4V0GA 4CZTA 5L2QA 2UZTA 4J95A 1FQ1B 4TWOA 3RM6A 2YLFA 5J7HA 3TNPC 4A06A 2C3LA 3FXXA 5I9VA 1BL6A 4HOKA 3UGCA 4LFIA 5A4QA 3VULA 4OGRA 4IHPA 2PUUA 2V7OA 5KHWA 2FUMA 4IZ5A 4IVBA 3UVQA 3M1SA 4G9RA 3LM5A 3R7IA 2CJMA 4D28A 3GCUA 4FV2A 3HAVA 2BTSA 3LCDA 4F08A 3KCFA 4FKRA 3TUDA 3OP5A 1K3AA 3HNGA 4C2VA 1A06A 1OPLA 3FSKA 4RPVA 4C8BA 4PNKA 5BUJA 4G3FA 5K0XA 5HO8A 3GU4A 2BIKB 3F3UA 2EU9A 5BPYA 5IEYA 3CBLA 4O96A 4YC3A 3ORKA 3IG7A 5TF9A 4YU2A 5L2TA 3S95A 2J5EA 1R1WA 3C51A 3UIXA 2C30A 1XWSA 3KXMA 3R7VA 3VBTA 2OIBA 4OTIA 2OJIA 4RLKA 2GHMA 3DK6A 3U6IA 2I7QA 3GU7A 4M68A 3G0EA 1VJYA 3IO7A 4IAFA 4IB0A 5FTGA 3CIKA 1EH4A 4G17A 4NKAA 1OL5A 4LRKA 4FC0A 4O0VA 4O0WA 5AP5A 4DEGA 5DR6A 5BYZA 4UXLA 4QPSA 4I1ZA 3QD0A 4C4GA 2WTKB 3HA6A 5CSXA 2ACXA 5IQIA 1CM8A 2QLQA 3HLLA 4C33A 3NWWA 3P5KA 4EOPA 4E4MA 3AMAA 3G33A 4NSTA 5EYKA 2QURA 4BL1A 2CGWA 2Y8OA 5L3AA 5FM3A 5HCZA 5AV0A 5DT4A 2GU8A 3NW7A 4EC8A 5IISA 4CMUA 2ZYBA 5DA3A 2WGJA 3HV4A 3G6GA 1PYXA 2EXEA 3KXHA 3OFMA 5L2IA 4W4YA 1M2QA 2V22A 2GDOA 1LR4A 4N6YA 4BI2A 4C58A 3OY1A 5IA3A 4EONA 2YDKA 4TRLA 2X9FA 1GIIA 3KMUA 2B55A 4APCA 3VHEA 1JKLA 2JIIA 2VTAA 3FLZA 3O8UA 4FZDB 4M67A 1KSWA 2PMNX 1WBSA 2BPMA 1YI3A 1SNXA 2XKEA 3CE3A 4CSVA 4ZY5A 4BR3A 2AC3A 2JAVA 2WAJA 2UZVA 5JMSA 5I9ZA 1FVRA 1YOLA 3LM0A 4NCTA 1H0VA 2RG5A 1JSVA 2C6LA 3UO6A 5IH5A 1DI9A 4MBLA 5L8KA 3C0HA 2F49A 4YZMA 4MX9A 5IQFA 2HXLA 4F4PA 3RPSA 1NY3A 5LVPA 5CT7A 2CHLA 4Y73A 4Z9LA 2C5OA 1OITA 1VYWA 3CGFA 3C50A 3SA0A 2OH0E 4JX7A 2VO0A 2QI8A 2Y0AA 3VS1A 4O7YA 1H4LA 1OIUA 2OWBA 2W17A 5DFPA 5DH3A 2W1CA 5ANOA 4Y83A 3QQFA 1XH5A 4FNZA 4MAOA 1OB3A 4XG4A 3RPRA 4IBMA 4X6RA 4CXAA 3PA5A 4DINA 4PMTA 4BIEA 1Q8UA 4RJ8A 3OCGA 4ZP5A 3AGMA 3ERKA 3BE9A 3A99A 5HESA 1W7HA 4FR4A 3FAAA 5D11A 4IX4A 2X7OA 4YJPA 4E5AX 1BLXA 3F5PA 4FSTA 5AUTA 2QC6A 5AUUA 1VR2A 5J9ZA 4U43A 4MHAA 4AGDA 5D10A 1KE6A 4AQCA 4G31A 5J5TA 1H25A 3UPZA 4OTRA 3R28A 4H58A 1OECA 4MWIA 3UC3A 2BHEA 3ZZEA 5GZ8A 3QLFA 4FKJA 1GNGA 3F7WA 4NT4A 4PDPA 4QD6A 1UU7A 3NZ0A 2KTYA 3MW1A 1H07A 3LJ1A 2XNNA 5IA4A 2WQNA 2Q0NA 4FSUA 3CPCA 3NW5A 4KIOA 4PTCA 3EZRA 4QMTA 3FQEA 2BILB 2DUVA 2YWPA 3GI3A 5J87A 4KIKA 4PPAA 4MTAA 4UB7A 3R9DA 4D5KA 3FMKA 4WHZA 4TYGA 4QOXA 5E8YA 2XK6A 3FKLA 3MJ1A 1TQMA 3RINA 3ZLSA 3QX4A 4KAOA 3G5DA 1PMVA 2OF2A 2CNQA 4FEVA 2F7EE 3QZIA 5GZ9A 2R0IA 3V8TA 1NW1A 3CXWA 4IVAA 3NUXA 4WNPA 2JKQA 4OT5A 4KB8A 4XG6A 3DQXA 5JFWA 3L8PA 4A9YA 2ZJWA 1OL6A 2JDOA 2C6KA 2GNJA 1SYKA 3MV5A 3PFQA 2WIHA 4OTFA 4TYEA 4YHJA 3VQUA 2B7AA 4AN9A 5M53A 4RC3A 3NYXA 4PL3A 2UZLA 2V0DA 3DPKA 3LIJA 3Q9YA 4TTHB 2GS7A 5DRBA 5FEDA 3I1AA 3R83A 4EHVA 4YHTA 3FZTA 4I5HA 5DG5A 4CFUA 5IQHA 2BKZA 3RNYA 5M4CA 1ATPE 5C01A 4UBAA 1NXKA 3VRYA 3BIZA 5LWNA 4YC8A 5B2KA 4J98A 2OZAB 4U5JA 3QL8A 5JGBA 2QOHA 2UW0A 4C3FA 1ZZ2A 5CAQA 3P0MA 2BROA 4LGDA 4DFBA 3MTFA 2V55A 3PIYA 5HIEA 4D4VA 4E8AA 3BHYA 4AF3A 4FL1A 4FV6A 4RVLA 3ZRKA 1MUOA 3NSZA 3E88A 3IW8A 3DT1A 2VGPA 3QGWA 5AFVA 5LCJA 3DTWA 3QHWA 3PSCA 1IASA 1Y57A 4RWIA 2YIXA 5FTQA 4X2KA 4Z16A 3FI8A 4BCNA 3OCTA 1H24A 3AD5A 5JKGA 4J8MA 5DHJA 4YTIA 4FL3A 4IM3A 3ID6C 3L9LA 4YJQA 3DAJA 5CSWA 5A4TA 5J9YA 4GW8A 3KRLA 5CAOA 1SZMA 4DH7A 4FEXA 1YDSE 3KGAA 3DJ7A 3TTIA 4UMUA 2C5YA 2OJ9A 3A61A 4GT3A 4EHZA 4IZ7A 2YABA 4KBCA 1F5QA 1YXTA 4GT5A 4O22A 2XNBA 5E91A 3IS5A 4D1ZA 3MESA 1LP4A 2PE0A 2RFNA 3E87A 3DXNA 1ZOHA 2FGIA 5AUVA 2HELA 2VWUA 3DCVA 4AA0A 1YQJA 3C7QA 3QQHA 5HLWA 4CG9A 1IA8A 4OTWA 4CFVA 2XM9A 4G5PA 4BBEA 3KEXA 3GC7A 2I1MA 2UW9A 5M4FA 3F5XA 4R7IA 4EL9A 3PA4A 4RJ5A 3P1AA 4XV2A 3VAPA 2C3JA 2GQGA 3AT4A 2XF0A 4KSQA 4LUEA 2ETRA 4GJ3A 5FDPA 