2NRYA

Crystal structure of irak-4
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
286
Chain Sequence
RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASTVMSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords interleukin-1 receptor-associated kinase 4
publication title Crystal structures of IRAK-4 kinase in complex with inhibitors: a serine/threonine kinase with tyrosine as a gatekeeper.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 286
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2nryA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2nryA01
4DG2E 2WXVA 1KOAA 1XWSA 3P1AA 3QQHA 3IW8A 4ZSLA 4D4SA 4FV5A 4YJUA 3COHA 1YI3A 2PWLA 4ZSJA 1H1QA 4ZMFA 2ITVA 3M11A 1JKKA 1OL1A 3EJ1A 5DRDA 5BPYA 3VHEA 1UVRA 3HAVA 1OL7A 3DKCA 1Q8YA 4RIWB 2ZMCA 3I0OA 4UXQA 5HLPA 4R1VA 4G17A 3QKMA 1YWVA 4YLKA 3O8UA 2B4SB 3FE3A 4W8EA 3TNQB 3E88A 3GU5A 3K3JA 3OD6X 4WSYA 2UW9A 5IA1A 1YI6A 2O2UA 2Z7RA 3FI8A 4ACMA 3LFNA 3CS9A 4YTHA 5KBQA 3GOKA 3SOCA 5J5TA 1ZOEA 5DR6A 3UIBA 5F9EA 4CMTA 5AV1A 4BCFA 4L43A 3PG3A 3R0TA 2BIYA 2JC6A 4HVIA 1ZAOA 2GNJA 2HW7A 2XVDA 3DNEA 4MHAA 4RT7A 4EH7A 2GNFA 2QI8A 3F3VA 4HNFA 5IH6A 2WTVA 3HDNA 3QUPA 4DYMA 3DKGA 5L2SA 2HZIA 2V0DA 4TXCA 4ZOGA 3VW6A 3P78A 3IQ7A 3QRTA 4U45A 3RM7A 4EUUA 4DEDA 4QTDA 4CMUA 5CZHA 5EM6A 3PP1A 4E6DA 3I7CA 5DE2A 2G1TA 1OKYA 4FKIA 5KBRA 5DI1A 1ZWSA 2VTSA 4A9YA 5F95A 2ERZE 4CT2A 4EJ7A 3PTGA 4R7IA 2YDKA 4BKYA 4X0MA 3EL7A 3IS5A 3ANQA 3VVHA 4QNYA 1REJA 2O0UA 4UEUA 2HWOA 2YM8A 4ZJIA 3VNTA 1XR1A 2OSCA 2J4ZA 5FM3A 3RPRA 1JSTA 3IG7A 4RJ5A 4L9IA 4FNZA 2AUHA 3EQBA 5AP5A 3W2OA 3W16A 4XJ0A 5L2TA 1V1KA 5IEXA 2C6DA 1SNUA 2PE0A 2GHLA 2RSVA 3ITZA 3QKLA 4RQVA 5LMAA 4QYHA 5A46A 4BDCA 4L00A 4BDHA 4DFXE 3QQKA 4TN6A 4NIFB 3UBDA 4N6YA 3ZUVA 5JH6A 4J71A 3MY5A 2YAAA 5LWNA 3QL8A 3BBTB 4U79A 3R28A 3A8XA 1U5QA 1H25A 4JG7A 3HP5A 4JG6A 3QLFA 2Q83A 4PTEA 3RCJA 4BCQA 3GCSA 4O6LA 5K0XA 1YOLA 2QHNA 3HP2A 3HV4A 3QD0A 4Q5EA 3PZEA 5IA3A 2ZM3A 3EQHA 4AT5A 3MW1A 1PMVA 2B1PA 4QMWA 3V04A 3L1SA 2VTTA 1Q3WA 4QMTA 5HVKA 1ZZLA 4AW0A 1VR2A 3HEGA 4FYNA 2QKWB 4TW9A 4XHKB 3R6XA 1R0EA 3OP5A 1URCA 3RNYA 1MRYA 3DFAA 3GI3A 3WF7A 1JSVA 3ZLXA 2PMNX 3F5GA 1ZYDA 3I7BA 2W1IA 3G33A 2ZVAA 4G3FA 4I3ZA 5ACKA 3THBA 3RWPA 2W99B 4YP8A 2J2IB 3ZBFA 1H24A 5JQ5A 3OXTA 4EYJA 2ZDUA 5A4QA 1XH5A 2OJFE 1ZLTA 3QTQA 3UNJA 4G3CA 3DNDA 3QAME 2OJ9A 3RK7A 4I6FA 2QOCA 5AUUA 4CVAA 3GC0A 3KVWA 1KE6A 2PL0A 2C1BA 3R02A 3Q4CA 4NH1A 1CKJA 4BWPA 1UU7A 3ZHPC 2EWAA 2OG8A 4IANA 3Q6UA 3LJ0A 3RMFA 1H1PA 2ONLC 5FRIA 4QP8A 4ZTRA 5I9XA 4W4YA 2E9OA 3FXWA 2R7IA 3CP9A 4GIHA 4CCBA 2BROA 3LFBA 5HICA 5K0KA 2VTOA 3MVHA 2ZJWA 5IQDA 4S30A 5FP5A 3EQPA 2R3HA 2IW6A 4G9RA 3REPA 2QOQA 4ID7A 4FR4A 4EOLA 5CSVA 2C5XA 4ZTHA 4FNYA 3ACKA 3GC8A 4FTMA 3BLRA 3Q4UA 1REKA 4JR7A 4KIKA 4TWCA 4I5HA 1GZKA 4FIHA 2UVZA 2WAJA 3O2MA 3OCSA 4PMTA 1Z57A 3TZ8A 1Y91A 2HZ4A 2PZ5A 4IQ6A 4BCMA 3U87A 4CQGA 4QTEA 4LRJA 2WMWA 5M51A 5GIOE 4FSUA 4BL1A 4M67A 5AWMA 4C34A 2IW9A 2W06A 3BLHA 2Y9QA 4IC8A 4G5PA 4IB0A 3LJ2A 3GT8A 5ANDA 4DGOA 4FIGA 5H2UA 4G16A 3SG8A 3OEZA 5LWMA 3FLZA 5AA9A 3MN3A 2H9VA 1JAMA 2WD1A 4ZK5A 3BZ3A 3JPVA 3LFSA 2WIHA 3SGCA 3I81A 4KKHA 3CTJA 3WE4A 2J50A 3WZEA 3FLYA 4WBBB 2W05A 2BPMA 4IACA 2F7EE 2CLXA 3IOPA 3LPBA 2JFMA 4JRVA 4O0TA 4Y5QA 4PWNA 3V6SA 3OG7A 3MFRA 3E63A 2R5TA 4L45A 4BDJA 5AAEA 3DK6A 3D5UA 3KRLA 4B4LA 3HDMA 3TDVA 3LFEA 4QT1A 5H9BA 3UPZA 4KWPA 2PY3A 1OMWA 5I3RA 4GKHA 1OGUA 3V8TA 5EH0A 3P08A 4GT3A 4RC4A 2PUPA 2J9MA 5EM7A 3GXLA 1HCLA 5HG7A 5LXMA 3LM0A 3MFUA 4U5JA 1BL6A 1NVQA 2X6EA 4FMQA 2BIKB 1UU8A 3NW6A 3PE2A 3CQEA 2Z7LA 4KIKB 3KU2A 3NUPA 2GDOA 1GNGA 5A14A 5DT3A 3R01A 4MF0A 1M52A 3E7OA 4ZS0A 5K5XA 4F70A 4EUTA 2WFYA 3R2YA 3F2NA 1SZMA 5FUTA 3BHYA 3O8TA 3ZO4A 2OIDA 1OL2A 3V5PA 4M68A 2C68A 2ITOA 2ZV7A 2OICA 4F99A 4FL1A 2C3IB 4KKGA 5K5NA 5CY3A 5HO6A 2YCRA 5JRSA 1UKHA 4WNKA 2ZM4A 5AA8A 3UVRA 4UY9A 4O0UA 1LR4A 4BCNA 5DT0A 3CQWA 5H3QA 2VV9A 2F2UA 3OC1A 3SAYA 5DVRA 2QNJA 5EQYA 2JKQA 3QKKA 2VTNA 2BFYA 1ZOHA 2BRGA 1OKWA 2OBJA 3PY0A 3ORLA 4LQMA 3VS1A 3RK5A 3POZA 3F9NA 2ZV8A 4O2PA 4AT4A 4N70A 4PF4A 4LG4A 4A4LA 1J1BA 1M17A 4RIOA 4DFZE 3NVKI 2DYLA 5EW8A 1ZZ2A 3D4QA 2YJRA 3BE9A 1IR3A 4QQ5A 5LMKA 3W2CA 4DEBA 3FLQA 2J0IA 2GS2A 1OKZA 1Q8UA 1YRPA 4AS0A 4NFMA 3QALE 2XIKA 1OBDA 2C3LA 2F57A 4GV1A 3W32A 3O7LB 4U97A 4BYIA 4Z7GA 3FI2A 4OBOA 1PJKA 4L8MA 2BZHB 3FZSA 5M08A 3DK3A 5HVJA 5IZFA 4XLVA 3BQCA 4I94A 3WF6A 5CALA 2BRMA 4D58A 2XEZA 4HYSA 3F3ZA 2WNTA 4X21A 3LVPA 3UVPA 4YBJA 2HELA 4IEBA 3BHVA 5DR9A 1YOJA 3VBWA 2F7XE 1AQ1A 4WA9A 4ACDA 3TNWA 4FTLA 3F61A 3OXZA 4EZ7A 5HTIA 1YWNA 2OO8X 4KBCA 3WF8A 3MVLA 3UNKA 4YNEA 2E9UA 5C8MA 2H34A 4FSQA 1YXXA 4NM5A 4ANMA 4PNKA 3QCXA 4HGLA 4CZYB 3UTOA 4F9WA 4S33A 1GZNA 5KZ0A 4YNOA 3BWFA 5I4NA 3QCYA 3DXQA 2OIBA 5KMJA 2QO7A 2RFEA 4W9WA 4CRSA 3U6HA 3KRXA 1BYGA 2C69A 2Q0BA 4RFZA 2I0HA 2JDRA 4GU9A 1FMKA 4KKEA 2QOHA 3DBEA 4YGAA 4ZXTA 3TZ9A 3FMMA 3VULA 5KMIA 3RTPA 1Q97A 4KIQA 5HE0A 3FLSA 4O7SA 2X7GA 1B39A 4LL0A 3VAPA 1OM1A 4FUXA 2WOTA 3P9JA 3R9HA 2C0IA 3UNZA 1B6CB 4J1RA 5IH5A 3DAJA 4KS7A 2VTQA 4Y72A 