2NRYA

Crystal structure of irak-4
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
295
structure length
286
Chain Sequence
RFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASTVMSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords interleukin-1 receptor-associated kinase 4
publication title Crystal structures of IRAK-4 kinase in complex with inhibitors: a serine/threonine kinase with tyrosine as a gatekeeper.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 286
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2nryA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2nryA01
2WTWA 5CS6A 4BZOA 2XJ1A 3Q9WA 4GUEA 4XRJA 4PNKA 3GU7A 5AV2A 4MD7E 2WTKC 3IGGA 4KINA 3F2AA 5AP0A 4CEGA 5LMKA 3EHAA 3V5PA 4ZAUA 2HELA 4C4JA 4DF3A 5E8WA 3D7TB 4FKOA 3JR1A 2WTKB 3LJ1A 5LVLA 1H07A 3VUGA 4UV0A 2Y4IC 5CU2A 4FMQA 4KAOA 2Q0NA 3OP5A 4ITJA 2XNGA 4O83A 3GQLA 2Y4PA 5JK3A 5DR6A 5J5SA 3AMBA 1ZY5A 3D9VA 4FZ6A 4I3ZA 1NVQA 1PYEA 3UP2A 4Y8DA 3LCKA 4PL5A 2C68A 4A06A 3L9NA 3K54A 2Y4IB 4BGHA 2DQ7X 1ZMVA 3MJ2A 2EB2A 2QU6A 2W1GA 4MXXA 3VRYA 4HGTA 3HGKA 4BIBA 3EWHA 3SRVA 3UG1A 2UW4A 4QP6A 4FZAB 5ITAA 3U87A 3A7GA 3PDTA 3KRLA 3R22A 4I93A 3RK5A 4O0SA 4J97A 3LW0A 4RFZA 3RNIA 2B9HA 4O81A 4QP8A 2UW6A 3RK9A 3W18A 1Q8WA 5GZ9A 2OBJA 3HV4A 4GVJA 4BKYA 4D5HA 3ZXZA 3R8MA 4E5BA 2HXQA 5E8YA 2BUJA 4FV6A 2X4ZA 3HECA 4HCTA 2BHHA 4YTFA 3QQLA 4IVBA 3SAYA 3FL4A 4AFEA 3PPJA 4QP7A 2R3JA 2WPAA 3EFJA 4BY9E 5BMMA 5IA4A 4ALUA 4E6DA 1UU9A 5L6PA 4UBAA 2J2IB 4IZAA 5J95A 3WIGA 5FP5A 1URWA 1G5SA 4R7IA 2DWBA 3BBWA 4JQ7A 1W98A 4OTRA 2OIQA 1YRPA 4LMNA 3VAPA 4F08A 5HLWA 3R8PA 1MRVA 4UMRA 4H05A 2CKEA 2VD5A 4XNEA 3UTOA 3E5AA 4JRVA 4XG6A 4XUFA 4HNIA 5IQFA 3R1SA 3BLRA 2R0IA 3DAKA 2YM6A 4O2PA 4V0GB 4AN9A 3MPAA 2UV2A 4QMQA 5BUJA 4USDA 5CVGA 4F6WA 4CQGA 5HE1A 4RX9A 3A62A 1R0PA 2GDOA 2QD9A 2R64A 3DPKA 2EWAA 3AXWA 4BTKA 2YACA 3WI6A 3GI3A 2OJJA 3SW7A 2PVYA 2KULA 2W1IA 3O23A 1SMHA 4QYGA 3RZBA 3KULB 3SGCA 2PVNA 4W4VA 2GTMA 2C6TA 1GIIA 1Q97A 4E1ZA 2J9MA 4XG2A 5DRDA 4G3GA 2QKRA 2F2UA 5L4QA 4QTAA 4E4XA 3R7YA 1WVYA 4MH7A 4RWIA 4QO9A 5B2MA 3FSFA 4IACA 4DEAA 3PVBA 4HYUA 4RSSA 1ZOEA 1P2AA 5DEWA 4FK3A 4W9XA 4Z7GA 3UODA 1YOMA 3QWJA 3D5WA 4LV8A 3OEFX 4CXAA 4HVSA 3MW1A 4DGOA 3EN4A 1OITA 2VZ6A 4ALVA 4GL9A 4Z7HA 4XX9A 2WQNA 2NPQA 4RFYA 3UBDA 4RJ4A 3REPA 2OK1A 5EQYA 5E8ZA 4EYMA 3PUPA 2W4OA 2X4FA 5EYDA 4UEUA 1PXJA 2HAKA 3KVXA 1J1CA 1OUYA 4JDKA 5HO6A 2QO7A 1G8AA 3LFQA 2WMUA 4EOSA 4MF1A 2ETMA 1YI6A 4I0RA 4RA4A 3C4EA 4P2KA 1WVWA 3UVQA 4UZDA 5M08A 2JDTA 4O0RA 1WBOA 3GNIB 3ACJA 3HDMA 1YI3A 5BUEA 4H1JA 3TJDA 4N6ZA 5B2KA 3TV4A 1IEPA 4GT5A 5L2SA 4EH9A 2NRYA 3Q60A 4JVGA 1I44A 4ZIMA 4D5KA 1OL2A 2C5OA 3DA6A 4PPAA 3G9LX 1PYXA 1ZWSA 3DNEA 3EYGA 3PRFA 4MYGA 4CTBA 2GQRA 4GKIA 2RIOA 3VF8A 1YHVA 2FH9A 2OXXA 4I5MA 5DOSA 3UJGA 4BBMA 3F5PA 2F4JA 2C6OA 2J7TA 5HX8A 1UWJA 3SD0A 4HGEA 4F0FA 5DPVA 4KKHA 1GJOA 2VU3A 3ODYX 4JG6A 2DYLA 2E9PA 2R3NA 2ITZA 5AR3A 3WE4A 2ERZE 4IC8A 4X3JA 2X81A 3SW4A 3WIKA 2HIWA 4NCTA 2XBJA 4MXOA 1MQ4A 2JC6A 4EZ3A 4DH1A 2VO6A 5M09A 3BV2A 2VUWA 5E8UA 4IZYA 3GC8A 2YDJA 3O8TA 3QALE 2ITVA 5IEYA 2CKQA 5KBRA 2W5AA 4FTQA 4FVQA 4QQCA 4I5PA 4FV8A 4A7CA 3ITZA 1JOWB 4CLIA 3CR0A 3HKOA 4L7SA 3LQ3A 3UE4A 3PP1A 3C13A 5A4EA 2GFCA 5M06A 4UWCA 2BALA 1ERKA 5HBHA 5HNIX 5CANA 3RWPA 4QPAA 3OY3A 3DKCA 4FL3A 4GIHA 3T3VA 3ZM4A 1JBPE 4R1YA 2UZTA 1XHAA 3IS5A 4FV3A 5EM7A 5CEPA 3EKNA 3MGYA 4I0SA 4QMXA 5L2WA 2PVKA 1H01A 1BL7A 1JPAA 2OIDA 2ITQA 2YZLA 2ZM1A 2PK9A 3MPTA 2W1FA 1PMNA 5E91A 4AE9A 4C4GA 4AGDA 5CVFA 3GOKA 3BU5A 3R00A 4MNEB 4P90A 4ZJIA 2BRBA 2PL0A 2V0DA 4RX5A 2ZV7A 3PE2A 3E93A 