3R9RA 3KK9A 2IZSA 4S32A 4XG2A 4G3GA 4JXFA 5LMKC 5CVHA 4CT1A 4IX6A 3IW4A 5HIDA 4AW2A 1DS5A 2UZOA 4RX7A 4BZDA 4ZLOA 4B4LA 4GK4A 2B53A 2EB2A 4MXXA 1UKIA 3BLQA 4M15A 2JKOA 3ELJA 4YZNA 3SV0A 4R3CA 4BWKA 1B6CB 1PXMA 3EFLA 1HCLA 5T68A 3SGCA 4KSPA 4A7CA 4AW0A 4BDHA 1H26A 5EM8A 4FICA 4N4SA 5IUHA 4M0ZA 3U8WA 2DYLA 3CTJA 4MXAA 1MQ4A 1W0XC 3FLNC 5H8EA 2P0CA 4TL0A 4Q5HA 2GNGA 3KB7A 1GZKA 5EQEA 2BDFA 5HG7A 5JZJA 4FUXA 4DGNA 2GHGA 5GJFA 4A4XA 3DLZA 3I5ZA 3O2MA 2FSLX 4DITA 4EEVA 4N70A 1FINA 2RFSA 4FKTA 1G8AA 4FL2A 4O7VA 2X7FA 3RALA 4MWHA 4EJ7A 2PVLA 2YWVA 3Q6WA 2ETMA 3H3CA 3D0EA 5AP4A 3SRVB 1WVXA 5KMKA 3NUYA 1CTPE 1ZY5A 3ROCA 3SX9A 3AC4A 3OBGA 3E64A 1CMKE 1W84A 3MVLA 4FX3A 5FEEA 5C27A 4EH6A 1P4OA 5EH0A 4BRXA 5EM6A 4QMQA 5CF8A 3R2YA 3W32A 3BEAA 4NJDA 4BTJA 5B2MA 4BKZA 5BNJA 4DLJA 1F0QA 1VZOA 4DEIA 3NUSA 2H8HA 3HRBA 1STCE 3HRFA 1GIHA 5L8LA 2BMCA 2XKCA 2BIYA 2C69A 2G01A 2W1EA 5AM6A 4HGEA 3VS6A 4XG9A 3S3IA 2UZEA 3F2NA 2XKDA 4EH4A 1O6KA 5CAPA 3ZM9A 3E5AA 4DA5A 4F09A 4O7RA 4JBOA 2YIYA 4C2WA 3OT3A 4QPAA 3PVUA 2G2FA 4GYIA 3NW6A 4BDKA 3GNIB 2VWZA 3IK3A 5F9EA 2A1AB 2PVMA 4FTCA 4HCUA 3EN4A 3BQCA 4KABA 4ASDA 4AUAA 2BKKA 3C0GA 4O2ZA 2W9FB 4AA4A 3NMUF 1BL7A 4WSQA 4XOYA 4DGLC 3L8SA 5I9WA 4JDKA 5BUEA 5DYJA 3FMEA 3ENHA 4TY1A 4HGLA 4TZRA 3FI4A 3EQRA 4P7EA 3V5TA 5D7AA 3WZJA 5KX8A 2FSOX 2CCIA 2P2IA 4FOBA 3F6XA 2R4BA 5EYCA 4BDCA 5AR2A 3SRVA 4O0YA 3SC1A 3HMIA 4AWIA 4CMTA 4GVJA 5GZAA 3MI9A 1NVQA 3LLTA 4QYGA 4DFNA 1G5SA 2WNTA 5M55A 4ACGA 3OMVA 3LJ0A 4WNMA 5FQDC 4O1PA 4D2PA 3GENA 3D5UA 5EQPA 3COMA 4BCPA 1YXXA 4NIFB 1GZNA 3O7LD 5AIKA 5ETCA 2QNJA 3KF7A 2OBJA 1YOJA 5DE2A 4BC6A 4DG3E 4JR3A 3R8VA 4PWNA 3R7EA 2C6MA 2I0YA 3QBNA 4FV0A 2JD5A 5EFQA 2OJFE 4TKSA 5IU2A 5AR4A 4E5BA 2IW6A 1QL6A 5J95A 2JGZA 5BVKA 5AMNA 3E7OA 5CEPA 4FTQA 3E3PA 3HZTA 3LMGA 2UW7A 4AW5A 2VUWA 3V6RA 4PMMA 5HNBA 3FY0A 4AN2A 4LGHA 4YLLA 4I5MA 4WOVA 3ET7A 3W8QA 4UALA 1OKWA 3LXPA 3SQQA 2WTWA 4YJTA 3UE4A 3U9CA 3VJNA 4DHFA 5H9BA 4KBAA 2B9JA 4C62A 3IDCA 2JDSA 4RMZA 3EN9A 4BHZA 3W16A 1MQBA 5FP6A 5E8VA 2OF4A 4JBVA 1M7NA 3HDNA 4IB5A 2I0EA 4BKYA 2CSNA 3DNEA 3RK5A 5LQFA 3WBLA 3RGFA 1JPAA 3C9WA 3AT2A 2IZRA 4QYHA 4ZMEA 1OL1A 3O7LB 4CFFA 4O7LA 2BZKB 3COKA 2BAKA 3BCEA 4FSRA 1PMUA 4L01A 4S2ZA 3TZ9A 3RPOA 4E6AA 5K4JA 5KMNA 4C4IA 5C4KA 4LRMA 5CZHA 2YM3A 3K54A 3HAMA 4KBKA 2HK5A 2QR7A 4CQEA 1KOBA 2VTIA 4USEA 4C61A 5AV4A 3OEFX 5KZIA 2F2UA 3GU8A 5HX6A 5BVDA 4FT7A 4EH9A 4E26A 1REJA 3H10A 2R3IA 2WKMA 5CNOA 3RVGA 5LVNA 3QTUA 4BDDA 4YURA 4YZCA 1FBNA 3PPJA 4I0RA 5A9UA 3U51A 4IE9A 3VVHA 1FVTA 2HW6A 3M11A 4X3JA 3Q2MA 3FXZA 2XBJA 3T9IA 5HORA 5M09A 1MP8A 3V5JA 2PHKA 4ZTHA 5I3RA 5DVRA 3FPMA 5KO1A 5FLFA 3NUUA 4PTEA 3KREA 1ZRZA 4JBPA 4M7IA 4FKSA 3UIUA 4E6CA 4F7LA 3ODYX 3P7AA 4DT9A 1JOWB 1Q41A 1XBBA 3IGOA 4FKPA 2VTOA 1QMZA 4O2PA 3A8WA 2IG7A 2XIZA 3NYVA 4WD5A 3WF5A 1HCKA 3LHJA 4ZOGA 3UO5A 3MWUA 3ULIA 3BHHA 2ITOA 1B39A 3FZOA 4Y8DA 3MH0A 3B8RA 1YI6A 3C5IA 2ESMA 3TT0A 4RVTA 3NIEA 3PJ2A 2VWXA 4FTAA 4G3EA 4CFXA 3MJ2A 2C6OA 3I79A 3GU6A 3TKHA 2RSVA 3CP9A 3L9MA 3CLYA 4L6QA 5K9IA 5A4EA 3BHUA 1WFCA 4FTRA 3AMYA 3DLSA 4GCJA 3TV7A 3PYYA 3OWPA 4C4JA 4JQEA 4D4SA 3P9JA 3REPA 3KVXA 3AQVA 3UOKA 3VQHA 1AQ1A 2VGOA 5DR9A 4ZTRA 4C37A 1URWA 5LVMA 5IDPA 2GFSA 1XH9A 3KCKA 4LGGA 4RIXA 3WF7A 5CAUA 3VHKA 1SM2A 4HCVA 4NCTC 4R3PA 1PKGA 2XIKA 2NNWB 3QQKA 4O81A 4I6BA 1GAGA 3KRWA 4RIYB 2R3HA 3F88A 3H0YA 2X8EA 5IQDA 4I0SA 4RVKA 2QKRA 2Q83A 2UW8A 3LQ8A 5IKWA 1H1SA 3MYGA 3QYZA 4I94A 3ORXA 3HP5A 2X2KA 4YTHA 5K5XA 5ANEA 4I22A 4FVPA 4JL9A 4RQKA 4HCTA 1XH6A 4QO9A 4OW8A 4TT7A 