3K5VA 1YXTA 1G3NA 3VF9A 4CLIA 5BVOA 4CTBA 3QLGA 4L53A 5CU6A 4DHFA 4G1WA 3W55A 3FV8A 5AAGA 3Q2MA 4IVDA 4YJQA 3Q53A 4QP6A 4NKAA 4BC6A 4QMYA 4EK3A 1PKDA 2WHBA 1BI7A 2VD5A 2JDSA 4FSWA 4WIHA 5B7VA 4IAKA 5HTCA 2CSNA 5F20A 4E93A 1QPDA 2GNGA 2QU6A 3LQ3A 3FZRA 2ETMA 4U41A 2PVYA 2X8EA 4GK4A 3RI1A 2BAQA 4KBKA 4PMSA 3R7EA 3RCDA 4FKQA 4DEGA 4D1XA 3PWDA 5HG5A 2JKOA 5CASA 4ZLZA 1WMKA 5LVOA 4IWQA 4IM3A 4O81A 2YIWA 4AOTA 3KXNA 3PY3A 2XRUA 2QODA 4GKIA 5FQDC 4NCTA 4JX3A 5A3XA 2X4ZA 3GNIB 2X2KA 2KTYA 2V7OA 4Z55A 5KMLA 3C4ZA 3HZTA 2YACA 4FBXA 5KKRB 4X2KA 3Q3BA 3UJGA 4M12A 2IG7A 3F5UA 1LP4A 4IAFA 2BDWA 1PW2A 2R2PA 4PY1A 2W96B 5D7VA 4IH8A 4A9TA 5JK3A 3A7IA 3H9OA 3MB6A 2UW5A 3MJ2A 4IX5A 1IAJA 1SMHA 4FTAA 3BRBA 4II5A 2CCHA 3G5DA 3KXGA 3COIA 5L2WA 2UUEA 1XKKA 2XNEA 4GH2A 4LM5A 4USFA 4EHGA 2ESMA 3TKIA 4NWMA 4AZFA 4F1MA 2V22A 4AAAA 4GS6A 4LOOA 3WIKA 3PRIA 3U6JA 5EYDA 2VWXA 5I9UA 5KCVA 3EFKA 3QXPA 2YWVA 1Q24A 3NNVA 5KZIA 3E8DA 3GU4A 4LRMA 1JWHA 1R0PA 5C03A 3FKNA 3WIGA 2CNUA 3TT0A 4J96A 3Q60A 4MF1A 4E3CA 4EOKA 4EZ3A 1Q8WA 2REIA 1TKIA 4IAAA 4MWHA 3ZS5A 4DH3A 3BYMA 5HNIX 4NYEA 4E4MA 5AIRA 3E93A 1OKVA 2B9JA 3O23A 2HENA 3UZRA 2OXYA 5AP6A 5AV0A 2XKCA 3R21A 2ITYA 4AZTA 3E5AA 4MNEB 2J51A 4C8BA 2VTLA 3H10A 1CTPE 3DAEA 3BLQA 4EH4A 2H6DA 3LOKA 4U3ZA 4K33A 4ZAUA 3POOA 2CNQA 2OZOA 3WZKA 1RW8A 2BVAA 3FY2A 2YHVA 4FV8A 2R3KA 3PXYA 5IMEA 5JGAA 4PPAA 4Q9SA 4HZRA 4M69B 4R3RA 4ITHA 5HCYA 4R1YA 4WSQA 4AP7A 4U44A 3U8WA 3FKOA 3ZEWA 4DT9A 2A2AA 2IWIA 2ZOQA 4H1MA 4L3LA 3LXLA 3L8SA 4UX9A 5IG1A 2O5KA 5J9ZA 4YC8A 2VX0A 4F0IA 4MD7E 2XKDA 4MBLA 3NYXA 2W5BA 3QF9A 4DITA 4C38A 2BR1A 4MXAA 4AX8A 3IW6A 4FV6A 4DG0E 2FSMX 5CNNA 3PWYA 2H8HA 3RALA 2P3GX 4BHNA 2WTIA 5HEZA 4H1JA 4AGDA 4BCPA 2W1DA 4FGBA 3CPCA 4J8MA 4V01A 4RWKA 3BU3A 1FOTA 5AP2A 3TN8A 5E8XA 3OFMA 5TE0A 3O8PA 3NDMA 1H4LA 5AX9A 4ITJA 4JQ7A 5CZIA 1SM2A 2PUUA 5IQCA 5F4NA 2RFDA 3TI1A 2B0QA 1Y8YA 3SW7A 5J95A 2YERA 4BBFA 4TKSA 1M7NA 3DDPA 3R8MA 1MQBA 4OTIA 5JFXA 3PIXA 3N4TA 2X9EA 4K18A 4JQ8A 3QGWA 3F2AA 4P5ZA 1ZY4A 3LQ5A 4O7LA 2QO9A 5EM5A 5J79A 2B9FA 4FL2A 2X2LA 2XJ1A 4CLJA 5A4EA 4X2GA 3MTLA 4KA3A 4D0XA 4IIRA 1U59A 4RJ6A 5AV2A 3G51A 4IAYA 2CCIA 2XS0A 4I5PA 4K6ZA 4QMMA 2FSLX 3O50A 1P2AA 3PA3A 3BHTA 4O6EA 5B0XA 4MD9E 3TUDA 3JR1A 4M97A 1E1XA 4I6HA 3OCBA 1Y6BA 2O63A 4RZWA 4F4PA 1VYZA 3ZZWA 2R3LA 4EH6A 2HCKA 4IAIA 1TVOA 2GPHA 1H28A 2WTCA 4W4XA 2FO0A 5ANOA 2W1CA 4FVQA 5AMNA 4ASEA 3ALNA 3VW8A 4HNIA 3UYTA 5JFSA 4BB4A 5FXQA 3JUHA 4IFGA 4YLLA 1UWJA 4O7ZA 3FYKX 4QYGA 1Q8TA 3FL4A 3LFCA 4S32A 5HESA 5D10A 3MA3A 2RG5A 2UW3A 3I6UA 3C51A 5HIEA 3I0QA 4PQNA 3ZCLA 4JIKA 4I20A 2OIQA 3R7YA 4FV7A 2O3PA 2J6MA 2WELA 3F3WA 3H9FA 3IK3A 3QZIA 3IDCA 4F7NA 2XMYA 3NNWA 5JMSA 3NW7A 5EYKA 5DYJA 3QHWA 3UP7A 2B54A 4FKTA 4IWDA 1EH4A 3AT4A 3DZOA 3OZ6A 4NTTA 4O2ZA 4O0SA 3AXWA 4BGGA 4ENXA 1J1CA 2R3MA 3G6GA 4QP2A 4RX7A 5HIBA 3OT3A 2FVDA 5CSWA 2GNHA 4OTPA 1U4DA 2QG5A 3FC1X 4RRVA 1APME 4BDFA 3ATSA 3UC3A 4DCAA 3JVRA 4ZIMA 2PTKA 3ZBXA 4BTFA 3UQFA 2VWIA 3NAXA 3CY2A 4RIYA 4FG8A 3JY9A 2YM4A 3F82A 3D83A 2YCSA 4AUAA 1SVEA 2WZJA 4JBQA 2NO3A 4FEQA 3WF9A 4D2VA 2WQEA 3Q5ZA 4KINA 2CKOA 1L3RE 3TJDA 5B2KA 3OCTA 3KK8A 3RZFA 3ZC6A 4DEIA 4JBVA 1G8SA 1PXKA 3Q52A 5EW9A 2VWYA 4RQKA 4WOVA 5DEYA 3VRYA 4BZNA 4F64A 3QTXA 3C4WA 1PXJA 4FV4A 4D2WA 4YPSA 4U81A 4ANOA 3QTSA 5KO1A 2X4FA 3DBFA 4M8TA 3OS3A 4G9CA 3KRWA 2R9SA 4KD1A 3O7LD 4UMQA 5CANA 3ZFYA 2VWWA 2VWZA 3R8LA 4BDDA 3AT2A 2XNGA 2Y4PA 5D12A 1JLUE 4ZS4A 2PVNA 2Y4IC 3KCFA 3GC9A 4EJNA 2OWBA 4LMUA 4MXCA 5L8KA 4M14A 3UIXA 3LLAA 4YTIA 2UW8A 1OIYA 1W84A 5CTPA 3HMNA 1BUHA 3FWQA 3PPZA 3TEIA 5A9UA 4EHEA 5FTGA 4QP9A 2V7AA 5GZ8A 2X39A 3VUMA 2C5VA 2GS7A 4C58A 4R7BA 3R63A 4A06A 3F69A 2ACXA 2BDFA 3C0IA 3ENHA 2PZPA 2XIZA 4GMYA 3UIUA 3EFLA 4RIYB 2IVSA 4RVMA 4FG7A 4L68A 3PPKA 5DT4A 2X6DA 5CAPA 4I4FA 5JEBA 1W7HA 3OWKA 3PJ3A 5E92A 3KGAA 4QP7A 4QP3A 1WBTA 4I0SA 3SXFA 5ITAA 4WG5A 3DBQA 5AUXA 3T3UA 3D7TA 4ZJVA 2CPKE 2HY81 2QURA 3AC4A 5M07A 4TT7A 4AQCA 5HKMA 3MJ1A 3EKKA 4C2WA 4G3DA 5LVMA 2OH4A 4QQCA 2GU8A 2PK9A 4K9YA 4YLJA 4NSTA 5FEEA 3AD6A 2C6OA 2VZ6A 1YHSA 2ZYBA 5T68A 1LEZA 3SRVB 4A4OA 2WTKB 3WILA 5C27A 3TNPC 4E5BA 1U46A 4FKUA 4I6QA 4NKSA 4X2NA 4A4XA 1P14A 5BVNA 2CGWA 2YM5A 5IUGA 4NL0A 3AGLA 1ATPE 2IZTA 2R64A 2UZEA 3EN7A 4ZZMA 4C37A 4DTBA 3FI3A 3QCSA 4FKVA 2XNNA 4O1OA 1PXNA 2XYUA 2ONLA 4KBAA 2WTDA 4QTAA 2QCSA 4CFFA 3FYJX 2E9NA 3VS5A 4PDSA 4O7WA 1F3MC 3QTWA 2F4JA 1PMNA 3ZSIA 5LQFA 3ZXTA 3ZRKA 4DFUA 4S31A 5DN3A 3KKVA 3KCKA 3ZZEA 1O6LA 5D9HA 2XJ2A 2FB8A 3D9VA 3W10A 4O96A 5B2MA 4CFXA 4RVTA 4YC6A 1GJOA 1H8FA 3SXSA 3L8VA 1WVYA 5IEYA 2UZUE 2X9FA 3GQLA 3NUUA 4L6QA 3D7TB 4RMZA 3FAAA 3DT1A 3SG9A 3GCUA 4RJ3A 3NRMA 3Q9ZA 4C62A 4OAVB 4O7NA 4XUFA 3NUAA 5ETAA 1AD5A 3CCNA 3HUBA 2QOIA 4WG4A 3VN9A 3BPRA 3A4OX 3RAKA 1M2RA 4ANBA 2YIRA 3D15A 4DE4A 3NUSA 3VUTA 4D9TA 4WD5A 2PULA 3QYWA 2PUIA 1XQZA 3MSSA 3G6HA 3QRKA 4FTKA 5HBEA 3T3VA 4XP3A 3TV7A 4LUEA 3TKHA 4CEGA 3EH9A 5FTOA 3OOGA 1JKSA 4TYHA 2PUNA 3D2KA 2VWUA 4FIJA 4K2RA 4R7HA 5KMNA 5HHWA 2OF2A 3M2WA 4ANLA 5M53A 5AM6A 5IEVA 4FT3A 2YDIA 4FZ7A 4AZVA 