3GU8A 3CC6A 1QPCA 4D2PA 4ZP5A 2B9JA 2F49A 2G01A 1VEBA 4MWIA 3PYYA 3ULZA 4ACGA 5L8JA 5HX6A 2YJSA 3VUIA 4LOPA 2IW6A 2A4LA 2WQEA 5IH6A 5JH6A 2J5EA 5EFQA 2CLQA 4YGAA 1H00A 4DG0E 2V5QA 3IW6A 2PE1A 3DB8A 1IA8A 3PFQA 4RRVA 3RM6A 4EQMA 3LFNA 3LXKA 4G34A 3OEZA 5CVHA 5JGBA 1PRYA 3V5WA 4JQEA 2Z60A 3V3VA 4DT9A 1VZOA 3BV3A 3DBDA 2UZOA 3EQBA 3KY2A 3V8WA 4B4LA 1GZ8A 4I92A 2GSFA 5AR5A 3FQHA 4V0GA 3F3UA 5I5ZA 3QYWA 4O7VA 1YWRA 4YO6A 3DGKA 1OI9A 3RI1A 4TWOA 4MCVA 2X8DA 5GHVA 4XG7A 3ZU7A 1UVRA 1S9IA 3O71A 3QGWA 2W9FB 3COMA 4M69B 5KMKA 1U46A 1IA9A 5IF1A 3TCPA 5JRSA 3NPCA 2RFDA 4TKSA 2WTDA 4RX8A 2XRUA 3QCQA 4IAYA 2J50A 2XK7A 5CENA 4QQJA 3Q2JA 3LM5A 4QP9A 4B8LA 4FTCA 4RJ6A 4F09A 4C34A 4J96A 2VO7A 3D94A 4TW9A 3UOLA 5IMXA 4LRJA 3MS9A 4BDJA 5BMSA 3LCTA 4PL3A 4IFGA 2OH0E 3LVPA 3R28A 3R73A 4FV7A 4HYHA 4FKUA 5F94A 3DKGA 4O7WA 5DYJA 3QQJA 4XOYA 3N4TA 3R7EA 2R7IA 1MRYA 3WZJA 3DS6A 3V5LA 5K0XA 3NUUA 4L00A 5CT7A 4CMTA 2VWWA 3EKKA 4G3CA 4RZVA 3U6JA 3QLFA 5HICA 1SYKA 3DFAA 2XBAA 3LZBA 3FI3A 4RIOA 2UZBA 4NIFB 3FLWA 5KBQA 4D2SA 4J71A 2HW7A 2O0UA 4YJSA 4AX8A 3OW4A 1OKVA 4FTIA 1PXKA 3PJ2A 1WBTA 3A2CA 1BX6A 3OS3A 3E87A 5L6OA 4N57A 2UW7A 3QKLA 1OL5A 4MNFA 3MB7A 4XV1A 3VQUA 2WEIA 3Q4ZA 3U54A 1IASA 5J79A 4JT3A 5IQDA 4GYGA 2BHEA 4FKIA 4PDOA 4CNHA 4EOLA 5DVRA 3NNXA 4I4FA 4CKIA 5DT4A 1XH7A 2X2LA 2IZTA 3KL8A 3QTQA 4X3FA 3EL7A 4XV3A 1KE7A 5I9ZA 4CLJA 2F2CB 4QTEA 3SC1A 4TYEA 5FTGA 3E92A 4IX6A 3ALNA 3D2IA 4QP3A 3ALOA 5FBNC 1OBDA 2WMRA 3ELJA 4CRSA 1AD5A 2GHMA 1KOAA 2P4IA 2QR7A 4S31A 5A3XA 3ROYA 4BC6A 2PULA 3C5IA 3ZC5A 1FINA 2XK6A 1XWSA 3NNUA 2VTJA 3CIKA 3Q4TA 3WBLA 1YWNA 4DFZE 1NY3A 5A6NA 4UMQA 4B7TA 4G31A 3JUHA 4O7NA 3IECA 2WHBA 4M15A 5TKDA 3MY1A 5F95A 2Z8CA 3A61A 3ODZX 2IWIA 3TNWA 3FMEA 4D4YA 2JBOA 4PPBA 4USFA 5LVOA 5AP6A 1FVRA 2QOFA 3E64A 4AACA 2XEYA 3VS0A 5KMOA 4IB3A 4RIXA 4O7TA 1LEZA 4BGQA 5HVJA 3LOKA 3OD6X 3OXTA 4G5JA 5FXRA 1R39A 1BI8A 4Q2AA 4ZK5A 1XH4A 3TNIA 1Y6BA 3ZLSA 3C4FA 4KBCA 3EN7A 5BNJA 2WXVA 2WB8A 3F2RA 3ENHA 3DCVA 1WBWA 3QZGA 3F88A 3I60A 2WMTA 2XH5A 3VO3A 1WCCA 4EL9A 2QOQA 1SVEA 3K2LA 3UP7A 4UMUA 3CQEA 4XG8A 1JNKA 4E73A 1AQ1A 5CEOA 4YBJA 3LJ0A 1BKXA 4TXCA 3CGFA 4JDIA 3ORKA 2QOIA 4UALA 4DEEA 2JFMA 1XBBA 4PMMA 4DG2E 5IZFA 3L8VA 5IA1A 3KB7A 2R3IA 3DBCA 2P2IA 3RAKA 1PXOA 2Z7SA 4I20A 2C5VA 4O7LA 4IHPA 4HNFA 4O1PA 5CNNA 1VYZA 3VWAA 3EQPA 3KN5A 4FK6A 2O65A 3QD3A 4YU2A 1R0EA 3VF9A 5HE2A 4DGGA 4DFUA 3BGPA 4IWQA 1Q99A 4PTCA 4QMWA 4ACHA 4FIFA 4UWBA 1OZ1A 2PZ5A 4UMPA 3BLHA 2R3KA 5CNOA 3LM0A 3D5XA 1PMEA 4D2RA 1ZYJA 3OFMA 4JR3A 2XUUA 4YJRA 5CSVA 2GPHA 3MWUA 3KXGA 2A1AB 4MWHA 4FTOA 2PMLX 3GENA 4QMSA 4EH6A 3FI2A 4TWCA 2JKQA 1R3CA 5HE3A 3HP5A 1BLXA 2C47A 3C5UA 5AUXA 1OKZA 4L53A 4DFYA 5IDNA 4GEOA 4TN6A 4WSQA 4ZSAA 2Q83A 4ZSEA 3ATSA 4O21A 4JQ8A 4BBFA 3MA6A 4PX6A 1F3MC 2LAVA 5B0XA 3E8CA 1JWHA 5HVKA 2GNFA 3BI6A 5EHLA 4JBQA 4LUEA 3OCTA 4XG3A 5CWZA 4FEQA 1JKSA 3H4JA 3R01A 4K2RA 3R8VA 3DK3A 3R0TA 4U80A 4DTKA 5IQHA 5EW9A 4NK9A 2WO6A 3RZFA 4CFMA 1REJA 2CCHA 3UIMA 2VNWA 3I7CA 3W2CA 2WQBA 3PJ8A 4I21A 5AADA 1Y8GA 3FE3A 2VWUA 4D55A 3G2FA 2YCSA 3NAXA 3VBYA 3O51A 3MTLA 4QP2A 2WU7A 4QTDA 5LVMA 2WAJA 4OBOA 3RM7A 3WYYA 1IR3A 4R8QA 3QQHA 4NJ3A 4BCJA 3IOKA 4GYIA 4R1VA 5E1EA 5HTBA 2GNHA 4Y46A 3ZO3A 2XIXA 4AA5A 1YXVA 3LXPA 4IQ6A 3ZM9A 3TTIA 4YP8A 4GG7A 4FODA 4I1ZA 5AX3A 3TKUA 1YWVA 3RALA 3U8WA 5EI8A 4OAVB 4B0GA 2J0MB 4LUDA 2CJMA 3VS6A 5K5XA 3Q6WA 1CMKE 2Q0BA 2ZDUA 3OUNB 4WG4A 3SV0A 4YHJA 4RJ8A 4RIWB 3HA8A 3NIZA 4YBKA 2VWYA 4TPTA 4EK8A 4LV5A 2C1BA 4FTNA 4NM0A 1B39A 4L3JA 3T8OA 1LUFA 4EOJA 4E4MA 3LLTA 4QQ5A 3TN8A 5ANOA 3ZTXA 4R3CA 3KMUA 3MVJA 3PVUA 