1OKZA 1QCFA 2BALA 3L9NA 5CI7A 2W06A 5G6VA 2IO6A 4BGHA 2X81A 1IAJA 3QTWA 3JS2A 4EBVA 2J9MA 5KMOA 4QT1A 3U9NA 1UNGA 1UV5A 4FKLA 2VNYA 4V04A 4Y5QA 4LG4A 3I6UA 3DA6A 3KL8A 3ITZA 4EQCA 1WCCA 4W8DA 4RJ6A 4W8EA 2OXYA 4PUZA 3V04A 5HNGA 4CD0A 3F5UA 4CZUA 4NM3A 5IG1A 3K2LA 5FGKA 5BQ0A 4QTBA 5HCXA 4E4NA 4C4EA 2ONLA 3ZSIA 2OSCA 1Q3WA 3WI6A 2HY81 3B8QA 3I60A 4PP7A 3WIKA 3MN3A 4PNIA 4EWHA 3PG3A 4YO6A 3GCVA 5TOZA 3N4TA 3UOLA 1E1VA 4C35A 4H3QA 4JS8A 3O8TA 4G3CA 4F7NA 4YPSA 3UIMA 5IH4A 2X8IA 3QCSA 4TWCA 3R71A 4IAIA 4Y72A 5CU3A 4F9YA 4ZTQA 3NLBA 3GOPA 5EOLA 2PULA 4FKGA 4QMPA 3BV2A 4J99A 4UMQA 5ACKA 5HO7A 5LVOA 3SKCA 4E73A 3FLQA 3FZ1A 5IDNA 2HWOA 3TZMA 4V0GB 3C4WA 1JWHA 2ITPA 3C13A 3ZLXA 5IA1A 1BI7A 1WBOA 3TI1A 4TWPA 3FY2A 2YZLA 1PXPA 3CTHA 3NYNA 4PMPA 4Q9ZA 1UU3A 2F2CB 4FV1A 1OBDA 1KWPA 3LFBA 5D9HA 2YCRA 3AMBA 3OOMA 3KU2A 4ZSLA 5C8NA 3B2TA 1TQIA 2VNWA 1CKIA 2BRNA 4KRCA 5M44A 2QONA 2QOCA 5HCYA 4UWCA 3E93A 4DT8A 2R3PA 3D2KA 3ZDUA 4XBUA 3G51A 3A7GA 3H0ZA 3DJ6A 3K3IA 3S2PA 5IEVA 3D9VA 2ITYA 3Q5ZA 5EW9A 3CD3A 3AC8A 3QTZA 3SXRA 3NAXA 4TNBA 3PJCA 4W4VA 5C4LA 4DYMA 3GGFA 4DEBA 4F1MA 5FUTA 4P4CA 5GHVA 2VV9A 4YO4A 2WIPA 4AW1A 4D2SA 5A4CA 5I9XA 2IJMA 1OGUA 2XK3A 3EN6A 3QU0A 3ZEPA 3OG7A 4KA3A 4KNBA 5LWMA 4AP7A 3WE8A 2W0JA 5HU3A 4FVRA 5HLPA 3QWKA 3R63A 3V5QA 1Z5MA 3ZC5A 4CKIA 3ORZA 4QP7A 5FXSA 4B8MA 4EUUA 3QKKA 2XS0A 4B7TA 2YEXA 3F5GA 4XOZA 4GT4A 2YZAA 5E90A 4USFA 4QMLA 4U79A 4DFZE 3KXXA 3ZUTA 3F7ZA 2BHHA 3PY0A 4MXOA 3VW8A 1CKPA 2SRCA 1XBAA 3LLAA 1CKJA 2OIDA 4EOMA 3UBDA 1KE9A 2PY3A 1YVJA 5CXZA 2R3JA 2E2BA 3DGKA 3R1YA 3D7ZA 2HOGA 3PSDA 4AFEA 3QCYA 3F3VA 3LFCA 3LMHA 3U54A 5GJDA 2WMRA 4BI1A 3ZFMA 4IX3A 5H8BA 5EHYA 2B9HA 1ZWSA 1Q62A 1OL7A 3GC0A 4ZY4A 3TDWA 4EH2A 4YJUA 3QCXA 5CAVA 4G34A 5C9CA 2UW3A 3QTRA 1GZ8A 4JIAA 4ANQA 3N4VA 4E7WA 4U45A 4AZSA 5CU6A 1WBNA 3ZS5A 3PJ8A 2VX3A 1UA2A 4NFNA 5JFXA 3PLSA 4FYOA 3UOJA 3ZZWA 3AGLA 3EQBA 4YLKA 3R04A 2ERZE 2ERKA 2IVUA 5FBNC 5CEKA 4ZZNA 3V8WA 1JSTA 2J0KA 2VWWA 1E9HA 4GVAA 5B0XA 1Y6AA 2O0UA 3QUEA 3RPVA 3UNJA 4CTCA 3G15A 3EN5A 5I9UA 4DTBA 1RJBA 3ZTXA 2X6DA 4EOLA 1FOTA 2WTJA 2WQMA 4RC2A 3HRCA 5JFSA 5CENA 1ZYJA 4UY9A 4IAZA 2UZDA 5DBXA 4C0TA 3QTSA 3FLSA 3PSBA 1YDTE 4FIJA 4AACA 5BX0A 3ZLYA 2B9IA 1H27A 4IH8A 4ITJA 3OOGA 1Q4LA 2WMQA 3HKOA 3KK8A 3V3VA 2AUHA 3PG1A 4FSMA 4FA2A 2C3IB 4QMNA 3AXWA 2C3KA 2PVJA 4DF3A 2QU5A 2J2IB 4MD8E 4NM5A 4U42A 5BVEA 2ITVA 4B8LA 4XV1A 4ITIA 5I9YA 3AC5A 4E5WA 2EXCX 4W9XA 4BY9E 5I3OA 3LOKA 3DTCA 3RKBA 2RG6A 4M8TA 3SW7A 2NPQA 3ZBFA 4EOKA 3LMIA 5TT7A 2BRHA 3GBZA 4Q2AA 4BDEA 4BDBA 4BFMA 2XNPA 1UU8A 1Q8ZA 2W5HA 3OY3A 2WTVA 4L43A 4GFMA 4L45A 3P79A 5G1XA 2CKPA 2BUJA 4MEDA 4JR7A 2XUUA 3BQRA 5EW8A 3HL7A 3TACA 3OVVA 3RWQA 4JLCA 4QP3A 1PXJA 2UVZA 5L8JA 1JAMA 2DQ7X 3IQ7A 4NJ3A 4RJ3A 3ZO1A 5A46A 4ASXA 4AU8A 1J1BA 1O6LA 2R3QA 4HGSA 4KIKB 4N0SA 5E8UA 3R9OA 2UW5A 3C4ZA 4ZLZA 4WUAA 1W8CA 3A8XA 2BZIB 2YCSA 5FTOA 3SXFA 3QQUA 3TNIA 2VX0A 2WQEA 3ULZA 3QRIA 2YACA 2ZAZA 3TJDA 3BRBA 4D2WA 2B4SB 1XO2B 3JR1A 2A19B 3Q4ZA 4IDVA 4RT7A 3GU5A 3PTGA 4D2TA 3QYWA 2IN6A 2CKQA 4GU9A 4HVHA 4DFYA 4U0IA 4JQ7A 2GMXA 4FTNA 5IA5A 3ORMA 4I23A 3R8MA 3U4UA 4QNAA 3GC9A 4MF0A 2RFDA 2F7XE 5HD4A 4DBXA 4YBKA 1ZYLA 4G6LA 4UZHA 3BYSA 4GFOA 4X21A 3RM7A 4H1MA 2Z7QA 1PF8A 3F61A 4NH1A 5DIAA 4BN1A 1Q3DA 4EK8A 3CSVA 5CEQA 4HVDA 4EH5A 3NS9A 4XG8A 1TKIA 5CEOA 4HGTA 4BGGA 3H9OA 5IF1A 1Y91A 4IB3A 4M66A 3AOXA 4MNFA 2CGVA 1RDQE 2CGXA 2VAGA 4XNEA 4KKGA 4FV7A 2ZMDA 4FZ7A 2Q0BA 4FEWA 3PA3A 5CS6A 2QOQA 1QPCA 4FOCA 4EI4A 4UWYA 4XCUA 4DCAA 4AGWA 2BFXA 3T9TA 2YITA 4LL0A 4N6ZA 