3E8EA 4UBAA 1ZY5A 3W2QA 3FXXA 4F0GA 3ORKA 2VO6A 5ANJA 5AUZA 4FTNA 5LARA 2PVHA 1QPEA 5EFQA 1B38A 3OUKA 3ULIA 2XKFA 4A9RA 4MQ1A 4AW5A 2WMVA 4OUCA 3D2IA 4FG9A 3FUPA 3KULA 4BI0A 1NA7A 3CQUA 5LCJA 3NUXA 5KMMA 3MY0A 3E62A 4FIIA 5M44A 3M1SA 2Y7JA 3DQXA 5BQ0A 3TUCA 3TCPA 2WEIA 3TNIA 4HVHA 4YURA 5E8UA 4LFIA 5C4LA 4IDVA 5CAQA 3R7GA 3SD0A 5C4KA 1LEWA 4TNDA 3B8RA 3KB7A 5E9EA 3ZXZA 2QKRA 2WU7A 3KL8A 3IDPA 4XG2A 4CTCA 3EQIA 3I60A 5AR3A 3RZBA 1STCE 4BDIA 2WQNA 3A61A 3WYYA 3QD2B 5JZJA 2XCKA 4O0WA 4AZEA 3GUBA 2DS1A 3LM5A 3MV5A 5AR2A 3UGCA 3DJ5A 5AP7A 3H4JA 4GVJA 4S2ZA 4UYAA 2EXMA 4P5QA 3MA6A 2IN6A 4UV0A 4HGEA 3ATTA 5CQUA 5GJDA 2RL5A 4TYHB 3QRUA 3OVVA 5CF8A 3B8QA 4C3FA 3RPVA 4ORKA 5GZ9A 1OZ1A 3L9PA 4KSPA 5K4IA 4FKOA 1W83A 4EQUA 2GMXA 4FKRA 4UYNA 3KREA 4XP0A 4E1ZA 2WKMA 3AC5A 4PRJA 3ACJA 3COKA 4NZWB 2PVFA 4KIOA 3C13A 1J3HA 2C4GA 4AWIA 2ITZA 5A6NA 2CKEA 4UWCA 4E6QA 4CKJA 2V5QA 3R9DA 2C6KA 2YLEA 4JJRA 5D41A 2W1ZA 3H30A 5GJFA 4DFLA 4RX9A 5IPJA 1OECA 3BYOA 3D14A 4FTUA 1MUOA 4F9AA 3I5NA 3Q9YA 2BUJA 2I6LA 4J52A 1GIHA 5DLSA 4FZDB 4HVDA 3IW7A 2OGVA 3BEAA 3UP2A 4F1TA 5M4FA 3VBTA 2F2CB 5E4HA 3KEXA 2E9PA 3ZYAA 5EI6A 4ZMEA 3RWQA 4RZVA 4HZSA 2C6EA 4UALA 4BZOA 4M84A 2GHGA 4MD8E 2OW3A 4QTCA 4C4IA 3VIDA 5BNJA 2UZTA 4FSZA 4J53A 1KWPA 2QVSE 4QO9A 5A4CA 2ITWA 4BCHA 2OF4A 1FBNA 3ORIA 2Z60A 2ZAZA 3ROYA 1UNLA 4F6WA 2ITNA 4K8AA 4AW1A 5BVFA 2JD5A 3AOXA 3V5TA 5CU2A 4FKPA 2QOFA 5GHVA 2BZJA 4DFBA 1KE8A 1H08A 3VS3A 1JOWB 3H0ZA 3VBQA 2WEVA 3R2BA 4XEYA 5AV4A 3MFTA 3KXHA 4MYGA 2YZLA 2JBPA 3Q9XA 2HK5A 4CXAA 5HLWA 4CFUA 1Q99A 4IFCA 4DC2A 5EDPA 4GG5A 3MPMA 3PP0A 4HYIA 4YJSA 4NJDA 1K9AA 4RC3A 4FV9A 3F6XA 4IWPA 5JFVA 5ANEA 2UZOA 3NCZA 3NYNA 2XIXA 3DU8A 3OF0A 3OHTA 4WUAA 3TV4A 4ZTSA 4CD0A 3OBGA 2LAVA 3TZ7A 2XH5A 1ERKA 4LUDA 4D28A 1U5RA 4MXZA 2XF0A 4JOAA 4YU2A 2IVTA 5HI2A 2A0CX 3MGYA 4LL5A 4AGWA 4MK0A 4ZP5A 2QR8A 5BMSA 3FQHA 4IMYA 5DEWA 4B9DA 5J7BA 3S00A 1FGKA 3NNUA 4GYGA 3VBXA 5AP0A 5KE0A 5M56A 2JKMA 2UVXA 3BEGA 2PVMA 4AZWA 4UN0C 3UOKA 5EQPA 5E8YA 3Q32A 4EONA 2G2IA 3LJ1A 4EWHA 5AR5A 2VGPA 3QRJA 4IC7A 3AD5A 3F88A 4ACHA 4BCKA 4FTJA 5KHXA 1WBSA 3NMUF 2B9HA 1QMZA 3E64A 4XG7A 5HNGA 3DK7A 4EBWA 4NM0A 3CTHA 4GFOA 4E73A 1NXKA 2XEYA 5CLPA 4Y95A 4DT8A 1YWRA 2IJMA 2J7TA 3WE8A 5A4LA 2XUUA 4WKQA 5AUWA 3DJ6A 4GEOA 2EXCX 4OT5A 4F7SA 5KHWA 5HG9A 3E3PA 1O6YA 2JIIA 3NNXA 3D5VA 5CU4A 5I9VA 4TNBA 4ENYA 4FSYA 4CYJA 3FMEA 4W8DA 3V3VA 2UZBA 2IVUA 5HD4A 3GGFA 2R3OA 4LV5A 4BTKA 2BCJA 1ZXEA 3PXQA 4AW2A 4HCUA 1WBOA 4LYNA 1H07A 1Q4LA 2B52A 1P5EA 1GOLA 2WO6A 3ORNA 2W17A 3QTRA 1YHVA 4HPUE 3EQRA 4C2VA 5JGDA 4YTFA 1A48A 1H1SA 2BRBA 2W4KA 5AP4A 4JG8A 4AOIA 5EM8A 3TKUA 2PE1A 4RVKA 3VS4A 4AE9A 3LFFA 5CS6A 5EHLA 4FV1A 4CQEA 3UIMA 4LV8A 3QYZA 1FVVA 3FZPA 4YTCA 4RC2A 2XK8A 4FGRA 1NVSA 3QD4A 1XBCA 2NRYA 2R7BA 4ASZA 4C33A 3AMYA 4JL9A 2IVVA 3UG2A 5KUPA 5E1SA 2XNPA 3AD4A 3IKAA 2J90A 4FKGA 4BCJA 3LZBA 2OLCA 5AR7A 3SC1A 3LCSA 5JGBA 1KE7A 2X81A 3EHAA 3EQGA 2XA4A 4C59A 4I5MA 2W1EA 4DCEA 4U43A 1WBPA 3H3CA 3O71A 4FA2A 2YM6A 1QL6A 2FA2A 5BYLA 3D0EA 4GFGA 5C8KA 3ZUUA 1W98A 4LOPA 4IJ9A 4ANSA 4H39A 1V0OA 4G3EA 4PTGA 4D2TA 1R78A 4QQTA 4ZY5A 3E7VA 5AAFA 2AC3A 4BN1A 1YI4A 3LLTA 4OT6A 2Z8CA 3PPJA 5A54A 4O1PA 4GL9A 3G90X 3Q04A 1CKIA 1Q5KA 4IWOA 1FQ1B 4FEWA 4HGSA 5FGKA 4C4EA 4F6SA 5C26A 1PXPA 4O21A 1ZMVA 1V0PA 5TT7A 4BVUA 3C50A 2VO3A 4MEDA 3R8ZA 4C3RA 4XH6A 4APCA 5HX6A 2GQRA 3R04A 2VTMA 2I0VA 2EU9A 2UW7A 3NW5A 2HWPA 3IGOA 3PA5A 4G31A 2W1FA 3G9NA 3MI9A 4AG8A 3DAKA 5TOZA 5J7HA 5M57A 2X7OA 4BHZA 3NX8A 3TZMA 2W9FB 1BMKA 4CKIA 5KX8A 3QC9A 5CAOA 1ND4A 2VUWA 3ZSGA 3W2SA 3ALOA 4D1SA 4DA5A 5IQIA 2W4JA 3VBYA 3A2CA 3DS6A 3P0MA 5BUJA 4C4FA 2YA9A 3P7CA 1ZYJA 4KB8A 4AN9A 4TRLA 1FINA 2X7FA 3KN6A 3ZH8A 1F0QA 3MWUA 3UC4A 3CC6A 3CGFA 3VO3A 3A60A 2CJMA 5T6KA 2PSQA 4HVGA 4QMLA 3G0EA 4XG9A 4YMJA 3ODYX 5HGIA 3OEFX 3PXFA 3T8OA 3ZU7A 4I6BA 4FYOA 1MP8A 4ZLYA 3N4UA 4IX3A 4DN5A 4HVSA 4I1ZA 3ZLWA 2YLFA 2XIYA 3R22A 4MAOA 4B8LA 3KF7A 3SV0A 4L44A 4E26A 5M4UA 4XX9A 3QQUA 4JXFA 4XMOA 5ACBC 1Q61A 3QD3A 4BDBA 3C4EA 1W0XC 4OTDA 3NIZA 1AGWA 4XG8A 3JXWA 5I3OA 4XLIA 2W1HA 3GBZA 3FHRA 4D2PA 4GT5A 4P90A 3F2RA 2YITA 2Y6OA 2ZMDA 2WMUA 4V0GA 3BQRA 4XS2A 3SLSA 3D5XA 4F65A 2WB8A 2YZAA 3DB6A 4BF2A 4F63A 4O7RA 3R9RA 5GINE 3KMWA 4HCTA 5BUIA 5L2QA 4JAIA 4AN2A 3VUIA 5EKNA 3OBJA 4YZBA 4B6LA 5HG8A 5J9YA 4JI9A 4LOQA 4X3JA 4BGQA 3C0HA 4E4NA 4F9YA 4IZ7A 2EUFB 4RLKA 2YDJA 2HZ0A 5HNBA 4C4GA 4QMSA 5FXSA 4FEUA 1JSUA 1IASA 3LCKA 3V5JA 2Y0AA 3DPKA 3U54A 3BU6A 3F5PA 3M42A 4FIEA 3ZO3A 3C7QA 5AV3A 4IVCA 5HU3A 3NAYA 5BVKA 4BDGA 4MXXA 2UW0A 3PUPA 4EOIA 4OTQA 1I44A 4KNBA 1U54A 4D55A 4O38A 4XNEA 5FBOA 1BX6A 4RG0A 2C0TA 2ITXA 3EN6A 3PVGA 4EK5A 4I22A 4OTFA 2R4BA 2KULA 1MQ4A 4YO4A 3FMJA 4F0FA 4CG9A 4XG4A 2IZUA 5E8ZA 3GCVA 3HECA 3C4XA 4Q5HA 3NSZA 2P33A 2FGIA 3RPYA 3PSBA 3RJCA 4RX5A 5CEMA 3VJNA 3ORMA 2PVRA 1OI9A 2VNWA 3AC2A 4BIDA 3DXNA 4C35A 4BIEA 1YVJA 1Z5MA 4G2FA 4J8NA 3ZUTA 2O64A 4BIBA 4D4VA 5AUVA 5HO7A 4BKZA 4V0GB 3UODA 1T46A 5FDPA 4OAUC 2A1AB 3MH1A 4P2KA 4QYFA 3UG1A 3CD3A 2C6TA 3R00A 2YN8A 3FI4A 5EYCA 2XNMA 