4E3CA 4E4NA 4U7ZA 4M0YA 3G6HA 2JGZA 2YIRA 3DQWA 4DBXA 2PHKA 2W1HA 3BYMA 5CT0A 1IAJA 4BDDA 4F4PA 3OMVA 1J1BA 4FA2A 3DAEA 4UXLA 5FM2A 3SXFA 3S00A 4MVFA 3R8UA 3ZUTA 1O6YA 1U54B 2PE2A 3EN5A 3R30A 3E63A 4GJ2A 5J9YA 4OGRA 4FYNA 4X2FA 4EQCA 4ZZOA 2WTVA 4ZXTA 4CD0A 3R7OA 3CD3A 3AMYA 4A9UA 4WOVA 4ZMEA 4LOOA 5K4IA 2JITA 2W1DA 3B8RA 2B4SB 4FTKA 3C0GA 1Q4LA 4AZSA 3VUKA 1G3NA 4XP2A 5M4FA 2XEZA 3RAIA 1JQHA 2UVXA 3FZSA 3L9PA 2JIUA 2JEDA 3QLGA 1X8BA 4FI1A 5AR2A 3TV7A 4HVIA 5A4LA 2NP8A 2PVFA 1ZMUA 4O7SA 3Q5ZA 5JFVA 4JG8A 3R9OA 4KKEA 4Z16A 3FPMA 3ZO4A 4O7RA 3BELA 1OL7A 4DEIA 4ENXA 4E7WA 5DMZA 4O82A 4EUTA 3NLBA 3QRUA 3G90X 3QA0A 4F9CA 5I9XA 4C61A 5KE0A 4DT8A 2CKPA 2J51A 3WF8A 1UNGA 2VWBA 4BI2A 3N4VA 4FIHA 1H1RA 3W16A 3II5A 3C4WA 4GT3A 4OBPA 5CSXA 5D7AA 3NW7A 3VNTA 5EM5A 5AM7A 3NEWA 4QYEA 5FEEA 5HKMA 3NX8A 4JX7A 2OFVA 3SOCA 4C4FA 2AYPA 5FEDA 2YCFA 4Y5HA 5L3AA 3UMXA 2ZMDA 2RKUA 5KCVA 4FUXA 4RMZA 3TZ7A 3VRZA 2C3IB 2UW0A 2CNUA 4AT4A 3KREA 2EXCX 4XH6A 3MA3A 2FSMX 2BZIB 3FMMA 4RIYA 1QPDA 1ZOGA 1PMUA 4W9WA 3KRXA 4YTIA 4E20A 1FQ1B 5FDPA 3PZHA 3AD4A 2VTPA 4G16A 5C01A 3UOJA 3FI4A 4DG3E 1JSUA 5CEQA 3HNGA 4YSJA 3BBTB 4ANSA 1OIUA 4WHZA 3V04A 4DYMA 1DI9A 4ZTQA 1XH9A 5HCZA 2QOLA 2XS0A 4FZDB 3ORLA 4A9SA 2XCHA 3DBQA 4BCQA 4IJ9A 2JLDA 3WZKA 4EBVA 4U6RA 4W8EA 5LVPA 4CV9A 5A14A 5DNRA 2OICA 2QU5A 2C5NA 3ZSHA 4TT7A 1HOWA 4QYYA 5F4NA 3HUBA 3V8TA 5HLNA 2YITA 1KV2A 1OUKA 2W1EA 3D2KA 4IANA 3R9RA 1XBCA 3BCEA 4FZ7A 4J7BA 4FGRA 1SNXA 4FV9A 5DRBA 4XHKB 4EJ7A 1Y91A 1P5EA 4OT5A 5AX9A 2PUUA 4F9YA 4FVRA 4GCJA 3QTIA 4TWNA 2QLUA 2Z7LA 3FKLA 1H24A 2WTJA 4F70A 4CFWA 4DTAA 4ACCA 2E9VA 3Q52A 5D1JA 4IAKA 4TYHB 3UVPA 4GIIA 4XLIA 4MBIA 2PMIA 4EC8A 4TY1A 3MI9A 2UUEA 3I5NA 2BZHB 3LFAA 4ASZA 4UX9A 4ASEA 3VJNA 2IZRA 3WZEA 1ZRZA 4PF4A 1YI4A 3HLLA 1CKJA 4QT1A 1SM2A 2C30A 4KUJA 2BAQA 3R63A 4AWIA 3HYHA 5E92A 4FKVA 3ORNA 4ANQA 3SVVA 4IM0A 1Q8UA 3TI1A 2EVAA 4Y95A 3WF9A 2C6IA 2BRNA 3QD4A 1U5QA 1W84A 1V0PA 3BKBA 3WF7A 1NA7A 4NUSA 4KIQA 4TYIA 3R21A 1ZXEA 3QTXA 4LYNA 1V1KA 3SHEA 4HVHA 4FSQA 2VWXA 1K9AA 3F3ZA 3OTVA 5IQAA 4XP0A 4WT6A 3S0OA 1W0XC 3C4CA 5DG5A 3D0EA 3RNYA 2WQOA 4FZFB 4FT9A 5AEPA 3CY2A 5FGKA 5E9EA 3W1FA 2C0OA 4N70A 1OVEA 4AT5A 1Q3DA 2VO0A 3OTUA 4FX3A 3RHKA 1ZZLA 3Q9ZA 4OUCA 5IUIA 1M2QA 4GS6A 5ETIA 3L8PA 3ET7A 2ZAZA 1PJKA 3AC4A 4CQEA 3QUPA 2OJIA 3RBWA 2QHMA 1WBPA 2VTQA 4YC8A 4OTQA 4WBOA 1PXMA 3IGOA 2FVDA 3CD8A 3C0HA 3LXLA 2RFNA 3U55A 3BQRA 3FY0A 3MH1A 3AOXA 4PRJA 3AG9A 2GHLA 4L6QA 5GNKA 2BDJA 3QCYA 4W4XA 5KMIA 5KUPA 2OLCA 1ZY4A 4F9AA 3AC1A 3RPOA 4IWOA 3OROA 4H3BA 4FEVA 4FNWA 5C27A 1WMKA 2VTMA 3MY5A 5HE0A 4BCGA 5CEMA 5H9BA 3CQUA 3L9LA 4BL1A 4O6LA 4RJ5A 2IJMA 4F6SA 3UO6A 4W4YA 4BCFA 1OMWA 3ORPA 4TNBA 4B6LA 2JDRA 1DI8A 4I0TA 4RBLA 3R9NA 3P7BA 3U9CA 2X8IA 3PE1A 4CMOA 4WRSA 4PMTA 4V04A 3FZRA 3O2MA 5BVDA 4FKSA 4AGUA 2YJRA 5EYKA 5EG3A 5CSPA 3UO4A 3LAUA 3ZO2A 2JKMA 5CF8A 5IMEA 2Z7RA 1GAGA 5EHYA 4FICA 2QC6A 3COKA 4RQVA 5BVKA 4AGWA 5HBJA 3FL5A 4G5PA 3BYUA 1YVJA 3CSVA 3HDNA 4YZMA 5BPYA 4WG5A 3B8QA 5C26A 4G6LA 2YISA 4YTCA 4QMOA 2YN8A 5B2LA 5L2TA 4M8TA 5LARA 5LWNA 2CSNA 1M14A 2OFUA 3D15A 3HX4A 4C2VA 5DEYA 3I1AA 4PDPA 5BQ0A 4ARKA 3TJCA 5DGZA 3H9OA 3CTHA 4L8MA 4I6HA 4FTJA 4RVLA 1OB3A 1YKRA 3QUEA 3QCXA 4LRMA 3HZTA 3CGOA 3KXMA 4FG7A 1CKIA 4U44A 3W32A 3ZBXA 4D0XA 2HY81 4YHTA 2NRUA 2YHVA 2HWPA 3BGQA 2BKKA 4KKGA 1HCLA 3LJ2A 2W0JA 3NUNA 4ACDA 4FTUA 4IZ5A 3CKXA 3HMOA 3KXZA 3PJCA 4I5HA 4U97A 1P4OA 4BB4A 2YFXA 3QTSA 4QPMA 4O84A 1WAKA 4YJNA 4IXPA 4YJPA 4C37A 5CAQA 3HV7A 1KSWA 4H1MA 4J95A 5HG8A 4QMYA 3TKIA 4O0XA 3NUPA 2WZJA 5DR9A 1IG1A 4IMYA 4YJVA 2XZSA 3E7OA 5ICPA 2PUNA 