3WILA 3EFKA 2XP2A 3EZVA 3OWKA 4Z7HA 3EKNA 3EKKA 3LQ5A 4G6NA 3O17A 4NFMA 3D14A 5CI6A 2VO7A 3VF9A 3SG9A 1M7QA 4R5SA 1RW8A 2ZDTA 4Z3VA 3G0FA 3NUNA 1XR1A 2WMUA 4LMUA 1OPKA 2XIRA 5ETIA 3WYYA 2CKEA 5CWZA 4QNYA 4WO5A 4BTKA 4FNYA 4OTGA 1LUFA 4A9RA 1IA9A 4IZYA 2O64A 3QQLA 5HTIA 3EN7A 5BVWA 5HNIX 5ETAA 3VS5A 3ZFXA 4XG3A 4EOQA 2H9VA 5L4QA 4FIEA 5EHOA 4QYEA 4DLIA 2Y6OA 3OWJA 3EL8A 1AGWA 3L8VA 4MK0A 5AUYA 5HZNA 1PY5A 2XNEA 3EJ1A 3CD8A 5D12A 3P86A 4ALWA 1WMKA 3SD0A 2XRWA 1ZOEA 4MKCA 5HBHA 2W4OA 3Q3BA 1APME 4G16A 3TWJA 3DXPA 4RA5A 3I4BA 2ZV7A 3A60A 4H05A 2YAKA 3POZA 4J1RA 4O83A 3DFCB 3VS3A 4YJVA 1O6YA 1NA7A 5JZNA 2OW3A 4BHNA 2EXMA 4MD7E 3PZEA 3WE4A 5KUPA 4M69A 3TZ8A 2PMIA 3R0TA 3MPMA 3KY2A 3PXZA 5EW3A 5HI2A 4DGGA 5FXRA 2PMLX 1SMHA 4NEUA 5F95A 3DBQA 4K77A 2OLCA 3GCSA 4FTJA 4FTMA 4CTBA 2C0OA 2FYSA 5J1WA 3DU8A 2JFLA 1JKKA 3P08A 2O2UA 4CFNA 3U87A 5KMMA 4R77A 3FI3A 3KULA 3PY3A 5AP1A 4APPA 4TYJA 4ZSEA 2FSTX 2GTMA 4EHEA 2R7IA 1R78A 4G2FA 5C8MA 3IDBA 3FV8A 5M4UA 4MXYA 1PYEA 4EH3A 5CALA 2WMBA 3Q6UA 5ACBC 3PPKA 2W1ZA 4RG0A 3JY9A 3G2FA 3QTQA 5BVNA 1XBCA 5IMXA 3QXPA 2E9OA 2XK4A 4KKHA 3ANRA 4DFLA 4HW7A 1Q8YA 3DOGA 2BRBA 3Q52A 4IEBA 3F2AA 3QAME 5K5NA 2IPXA 4BCOA 4QQTA 4DG0E 4IANA 3SOCA 3VUMA 4UV0A 1JLUE 4ID7A 5AR5A 4CFMA 2VTNA 3ZEWA 5AX3A 3QD4A 4BI0A 4R7BA 4R3RA 1JKSA 3IKAA 3P7CA 3KVWA 4XG7A 3ORLA 4WG5A 4OBPA 4X2GA 2UZBA 2W5AA 3DDQA 1V0PA 3MH3A 4ALVA 3LCSA 3FHRA 5C8KA 4R6VA 2PVNA 4BWXA 3C4FA 4K18A 3P23A 4JG7A 4J7BA 5IA0A 2XNGA 1P14A 4GKHA 2PVKA 2OKRA 2Y4IC 2XRUA 3EHAA 4LRJA 4ACDA 3ZONA 3BYVA 3CEKA 1K2PA 3BE2A 4NTTA 3F66A 1MRYA 2O8YA 2YJSA 3W2PA 3ALNA 3MIYA 3WARA 1YDRE 2VRXA 5DT0A 4UYAA 3RZBA 4B99A 2ZM3A 3MIAA 2QHMA 4OTDA 2YISA 2VWBA 3QD3A 3BLHA 4BYJA 2PZYA 2Z02A 4DAWA 4E6DA 1BUHA 1IEPA 3R7YA 3THBA 2NP8A 4O6EA 3GT8A 5GIPE 2YM5A 5LMBA 1WVWA 3WOWA 4D0WA 4EYMA 2ZB0A 3RAIA 1ZAOA 2Z2WA 3E63A 5FP5A 1OZ1A 1TQPA 2JLDA 3DKGA 3PXYA 1PKDA 4MQ1A 4BCFA 3OT8A 1UNHA 4QQJA 5FEQA 4HZSA 3DBEA 3KN6A 3DBCA 4QP6A 2CNVA 3NUPA 3E92A 3WZUA 1M52A 3RZFA 2XJ0A 2EUFB 2WTCA 2XCKA 4P5QA 5DPVA 3HX4A 5HBEA 2W1FA 3F82A 1P5EA 1Q24A 4O0RA 5A4LA 5JRQA 1M14A 3UDBA 4ZY6A 4P5ZA 2OJJA 4USDA 5KCVA 1JVPP 2XEZA 3TCPA 4IM2A 2OFVA 1Q97A 3TZ7A 2RFEA 2UV2A 3AC3A 4O1OA 3CC6A 4U3ZA 1LEZA 4EKKA 5C1QB 5AP2A 2XYUA 3ORTA 3R22A 4QTAA 3EQDA 3BBTB 3DNDA 2XCHA 3O8PA 4FV8A 2UZWE 5J8IA 1OVEA 3VUGA 3D5XA 2ONLC 4Y85A 4V01A 5CASA 4Z55A 4IFGA 4RBLA 4K1BA 4KIQA 4D4YA 3TKUA 2J90A 3EIDA 3FMDA 1GIJA 2JAMA 3O96A 4FZFB 4PP9A 2PE2A 4UEUA 4OAUC 3EMGA 3UIBA 2VTJA 3QKMA 4AT3A 4DN5A 2QG7A 3BWFA 3JXWA 3NEWA 4I0TA 4HVSA 3NUAA 5DRDA 5EI6A 4EORA 4IQ6A 2GNHA 2VWVA 4ZSAA 1E1XA 1OUYA 3BYMA 4UXQA 4GG7A 3CQUA 3R7OA 3R2BA 3HMNA 3D7TA 3EQCA 3VN9A 3PDTA 5LJJA 4JBQA 4NWMA 3TUBA 5E8XA 4HZRA 2BFYA 4O21A 4FG7A 2CGUA 5HTCA 1OKYA 2JFMA 4GKIA 4FTLA 4ZS4A 2C0TA 2PZ5A 1UKHA 2R3KA 3FQSA 3I81A 4OAVB 5HE2A 1KUTA 4MF1A 3TEIA 5CEMA 3Q32A 3BLRA 2J50A 3A7IA 4TPTA 4H1JA 4HNIA 5CY3A 4L68A 4RSSA 5AUXA 5B7VA 3CKXA 1YXVA 5DWRA 3KA0A 5F1ZA 5GINE 2Z7LA 4EQMA 1REKA 4FZ6A 4XH6A 5J1VA 2WO6A 3ACJA 4LYNA 2W99B 3E8NA 2OH4A 3GEQA 4YHFA 3RAHA 4FSWA 3TV4A 4M13A 2YM6A 1IRKA 2QOFA 4JRVA 1L8TA 5BYLA 3HV7A 4AS0A 5HX8A 4GIHA 2DWBA 2XBAA 3C4EA 4O82A 1H08A 3OHTA 4O27B 4XBRA 3ZBXA 2GQSA 2FB8A 3QRUA 3WYXA 1KOAA 4LOQA 4M97A 3D15A 5T6KA 3MFTA 4FEQA 4IM0A 3SW4A 4EZ7A 3W2SA 4UX9A 1Q5KA 3O50A 3R02A 4NW5A 4NM7A 3A2CA 3AD4A 3DBDA 1J1CA 2ZDUA 5HG5A 1BMKA 4IC7A 5AR8A 3K5VA 2HY0A 3QLGA 1H1WA 4AT5A 1Q61A 1U46A 3BU3A 5HIBA 3ZUVA 1BX6A 3UQGA 2PYWA 4ZIMA 5IH6A 2B54A 3N4UA 4NW6A 5ANJA 4O91A 1ZMUA 2WMAA 3QKLA 3DZOA 5ANGA 4YPDA 5EYDA 5E8WA 3VS7A 1H1RA 1NT2A 2F9GA 4FT5A 4ONAA 2R3FA 5ANKA 4WG3A 3BGZA 2ITWA 4GK2A 4BDFA 3JUHA 2QOLA 3ZLWA 3E7VA 4RWLA 3NCGA 4CQGA 1U4DA 4CV8A 3KRRA 2Y4IB 5D1JA 3L1SA 3ZM4A 3UZRA 5IQGA 1PXLA 1SVHA 3HMPA 5EDQA 4DEHA 2CN5A 3PIXA 4FIFA 4A9SA 4F64A 5J9LA 1PMEA 3ATSA 3BU5A 2W1IA 4FTTA 4RIXB 4BCHA 1PXOA 5I5ZA 3TM0A 4IXPA 5JH6A 4O7ZA 2R9SA 4K33A 3RJCA 4I24A 4DGOA 3W2CA 5KHXA 4RFZA 1OMWA 1UVRA 1BYGA 4EC9A 5AP7A 2Z8CA 2C6DA 4IWQA 5FRIA 2GNIA 3KC3A