1YKRA 3HRFA 5BVEA 3C9WA 2RGPA 3KVXA 1JPAA 2P2HA 3LE6A 3LMIA 4R78A 3BU5A 1W82A 4IM0A 2GCDA 5M4CA 3UQCA 4U42A 3CR0A 4KABA 1XH8A 3K3IA 5G1XA 3G15A 3B2TA 5DH3A 3AC3A 2OFUA 1DM2A 2YM7A 3EZVA 3IGGA 2ETRA 3I1AA 3P4KA 2WMXA 2A27A 3HA6A 3PIZA 3R8VA 4AE6A 3QU0A 4FKWA 4L46A 4J95A 1HCKA 4BICA 3P7AA 4MQ2A 2AYPA 4R3PA 2CN8A 2C3KA 1U54B 5DWRA 3SA0A 4RX8A 3PRFA 5ANGA 2QR7A 3RP9A 3UZPA 1H0WA 5DPVA 2ERKA 1YDSE 2G15A 2QOBA 3KFAA 2W1GA 3R71A 4IE9A 3KK9A 3DBDA 3KMUA 3KA0A 4MNFA 4IJPA 5BMMA 4Z16A 4CG8A 2BILB 2BKZA 1GY3A 4N6ZA 5H8BA 3G0FA 4FSTA 4AZSA 5LJJA 3OUNB 5KKRC 5CAUA 1RJBA 2BKKA 2WMAA 4L7FA 2XM8A 2JBOA 4EOMA 4NM3A 4YZNA 4DLIA 3O17A 4FZ6A 4GCJA 4GVAA 3QXOA 4OBPA 4XYFA 3EQCA 2R3QA 3FPQA 2BMCA 4GUBA 4I41A 3VF8A 4FL3A 4IW0A 5F1ZA 3G2FA 4DH8A 2C1AA 5T3QA 4F9BA 4FT5A 3RM6A 3ZMMA 4BKJA 4E5AX 3V5QA 1OPLA 5BVWA 1GAGA 1PYEA 2Y4IB 3MYGA 3QA0A 4JQEA 3SOAA 4FX3A 4ACGA 3L8XA 4M0ZA 4E5WA 5CNOA 4I24A 5HBHA 3L8PA 1RQQA 1DI9A 4DH1A 3FZTA 3FC2A 4AA0A 3BV3A 3GU6A 3ULZA 5IQHA 4JT3A 2IPXA 1LUFA 4AT3A 5FG8A 3AG9A 3EZRA 3E8NA 4FK6A 2JIUA 5E8WA 3DQWA 3NEWA 5FEDA 5EW3A 4OTWA 3R9NA 3VUHA 4E6CA 4FNWA 3MB7A 3E92A 2WMTA 3L9NA 3HX4A 4L67A 4RVLA 1IA9A 3FPMA 1OBGA 3FMDA 5CEIA 2IZRA 5ANKA 1WBNA 4DEHA 3KXXA 4B7TA 2QD9A 3TTIA 3FMLA 4AFEA 4DEEA 2WQOA 5IQAA 4BI1A 4X2JA 4UWBA 2Z7QA 2XYNA 3OT8A 2WQBA 4AU8A 3C4FA 2YCFA 3Q4TA 3P5KA 2PMOX 4J97A 4GK3A 3DCVA 3QBNA 3F7WA 5J8IA 4D1ZA 5HZNA 4ERWA 2VN9A 5EDQA 4Y46A 2BHHA 4RA4A 1JKLA 3NWWA 2EB2A 4D4YA 1JBPE 4L42A 2C30A 3WARA 1OIRA 3IW5A 5CAVA 2I7QA 4X6RA 4F1OA 2B7AA 3OXIA 4D0WA 1OVEA 3DFCB 3RPSA 2XKEA 3V6RA 5CU3A 5AX3A 4C61A 5I5ZA 3W8LA 2CDZA 3EIDA 4DGMA 1BKXA 4IX6A 1YXSA 4FC0A 4KAOA 3LFQA 3SDJA 4Y83A 3CE3A 1OL6A 4DFYA 2R3JA 3S1HA 2XZSA 3PXKA 5CVFA 1XBAA 2VTJA 2VRXA 5CENA 5I9ZA 1OPKA 3BGZA 4QRCA 4C36A 4RFYA 5AUYA 5DOSA 3Q6WA 4EQMA 3DTWA 1KOBA 5EHOA 3VQHA 3HV3A 1J7LA 2BAJA 2Y8OA 3EQFA 4JRNA 4C3PA 4F6UA 3UO6A 3LKMA 4L52A 5AEPA 3S2PA 3PXZA 4W4VA 4DG3E 3QTIA 1IA8A 2R3IA 5DA3A 3MFSA 3F3UA 3PSDA 4RJ7A 3EQDA 2E2BA 2JAMA 5FM2A 3ZM4A 5JQ8A 4UB7A 3FEGA 2OJIA 2XIRA 2DQ7X 4LRKA 4YJNA 4TWOA 3S95A 3BELA 4G3GA 4XBUA 4A7CA 4DEAA 5AUTA 4L01A 1W8CA 3DA6A 4R5SA 5CQWA 3UOLA 3UE4A 3K54A 5EDRA 4YSMA 3EFWA 2J0KA 4QP1A 3HMPA 4EOQA 5DHJA 5G6VA 3CTQA 3NGAA 4WNMA 5AR4A 4EI4A 4PX6A 4YHTA 3R9OA 4ALVA 3AC1A 1KV1A 4H3QA 4ASDA 3TUBA 4QP4A 2NRUA 4YPDA 3GCPA 5I0BA 4O84A 5JRQA 4RIWA 5AIKA 2C6IA 2OFVA 5FTQA 5DR2A 2OXDA 4XRJA 3PZHA 5JT2A 2ZV9A 2E9VA 4TZRA 1E9HA 3MIYA 3R73A 3CGOA 2XNBA 3HNGA 3R1QA 3BYUA 2FYSA 2R3FA 4NEUA 3QX2A 4QMXA 4WG3A 4ZLOA 3E3BX 4RFMA 1E1VA 1DAYA 1WVXA 5L6WL 3AMAA 3HUCA 2XK4A 4IXPA 4CMOA 1YDTE 1KE9A 4MXYA 3MPAA 4V05A 4YHJA 3ORPA 1QCFA 4QNAA 2P55A 5DGZA 3PG1A 5JN2A 4X3FC 5A6OA 4IX4A 5LCKA 3GB2A 4BR3A 4FZFB 3V5LA 2X1NA 3TWJA 4ANQA 1TQIA 3CY3A 3DXPA 4ZY6A 4F7JA 5L2IA 4OLIA 4QPSA 4U6RA 4H58A 5HBJA 2OU7A 2I0YA 5IQBA 2J0JA 2VTAA 4RIXA 4WNOA 3FLWA 3R83A 3IO7A 3VQUA 1VJYA 3DBCA 2F49A 5IA5A 3ORXA 2HW6A 2R3PA 3EYGA 3FKLA 3HLLA 1SNXA 4BCGA 4DBXA 2YFXA 3BWJA 4KRDA 2FSOX 4FKJA 4M66A 5ETCA 4BFMA 1R39A 4HPTE 3PXRA 4FT0A 2RF9A 3LXNA 2CN5A 5AFVA 5EOLA 5D7AA 3AMBA 3GU8A 2Q0NA 3SKCA 3AGMA 5B2LA 1PXIA 4BTMA 2W7XA 2ZDTA 2UZDA 1Y6AA 4N4SA 2PZYA 3CJGA 3ORZA 3W18A 2FUMA 5CF6A 1H0VA 3QCQA 5FLFA 1ZMWA 3HV6A 4YHFA 4D9UA 4YSJA 3MH3A 4GJ2A 4LI5A 5FD2A 1KSWA 4MBIA 2PMLX 2YM3A 2WMRA 3LFAA 3MTFA 3RGFA 4C02A 4EK4A 4GRBA 3D5WA 5K3YA 2Y6MA 2H96A 3VBVA 4EHVA 2QOKA 3N51A 4BCOA 3GFEA 3VC4A 5KNJA 3HAMA 5CXZA 5HE3A 4C4HA 5K9IA 4EC8A 3MY1A 4RWIA 4PMPA 3U9CA 5DMZA 2RFNA 4NIFA 3C4CA 1ZOGA 4IVBA 1OUYA 4OW8A 3O96A 2X2MA 4O22A 3JVSA 4EKLA 4FK3A 2NPQA 4S34A 3U9NA 1OIUA 5IA4A 2RIOA 3V8WA 4FNXA 5BX0A 1WBWA 4ZY4A 3EOCA 4AACA 2JITA 1KV2A 3F66A 3CSVA 3ZONA 4I0RA 2CKQA 3I4BA 2R3RA 4RIXB 4ERKA 5FEQA 2BHEA 5E8TA 3T9IA 4O7VA 5E90A 4K11A 5E8SA 3OW3A 3HMMA 3P86A 4DGLC 1JKTA 2OZAA 4YJVA 2HYYA 3CEKA 4GIIA 3ZEPA 2C47A 1VZOA 4ZEGA 4U0IA 5H8GA 2C5NA 2HOGA 5IISA 5GNKA 2J0LA 2DWBA 3FBVA 4CNHA 3I79A 4USEA 1WCCA 4W9XA 1T45A 4ZZOA 2RKUA 2BAKA 4GJ3A 4AFJA 1G8AA 1Q3DA 5C01A 4DTAA 3Q96A 2ITQA 4O91A 4W4WA 3LW0A 4PP9A 4AA4A 3NYVA 5K4JA 3F3TA 3PJ8A 5CSPA 2NP8A 3UOHA 4AOJA 4QMQA 2XK9A 2OJGA 2WMQA 3LFDA 1CM8A 1H26A 2VU3A 2CHLA 4NW6A 2WTKC 3RINA 4EH3A 5CSXA 4HW7A 2GNIA 3UO4A 1OIQA 4DBNA 4PNIA 3FHIA 4JS8A 4BYJA 3MH0A 3LCOA 3JS2A 5KMOA 4TWNA 1UNHA 1VEBA 3PE1A 3BI6A 4RPVA 3TNHA 3RNIA 4WO5A 4IB1A 3FMNA 4O86A 4UXLA 5CVGA 2BTRA 3VUKA 3AT3A 4QYYA 3T9TA 3C1XA 4HJOA 4PL5A 4LGHA 4X6QC 4UMRA 1K3AA 2R3NA 4FVRA 5ETFA 5E8VA 5CI7A 2CGUA 3VUDA 4TYEA 3PA4A 1O9UA 3MVMA 4BDKA 2OZAB 1URWA 5IU2A 2W9ZB 2V62A 2XM9A 2YWPA 3KULB 5JSMA 1J7IA 4EH8A 4PDYA 4GUEA 2GS6A 5CVHA 3WF5A 3RAHA 3UMXA 5L4QA 2WTWA 4PL4A 3MBLA 4FV2A 5AP3A 5HD7A 4EYMA 3QQLA 4XP2A 5DFPA 5HQ0A 4ZSEA 4JNWA 3A62A 4FEVA 4RSSA 3NR9A 1PXLA 1A9UA 4GSBA 2PU8A 4NFNA 1PKGA 1YOMA 3O51A 3PJ1A 4GK2A 3MVJA 4MWIA 1XH4A 2IO6A 4XOYA 2HXLA 1FVTA 1OL5A 3ELJA 4G6NA 4PDPA 3W33A 1ZYSA 1WAKA 4HYUA 3TL8A 4XV3A 3RAIA 2P0CA 3KY2A 3ZLSA 4CV8A 4EL9A 5BYYA 4UMTA 1BL7A 1SVHA 3WOWA 3QQGA 4F7LA 3C5IA 2VO7A 3MH2A 5C8NA 1JNKA 