1UU3A 2W99B 2J0KA 4AG8A 4M7IA 3QX2A 4IVCA 3PG3A 5ANJA 3N4UA 3UPXA 1YQJA 1ZYDA 2AC5A 2H8HA 3VS1A 1UKHA 2PZYA 3W2OA 2RSVA 5IKWA 3ERKA 1H8FA 4AZTA 4ZZNA 1PY5A 4PP9A 3GFEA 3LHJA 3VIDA 3W2QA 4N0SA 3B2TA 5CZHA 4C33A 2ITXA 4U3ZA 3RMFA 4ASXA 3F66A 5AR7A 5HBEA 3D5UA 4H36A 3VW6A 3MIAA 3ZRLA 4C35A 1IRKA 1UKIA 1WVXA 5AR4A 4D58A 5IQCA 3Q2MA 4NL0A 3UC3A 4C0TA 3OCGA 4Q9SA 4D9TA 2XKDA 5DBXA 5AP7A 1H1SA 4PWNA 3QZIA 4LQMA 5T6KA 3EZRA 3BHUA 3U4WA 3FAAA 5AUWA 5C4KA 2XK9A 4EWQA 3ZEWA 2R3FA 4EHGA 5FEQA 3ANRA 4CFXA 2BRGA 2O2UA 3SX9A 4X2NA 1TQMA 3PVGA 4IC7A 3AGMA 3IDCA 4GK2A 4I23A 1NVSA 2BZJA 4MD9E 3FSKA 1PKDA 5AP1A 5FG8A 3VUMA 5EDRA 2UW8A 2YM8A 4U41A 3ATTA 1W82A 3DQXA 4F99A 4NFMA 4NKSA 4J52A 2GNIA 4D4SA 4YUQA 4FSTA 2BAJA 4FOBA 4IVDA 3KCKA 3JXWA 3GUBA 1NVRA 2YIQA 5HNGA 2IW8A 4YR8A 4EOQA 2G2HA 2CNQA 2J6MA 2Y6MA 3WYXA 2Y6OA 4CFVA 3D7TA 3F5GA 3FKOA 5TF9A 3TNHA 3DDQA 2YWPA 2B53A 2XM8A 2A0CX 3EB0A 3F69A 3LFCA 3NW6A 4M68A 5CI6A 2FA2A 4IW0A 3ORXA 2W06A 4TNDA 5FRIA 5JEBA 3IW8A 4BDKA 4EORA 2XA4A 3CS9A 4RC2A 3UIBA 4RX7A 3P1AA 2WIPA 4BI0A 2R5TA 4L52A 4ZMFA 4IB1A 4KRDA 3LQ5A 2WMSA 2VX1A 3AT3A 3TZ9A 1XKKA 5FTQA 3U9NA 3O17A 3PSDA 4AFJA 4IB0A 3QX4A 5D7VA 1Z57A 2BFYA 4EJNA 5CQUA 1ZOHA 2RFSA 4DHFA 1XO2B 3PIZA 4WBBB 4BGGA 4O86A 5C8NA 2YDIA 4O22A 2WFYA 4G2FA 1YDTE 3GFWA 2OG8A 4KD1A 4USEA 5GINE 4HCVA 4ZSLA 3H0YA 4U3YA 4K1BA 4AOIA 1H1PA 5EQEA 3A7HA 3A8XA 3GT8A 3PJ1A 3QQUA 4AAAA 3BHVA 3JVSA 4OTIA 2JBPA 5K4JA 3DK6A 3HRCA 3NR9A 5M4IA 1Z5MA 3H9RA 5HTIA 5IEVA 2QONA 3M1SA 4L46A 2UZNA 4DEDA 3MH0A 4AN2A 3QU0A 4YNOA 4GG5A 4C4EA 2B55A 4XBRA 1CSNA 3K3IA 2QO9A 3L8SA 4X21A 4YTHA 4FR4A 3SOAA 2SRCA 5D10A 3UQGA 3LFFA 3E3PA 3E8NA 3LIJA 4P5ZA 2XK8A 5CQWA 5EI6A 4UWYA 4FSNA 4NJDA 2XNPA 3KKVA 3O8PA 4PDSA 4QMVA 3SQQA 4I4EA 4E6AA 1OBGA 4H3QA 4FGBA 5TOZA 4MBJA 4F0GA 3LLAA 2P2HA 1H08A 4QRCA 2YM7A 5IU2A 5LCJA 5KX8A 5HD4A 3C4XA 2XNEA 4IB5A 3BHTA 1E1XA 3KN6A 3KRRA 4HOKA 3ZFMA 3P7AA 4FKLA 5J7HA 4TZRA 4ENYA 3OT3A 4K6ZA 5AMNA 4FTAA 2X6EA 4QMTA 3ZBFA 2C3LA 2J90A 3QHRA 2CHLA 4M3QA 3FMKA 2IW9A 3TDWA 2C0TA 3KULA 2VN9A 4U43A 2JDSA 4K11A 3Q4CA 5J5TA 2GHGA 3ZSIA 4AA0A 3R1QA 3ORZA 3LFSA 3MIYA 3Q96A 3EIDA 2RFEA 4OTFA 2WEVA 4DAWA 4LRKA 1FOTA 2WMQA 5AJQA 4DFLA 2R2PA 4L7FA 3SXRA 4IAZA 5FM3A 3VS5A 4O96A 1H26A 5LXMA 4TWPA 4LG4A 4FNYA 4RC3A 3ZUVA 4JXFA 1NW1A 1IAHA 3OWPA 2XYNA 1PHKA 1Y6AA 1AGWA 4KS7A 4X2GA 4ZTMA 3A99A 2WOTA 3VBQA 5HG7A 4XCUA 5T3QA 2ZB0A 3EFLA 5E1SA 3KMMA 3F3TA 5HG5A 2V7AA 2PTKA 3OWLA 3FZPA 5IG1A 5CEKA 4FV2A 2IVSA 3G51A 3NRMA 4G6OA 4BWKA 3AC5A 2FO0A 3QTRA 4FIEA 2PUPA 5TO8A 3MH2A 4F1OA 4CT1A 3NGAA 3ZYAA 5CAUA 3R02A 4L42A 3ZS5A 3WF5A 4HGLA 2Z2WA 4FKRA 2WELA 4I41A 3WZUA 4MXCA 3IDBA 4HJOA 4Q5HA 4YSMA 5CALA 4LL0A 3NMUF 1U59A 2CKOA 1REKA 4D9UA 2C5XA 5GJFA 2PMOX 4TYJA 5E7RA 2QNJA 2RG6A 3MB6A 3N51A 3W8QA 3BZ3A 1KE6A 4U81A 4V05A 5AUVA 3KA0A 2W7XA 3NDMA 1VR2A 2GU8A 4EOOA 3F82A 4NW5A 2B52A 3FMJA 4C8BA 2ZOQA 4PNIA 2CDZA 2Y9QA 3TG1A 2IPXA 2O63A 4IH8A 4O7ZA 5HTCA 2OH4A 3AT4A 4DN5A 4C02A 4ZJJA 5F20A 2BVAA 4CCUA 1KUTA 3VUDA 4BRXA 3CJFA 1OECA 2JAVA 3DT1A 4YHFA 3ETAA 4WUAA 1H1WA 3UOHA 1JKKA 3WF6A 5M44A 2G2FA 4FV4A 1NXKA 3KFAA 4XMOA 2AC3A 4GSBA 2IVTA 5CYIA 3A4OX 5JT2A 2ETRA 2V22A 2UZLA 4M0ZA 2ZDTA 5T68A 1DM2A 3PSCA 4IE9A 4RWKA 5C8MA 3FXZA 5HQ0A 2EUFB 2V55A 2W9ZB 4DH7A 3R9DA 1UU8A 4EK5A 3UOKA 4PQNA 5CLPA 2PVJA 2PY3A 2YIWA 5CTPA 3TIZA 3ZONA 3HL7A 3DAJA 3C7QA 1JKLA 2OIBA 1RW8A 1HCKA 2BCJA 2UZVA 2XNNA 4HYIA 3GEQA 4AOJA 3BPRA 5ACKA 4OAUC 4DLIA 4EOMA 3JPVA 3NNVA 1LEWA 1UNHA 2HCKA 2HZIA 4CFFA 4R3PA 2VWVA 1M17A 2VRXA 1GZNA 1VYWA 2QHNA 1FVVA 3L8XA 4FSZA 5M4CA 3MFUA 3CJGA 3UDBA 