chains in the Genus database with same CATH superfamily
3ACKA 2VWYA 4WUNA 3PUPA 4AZTA 1XQZA 2WOTA 1VLRA 4UN0C 4FKUA 4U7ZA 5AP3A 2Y7JA 2QHNA 5CU2A 3EFJA 1G8SA 2PK9A 1TVOA 5EG3A 3EWHA 1VEBA 2QOBA 3A7FA 5EHLA 3UMWA 3WZEA 3FBVA 3VUHA 3HECA 4IWPA 1ZMWA 3II5A 3UMXA 1WBTA 3ODZX 3PXRA 2B0QA 2Z60A 5FWKK 2Y9QA 1Q8TA 3COHA 4QP2A 4RX8A 4WA9A 4TXCA 4QTCA 4PDSA 3VJOA 3HMOA 3QZFA 3JPVA 4PV0A 1K9AA 2R0UA 2ZVAA 2GCDA 4B9DA 3CY2A 4IAKA 5AUZA 2XMYA 4LV7A 2RKUA 2QVSE 4BBFA 2OGVA 3BPRA 2CN8A 4KS7A 4IJPA 3D2IA 4OTHA 4BYIA 4JI9A 3OBJA 5HTBA 2LAVA 1R0EA 3DY7A 4R1VA 5J5SA 4YJNA 4DH1A 5IQBA 4PPBA 5KBRA 3O51A 3ATTA 5EI8A 2E9NA 3IW7A 1OKVA 4H39A 3P4KA 2CLQA 1U5RA 4A07A 2X9EA 2PU8A 2YM7A 4YZDA 4EOOA 4F0FA 4R7HA 3C5UA 5ITAA 4XJ0A 3AD6A 3UODA 3MB6A 3VC4A 2W9ZB 4PY1A 3GUBA 3UVPA 1W83A 2JBOA 3R30A 3FL4A 3TYKA 1PMNA 3E8DA 4HYIA 2XJ2A 4UMPA 3DQWA 2B52A 4CGAA 2CNUA 4QMMA 4DHJA 3FUPA 3UVRA 2C5XA 4U8ZA 5I4NA 2J7TA 3FWQA 4RWJA 3QD2B 5HHWA 3DJ5A 3ZO2A 3IOPA 3KQ7A 3IPHA 2AYPA 4IWDA 3UOHA 4FIHA 4BCJA 4C4FA 4D0XA 4U40A 3U6HA 5HG9A 2UVXA 3S1HA 3UP2A 4BWPA 4KS8A 2V62A 3QRJA 2WU7A 1PXIA 2I40A 4L7FA 4TYHA 2RIOA 5C03A 3IGGA 1I09A 3FLYA 4FK3A 4ZLYA 3VNTA 4KUJA 3M42A 2R2PA 4H3PA 4YJRA 2QCSA 3PJ1A 4CLIA 3BELA 3LXKA 4F1OA 3NCZA 2VTLA 4BGQA 3KIOC 2OI4X 4JDJA 3PRIA 3BBWA 1OI9A 4RX5A 2WTIA 3R00A 4QQCA 4CYJA 3QZHA 1XHAA 4IB1A 1R3CA 4JNWA 3PXKA 4XS2A 4BCQA 3ETAA 3CCNA 3FHIA 3GFEA 5H8GA 5EOBA 4HVIA 4ZJVA 1OIYA 2WOUA 3PE1A 2QO2A 3H4JA 3NDMA 4B6LA 4GRBA 2WMVA 4M3QA 4BTMA 5KKRC 5M07A 2WXVA 4QMUA 4I6HA 4FE2A 2YCFA 4TW9A 2HIWA 3FI2A 5FM2A 5AWMA 4TWNA 5HD7A 5IA2A 3R1NA 4O7TA 2OK1A 3EL7A 3QRKA 4GJ2A 3TNQB 4NYEA 1PRYA 2VTTA 4UMTA 2CPKE 2HZ4A 3FYJX 4R1YA 1J3HA 4DFXE 1VYZA 2R3LA 4UYNA 3NNWA 3P7BA 5AV3A 3ZO3A 1G8KA 3BYUA 4F6SA 3P5JC 4JOAA 4OBOA 5M56A 2X8DA 3DDPA 4MNEA 3GQIA 2XALA 1ZXEA 3DS6A 3W18A 3BHVA 3I7BA 3L9PA 3QTXA 2FVDA 4W4WA 5CX9A 3VUDA 4LL5A 1A9UA 2OICA 3VS4A 3RHKA 5TKDA 4FIIA 3V5LA 4JMQA 4RRVA 2QKWB 4NKSA 2J51A 4QTDA 1WBPA 4AZFA 2BCJA 4FBXA 2B1PA 4BCIA 4MYGA 1ERKA 3Q5IA 2P2HA 4J96A 3QCQA 4A9TA 4IJ9A 5HICA 4D58A 4YUQA 4O7WA 4X2JA 2VX1A 4AX8A 3GCPA 1Z9XA 4L53A 4IC8A 4GMYA 2HZIA 4I20A 4D1XA 3AKKA 3VUTA 2X7GA 3DKCA 4FK6A 4M14A 3HV6A 4RZWA 5TO8A 3TMOA 2NO3A 4GL9A 3ZC6A 4ZTMA 4DBNA 2GS6A 2I0HA 2W4KA 3HP2A 3KF4A 4FG8A 3R7UA 2C1AA 2QU6A 4C59A 1H8FA 2EB3A 4YTFA 4GYGA 2BRMA 5AEPA 3Q9XA 3LKMA 1JQHA 3H30A 4GU6A 1JKTA 4J97A 3CGOA 4AE6A 4AFJA 3O0GA 1T45A 2HYYA 3CQEA 2NRUA 3R8PA 5JRSA 2BVAA 5E1EA 5T3QA 5EDRA 2A27A 4AOIA 2YCQA 3KMMA 2JIVA 4CCUA 2FH9A 4YNEA 4EKLA 4DE4A 5BMMA 4D4RA 4AGUA 2W5BA 5H3QA 3RK9A 3OXIA 3O23A 4QP9A 3VBVA 1H1QA 2XEYA 1DM2A 4CCBA 5L2WA 5HE0A 5HVYA 3WF9A 2WELA 3MS9A 3MY1A 3MY5A 4F63A 3QGYA 4X0MA 4D9UA 2Y6MA 5IPJA 5TR6A 3ZRLA 4PRJA 4N57A 3VRZA 4K2RA 3ZRMA 4AE9A 4ASEA 4ANSA 4FSZA 3Q4TA 3BU6A 5AAFA 4E4XA 4FSNA 4BDJA 4I4EA 4CKRA 2FSMX 3E3BX 4HPUE 3HV3A 4L44A 4U80A 5CF5A 3SG8A 4BIDA 3OROA 1U54A 2YDJA 4QMSA 2YIWA 2ITNA 2R3MA 2B9FA 4AG8A 5I0BA 4BDAA 2YERA 2WQOA 4JG8A 1DAWA 2UUEA 5LARA 4BBMA 2XB7A 1YRPA 2VN9A 3ORPA 3G9LX 