3QUEA 1DS5A 3QX4A 4Z9LA 4QMUA 2A19B 3BX5A 3EKNA 4YJPA 4H3BA 4C57A 4F08A 5C9CA 3FSKA 4NTSA 5IF1A 4AGCA 4YJRA 3CBLA 4O83A 5L6OA 4R8QA 2JAVA 3PIYA 5FWKK 3WZJA 3ID6C 2HAKA 4YZMA 2W5HA 3GP0A 4FOCA 4K0YA 2GQSA 4IM2A 3FZOA 5DG5A 4M7IA 2X0GA 4WBOA 5EK7A 5TKDA 4EK6A 4PL3A 2YEXA 1H01A 1YW2A 2GFCA 4IADA 4U7ZA 3CKWA 5HIDA 3PY1A 3R8PA 1OB3A 3A7JA 4OTRA 3E87A 2XK3A 5JFWA 3UVQA 5M4IA 3ANRA 3GVUA 3CJFA 3OWPA 4O0XA 4RJ4A 2CMWA 3CLYA 1P4FA 2R3GA 4QPAA 3TACA 3Q4ZA 1H00A 2BZIB 3GENA 5DIAA 1I09A 3HMOA 3BKBA 4IAZA 3FDNA 5FBNC 1Y8GA 4M0YA 3RK9A 3UQGA 2JLDA 2OI4X 5BVDA 5CF5A 3TG1A 2PYWA 4PPBA 4FTIA 3VHKA 5JKGA 2ZB0A 4CYIA 4Y8DA 3OTVA 4J99A 3D7ZA 4FV3A 3NUNA 3ET7A 4P7EA 3ZC5A 1Z9XA 4LGGA 4MXOA 1M2PA 3EFJA 2C6LA 5CEOA 3UO5A 3BV2A 4IZAA 4I93A 3Q2JA 4PPCA 4R6VA 1YXVA 2WMSA 2B55A 3HA8A 4QMPA 3S4QA 2QG7A 3PLAE 1Q62A 4DFNA 4NM7A 3L9LA 3QWKA 4FTQA 4V04A 4XV1A 3KRRA 3HGKA 2F9GA 1PMUA 2A4LA 2WIPA 5HVYA 5GZAA 2QLUA 4U3YA 3EN5A 5J87A 2ZM1A 4EH5A 4BBMA 4TY1A 3FQSA 2ITPA 1DI8A 3DLZA 2PZIA 3BIZA 5HE2A 4JDIA 4ONAA 4J98A 5IA2A 4G6OA 2VTIA 4K77A 4MH7A 4R77A 3FY0A 5IUIA 2Z2WA 4XV2A 4APPA 3ZDUA 2JKKA 4UZHA 3V5WA 1ZMUA 5EYMA 2QOLA 4EOJA 2VX3A 4ZSAA 3SVVA 2EVAA 5D1JA 2QOOA 4PDOA 4CRLA 4JX7A 4N0SA 3ZM9A 4BWXA 3A8WA 1IRKA 5HTBA 4UZDA 3FZ1A 1KE5A 3WZUA 1PRYA 5E1EA 4O0RA 4ZTNA 2J5EA 3OY1A 4FVPA 2R0UA 2DUVA 4KUJA 4QTBA 1UU9A 5LVNA 2QC6A 4QYEA 3GCQA 3PSCA 3CXWA 4XG3A 3DOGA 4DLJA 4O82A 4TYIA 3EWHA 5CEKA 4AXAA 4QMOA 5L6PA 3U6IA 5CT0A 3DTCA 2YAKA 1XH7A 3F5XA 2YIQA 3OWLA 4CCUA 4O0YA 1BLXA 4WRSA 4XBRA 4ARKA 1PY5A 1CDKA 4E8AA 5HX8A 2UZLA 2VWBA 3QZFA 2GQGA 2B53A 3NUYA 4CT1A 3V51A 3GEQA 3R1SA 2GTNA 4BY9E 2WMBA 3W8QA 3PVBA 5LVLA 2CKPA 4EWQA 5AM7A 1Q41A 2XBJA 4R3CA 4JDJA 4U80A 2W4OA 2YIYA 2Z7SA 4QOXA 4D2RA 4DGNA 2UZNA 3QWJA 3KQ7A 1PYXA 3OW4A 1TQPA 2XB7A 5FDXA 2VNYA 5FP6A 4DINA 4EQCA 4NUSA 1M14A 2V55A 5CSHA 4JBOA 2EB3A 2F7ZE 2GNLA 2P2IA 2RFSA 2O8YA 3A99A 1UWHA 3EN9A 3K2LA 1ZRZA 3QFVA 3R7UA 2GFSA 4FZAB 3RVGA 4HOKA 4BBEA 4TTHB 2BALA 1QPJA 4CKRA 3U55A 2WTJA 2PMIA 2ZB1A 4J7BA 4RWJA 3A4PA 1MRUA 3H0YA 2XK6A 4GYIA 2PVLA 5IMXA 1UA2A 4XV9A 3BYVA 2C0OA 3JY0A 3KRJA 1UV5A 5TO8A 4O7YA 4FEXA 3DLSA 4Y73A 4GT4A 2QHMA 4YR8A 3ZRLA 3BCEA 4G6LA 3TIYA 3WI6A 4CGAA 3W1FA 4FICA 2PZRA 3FMHA 2B9IA 3R1NA 2WQMA 4D5KA 3LCDA 4IBMA 3B2WA 2VWVA 4ZTMA 3TDWA 5GIPE 2W5AA 1PMEA 2HIWA 4RJ8A 1XH9A 2CGXA 4JR3A 5D11A 4KSQA 3UPXA 1CSNA 3TIZA 2UV2A 3BHUA 4AGUA 2CLQA 3PLSA 2G2HA 2OH0E 3HVCA 4MX9A 3ORTA 3ENMA 1K2PA 4DH5A 2P4IA 2UVYA 3R30A 4OBQA 3NLBA 4FE2A 2QO2A 4EOPA 5ICPA 3AC8A 2BRNA 5TF9A 4D5HA 4ALWA 3A7GA 4BDEA 1ZYLA 5LMBA 1MRVA 3IONA 1JQHA 1VYWA 1R3CA 1WBVA 4Q2AA 4D2SA 3GQIA 3ZDIA 3K5UA 5EI8A 4GG7A 3DDQA 3W2RA 4CSVA 4IHPA 4EBVA 1SVGA 4MNEA 3O0GA 3QHRA 3N4VA 3TV6A 2Z02A 3QGYA 2QLQA 4JDHA 4TPTA 3QA8A 3UDBA 3WZDA 2WU6A 3MESA 3PJ2A 3BHHA 4NU1A 3OOMA 2VTHA 3OWJA 1GIIA 3GC7A 2QONA 3UOJA 4FSMA 5AJQA 3QTZA 1XH6A 4E7WA 4OGRA 3FQEA 4M69A 4DTKA 4P4CA 4B0GA 1IG1A 2XNOA 3DZQA 4IB5A 2IW8A 5CXHA 4FI1A 1O6KA 2JDOA 4PTCA 1NY3A 5DNRA 4NW5A 3RAWA 3NZ0A 3C5UA 4JAJA 4ZTLA 4JIAA 3SQQA 4RA5A 3FMKA 5M06A 3QZHA 4GU6A 4YBKA 4FT7A 4ZJJA 3HV5A 2C6MA 5J9LA 1CKPA 3IOKA 1PHKA 4BGHA 1H1RA 1UNGA 2PE2A 3V01A 2J0MB 5LOHA 1IEPA 1NT2A 4BRXA 4IDTA 4ZTQA 2O65A 4RWLA 4JVGA 4WRGA 3RPOA 3ZO2A 5I9YA 3SHEA 5IUHA 4QPMA 3VJOA 1LPUA 3AQVA 3CKXA 3KC3A 4KRCA 3R7OA 3BBWA 1GZ8A 2W0JA 2LGCA 3LCTA 2NNWB 1SYKA 5ANIA 3MIAA 4RLLA 4FUYA 2J5FA 4DH7A 3DB8A 1WVWA 1QPCA 2PVJA 3V8SA 5BUEA 5CEPA 4I23A 3I5ZA 4EOSA 3ROCA 4RBLA 4CZTA 4BI2A 3LHJA 4FF8A 4BDAA 2XCHA 1DAWA 3OTUA 2FSTX 3FL5A 3ERKA 4FSRA 2UZVA 2GTMA 3EB0A 3VRZA 2WGJA 3EMGA 3ODZX 5BYZA 3ZO1A 4H3PA 5CF4A 5LMKC 3IDBA 4OTGA 4FSNA 3SX9A 4OTHA 2RG6A 2OXXA 3BGPA 4B8MA 4BCIA 3DV3A 1RE8A 4M13A 2I0EA 2FH9A 1TQMA 4USDA 4Y85A 1M2QA 4L3JA 4YZ9A 4B99A 4YJTA 4FTTA 4AF3A 4X7QA 3IW4A 4YZDA 5LVPA 1HOWA 3VUGA 2VGOA 2VX1A 3ZFMA 4DAWA 4F09A 5HU9A 1GZOA 5HOAA 3GOPA 3LMGA 5CWZA 1XO2B 1PXMA 1M7QA 3F7ZA 3S3IA 5IDPA 4C4JA 3KXZA 2HZNA 3LQ8A 4YJOA 1XJDA 5ETIA 4EOOA 4EORA 2WOUA 4AN3A 4BWKA 3LMHA 3BE2A 4I92A 5M09A 4ITIA 3QQJA 1P4OA 1OUKA 2CNVA 4CV9A 2OK1A 5EG3A 3KXMA 3L9MA 3QZGA 1RDQE 3DY7A 3BYSA 4L7SA 5IH4A 4M3QA 3S0OA 5DBXA 2BTSA 2GSFA 4DGGA 4QQJA 4IZYA 4Z3VA 1KUTA 5L3AA 3BGQA 2XJ0A 1GIJA 4U8ZA 4E4XA 5E7RA 5FXRA 1JVPP 1J91A 1YDRE 3R7IA 3Q9WA 2UW6A 3QTUA 5EOBA 5IQGA 5HORA 5AADA 1OITA 4MCVA 3FJQE 3IPHA 3VS6A 4F9CA 5EHYA 2JGZA 1BI8A 1X8BA 3PFQA 4MTAA 4O0VA 4UWYA 4X3FA 3ZSHA 5L8JA 4I0TA 3VS2A 4XOZA 4N57A 2UZWE 2BRHA 3EL8A 4G34A 4H36A 1YQJA 4IB3A 4O27B 1J7UA 3NVMB 1IAHA 4FV0A 3MS9A 5IKWA 1F5QA 4M15A 2G2FA 4MKCA 1L8TA 1G5SA 3ZTXA 3VS7A 3LXKA 4DF3A 2G01A 1WZYA 3LXPA 4I5CA 5HO8A 3PJCA 4EEVA 4QMZA 4BTJA 4HGTA 5TR6A 2GHMA 5L8LA 2PHKA 2QQ7A 2UW4A 3G9LX 3QC4A 2HXQA 3EYHA 5HE1A 3CPBA 3KF4A 4ASXA 4FT9A 3NYOA 4XRLA 4E6AA 3II5A 1V0BA 3UYSA 5CT7A 4LGDA 2ZV2A 3HRCA 2ITUA 4FIFA 4C0TA 3H9RA 3DGKA 4I4EA 2YCQA 2XRWA 3DJ7A 3WYXA 4H05A 1WFCA 2X8DA 1FVRA 3E8CA 3VWAA 4EKKA 1FMOE 4KS8A 4A9SA 2XBAA 3UMWA 4NCTC 3HV7A 4FTCA 3HMIA 3IECA 4CFVA 3GFWA 4NT4A 1H1WA 1PF8A 3DKOA 3A7HA 4I21A 5EKOA 