3TL8A 5CF4A 4MNEA 2UZWE 5CSHA 5JQ8A 3E7VA 4JRNA 4ZOGA 4M12A 4A9RA 5ACBC 3FXXA 2VAGA 2VNYA 3W8LA 5EQPA 1OL6A 3TNQB 4RG0A 1PW2A 3VQHA 1OIYA 4KABA 3PA5A 1PXPA 2VTRA 3MV5A 3KF4A 5JRQA 3ANQA 4YZCA 2ITOA 4MKCA 4BDBA 1J7LA 5D41A 1B6CB 4C57A 3EQDA 3HMMA 4BYJA 2VO3A 4J8MA 3QFVA 3AT2A 3GU6A 4HPUE 5KZ0A 1RDQE 3DBFA 5FDXA 4FKPA 3BYSA 4QOXA 3EFWA 3QTWA 5KMNA 1T45A 2W4JA 4MXZA 3BIZA 2IZUA 3WZDA 4NZWB 2ZM3A 3ZUUA 2IVUA 3F9NA 2QOCA 4BYIA 4ERKA 4P5QA 4KWPA 3F2NA 4NWMA 5CF5A 4CVAA 2CGVA 2J4ZA 4WUNA 5J9LA 3PXRA 3OG7A 5E8TA 1LPUA 2BRHA 1O6KA 2HW6A 2OF4A 3AMAA 3PWYA 4BDEA 4CV8A 5I3OA 1U5RA 4PMPA 5LOHA 2P0CA 4BDAA 4C4IA 4O7YA 4OTGA 2VX3A 4C3RA 1Q8YA 5IQGA 5CU0A 4C36A 2C6MA 3DTWA 3R04A 2OW3A 2WMWA 3HAMA 3B2WA 4D2TA 3SKCA 5H8GA 4ANMA 2VTNA 4QMUA 1PMVA 3BE2A 1WZYA 4GU6A 4IZ7A 4M69A 2O5KA 4UYAA 4RT7A 3TV6A 5EDPA 3C0IA 2ACXA 2R3QA 3R7VA 1QPEA 3I4BA 5GJDA 2I1MA 4JBPA 3S3IA 4JNWA 2XIZA 3NYNA 4FL1A 5BVEA 2UZUE 3VS7A 4BZDA 2OZAB 3N9XA 1PKGA 3VS3A 3BRBA 5HGIA 4EZ7A 3OF0A 4FL2A 3OCSA 5AV4A 3QC4A 4GU9A 4O0YA 1KE5A 2PVMA 4EH3A 3KXNA 4DGLC 4JX3A 4J8NA 3UVRA 2XNOA 1BYGA 5AUYA 2CMWA 4RWLA 5ETCA 4ZS0A 4ZTNA 4LGHA 3W2SA 2C5YA 2ZB1A 1CM8A 4UN0C 1Q24A 4MTAA 4E6CA 4HVDA 5BVOA 1ND4A 2PZRA 3HMPA 5LCKA 1U4DA 2DS1A 4I94A 4P4CA 3PXKA 3HUCA 4U40A 2W5BA 3JVRA 4JDJA 4IJPA 5KZIA 2C4GA 4YLJA 1ZYCA 4X2KA 4NIFA 2ETKA 4O1OA 1PXNA 2V7OA 2XM9A 3G0EA 5CEIA 4ACMA 3OHTA 4FV1A 3DNDA 5DT0A 4FF8A 5M55A 5M51A 2JFLA 3K5UA 4IX4A 2BTRA 4EWHA 3EQRA 3UIUA 2XIRA 2OJ9A 3G0FA 1L8TA 4NKAA 4G3FA 3A7FA 1F5QA 4FTLA 2ESMA 3PXFA 5DA3A 1F0QA 5DHJA 3GC9A 1GZOA 4YJOA 2P33A 2UW5A 3R8LA 1K2PA 4WNOA 3FYKX 4M97A 3QRIA 4UMTA 4DH8A 5A6OA 4YJQA 3MJ1A 3FLYA 2XIYA 2PE0A 4FKJA 3GCUA 1OPKA 3IK3A 4K77A 4RVKA 1Y8YA 3ZRKA 1SNUA 4GVAA 5IUHA 2XP2A 4L9IA 5IH5A 3TKHA 3O8UA 2PZPA 3CEKA 5L8LA 2YCQA 2EU9A 4RZWA 4IVAA 5LMKC 4CKRA 2WKMA 3PA4A 3D7ZA 4U5JA 4PDYA 4M67A 4AU8A 4CG9A 2FYSA 3ACKA 2B9FA 3MY0A 3SLSA 4A4XA 2GS7A 4EK3A 2A2AA 3T3UA 2R3MA 1XH5A 3NCGA 1W8CA 3OCBA 3DLSA 4EQUA 2VTTA 4CYJA 4GFGA 2J0LA 2OSCA 3BQCA 1K3AA 4A4LA 1M7QA 1YDRE 2X8EA 2OKRA 3RCDA 2WIHA 1M52A 3Q4UA 3ORIA 3FXWA 2YA9A 2LGCA 3R2BA 3PY0A 2IN6A 4EI4A 3NUAA 5BYYA 3OUKA 4GK3A 3TTJA 3VBWA 3A4PA 4IWDA 2X2MA 4YZBA 3RGFA 4GV1A 3QZHA 2HZ4A 3ZZEA 4O0UA 1M2RA 1STCE 4EH5A 1GIJA 2O3PA 3D14A 5CI7A 4CT2A 2WNTA 3P5KA 3AQVA 3WILA 4K18A 4L68A 3RPYA 3FYJX 2QODA 3V51A 2F7XE 4BBEA 1PF8A 3SRVB 3QA8A 3PA3A 4PY1A 4QMZA 4A07A 5L2QA 5HU3A 1B38A 2B54A 4H3PA 4HZSA 3R7GA 2YM5A 3QZFA 4JLCA 4KRCA 3OXIA 4O6EA 3VBVA 3COHA 4L43A 4MBLA 2YERA 4E8AA 4JDHA 5IPJA 4F7JA 3ZDUA 1Q8TA 4NU1A 2VWZA 4FKQA 3RAWA 4BDFA 3NUXA 1RQQA 5HVYA 4BWXA 3FZ1A 2BKZA 5I3RA 4L01A 4FV5A 3KEXA 4TTHB 4JAJA 5HIEA 3VJOA 4QMLA 3V01A 4AW0A 3VS4A 3IQ7A 5IA5A 1UU7A 3K5VA 3CQWA 3PSBA 5FD2A 3TACA 4FSWA 3UNZA 3TUDA 4AZEA 4CRLA 3Q5IA 2EXEA 4IWPA 4X6QC 3IONA 1YXSA 3GGFA 4BFMA 5K3YA 3A8WA 5BVNA 5AP3A 2ITNA 4JR7A 3S95A 4BCHA 2OU7A 3ULIA 5EOBA 3AC3A 4G3EA 5I9WA 3E8EA 3O96A 3QBNA 3QUDA 4MHAA 5J87A 2PVHA 3V5JA 5TR6A 4F63A 1WBNA 3E3BX 4E6QA 4YC3A 3DKOA 3PPZA 1OPLA 3TM0A 3QTUA 4GKHA 3FWQA 4ZTSA 3ID6C 2WMVA 4EOKA 1G8SA 1WBVA 3QKKA 2IO6A 3BX5A 3IG7A 4WRGA 4C2WA 3KK9A 4CMUA 5JN2A 5J7BA 4YJUA 1H25A 3OVVA 3EQFA 5A4QA 2HENA 3NAYA 4AZFA 1BMKA 3GCSA 5DR2A 2WTCA 1KV1A 4K0YA 4ZLYA 4Q9ZA 1J7IA 3NYOA 3MFSA 3P0MA 1MP8A 5DN3A 4DFXE 2W96B 2WU6A 3PIYA 2CN5A 1L3RE 3DV3A 3V5TA 4RFMA 4FSUA 3IOPA 4ZLOA 2B0QA 3BYOA 5DE2A 5IDPA 5KHXA 3QRTA 1KE8A 4XOZA 4YJTA 2X7OA 4X7QA 5F1ZA 4BDHA 4D28A 4D2VA 3JS2A 1E9HA 5JZJA 2XIKA 3BE9A 5BUIA 2I0HA 2BR1A 3KC3A 4OT6A 2I40A 1YHSA 3MDYA 3EQHA 2ZV8A 4E5AX 2NO3A 4RJ3A 4M84A 2VGPA 4RIWA 