3NFGB 4K9YA 4L7SA 4YMJA 3TJCA 4H36A 4GV1A 4KRDA 2PUIA 5EI2A 4K8AA 1H28A 4AQKA 1S9IA 4CLJA 2ZOQA 3OEZA 3OW4A 4LQMA 4PL5A 3E8CA 3FQHA 4MXCA 4QP1A 3VBQA 2ITTA 2XNMA 2PVHA 3BLAA 3M2WA 4HVGA 3AC2A 5FDXA 4CMOA 1OUKA 2WU6A 5F94A 1OM1A 3LZBA 3PVBA 1Z57A 3LCTA 4QDEA 1IR3A 2XZSA 3HDMA 4IFCA 4FTKA 1DAYA 3MBLA 1QPJA 3JY0A 4IVDA 5DT3A 4DDIA 4LV5A 1WBVA 2RGPA 3KN5A 5DLSA 4S34A 4AZWA 3QUDA 1M17A 2PVYA 4C3PA 3K3JA 5LMAA 2XK7A 1G3NA 3UTOA 3S00A 1YI4A 3B2WA 4R8QA 3PXFA 2C47A 2P3GX 3LFQA 3BEGA 4ZAUA 4GG5A 3Q53A 3FEGA 3ZDIA 2UW4A 4ENXA 5IUIA 3QC9A 1ZY4A 1CSNA 2XAOA 2OO8X 3FMNA 1OIRA 2EWAA 2XVDA 3NVMB 4P2KA 4QMVA 3A4PA 4AA5A 4ERKA 2CMWA 3TNWA 4GFGA 5J7BA 4EZ5A 2WFYA 2JKMA 3GCQA 5EDPA 1UWJA 5LOHA 2PUPA 4F9BA 3W2QA 1GOLA 5CSHA 1V0BA 1MRUA 2BDJA 3BKBA 5GNKA 2HW7A 3DAEA 4ANMA 3UNKA 2WMTA 2IF8A 3OCSA 5KKRB 4O38A 4Z7GA 4EK3A 2WEIA 3QA8A 3BL9A 3UDTA 3DKOA 3OC1A 4F7SA 4ZJJA 3UG1A 4L8MA 5KMJA 3D83A 1V1KA 5JT2A 3QALE 4ALUA 3JVRA 2X4ZA 4IW0A 5KZ0A 4LV8A 3HMMA 4HYSA 4PMSA 3RBWA 3O5AA 2G9XA 3QHRA 4TNDA 4ZTLA 2JDRA 3FSFA 3FZSA 3LXNA 2C5NA 3Q9WA 4CRSA 1J7UA 1A48A 3BV3A 2O5KA 4O84A 4FKQA 3UP7A 4DEDA 4F99A 4ACMA 1LPUA 1YXSA 4AXCA 4OTPA 5DEYA 3KKVA 3PWDA 4IVCA 3GVUA 2ZM1A 4FKIA 4LUDA 5FXQA 3UZPA 2OG8A 3GOKA 3WF8A 5AADA 4PDOA 3Q4UA 2AC5A 4WBOA 5LVLA 3RMFA 1ND4A 4DH3A 4MD9E 4X2FA 2W96B 2WB8A 3F9NA 2P55A 2F4JA 2WQBA 4FNWA 4PDYA 4OT6A 2ZM4A 2UW6A 3FMMA 2BRGA 3LFNA 3NPCA 3CR0A 2A2AA 3KMWA 1XH4A 4U41A 2Y4PA 2VTMA 1P4FA 5HG8A 4MH7A 1H01A 3NNXA 2OXXA 2CCHA 4R5YA 2IZUA 2VZ6A 3SLSA 3ZO4A 3EFWA 5HU9A 3R1SA 4JIKA 2PWLA 4O6LA 3KFAA 1QPDA 4YJOA 2O63A 4I6FA 4A4OA 4M69B 2PZRA 2UZNA 1PJKA 4GIIA 3IOKA 4RFYA 4EYJA 3QXOA 2XJ1A 4YGAA 3QA0A 4FRFA 1Q99A 4RZVA 5BVOA 4WIHA 3NIZA 4O0XA 2GQRA 4BKJA 1OL2A 5CZIA 3MH2A 5HE1A 5M4IA 3NNVA 4FVQA 4WG4A 3GC8A 2WMXA 2H34A 5AM7A 2P33A 1SNUA 3DV3A 3KULB 3QC4A 5AV2A 5JSMA 3GXLA 4X7QA 3CJFA 3SOAA 4JJRA 2XIXA 4C36A 4UWBA 2C68A 2ZV2A 2C0IA 4RIWA 3W2RA 4X6QC 2OIQA 1FMKA 4RWKA 4FG9A 2E9PA 4OUCA 3MGYA 5CEIA 1J7LA 3RI1A 1GZOA 2HENA 2REIA 2IVTA 1ZYSA 5EKOA 3UO4A 3WZKA 4QP4A 1HOWA 2XK8A 3DB8A 3HUCA 4EUTA 2E9UA 4XP3A 1FGKA 3MVHA 4J8NA 4FUYA 3VUIA 1H00A 2GS2A 5J79A 5L6OA 4FV5A 3OTUA 4FTIA 4QMZA 5AX9A 3UNZA 3RCJA 3FYKX 3FL5A 2I0VA 1WZYA 2W7XA 3I0QA 3MFSA 3BI6A 1XH7A 3W1FA 5BMSA 4L3JA 3IW5A 2VO3A 4ZZOA 3VBYA 1U5QA 1BKXA 4RQVA 4Y95A 5DI1A 3FLWA 4U9AA 1PHKA 5A6OA 4DFUA 2X0GA 3MVJA 1F3MC 4HNFA 2YA9A 2XNOA 1U59A 4O86A 2PZPA 4EWQA 1W2FA 2J0MB 3F3ZA 5L6PA 1ZZLA 2OXDA 3F69A 3QZGA 4ZXTA 1FGIA 2VTSA 5E8TA 4U3YA 2YN8A 3R6XA 4DEEA 4CKJA 4X2NA 5K0KA 4KIPA 5A3XA 3PPZA 2A0CX 2J6MA 3UC4A 4CEGA 1PXNA 1J7IA 4DH8A 4EK6A 4PL4A 5CF4A 2JKKA 2R64A 2VO6A 5CQUA 2J4ZA 1WBWA 4F0GA 4EH7A 4AOTA 3WIGA 2YLEA 4HPTE 3DZQA 3FC1X 1YWNA 2J5FA 4YZ9A 2R7BA 5A6NA 4DH5A 2JDTA 3RNIA 3BHTA 3VF8A 4EJNA 4AN3A 3O71A 3NR9A 3DKFA 2IW9A 3F3WA 3RAWA 5M08A 4XV9A 3RHXA 5KNJA 3NX8A 4YSJA 5AUWA 4ACHA 4U97A 4U81A 3OTVA 5KE0A 4ANBA 3OZ6A 2VTHA 3ZXTA 5A14A 4XP0A 5L6WL 1AD5A 3MH1A 3V5WA 3ZYAA 5AA8A 1I44A 4RFMA 3EOCA 4DC2A 5CVFA 5FG8A 4C57A 1ZMVA 4JQ8A 3ENMA 4L3LA 3K5UA 4U44A 4ASZA 4L3PA 4UMRA 4RLLA 5E8SA 3D4QA 4FMQA 4XUFA 3Q4CA 2BZHB 4I3ZA 5EM7A 4YC6A 3A7JA 4LOOA 4QRCA 4XRJA 3C1XA 4YBJA 5F20A 3ZU7A 4ANNA 5AAGA 3MFRA 3DB6A 5CT0A 4AGCA 4IZAA 4HYHA 4XHKB 5BVFA 3LAUA 2X39A 3N51A 4ZMFA 5AIRA 3LFSA 3KXZA 5M57A 4IIRA 3MSSA 4DGMA 1UNLA 2OZAA 3G9NA 3G6HA 5JQ8A 4TN6A 3GQLA 5IZFA 5JK3A 2C6TA 3FMHA 3HA8A 2ZFYA 1W82A 4RX9A 4EHGA 2ETKA 3KRXA 5ANIA 5IQCA 3MFUA 3LQ3A 2CLXA 3D5VA 4GEOA 5DNRA 3D7TB 5A54A 5AA9A 2QO7A 4XYFA 2BR1A 3I7CA 4OBQA 