3HRBA 2I1MA 1YXUA 4A07A 2XP2A 4JLCA 2IZSA 2XK7A 2YIXA 4PMMA 4FKSA 1PXOA 2G9XA 4FKLA 3ZRMA 3LIJA 5AR8A 5CYIA 3FSFA 3Q5IA 4U9AA 1NVRA 3P7BA 2C3JA 3P23A 4QD6A 4X3FB 4EZ5A 1FPUA 4CFNA 4D4RA 4OR5A 4ZSGA 4X2FA 1Y57A 4LMNA 5CI6A 3QQFA 4NJ3A 4Y5HA 4UMPA 3DKFA 4QMVA 4PV0A 2JEDA 5HLNA 5J5SA 2QU5A 3OY3A 2VO0A 2ETKA 4IZ5A 4WHZA 3SW4A 4TYJA 1H27A 3RHXA 3PYYA 2I40A 4RGJA 4G5JA 3TXOA 2EXEA 3ZLYA 4E4LA 4ANNA 5E91A 1NW1A 4HYHA 4MBJA 4KIPA 2PPQA 1YHWA 2R0IA 4XCUA 3RBWA 4YUQA 4TYGA 4FTOA 3NCGA 4YZCA 4EH9A 5CU0A 2YABA 3KMMA 4CFMA 4E20A 4MVFA 4FTRA 4QMNA 3R7VA 1FGIA 3LAUA 3KN5A 2VTRA 4HCVA 2CGVA 2JIVA 4XG6A 5JZNA 3TTJA 4EC9A 5I9WA 5HCXA 2PVKA 5EQEA 5IQFA 4GFMA 2JDTA 5A4TA 5M55A 4IVAA 3ZOSA 3CIKA 3NIEA 5IA0A 3I6WA 3TM0A 1UU3A 3SRVA 5C1QB 2WPAA 5HCZA 1R1WA 2BZKB 4WNPA 5H8EA 4BZDA 4CZUA 2C5OA 4CFWA 4TL0A 5GJGA 1OPJA 4O7TA 3NS9A 4YC3A 1XBBA 3OROA 4JBPA 3JYAA 5AP1A 4ALUA 4Q9ZA 4AA5A 4ACCA 3FLNC 3D94A 5DRBA 5CEQA 2SRCA 1ZARA 2HY0A 3COMA 3W2PA 3R1YA 5KMKA 3VS0A 2YISA 3QRIA 4NK9A 3RHKA 4PP7A 2JFLA 2C5YA 4TWPA 2ITTA 3TJCA 3N9XA 3PVUA 4WUNA 3U4UA 4PUZA 5CX9A 3U51A 3MPTA 1S9JA 3OCGA 2BFXA 2BDJA 3CD8A 1A06A 3C0GA 4WT6A 4FODA 3U4WA 2JDVA 4JDKA 1UKIA 2OJJA 2OKRA 2YJSA 3RKBA 4GW8A 3PDTA 1Q8ZA 1ZYCA 3SXRA 3HKOA 2X8IA 4YO6A 1XHAA 3NPCA 4FOBA 1CMKE 2VTPA 4EK8A 4ZZNA 4C7TA 5F94A 1S9IA 3GU7A 3QUDA 2VAGA 4A9UA 3MDYA 5J1VA 5J1WA 3UZTA 4U40A 4Z7HA 3R8UA 3PVWA 4UMUA 3OMVA 2AC5A 4R5YA 3ETAA 3EN4A 3FXZA 5IDNA 5IQEA 3WBLA 4EHZA 4K1BA 3P79A 3ZFXA 3HL7A 5EI2A 3HYHA 4L3PA 4EH2A 3A7FA
chains in the Genus database with same CATH superfamily
4DG2E 2WXVA 1KOAA 1XWSA 3P1AA 3QQHA 3IW8A 4ZSLA 4D4SA 4FV5A 4YJUA 3COHA 1YI3A 2PWLA 4ZSJA 4LV7A 1H1QA 4ZMFA 2ITVA 3M11A 1JKKA 1OL1A 3EJ1A 5DRDA 5BPYA 3VHEA 1UVRA 3HAVA 1OL7A 3DKCA 1Q8YA 4RIWB 2ZMCA 3I0OA 4UXQA 5HLPA 4R1VA 4G17A 3QKMA 1YWVA 4YLKA 3O8UA 2B4SB 3FE3A 4W8EA 3TNQB 3E88A 3GU5A 3K3JA 3OD6X 4WSYA 2UW9A 5IA1A 1YI6A 2O2UA 2Z7RA 3FI8A 4ACMA 3LFNA 3CS9A 4YTHA 5KBQA 3GOKA 3SOCA 5J5TA 1ZOEA 5DR6A 3UIBA 5F9EA 4CMTA 5AV1A 4BCFA 4L43A 3PG3A 3R0TA 2BIYA 2JC6A 4HVIA 1ZAOA 2GNJA 2HW7A 2XVDA 3DNEA 4MHAA 4RT7A 4EH7A 2GNFA 2QI8A 3F3VA 4HNFA 5IH6A 2WTVA 3HDNA 3QUPA 4DYMA 3DKGA 5L2SA 2HZIA 2V0DA 4TXCA 4ZOGA 3VW6A 3P78A 3IQ7A 3QRTA 4U45A 3RM7A 4EUUA 4DEDA 4QTDA 4CMUA 5CZHA 5EM6A 3PP1A 4E6DA 3I7CA 5DE2A 2G1TA 1OKYA 4FKIA 5KBRA 5DI1A 1ZWSA 2VTSA 4A9YA 5F95A 2ERZE 4CT2A 4EJ7A 3PTGA 4R7IA 2YDKA 4BKYA 4X0MA 3EL7A 3IS5A 3ANQA 3VVHA 4QNYA 1REJA 2O0UA 4UEUA 2HWOA 2YM8A 4ZJIA 3VNTA 1XR1A 2OSCA 2J4ZA 5FM3A 3RPRA 1JSTA 3IG7A 4RJ5A 4L9IA 4FNZA 2AUHA 3EQBA 5AP5A 3W2OA 3W16A 4XJ0A 5L2TA 1V1KA 5IEXA 2C6DA 1SNUA 2PE0A 2GHLA 2RSVA 3ITZA 3QKLA 4FRFA 4RQVA 4QYHA 5LMAA 5A46A 4BDCA 4L00A 4BDHA 4DFXE 3QQKA 4TN6A 4NIFB 3UBDA 4N6YA 3ZUVA 5JH6A 4J71A 3MY5A 2YAAA 5LWNA 3QL8A 3BBTB 4U79A 3R28A 3A8XA 1U5QA 1H25A 4JG7A 3HP5A 4JG6A 3QLFA 2Q83A 4PTEA 3RCJA 4BCQA 3GCSA 4O6LA 5K0XA 1YOLA 2QHNA 3HP2A 3HV4A 3QD0A 4Q5EA 3PZEA 5IA3A 2ZM3A 3EQHA 4AT5A 3MW1A 1PMVA 2B1PA 4QMWA 3V04A 3L1SA 2VTTA 1Q3WA 4QMTA 5HVKA 1ZZLA 4AW0A 1VR2A 3HEGA 4FYNA 2QKWB 4O4FA 4TW9A 4XHKB 3R6XA 1R0EA 3OP5A 1URCA 3RNYA 1MRYA 3DFAA 3GI3A 3WF7A 1JSVA 3ZLXA 3UDTA 2PMNX 3F5GA 1ZYDA 3I7BA 2W1IA 3G33A 2ZVAA 4G3FA 4I3ZA 5ACKA 3THBA 3RWPA 2W99B 4YP8A 2J2IB 3ZBFA 1H24A 5JQ5A 4DDIA 3OXTA 4EYJA 2ZDUA 5A4QA 1XH5A 2OJFE 1ZLTA 3QTQA 3UNJA 4G3CA 3DNDA 3QAME 2OJ9A 3RK7A 4I6FA 2QOCA 5AUUA 4CVAA 3GC0A 3KVWA 1KE6A 2PL0A 2C1BA 3R02A 3Q4CA 4NH1A 1CKJA 4BWPA 1UU7A 3ZHPC 2EWAA 2OG8A 4IANA 3Q6UA 3LJ0A 3RMFA 1H1PA 2ONLC 5FRIA 4QP8A 4ZTRA 5I9XA 4W4YA 2E9OA 3FXWA 2R7IA 3CP9A 3P5JC 4GIHA 4CCBA 2BROA 3LFBA 5HICA 5K0KA 2VTOA 3MVHA 2ZJWA 2IF8A 5IQDA 4S30A 5FP5A 3EQPA 2R3HA 2IW6A 4G9RA 3REPA 2QOQA 4ID7A 4FR4A 4EOLA 5CSVA 2C5XA 4ZTHA 4FNYA 3ACKA 3GC8A 4FTMA 3BLRA 3Q4UA 1REKA 4JR7A 4KIKA 4TWCA 4I5HA 1GZKA 4FIHA 2UVZA 2WAJA 3O2MA 3OCSA 4PMTA 1Z57A 3TZ8A 1Y91A 2HZ4A 2PZ5A 1W2DA 4IQ6A 4BCMA 3U87A 4CQGA 4QTEA 4LRJA 2WMWA 5M51A 5GIOE 4FSUA 4BL1A 4M67A 5AWMA 4C34A 2IW9A 2W06A 3BLHA 2Y9QA 4IC8A 4G5PA 4IB0A 3LJ2A 3GT8A 5ANDA 4DGOA 4FIGA 5H2UA 4G16A 3SG8A 3OEZA 5LWMA 3FLZA 5AA9A 3MN3A 2H9VA 1JAMA 2WD1A 4ZK5A 3BZ3A 3JPVA 3LFSA 2WIHA 3SGCA 3I81A 4KKHA 3CTJA 3WE4A 2J50A 3WZEA 3FLYA 4WBBB 2W05A 2BPMA 4IACA 2F7EE 2CLXA 3IOPA 3LPBA 2JFMA 4JRVA 4O0TA 4Y5QA 4PWNA 3V6SA 3OG7A 3MFRA 3E63A 2R5TA 4L45A 4BDJA 5AAEA 3DK6A 3D5UA 3KRLA 4B4LA 3HDMA 3TDVA 3LFEA 4QT1A 5H9BA 3UPZA 4KWPA 2PY3A 1OMWA 5I3RA 4GKHA 1OGUA 3V8TA 5EH0A 3P08A 4GT3A 4RC4A 2PUPA 2J9MA 5EM7A 3GXLA 1HCLA 5HG7A 5LXMA 3LM0A 3MFUA 4U5JA 1BL6A 1NVQA 2X6EA 4FMQA 2XARA 2BIKB 1UU8A 3NW6A 3PE2A 3CQEA 2Z7LA 4KIKB 3KU2A 4O4DA 3NUPA 2GDOA 1GNGA 5A14A 5DT3A 3R01A 4MF0A 1M52A 3E7OA 4ZS0A 5K5XA 4F70A 4EUTA 2WFYA 3R2YA 3F2NA 1SZMA 5FUTA 3BHYA 3O8TA 3ZO4A 2OIDA 1OL2A 3V5PA 4M68A 2C68A 2ITOA 2ZV7A 2OICA 4F99A 4FL1A 2C3IB 4KKGA 5K5NA 5CY3A 5HO6A 2YCRA 5JRSA 1UKHA 4WNKA 2ZM4A 5AA8A 3UVRA 4UY9A 4O0UA 1LR4A 4BCNA 5DT0A 3CQWA 5H3QA 2VV9A 2F2UA 3OC1A 3SAYA 5DVRA 2QNJA 5EQYA 2JKQA 3QKKA 2VTNA 2BFYA 1ZOHA 2BRGA 1OKWA 2OBJA 3PY0A 3ORLA 