5ANGA 3DJ7A 5AA8A 2QQ7A 5BYLA 1YXTA 5EYMA 2H96A 1S9JA 4TRLA 2G9XA 3OOGA 4UYNA 2QOBA 3LFBA 4D4RA 4DGNA 4Y85A 5BVWA 1V0OA 3O7LB 4JBVA 3FMHA 1EH4A 4HCUA 4CZTA 4DC2A 5HU9A 3NUSA 3G5DA 2UVYA 3AC8A 2FUMA 4D2WA 3BGZA 2HXLA 2IVVA 3BU3A 4MX9A 3Q9XA 4EK4A 3MTFA 4A9YA 4F9WA 5AAEA 1CKPA 3ZH8A 3ZMMA 4YZDA 4ZJVA 4NCTC 5C4LA 5IH4A 4CGAA 3IW4A 3CTJA 4O2ZA 2GTNA 4LI5A 4X6RA 4CFUA 4D4VA 1OM1A 1U54A 2B9IA 3RPSA 2BPMA 3UQFA 2ITUA 3IPHA 4U79A 4U8ZA 3FC1X 2ITWA 3AGLA 3IW7A 3ORMA 3M2WA 4L45A 4ITHA 4LFIA 4OW8A 4XV9A 3V8SA 1E1VA 3VBTA 4ASDA 2YM4A 4DH3A 4Z3VA 2G1TA 4ANNA 4FKWA 2FSOX 3I81A 2VTLA 2X0GA 4BDIA 3Q6UA 3VUHA 4C3FA 3W2PA 4X0MA 4DLJA 3FLZA 5CXZA 5JFWA 3PLSA 2JDVA 3G6GA 3QD2B 4FSRA 4O0VA 2PSQA 3SDJA 5EK7A 2YM3A 4A4OA 5LWMA 3CPCA 4EBWA 4HVGA 1UNLA 3C50A 3I6UA 4O91A 4JI9A 5EH0A 3FY2A 2WD1A 5JGAA 5AP2A 2IZSA 3BHYA 4Y73A 2Z02A 1YXUA 1W7HA 2OXDA 3OWJA 4IAAA 4F0IA 3UNKA 4IAIA 1H1QA 4JL9A 4MXYA 4E26A 4JBOA 3MBLA 2GQSA 5AUUA 4J1RA 4ZY6A 2QOKA 3GBZA 3NVMB 4R77A 3PZEA 3RKBA 4ZY4A 3UC4A 3DJ6A 3QQFA 4QPSA 4AZVA 1FMOE 3MN3A 2ZV2A 2ZYBA 1UA2A 2W17A 3FJQE 3C51A 4XBUA 5EYCA 4I6QA 3EN9A 2PWLA 3FZOA 5AV0A 4WNMA 2YAKA 3VC4A 5AA9A 3FC2A 2VTIA 3LMHA 4ZTLA 4WNPA 1BUHA 3FHRA 3TIYA 2G2IA 3DJ5A 3GCQA 3KK8A 4DH5A 2I6LA 3CTQA 5DIAA 3V6RA 3C9WA 4K8AA 5K5NA 4M66A 2XCKA 3DDPA 1Q41A 3PY3A 3MYGA 5TE0A 3NCZA 1RJBA 3DLZA 4GT4A 2A19B 4EHVA 1JLUE 1ZYLA 3HP2A 4KBKA 5FTOA 2IG7A 3NVKI 1O9UA 1Z9XA 4DBNA 5FXSA 3DOGA 1GY3A 4FSMA 5HLPA 5HOAA 5L8KA 2P55A 5JQ5A 4G3DA 3ENMA 4R5SA 1GIHA 2BDFA 4BCMA 1R1WA 3R6XA 1T46A 3HEGA 3P9JA 4PPCA 5FLFA 3GQIA 1YW2A 3DKFA 2RL5A 5EOLA 3LCOA 2BMCA 3I0QA 1MUOA 5B7VA 2RG5A 4JIKA 1XQZA 5JKGA 3JY0A 2BFXA 3NSZA 3FPQA 2QI8A 1TVOA 3NWWA 5IA3A 3ZC6A 3CLYA 3F61A 4MEDA 1H27A 3OC1A 4BKJA 4PTEA 3FLNC 3LXNA 2GMXA 3I0OA 5EI2A 4D1ZA 4QQTA 2EB3A 4G9RA 4TYHA 4FKTA 4B8MA 3IDPA 4YPDA 5CAVA 1DAYA 4IEBA 4UZHA 4AP7A 4DEHA 5HNBA 4F7SA 4G9CA 2YEXA 3PTGA 4XYFA 1GZKA 2ONLC 4U45A 4FEUA 1JSVA 4XJ0A 2VTHA 4JOAA 4DINA 5HHWA 3FKNA 3U4UA 3D4QA 4W4WA 3DB6A 5EM8A 5E4HA 2X2KA 4X2JA 4ZEGA 4ALWA 5G6VA 5AIRA 3SXSA 4U42A 2BDWA 3QD0A 4KIOA 1TKIA 5A54A 4X3FC 3DZQA 5BYZA 3DBEA 3QRKA 2XK3A 1KE9A 4B9DA 4DGMA 2BAKA 4YLLA 4DA5A 1R78A 5ANKA 2GQGA 2RGPA 2YIYA 3P23A 2RF9A 1QPJA 3VS2A 3RP9A 1JKTA 4XG9A 5AIKA 2W05A 3P08A 4O0WA 4YLKA 4X3FB 3PPKA 5IISA 4EYJA 3QC9A 5K9IA 3ORTA 4JG7A 2G15A 4B99A 5DLSA 3WOWA 3HVCA 3OBGA 3VUTA 4NM3A 3KQ7A 1SVGA 2C6DA 4L3PA 4LOQA 4MQ1A 4QP4A 4D0WA 3UZTA 2W4KA 1SVHA 3HV3A 4AW1A 4BN1A 2YWVA 4CYIA 3FHIA 3QF9A 2H34A 3QRJA 4ANOA 1I09A 5ANIA 4NEUA 4KSPA 4I6BA 5AWMA 3NYVA 3OT8A 3UYTA 3E62A 4JS8A 3F3WA 2YCRA 3OY1A 3C4ZA 3RWQA 3QCSA 4BHNA 2CNVA 4PL4A 1YHWA 4FIGA 3T9IA 3V5QA 4S2ZA 4RIXB 1KOBA 3F5UA 3GXLA 4U9AA 5FP6A 3TZMA 4BWPA 4C4HA 4EKLA 3DY7A 5IA0A 1WBSA 4HYSA 5E8SA 4AXAA 3Q04A 3TEIA 2XKEA 3O50A 3P4KA 4APCA 3I7BA 2OZOA 2UW9A 2X1NA 3OZ6A 4ONAA 5TT7A 3RJCA 2WQMA 4LGDA 3QXPA 4Q5EA 5IA2A 2PU8A 3RINA 3QQGA 4BCNA 5IUGA 4RVTA 2GNJA 2BIYA 2X9FA 3EN6A 4NM7A 2YDKA 4WSYA 5AV3A 3SA0A 4PTGA 3A7IA 4II5A 5ETFA 4BCKA 3TXOA 4KSQA 2W5HA 4WKQA 4FV0A 3Q9YA 3UZPA 4S33A 2O8YA 2OF2A 2BRMA 3MESA 3CXWA 4F1TA 4HZRA 3ZCLA 4JAIA 4KBAA 4NFNA 2R3OA 2O64A 3GU5A 3R1YA 4CG8A 3FLQA 4W8DA 3VN9A 4ZLZA 3G33A 4AOTA 4MF0A 2PUIA 4MD8E 1OIRA 3S4QA 3D83A 1XH8A 3U51A 4JIAA 3UQCA 4BCIA 5AP4A 1ATPE 3RCJA 4F9BA 1QCFA 1YOLA 3QYZA 4AE6A 4BZNA 1H0VA 1UV5A 3PWDA 3FEGA 1O6LA 3A7JA 3GC7A 3ZEPA 3BEGA 2UZDA 2I0YA 3VHKA 1FGIA 1J3HA 1YXXA 2C69A 2GFSA 3R1NA 4BHZA 3DXNA 4F1MA 5I4NA 2NNWB 2YZAA 3DXPA 2QOOA 2WMAA 5DWRA 4KA3A 4R7HA 3P7CA 3S1HA 4CTCA 4QTBA 1QMZA 4S34A 3ZDIA 2XNMA 3PY1A 3RPRA 4K33A 