3PVGA 3LCOA 4EZ3A 3UZTA 2PL0A 4K11A 2PTKA 4GUBA 3R01A 5E4HA 4C7TA 1O9UA 3OCBA 1KE7A 5CLPA 4YJSA 3POOA 4DCEA 4YZBA 5DR2A 1YWVA 4EK4A 4EQUA 1ZYCA 2BZJA 3H9RA 2GHLA 1URCA 4IADA 2YJRA 3IECA 3P78A 1YW2A 4XX9A 3RWPA 4D55A 2X6EA 2G1TA 3FKNA 2Z7RA 4EBWA 4E6QA 4E1ZA 4YNOA 2QO9A 3TNHA 4CT2A 4RJ7A 3TTJA 5CU0A 2OFUA 4C4HA 2R3GA 5IMEA 3GB2A 2YHVA 2CDZA 4JT3A 5CSVA 5JGDA 4KINA 4PX6A 1H1PA 2KULA 4ZS0A 4ANOA 3EQIA 3MDYA 4HYUA 4FYNA 5CTPA 4PTGA 4ZSGA 2ZV8A 5EYMA 4CV9A 2PSQA 4I92A 1YHVA 5IEXA 1KE8A 3R21A 4ERWA 4NL0A 3U55A 3F2RA 5F4NA 1ZOGA 2GPHA 4GK3A 5E92A 3V51A 2WTDA 3RCDA 3S4QA 3EYGA 3LFFA 4QMWA 4W9WA 4Y46A 2C1BA 4QDVA 4MXZA 1JSUA 4Q9SA 4ZTNA 4BIBA 3ZHPC 3BGQA 4XRLA 1PXKA 2BTRA 1FVVA 3MB7A 3TUCA 4GSBA 4RC4A 2HAKA 4MBIA 3ORIA 2WZJA 4LMNA 2H6DA 5E1SA 3GFWA 1KE5A 2HZNA 3FZRA 4O0TA 3ZSHA 4QYYA 4U6RA 5HLNA 4OTQA 3PE2A 3UQCA 5HKMA 3HV5A 4I5PA 2GNFA 3EYHA 3TDVA 3SAYA 3BX5A 5K4IA 4YLJA 4AOJA 1Q8WA 4QPMA 3T3UA 4NUSA 3R73A 3UG2A 2G15A 4BTFA 1GJOA 1ZLTA 2YDIA 3D94A 3DK3A 3HYHA 5DOSA 3TIZA 3KXGA 2W1HA 3TIYA 3NGAA 3CS9A 4ZTSA 4BDGA 4D5HA 4DG2E 5HQ0A 4C3RA 5CYIA 3W2OA 2VD5A 4ANLA 5AAEA 2WEVA 5CANA 2HWPA 4MVFA 3ZFYA 4G9CA 4LI5A 5DGZA 2ITZA 3PP1A 1M2PA 3V5PA 4EH8A 1GY3A 5AV1A 3MTLA 4X3FC 2UVYA 4RJ4A 4TYIA 5JQ5A 3DBFA 4D9TA 4I5CA 4PPCA 2PE1A 2ZB1A 2GFCA 4QP8A 1B38A 5HE3A 4D2VA 5DMZA 5GIOE 4WNOA 5H2UA 4ACCA 2IZTA 2VTRA 4J53A 3LFDA 3TG1A 4WBBB 4V05A 3LXLA 3TXOA 1LEWA 3JYAA 4OR5A 4C02A 4L67A 2WD1A 2UZUE 3HVCA 4G3DA 4II5A 2QQ7A 2G2HA 2R5TA 4EK5A 4FIGA 4L9IA 2XM8A 2X2MA 4AAAA 3OUNB 1ST4A 5GJGA 2PMOX 4H3BA 4CYIA 3V6SA 3C4XA 3OXTA 4E20A 4FV3A 3FPQA 3CTQA 4AAYA 1R39A 4YTCA 4GS6A 2RL5A 3ROYA 2V5QA 3TV6A 1KV1A 1RQQA 4RIWB 3NRMA 3R8ZA 3ZMMA 5ICPA 3PXQA 2WHBA 4JAIA 4F6UA 4XLVA 3S0OA 2PUNA 4A9UA 4AXDA 2X4FA 5HVKA 4RGJA 4O7NA 4ZEGA 4BDIA 3H9FA 1W98A 5FD2A 3QRTA 4G5JA 1M2RA 5M51A 4HJOA 5AJQA 1YHSA 2GTNA 2QR8A 3IONA 4IAYA 4MCVA 2IW8A 2HZ0A 3PIZA 5HEZA 2JDVA 3BZ3A 4O4DA 3RPYA 3VS0A 4E4LA 3PLAE 1YOMA 4NTSA 2R3NA 3ZUUA 4RVMA 2QG5A 1ZARA 4F65A 1OGYA 3GP0A 4QMXA 2VU3A 5DEWA 5EM5A 2ZV9A 4JRNA 3A62A 5E8ZA 4BVUA 2G2IA 3AC1A 4F1TA 4FKOA 3EQPA 4CG8A 4AZEA 1WVYA 2W05A 3TL8A 2VTPA 4IWOA 4CRLA 5CU4A 4C38A 4FT3A 3QF9A 4NIFA 3Q60A 2ZMCA 4UZDA 5D7VA 4FT9A 1XKKA 4S33A 2F7ZE 4GUEA 3R8UA 2GSFA 4WNKA 4XP2A 4LM5A 4EOSA 2HCKA 3PY1A 2IEWA 4A4LA 4FF8A 3NNUA 3OD6X 3PZHA 5JGAA 5BUIA 4YP8A 4FI1A 3LJ2A 1CDKA 4AXAA 3OUKA 4ITHA 3T3VA 1Y8YA 3W10A 1SVGA 2YIQA 3I0OA 3NYOA 4K6ZA 4OLIA 4BZNA 2PVFA 2YAAA 2ITXA 5DN3A 3N9XA 3QFVA 4E93A 4TYHB 3I5NA 4ZZMA 3VWAA 4O0SA 1DI8A 4ORKA 1UWHA 3RP9A 4F9AA 4ZSJA 4XMOA 3R7GA 1BI8A 4XV3A 3EQGA 2P4IA 4G6OA 4WRGA 5C26A 3NVKI 1XMLA 3MY0A 2X1NA 1JNKA 2H96A 3MVMA 1XJDA 2W1DA 4S31A 4FTOA 3Q2JA 3R8LA 2FO0A 3HEGA 3FMLA 1Y6BA 4BB4A 4G1WA 3DK7A 2GNLA 3SHEA 4BCMA 4CZYB 3CPBA 1MRVA 4FKVA 5KBQA 4FJVA 2NRYA 1W2CA 3D5WA 1TZDA 5TE0A 4JAJA 2R3RA 2PVRA 4MQ2A 4B0GA 3LE6A 3MA3A 4I6QA 4FSYA 3T8OA 5LMKA 4F0IA 4XEYA 1UU9A 5CSPA 4ZK5A 4D2RA 4BICA 3Q04A 4EOIA 3WZDA 3MPTA 2CKOA 4JDHA 3KRJA 2A4LA 1OPJA 2XYNA 3PRFA 3OXZA 4R78A 4S30A 5HGIA 3V01A 2F57A 2AEGA 3U6JA 3FE3A 5JEBA 3CQWA 2IVVA 2WMWA 3QQJA 1XH8A 2JC6A 4MNEB 4I93A 2J0JA 2I6LA 4BF2A 3I6WA 3W55A 3E8EA 5E9EA 3C0IA 2J0IA 3BYOA 2QOIA 2JEDA 3R1QA 5B2LA 2QOOA 3FXWA 3VBXA 5CXHA 2YIRA 1T46A 3PVWA 3OS3A 4IDTA 2JBPA 5IUGA 5FBOA 5HOAA 3BWJA 5JFVA 1KV2A 3PWYA 4AZVA 2LGCA 4FEUA 4QQ5A 1PW2A 2OU7A 4FV4A 1SVEA 2ITQA 4J52A 4PQNA 3OW3A 3R9NA 3KXNA 4FV9A 1FPUA 5IQEA 2IWIA 3EB0A 4LOPA 2E9VA 4FGRA 4F9CA 3QUPA 1H0WA 3IW6A 4X3FB 3BGPA 1JBPE 2QLUA 4M12A 4CVAA 3CKWA 