4LQMA 3VS1A 3RK5A 3POZA 3F9NA 2ZV8A 4O2PA 4AT4A 4N70A 4PF4A 4LG4A 4A4LA 1J1BA 1M17A 4RIOA 4DFZE 3NVKI 2DYLA 5EW8A 1ZZ2A 3D4QA 2YJRA 3BE9A 1IR3A 4QQ5A 5LMKA 3W2CA 4DEBA 3FLQA 2J0IA 2GS2A 1OKZA 1Q8UA 1YRPA 4AS0A 4NFMA 3QALE 2XIKA 1OBDA 2C3LA 2F57A 4GV1A 3W32A 3O7LB 4U97A 4BYIA 4Z7GA 3FI2A 4OBOA 1PJKA 4L8MA 4DHZA 2BZHB 3FZSA 5M08A 3DK3A 5HVJA 5IZFA 4XLVA 3BQCA 4I94A 3WF6A 5CALA 2BRMA 4D58A 3BLAA 2XEZA 4HYSA 3F3ZA 2WNTA 4X21A 3LVPA 3UVPA 4YBJA 2HELA 4IEBA 3BHVA 5DR9A 1YOJA 3VBWA 2F7XE 1AQ1A 4WA9A 4ACDA 3TNWA 4FTLA 3F61A 3OXZA 4EZ7A 5HTIA 1YWNA 2OO8X 4KBCA 3WF8A 3MVLA 3UNKA 4YNEA 2E9UA 5C8MA 2H34A 4FSQA 1YXXA 4NM5A 4ANMA 4PNKA 3QCXA 4HGLA 4CZYB 3UTOA 4F9WA 4S33A 1GZNA 5KZ0A 4YNOA 3BWFA 5I4NA 3QCYA 3DXQA 2OIBA 5KMJA 2QO7A 2RFEA 4W9WA 4CRSA 3U6HA 3KRXA 1BYGA 2C69A 2Q0BA 4RFZA 2I0HA 2JDRA 4GU9A 1FMKA 4KKEA 2QOHA 3DBEA 4YGAA 4ZXTA 3TZ9A 3FMMA 3VULA 5KMIA 3RTPA 1Q97A 4QDVA 4KIQA 5HE0A 3FLSA 4O7SA 2X7GA 1B39A 4LL0A 3VAPA 1OM1A 4FUXA 2WOTA 3P9JA 3R9HA 2C0IA 3UNZA 1B6CB 4J1RA 5IH5A 3DAJA 4KS7A 2VTQA 4Y72A 3K5VA 1YXTA 1G3NA 3VF9A 4CLIA 5BVOA 4CTBA 3QLGA 4L53A 5CU6A 4DHFA 4G1WA 3W55A 3FV8A 5AAGA 3Q2MA 4IVDA 4YJQA 3Q53A 4QP6A 4NKAA 4BC6A 4QMYA 4EK3A 1PKDA 2WHBA 1BI7A 2VD5A 2JDSA 4FSWA 4WIHA 5B7VA 4IAKA 5HTCA 2CSNA 5F20A 4E93A 1QPDA 2GNGA 2QU6A 3LQ3A 2XAMA 3FZRA 2ETMA 4U41A 2PVYA 2X8EA 4GK4A 3RI1A 2BAQA 4KBKA 4PMSA 3R7EA 3RCDA 4FKQA 4DEGA 4D1XA 3PWDA 5HG5A 2JKOA 5CASA 4ZLZA 1WMKA 5LVOA 4IWQA 4IM3A 4O81A 2YIWA 4AOTA 3KXNA 3PY3A 2XRUA 2QODA 4GKIA 5FQDC 4NCTA 4JX3A 5A3XA 2X4ZA 3GNIB 2X2KA 2KTYA 2V7OA 4Z55A 5KMLA 3C4ZA 3HZTA 2YACA 4FBXA 5KKRB 4X2KA 3Q3BA 3UJGA 4M12A 2IG7A 3F5UA 1LP4A 4IAFA 2BDWA 1PW2A 2R2PA 4PY1A 2W96B 5D7VA 4IH8A 4A9TA 5JK3A 3A7IA 3H9OA 3MB6A 2UW5A 3MJ2A 4IX5A 1IAJA 1SMHA 4FTAA 3BRBA 4II5A 2CCHA 4O4CA 3G5DA 3KXGA 3COIA 5L2WA 2UUEA 3PFYA 1XKKA 2XNEA 4GH2A 4LM5A 4USFA 4EHGA 2ESMA 3TKIA 4NWMA 4AZFA 4F1MA 2V22A 4AAAA 4GS6A 4LOOA 3WIKA 3PRIA 3U6JA 5EYDA 2VWXA 5I9UA 5KCVA 3EFKA 3QXPA 2YWVA 1Q24A 3NNVA 5KZIA 3E8DA 3GU4A 4LRMA 1JWHA 1R0PA 5C03A 3FKNA 3WIGA 2CNUA 3TT0A 4J96A 3Q60A 4MF1A 4E3CA 4EOKA 4EZ3A 1Q8WA 2REIA 1TKIA 4IAAA 4MWHA 3ZS5A 4DH3A 3BYMA 5HNIX 4NYEA 4E4MA 5AIRA 3E93A 1OKVA 2B9JA 3O23A 2HENA 3UZRA 2OXYA 5AP6A 5AV0A 2XKCA 3R21A 2ITYA 4AZTA 3E5AA 4MNEB 2J51A 1W2CA 4C8BA 2VTLA 3H10A 1CTPE 3DAEA 3BLQA 4EH4A 2H6DA 3LOKA 4U3ZA 4K33A 4ZAUA 3POOA 2CNQA 2OZOA 3WZKA 1RW8A 2BVAA 3FY2A 2YHVA 4FV8A 2R3KA 3PXYA 5IMEA 5JGAA 4PPAA 4Q9SA 4HZRA 4M69B 4R3RA 4ITHA 5HCYA 4R1YA 4WSQA 4AP7A 4U44A 3U8WA 3FKOA 3ZEWA 4DT9A 2A2AA 2IWIA 2ZOQA 4H1MA 4L3LA 3LXLA 3L8SA 4UX9A 5IG1A 2O5KA 5J9ZA 4YC8A 2VX0A 4F0IA 4MD7E 2XKDA 4MBLA 3NYXA 2W5BA 3QF9A 4DITA 4AXCA 4C38A 2BR1A 4MXAA 4AX8A 3IW6A 4FV6A 4DG0E 2FSMX 5CNNA 3PWYA 2H8HA 3RALA 2P3GX 4BHNA 2WTIA 5HEZA 4H1JA 4AGDA 4BCPA 2W1DA 4FGBA 3CPCA 4J8MA 4V01A 4RWKA 3BU3A 1FOTA 5AP2A 3TN8A 5E8XA 3OFMA 5TE0A 3O8PA 3NDMA 1H4LA 5AX9A 4ITJA 4JQ7A 5CZIA 1SM2A 2PUUA 5IQCA 5F4NA 2RFDA 3TI1A 2B0QA 1Y8YA 3SW7A 5J95A 2YERA 4BBFA 4TKSA 1M7NA 3DDPA 3R8MA 1MQBA 4OTIA 5JFXA 3PIXA 3N4TA 2X9EA 4K18A 4JQ8A 3QGWA 3F2AA 4P5ZA 1ZY4A 3LQ5A 4O7LA 2QO9A 5EM5A 5J79A 2B9FA 4FL2A 2X2LA 2XJ1A 4CLJA 5A4EA 4X2GA 3MTLA 4KA3A 4D0XA 1ST0A 4IIRA 1U59A 4RJ6A 5AV2A 3G51A 4IAYA 2CCIA 2XS0A 4I5PA 4K6ZA 4QMMA 2FSLX 3O50A 1P2AA 3PA3A 3BHTA 4O6EA 5B0XA 4MD9E 3TUDA 3JR1A 4M97A 1E1XA 4I6HA 3OCBA 1Y6BA 2O63A 4RZWA 4F4PA 1ST4A 1VYZA 3ZZWA 2R3LA 4EH6A 2HCKA 4IAIA 1TVOA 2GPHA 1H28A 2WTCA 4W4XA 2FO0A 5ANOA 2W1CA 4FVQA 5AMNA 4ASEA 3ALNA 3VW8A 4HNIA 3UYTA 5JFSA 4BB4A 5FXQA 3JUHA 4IFGA 4YLLA 1UWJA 4O7ZA 3FYKX 4QYGA 1Q8TA 3FL4A 3LFCA 4S32A 5HESA 5D10A 3MA3A 2RG5A 2UW3A 3I6UA 3C51A 5HIEA 3I0QA 4PQNA 3ZCLA 4JIKA 4I20A 2OIQA 3R7YA 4FV7A 2O3PA 2J6MA 2WELA 3F3WA 3H9FA 3IK3A 3QZIA 3IDCA 4F7NA 2XMYA 3NNWA 5JMSA 3NW7A 5EYKA 5DYJA 3QHWA 3UP7A 2B54A 4FKTA 4IWDA 4O4BB 4F78A 1EH4A 3AT4A 3DZOA 3OZ6A 4NTTA 4O2ZA 4O0SA 3AXWA 4BGGA 4ENXA 4AXFA 1J1CA 2R3MA 3G6GA 4QP2A 4RX7A 5HIBA 3OT3A 2FVDA 5CSWA 2GNHA 4OTPA 1U4DA 2QG5A 3FC1X 4RRVA 1APME 4BDFA 3ATSA 3UC3A 4DCAA 3JVRA 4ZIMA 2PTKA 3ZBXA 4BTFA 3UQFA 2VWIA 3NAXA 3CY2A 4RIYA 4FG8A 3JY9A 2YM4A 3F82A 3D83A 2YCSA 4AUAA 1SVEA 2WZJA 4JBQA 2NO3A 4FEQA 3WF9A 4D2VA 2WQEA 3Q5ZA 4KINA 2CKOA 1L3RE 3TJDA 5B2KA 3OCTA 3KK8A 3RZFA 3ZC6A 4DEIA 4JBVA 1G8SA 1PXKA 3Q52A 5EW9A 2VWYA 4RQKA 4WOVA 1XMMA 5DEYA 3VRYA 4BZNA 4F64A 3QTXA 3C4WA 1PXJA 4FV4A 4D2WA 4YPSA 4U81A 4ANOA 3QTSA 5KO1A 2X4FA 3DBFA 4M8TA 3OS3A 3NFFB 4G9CA 3KRWA 2R9SA 4KD1A 4DHIB 3O7LD 4UMQA 5CANA 3ZFYA 2VWWA 2VWZA 3R8LA 4BDDA 3AT2A 2XNGA 2Y4PA 5D12A 1JLUE 4ZS4A 2PVNA 2Y4IC 3KCFA 3GC9A 4EJNA 2OWBA 4LMUA 4MXCA 5L8KA 4M14A 3UIXA 3LLAA 4YTIA 2UW8A 1OIYA 1W84A 5CTPA 3HMNA 1BUHA 3FWQA 3PPZA 3TEIA 5A9UA 4EHEA 5FTGA 4QP9A 2V7AA 5GZ8A 2X39A 3VUMA 2C5VA 2GS7A 4C58A 4R7BA 3R63A 4A06A 3F69A 2ACXA 2BDFA 3C0IA 3ENHA 2PZPA 2XIZA 4GMYA 3UIUA 3EFLA 4RIYB 2IVSA 4RVMA 4FG7A 4L68A 3PPKA 5DT4A 2X6DA 5CAPA 4I4FA 5JEBA 1W7HA 3OWKA 3PJ3A 5E92A 3KGAA 4QP7A 4QP3A 1WBTA 4I0SA 3SXFA 5ITAA 4WG5A 3DBQA 5AUXA 3T3UA 3D7TA 4ZJVA 