3WE8A 2WTIA 5EKOA 1M2PA 2C6KA 2XMYA 3LMIA 2ZV9A 4YZNA 3DXQA 4FTMA 5I9UA 4PP7A 4IM3A 4OLIA 4XG4A 3ZLWA 4KS8A 5E8VA 5JFXA 3GOPA 3NIEA 4GFMA 3G9NA 3VW8A 2R3RA 5M57A 3QGYA 3CPBA 2CGWA 5K0KA 4C38A 5CAOA 5CF6A 4FOCA 3DTCA 2PVLA 1XH6A 1MQBA 4OTHA 3LE6A 1BI7A 2PPQA 4Y72A 4APPA 3KF7A 2XF0A 5AV1A 3VVHA 3F6XA 3OBJA 3CKWA 4CZUA 5J1VA 5KMJA 3H10A 2W1CA 3P78A 5DT3A 1LR4A 4C7TA 1URCA 4J99A 4XS2A 4CKJA 4EK6A 3O0GA 4QTCA 4TL0A 3VBXA 3Q3BA 2X6DA 4UB7A 4EOPA 3V6SA 2F7EE 5JGDA 3UGCA 2FSTX 3EMGA 3W55A 5AUTA 3TZ8A 4RLKA 4IADA 4CCBA 4NM5A 5ETAA 3S2PA 4HPTE 3TT0A 4QD6A 4EH4A 3KGAA 2YABA 3W2RA 4CZYB 5AP5A 5IQEA 3UYSA 4A9TA 1H28A 3EFKA 1RE8A 4NTTA 2ZJWA 3R8ZA 2CGXA 2VWIA 3UZRA 2I0EA 3CY3A 4IX5A 3HA6A 4LM5A 1OKWA 5EW3A 5BX0A 4WA9A 1ZAOA 3IW5A 4GW8A 3ZSGA 3G15A 5KMLA 5GJGA 1XJDA 3GC0A 4R78A 4FSYA 4RC4A 2ONLA 3R9HA 2E9OA 5EM6A 1OIQA 3UMWA 4EH7A 3BYVA 3UIXA 3IO7A 4RPVA 5CU3A 4BTJA 2AUHA 3KXHA 3C1XA 5GZ8A 2FGIA 2V62A 3PXQA 2QLQA 4FT0A 3NW5A 4U0IA 1FBNA 3L1SA 3TWJA 2BTSA 3CBLA 3RK7A 5LQFA 3AD5A 4G1WA 4RGJA 2BILB 3KVWA 3W10A 4EKKA 2HK5A 4NT4A 3QAME 4DE4A 1FPUA 2VGOA 2VV9A 4IX3A 4YZ9A 4NYEA 4R5YA 2I0VA 2GCDA 4WD5A 5H8EA 4H39A 4RQKA 5KMMA 4FNZA 4BCPA 3FQSA 4ZY5A 3NS9A 2WMXA 5E90A 2R3PA 3BLQA 3LCDA 2ITTA 3NZ0A 5HCXA 4FT5A 2H9VA 4ZTRA 4GH2A 3JYAA 3LQ8A 3GP0A 5AAFA 5M53A 4MXAA 4C59A 1BL6A 2QG5A 2KTYA 4PMSA 4DCEA 2H6DA 3H9FA 3KXXA 2YLFA 5GZAA 1NT2A 2XKCA 5IQBA 2UVZA 3FLSA 3Q53A 4O38A 1OL1A 4XEYA 3EZVA 4GUBA 5C9CA 2J0JA 3KMWA 3DU8A 3KRJA 4IBMA 4Y5QA 4R6VA 3ZXTA 4G17A 2XRWA 5LJJA 2BROA 4S30A 3MFRA 4KIKB 1JVPP 1FGKA 4RA5A 3UO5A 4FTRA 4IDTA 4F65A 3HMNA 4RLLA 4N6YA 5AFVA 4EC9A 5CY3A 4ZSGA 3WARA 5LMAA 3PP0A 2C3JA 3BU6A 4I24A 3O7LD 5A4TA 2R9SA 4RWJA 1GNGA 3Q32A 3IKAA 4GK4A 4IDVA 2XJ2A 4IM2A 4YO4A 2OWBA 4DFNA 3FDNA 5DI1A 4F6UA 3R83A 4AS0A 5C1QB 3MSSA 3PVWA 1W83A 3GU4A 4OTWA 2E2BA 3QWKA 3DK7A 4KB8A 5J8IA 4EHZA 4R3RA 1LP4A 1A9UA 3LPBA 5G1XA 2OI4X 2J5FA 3UNJA 2ITYA 3QQKA 2BZKB 4GJ3A 3RHXA 4MAOA 4F64A 3HV6A 4ANBA 1KWPA 4FE2A 4BIDA 5E8XA 3TUBA 2F9GA 2HWOA 2VTOA 3GB2A 3MVLA 4FG8A 4M13A 2HYYA 3H30A 2R3HA 5DH3A 4YURA 3POOA 2XB7A 3RVGA 3AD6A 5JZNA 2QG7A 4RIYB 2ZM4A 4FNXA 2R0UA 1XR1A 3ROCA 2X7FA 2QKWB 3F7ZA 3QL8A 1MRUA 4J98A 3ZLYA 4EEVA 5AR8A 1WFCA 3MVHA 3EJ1A 3PJ3A 5KHWA 4ZSJA 5I9YA 2F57A 2XVDA 2GNLA 5CU4A 3UG2A 5A46A 1DS5A 3NUYA 5CSWA 2GS2A 2Y0AA 3R7IA 3ZFXA 3BHHA 5IEXA 2PZIA 1A48A 2UZEA 2JD5A 1Q8ZA 1ZLTA 5CXHA 5L2IA 2XJ0A 5AUZA 4ERWA 1M7NA 1H0WA 4BTMA 2R7BA 2XNBA 2GNGA 4DFBA 4F7LA 4FC0A 1A06A 4I22A 3R7UA 4C3PA 2VX0A 4FTTA 2PMNX 3R71A 3KRWA 3GCPA 2YLEA 2WMBA 4GMYA 2Y8OA 5KO1A 5D9HA 1ZZ2A 4EZ5A 3D5VA 4DCAA 5FBOA 4AW2A 3FMNA 2ZMCA 3I6WA 3AC2A 4PV0A 4M14A 3FZTA 2HZ0A 4AN3A 1Q5KA 2R3GA 3EL8A 4E5WA 3OWKA 3THBA 3VHEA 3PXZA 3ZRMA 4QP1A 2FSLX 5HEZA 3OOMA 4XLVA 4ANLA 2PVRA 5I0BA 4FEXA 3FBVA 4K9YA 5F9EA 4DTBA 1CDKA 5GIOE 4Z9LA 3QXOA 1P4FA 4Y83A 3EH9A 3CP9A 4FVPA 2C6LA 2CCIA 3MFTA 1FVTA 3PXYA 3BEAA 5DFPA 4FEWA 3FV8A 2P3GX 4AA4A 2Z7QA 4J53A 2CGUA 3GVUA 4UY9A 4WG3A 5ANDA 4QMMA 2OXYA 5AM6A 3PG1A 5H3QA 1J7UA 3DFCB 3PLAE 4I5CA 4L67A 2XYUA 5L6WL 4P7EA 5I9VA 2C0IA 1TQIA 4S32A 5C8KA 5FWKK 5EW8A 4KNBA 5J9ZA 4QMPA 3PIXA 1VJYA 4D1SA 2R4BA 4XV2A 1JAMA 4ITIA 3E8DA 4E93A 3F3VA 1P14A 3MH3A 2JDOA 3OW3A 4IIRA 4RJ7A 2DUVA 2CN8A 1DAWA 3MPMA 5FXQA 2JKKA 4YMJA 4L44A 2BIKB 2OO8X 3M11A 4O0TA 4BICA 5J1WA 4BDGA 4FIIA 4O27B 5CU6A 5HCYA 3COIA 4DEBA 5A9UA 1Y57A 3HRBA 4FBXA 4EOIA 5D12A 2PYWA 3FQEA 5A4CA 5HZNA 3SG9A 3F5XA 4OTDA 3M42A 4FKGA 5AAGA 4CSVA 2XK4A 3LMGA 4EHEA 2C6EA 2E9NA 4WNKA 2C1AA 3FI8A 5LVNA 4R7BA 2JKOA 2X39A 4XP3A 4QMNA 2B1PA 2E9UA 4AF3A 4G6NA 2GS6A 4ZZMA 4OBQA 