2WTKC 4QMYA 2C4GA 3TKIA 2BAQA 4IAAA 2FA2A 3C4CA 4JG6A 4P90A 4IX5A 2C5VA 5KMIA 3CJGA 3RTPA 4NK9A 3R9HA 3LFAA 4YR8A 3W8LA 2XH5A 2VTQA 2JIUA 4K0YA 2WPAA 3VS2A 1NVRA 5AP6A 4KWPA 5L2SA 4RA4A 3OWLA 5K3YA 3QTIA 4M0YA 2O65A 5ETFA 4CNHA 2O3PA 3FMJA 5AP0A 4J71A 3A4OX 3AG9A 4JDIA 4I41A 3LFEA 4WKQA 2C6IA 3LCKA 4XLIA 4IACA 4ENYA 2QOKA 4QYFA 3Q9ZA 4F70A 2C6EA 3ZCLA 4GH2A 4KD1A 3FDNA 3UJGA 4L00A 3A7HA 2BAJA 3JVSA 3RK7A 4JX3A 2R3OA 2IVSA 3DXQA 3E62A 2YM4A 3VIDA 3SVVA 1YHWA 3FKOA 3ORNA 1YWRA 2RF9A 3EQFA 5JN2A 5KMLA 4ARKA 4ZJIA 3MPAA 3LPBA 3LW0A 1ZYDA 4FODA 4CFWA 2EVAA 4KKEA 2HXQA 2W4JA 5HBJA 4EOJA 2BDWA 2DS1A 4YSMA 1IAHA 1FMOE 1YKRA 2Z7SA 3ANQA 4RIOA 4RIYA 4WT6A 5CF6A 3FJQE 2X0QA 3Q96A 1YXUA 4I21A 2ITUA 1XMMA 3AT3A 1U54B 4L42A 3L8XA 4FZAB 4C34A 5EQYA 4QTEA 5LCKA 2YFXA 3W33A 3IDPA 3OF0A 3ZXZA 3EQHA 2XA4A 4FNXA 4IMYA 4AXEA 1Y8GA 4Q5EA 3WF6A 2QODA 3QQGA 4X3FA 4F9WA 1OIQA 3ALOA 5BYYA 2QD9A 5EKNA 2VWIA 3FC2A 4BZOA 1L3RE 4NM0A 4NU1A 5AR7A 4L52A 5HO6A 4BCKA 4DEAA 5ANDA 2X2LA 1X8BA 2OJGA 1IG1A 4DDGA 3VO3A 3ZH8A 2OZOA 3V8SA 5HVJA 2JITA 1QPEA 3U4WA 3NAYA 4DTAA 5CVGA 4QMOA 4L46A 4E3CA 4FTUA 4PF4A 1OBGA 4NZWB 4AT4A 2XK9A 4O0UA 4W4XA 4BCGA 4F6WA 4WRSA 1NVSA 3HGKA 1R0PA 4I4FA 5IQAA 1P2AA 3LVPA 4D1SA 1J91A 2WMSA 3UPXA 3VW6A 3UQFA 4WSYA 3EH9A 4FGBA 3VUKA 2XKFA 3QWJA 3DAKA 4DTKA 4F7JA 2W1GA 5LXMA 3MA6A 5EK7A 3FZPA 4M84A 3ZOSA 4JVGA 5CQWA 3VBWA 2XIYA 4O7SA 5D41A 1RE8A 3QX2A 5AR3A 3SXSA 4FSQA 3F3TA 5CNNA 5E7RA 5M06A 4Y5HA 1V0OA 3UYSA 3UDSA 2YM8A 2J0LA 2V7AA 3G90X 4FT0A 3RAKA 3W0OA 3CY3A 2PZIA 2PPQA 4FKWA 3PP0A 3COIA 4MBJA 1WAKA 3TN8A 3HUBA 3SDJA 3UYTA 1S9JA 3PJ3A 3DFAA 3ZSGA 4V0GA 4CZTA 5L2QA 2UZTA 4J95A 1FQ1B 4TWOA 3RM6A 2YLFA 5J7HA 3TNPC 4A06A 2C3LA 3FXXA 5I9VA 1BL6A 4HOKA 3UGCA 4LFIA 5A4QA 3VULA 4OGRA 4IHPA 2PUUA 2V7OA 5KHWA 2FUMA 4IZ5A 4IVBA 3UVQA 3M1SA 4G9RA 3LM5A 3R7IA 2CJMA 4D28A 3GCUA 4FV2A 3HAVA 2BTSA 3LCDA 4F08A 3KCFA 4FKRA 3TUDA 3OP5A 1K3AA 3HNGA 4C2VA 1A06A 1OPLA 3FSKA 4RPVA 4C8BA 4PNKA 5BUJA 4G3FA 5K0XA 5HO8A 3GU4A 2BIKB 3F3UA 2EU9A 5BPYA 5IEYA 3CBLA 4O96A 4YC3A 3ORKA 3IG7A 5TF9A 4YU2A 5L2TA 3S95A 2J5EA 1R1WA 3C51A 3UIXA 2C30A 1XWSA 3KXMA 3R7VA 3VBTA 2OIBA 4OTIA 2OJIA 4RLKA 2GHMA 3DK6A 3U6IA 2I7QA 3GU7A 4M68A 3G0EA 1VJYA 3IO7A 4IAFA 4IB0A 5FTGA 3CIKA 1EH4A 4G17A 4NKAA 1OL5A 4LRKA 4FC0A 4O0VA 4O0WA 5AP5A 4DEGA 5DR6A 5BYZA 4UXLA 4QPSA 4I1ZA 3QD0A 4C4GA 2WTKB 3HA6A 5CSXA 2ACXA 5IQIA 1CM8A 2QLQA 3HLLA 4C33A 3NWWA 3P5KA 1TFFA 4EOPA 4E4MA 3AMAA 3G33A 4NSTA 4I6LA 5EYKA 2QURA 4BL1A 2CGWA 2Y8OA 5L3AA 5FM3A 5HCZA 5AV0A 5DT4A 2GU8A 3NW7A 4EC8A 5IISA 4CMUA 2ZYBA 5DA3A 2WGJA 3HV4A 3G6GA 1PYXA 2EXEA 3KXHA 3OFMA 5L2IA 4W4YA 1M2QA 2V22A 2GDOA 1LR4A 4N6YA 4BI2A 4C58A 3OY1A 5IA3A 4EONA 2YDKA 4TRLA 2X9FA 1GIIA 3KMUA 2B55A 4APCA 3VHEA 1JKLA 2JIIA 2VTAA 3FLZA 3O8UA 4FZDB 4M67A 1KSWA 2PMNX 1WBSA 2BPMA 1YI3A 1SNXA 2XKEA 3CE3A 4CSVA 4ZY5A 4BJJA 2AC3A 2JAVA 2WAJA 2UZVA 5JMSA 5I9ZA 1FVRA 1YOLA 3LM0A 4NCTA 1H0VA 2RG5A 1JSVA 2C6LA 3UO6A 5IH5A 1DI9A 4MBLA 5L8KA 3C0HA 2F49A 4YZMA 4MX9A 5IQFA 2HXLA 4F4PA 1W2DA 3RPSA 1NY3A 5LVPA 5CT7A 2CHLA 4Y73A 4Z9LA 2C5OA 1OITA 1VYWA 4LDTA 3CGFA 3C50A 3SA0A 2OH0E 4JX7A 2VO0A 2QI8A 2Y0AA 3VS1A 4O7YA 1H4LA 1OIUA 2OWBA 2W17A 5DFPA 5DH3A 2W1CA 5ANOA 4Y83A 3QQFA 1XH5A 4FNZA 4MAOA 1OB3A 4XG4A 4DHIB 3RPRA 4IBMA 4X6RA 4CXAA 3PA5A 4DINA 4PMTA 4BIEA 1Q8UA 4RJ8A 3OCGA 4ZP5A 3AGMA 3ERKA 3BE9A 3A99A 5HESA 1W7HA 4FR4A 3FAAA 5D11A 4IX4A 2X7OA 4YJPA 4E5AX 1BLXA 3F5PA 4FSTA 5AUTA 2QC6A 5AUUA 1VR2A 5J9ZA 4U43A 4MHAA 4AGDA 5D10A 1KE6A 4AQCA 4G31A 5J5TA 1H25A 3UPZA