2CPKE 2HY81 2QURA 3AC4A 5M07A 4TT7A 4AQCA 5HKMA 3W0SA 3MJ1A 3EKKA 4C2WA 4G3DA 5LVMA 2OH4A 4QQCA 2GU8A 2PK9A 4K9YA 4YLJA 4NSTA 5FEEA 3AD6A 2C6OA 2VZ6A 1YHSA 2ZYBA 5T68A 1LEZA 3SRVB 4A4OA 2WTKB 3WILA 5C27A 3TNPC 4E5BA 1U46A 4FKUA 4I6QA 4NKSA 4X2NA 4A4XA 1P14A 5BVNA 2CGWA 2YM5A 5IUGA 4NL0A 3AGLA 1ATPE 2IZTA 2R64A 2UZEA 3EN7A 4ZZMA 4C37A 4DTBA 3FI3A 3QCSA 4FKVA 2XNNA 4O1OA 1PXNA 2XYUA 2ONLA 4KBAA 2WTDA 4QTAA 2QCSA 4CFFA 3FYJX 2E9NA 3VS5A 4PDSA 4O7WA 1F3MC 3QTWA 1G8KA 2F4JA 2IEWA 1PMNA 3ZSIA 5LQFA 3W0PA 3ZXTA 3ZRKA 4DFUA 4S31A 5DN3A 3KKVA 3KCKA 3ZZEA 1O6LA 5D9HA 2XJ2A 2FB8A 3D9VA 3W10A 4O96A 5B2MA 4CFXA 4RVTA 4YC6A 2A98A 1GJOA 1H8FA 3SXSA 3L8VA 1WVYA 5IEYA 2UZUE 2X9FA 3GQLA 3NUUA 4L6QA 3D7TB 4RMZA 3FAAA 3DT1A 3SG9A 3GCUA 4RJ3A 3NRMA 3Q9ZA 4C62A 4OAVB 4O7NA 4XUFA 3NUAA 5ETAA 1AD5A 3CCNA 3HUBA 2QOIA 4WG4A 3VN9A 3BPRA 3A4OX 3RAKA 1M2RA 4ANBA 2YIRA 3D15A 4DE4A 3NUSA 3VUTA 4D9TA 4WD5A 2PULA 3QYWA 2PUIA 1XQZA 3MSSA 3G6HA 3QRKA 4FTKA 5HBEA 3T3VA 1TFFA 4XP3A 3TV7A 4LUEA 3TKHA 4CEGA 3EH9A 5FTOA 3OOGA 1JKSA 4TYHA 2PUNA 3D2KA 2VWUA 4FIJA 4K2RA 4R7HA 5KMNA 5HHWA 2OF2A 3M2WA 4ANLA 5M53A 5AM6A 5IEVA 4FT3A 2YDIA 4FZ7A 4AZVA 3E8EA 4UBAA 1ZY5A 3W2QA 3FXXA 4F0GA 3ORKA 2VO6A 5ANJA 5AUZA 4FTNA 5LARA 2PVHA 1QPEA 5EFQA 1B38A 3OUKA 3ULIA 2XKFA 4A9RA 4MQ1A 4AW5A 3TMOA 2WMVA 4OUCA 3D2IA 4FG9A 3FUPA 3KULA 4BI0A 1NA7A 3CQUA 5LCJA 3NUXA 5KMMA 3MY0A 3E62A 4FIIA 5M44A 3M1SA 2Y7JA 3DQXA 5BQ0A 3TUCA 3TCPA 2WEIA 3TNIA 4HVHA 4YURA 5E8UA 4LFIA 5C4LA 4IDVA 5CAQA 3R7GA 3SD0A 5C4KA 1LEWA 4TNDA 3B8RA 3KB7A 5E9EA 3ZXZA 2QKRA 2WU7A 3KL8A 3IDPA 4XG2A 4CTCA 3EQIA 3I60A 5AR3A 3RZBA 1STCE 4BDIA 2WQNA 3A61A 3WYYA 3QD2B 5JZJA 4BJJA 2XCKA 4O0WA 4AZEA 3GUBA 2DS1A 3LM5A 3MV5A 5AR2A 3UGCA 3DJ5A 5AP7A 4JMQA 3H4JA 4GVJA 4S2ZA 4UYAA 2EXMA 4P5QA 3MA6A 2IN6A 4UV0A 4HGEA 3ATTA 5CQUA 5GJDA 2RL5A 4TYHB 3QRUA 3OVVA 5CF8A 3B8QA 4C3FA 3RPVA 4ORKA 5GZ9A 1OZ1A 3L9PA 4KSPA 5K4IA 4FKOA 1W83A 4EQUA 2GMXA 4FKRA 4UYNA 3KREA 4XP0A 4E1ZA 2WKMA 3AC5A 4PRJA 3ACJA 3COKA 4NZWB 2PVFA 4KIOA 3C13A 1J3HA 2C4GA 4AWIA 2ITZA 5A6NA 2CKEA 4UWCA 4E6QA 4CKJA 2V5QA 3R9DA 2C6KA 2YLEA 4JJRA 5D41A 2W1ZA 3H30A 5GJFA 4DFLA 4RX9A 5IPJA 1OECA 3BYOA 3D14A 4FTUA 1MUOA 4F9AA 3I5NA 3Q9YA 2BUJA 2I6LA 4J52A 1GIHA 5DLSA 4FZDB 4HVDA 3IW7A 2OGVA 3BEAA 3UP2A 4F1TA 5M4FA 3VBTA 2F2CB 5E4HA 3KEXA 2E9PA 3ZYAA 1OGYA 5EI6A 4ZMEA 3RWQA 4RZVA 4HZSA 2C6EA 4UALA 4BZOA 4M84A 2GHGA 4MD8E 2OW3A 4QTCA 4C4IA 3VIDA 5BNJA 2UZTA 4FSZA 4J53A 1KWPA 2QVSE 4QO9A 5A4CA 2ITWA 4BCHA 2OF4A 1FBNA 3ORIA 2Z60A 2ZAZA 3ROYA 1UNLA 4F6WA 2ITNA 4K8AA 4AW1A 5BVFA 2JD5A 3AOXA 3V5TA 3AKKA 5CU2A 4FKPA 2QOFA 5GHVA 2BZJA 4DFBA 1KE8A 1H08A 3VS3A 1JOWB 3H0ZA 3VBQA 2WEVA 3R2BA 4XEYA 5AV4A 3MFTA 3KXHA 4MYGA 2YZLA 2JBPA 3Q9XA 2HK5A 4CXAA 5HLWA 4CFUA 1Q99A 4IFCA 4DC2A 5EDPA 4GG5A 3MPMA 3PP0A 4HYIA 4YJSA 4NJDA 1K9AA 4RC3A 4FV9A 3F6XA 4IWPA 4QEBA 5JFVA 5ANEA 2UZOA 3NCZA 3NYNA 2XIXA 3DU8A 3OF0A 3OHTA 4WUAA 3TV4A 4ZTSA 4CD0A 3OBGA 2LAVA 3TZ7A 2XH5A 1ERKA 4LUDA 4D28A 1U5RA 4MXZA 2XF0A 4JOAA 4YU2A 2IVTA 5HI2A 2A0CX 3MGYA 4LL5A 4AGWA 4MK0A 4ZP5A 2QR8A 5BMSA 3FQHA 4IMYA 5DEWA 4B9DA 5J7BA 3S00A 1FGKA 3NNUA 4GYGA 3VBXA 5AP0A 5KE0A 5M56A 2JKMA 2UVXA 3BEGA 2PVMA 4AZWA 4UN0C 3UOKA 5EQPA 5E8YA 3Q32A 4EONA 2G2IA 3LJ1A 4EWHA 5AR5A 2VGPA 3QRJA 4IC7A 3AD5A 3F88A 4ACHA 4BCKA 4FTJA 5KHXA 1WBSA 3AKJA 3NMUF 2B9HA 1QMZA 3E64A 4XG7A 5HNGA 3DK7A 4EBWA 4NM0A 3CTHA 4GFOA 4E73A 1NXKA 2XEYA 5CLPA 4Y95A 4DT8A 1YWRA 2IJMA 2J7TA 3WE8A 5A4LA 2XUUA 4WKQA 5AUWA 3DJ6A 4GEOA 2EXCX 4OT5A 4F7SA 5KHWA 5HG9A 3E3PA 1O6YA 2JIIA 3NNXA 3D5VA 5CU4A 5I9VA 4TNBA 4ENYA 4FSYA 4CYJA 3FMEA 4W8DA 3V3VA 2UZBA 2IVUA 5HD4A 3GGFA 2R3OA 4LV5A 4BTKA 2BCJA 1ZXEA 3PXQA 4AW2A 4HCUA 1WBOA 4LYNA 1H07A 1Q4LA 2B52A 1P5EA 1GOLA 2WO6A 3ORNA 2W17A 3QTRA 1YHVA 4HPUE 3EQRA 4C2VA 5JGDA 4YTFA 1A48A 1H1SA 2BRBA 2W4KA 5AP4A 4JG8A 4AOIA 5EM8A 3TKUA 2PE1A 4RVKA 3VS4A 4AE9A 3LFFA 5CS6A 5EHLA 4FV1A 4CQEA 3UIMA 4LV8A 3QYZA 1FVVA 3FZPA 4YTCA 4RC2A 2XK8A 4FGRA 2X0PA 1NVSA 3QD4A 1XBCA 2NRYA 2R7BA 4ASZA 4C33A 3AMYA 4JL9A 2IVVA 3UG2A 5KUPA 5E1SA 2XNPA 3AD4A 3IKAA 2J90A 4FKGA 4BCJA 3LZBA 2OLCA 5AR7A 3SC1A 3LCSA 5JGBA 1KE7A 2X81A 3EHAA 3EQGA 2XA4A 4C59A 4I5MA 2W1EA 4DCEA 4U43A 1WBPA 3NFGB 3H3CA 3O71A 4FA2A 2YM6A 1QL6A 2FA2A 5BYLA 3D0EA 4GFGA 5C8KA 3ZUUA 1W98A 4LOPA 4IJ9A 4ANSA 4H39A 1V0OA 4G3EA 4PTGA 4D2TA 1R78A 4QQTA 4ZY5A 3E7VA 5AAFA 2AC3A 4BN1A 1YI4A 3LLTA 4OT6A 2Z8CA 3PPJA 5A54A 4O1PA 4GL9A 3G90X 3Q04A 1CKIA 1Q5KA 4IWOA 1FQ1B 4FEWA 4HGSA 5FGKA 4C4EA 4F6SA 5C26A 1PXPA 4O21A 1ZMVA 1V0PA 5TT7A 4BVUA 3C50A 2VO3A 4MEDA 3R8ZA 4C3RA 4XH6A 4APCA 5HX6A 2GQRA 3R04A 2VTMA 2I0VA 2EU9A 2UW7A 3NW5A 2HWPA 3IGOA 3PA5A 4G31A 2W1FA 3G9NA 3MI9A 4AG8A 3DAKA 5TOZA 5J7HA 5M57A 2X7OA 4BHZA 3NX8A 3TZMA 2W9FB 1BMKA 4CKIA 5KX8A 3QC9A 5CAOA 1ND4A 2VUWA 3ZSGA 3W2SA 3ALOA 4D1SA 4DA5A 5IQIA 2W4JA 3VBYA 3A2CA 3DS6A 3P0MA 5BUJA 4C4FA 2YA9A 3P7CA 1ZYJA 4KB8A 4AN9A 4TRLA 1FINA 2X7FA 3KN6A 3ZH8A 1F0QA 3MWUA 3UC4A 3CC6A 3CGFA 3VO3A 3A60A 2CJMA 5T6KA 2PSQA 4HVGA 4QMLA 3G0EA 4XG9A 4YMJA 3ODYX 5HGIA