5KKRC 4H58A 1GOLA 2W1ZA 4KIKA 4UXQA 4ZTHA 5C03A 2WOUA 2X9EA 5JFSA 5ANEA 4BI1A 3DZOA 4NW6A 1OKYA 3RAHA 4CFNA 1XBAA 3MVMA 2B7AA 4QNYA 4ORKA 4QYHA 4BF2A 4GFOA 5KKRB 3W33A 2Y7JA 4WO5A 5HIBA 4KIPA 2R3LA 3KCFA 3LFDA 3EQGA 3I79A 1CTPE 3A60A 4EH8A 4FT3A 3HAVA 3ZLXA 5HI2A 3T9TA 3L9MA 4Z55A 4E4LA 4C58A 3HV5A 3UPZA 5EHOA 5JSMA 2QO2A 2OJGA 2J0IA 1J91A 4NTSA 5FQDC 5HD7A 4QNAA 3ZZWA 4EONA 3P79A 4BKZA 2HY0A 2YIXA 1OGUA 3CE3A 3R2YA 3LKMA 4N4SA 4YNEA 5EDQA 2C3KA 4HGSA 4LGGA 4BTFA 5D11A 5IQIA 4PUZA 1FMKA 2QR8A 4NH1A 4FUYA 1UWHA 3TNPC 2CLXA 1YOJA 4MQ2A 4DEGA 4JJRA 5M07A 4BVUA 3TUCA 3EQCA 4FG9A 4XRLA 3NNWA 4GRBA 2QVSE 3I5ZA 4LMUA 2UW3A 4NSTA 4BIEA 2JAMA 4AQCA 2OZAA 2JIIA 2VTAA 2QURA 5CZIA 3CCNA 3BWJA 1TQPA 5M56A 4AZWA 4BCOA 3H3CA 4YC6A 5H8BA 3VULA 5CASA 3POZA 2ZVAA 4HW7A 4AUAA 4OR5A 5JMSA 3ZFYA 2FB8A 3FMLA 4EH2A 4ZS4A 3P86A 4TYGA 3EQIA 1Q62A 3TDVA 4ID7A 4LL5A 3FUPA 3E88A 2F7ZE 4FYOA 4BDCA 3HRFA 4AT3A 3HMIA 4OTPA 2ITPA 4EUUA 3U6HA 4YPSA 4I6FA 5LMBA 4AGCA 3K3JA 5HESA 2HZNA 1APME 2OGVA 2X7GA 1SZMA 4L3LA 3QTZA 2QCSA 1Q61A 5HO8A 5HG9A 5KNJA 4MK0A 3U6IA 2WGJA 4DITA 1ZMWA 3LCSA 1OPJA 3KU2A 4AW5A 1H4LA 1YDSE 1Q3WA 1JSTA 1ZYSA 4IFCA 3F7WA 3RPVA 1PXIA 2CPKE 2OJFE 2YAAA 3EYHA 5H2UA 2ERKA 1QL6A 2EXMA 3ZOSA 2A27A 1ZARA 3RTPA 3ZHPC 3NYXA 2JIVA 4C62A 5EKNA 5HO7A 4D1XA 5CX9A 3EOCA 4QYFA 4V01A 5HORA 5HIDA 5FUTA 4FIJA 2HOGA 3PRIA 3H0ZA 2I7QA 4F7NA 5M4UA 3OXZA 3SG8A 3QKMA 4IAFA 2VTSA 1V0BA 4FT7A 3BWFA 2QOHA 3GCVA 2XKFA 4RVMA 5CAPA 5GIPE 1PXLA 3QHWA 4WIHA 5BVFA 3ZO1A 4BR3A 2REIA 3JY9A 3FMDA 3LFEA
chains in the Genus database with same CATH superfamily
2WTWA 5CS6A 4BZOA 2XJ1A 3Q9WA 4GUEA 4XRJA 4PNKA 3GU7A 5AV2A 4MD7E 2WTKC 3IGGA 4KINA 3F2AA 5AP0A 4CEGA 5LMKA 3EHAA 3UDTA 3V5PA 4ZAUA 2HELA 4C4JA 4DF3A 4AXFA 5E8WA 3D7TB 4FKOA 2XAMA 3JR1A 2WTKB 3LJ1A 5LVLA 1H07A 3VUGA 4UV0A 2Y4IC 5CU2A 4FMQA 4KAOA 2Q0NA 3OP5A 4ITJA 2XNGA 4O83A 3GQLA 2Y4PA 5JK3A 5DR6A 5J5SA 3AMBA 1ZY5A 3D9VA 4FZ6A 4I3ZA 1NVQA 1PYEA 3UP2A 4Y8DA 3LCKA 4PL5A 2C68A 4A06A 3L9NA 3K54A 2Y4IB 4BGHA 2DQ7X 1ZMVA 3MJ2A 2EB2A 2QU6A 2W1GA 4MXXA 3VRYA 4HGTA 3HGKA 4BIBA 3EWHA 3SRVA 3UG1A 2UW4A 4FRFA 4QP6A 4FZAB 5ITAA 3U87A 3A7GA 3PDTA 3KRLA 3R22A 4I93A 3RK5A 4O0SA 4J97A 3LW0A 4RFZA 3RNIA 2B9HA 4O81A 4QP8A 2UW6A 3RK9A 3W18A 1Q8WA 5GZ9A 2OBJA 3HV4A 4GVJA 4BKYA 4D5HA 3ZXZA 3R8MA 4E5BA 2HXQA 5E8YA 2BUJA 4FV6A 2X4ZA 3HECA 4HCTA 2BHHA 4YTFA 3QQLA 4IVBA 3SAYA 3FL4A 4AFEA 3PPJA 4QP7A 2R3JA 2WPAA 3EFJA 4BY9E 5BMMA 5IA4A 4ALUA 4E6DA 1UU9A 5L6PA 4UBAA 2J2IB 4IZAA 5J95A 3WIGA 5FP5A 1URWA 1G5SA 4R7IA 2DWBA 3BBWA 4JQ7A 1W98A 4OTRA 2OIQA 1YRPA 4LMNA 3VAPA 4F08A 5HLWA 3R8PA 1MRVA 4UMRA 4H05A 2CKEA 2VD5A 4XNEA 3UTOA 3E5AA 4JRVA 4XG6A 4XUFA 4HNIA 5IQFA 3R1SA 3BLRA 2R0IA 3DAKA 2YM6A 4O2PA 4V0GB 4AN9A 3MPAA 2UV2A 4QMQA 5BUJA 4USDA 5CVGA 4F6WA 4CQGA 5HE1A 4RX9A 3A62A 1R0PA 2GDOA 2QD9A 2R64A 3DPKA 2EWAA 3AXWA 4BTKA 2YACA 3WI6A 3GI3A 2OJJA 3SW7A 2PVYA 2KULA 2W1IA 3O23A 1SMHA 4QYGA 3RZBA 3KULB 3SGCA 2PVNA 4W4VA 2GTMA 2C6TA 1GIIA 1Q97A 4E1ZA 2J9MA 4XG2A 4AQKA 5DRDA 4G3GA 2QKRA 2F2UA 5L4QA 4QTAA 4E4XA 3R7YA 1WVYA 4MH7A 4RWIA 4QO9A 5B2MA 3FSFA 4IACA 4DEAA 3PVBA 4HYUA 4RSSA 1ZOEA 1P2AA 5DEWA 4FK3A 4W9XA 4Z7GA 3UODA 1YOMA 3QWJA 3D5WA 4LV8A 3OEFX 4CXAA 4HVSA 3MW1A 4DGOA 3EN4A 1OITA 2VZ6A 4ALVA 4GL9A 4Z7HA 4XX9A 2WQNA 2NPQA 4RFYA 3UBDA 4RJ4A 3REPA 2OK1A 5EQYA 5E8ZA 4EYMA 3PUPA 2W4OA 2X4FA 5EYDA 4UEUA 1PXJA 2HAKA 3KVXA 1J1CA 1OUYA 4JDKA 5HO6A 2QO7A 1G8AA 3LFQA 2WMUA 4EOSA 4MF1A 2ETMA 1YI6A 4I0RA 4RA4A 3C4EA 4P2KA 1WVWA 3UVQA 4UZDA 5M08A 2JDTA 4O0RA 1WBOA 3GNIB 3ACJA 3HDMA 1YI3A 5BUEA 4H1JA 3TJDA 4N6ZA 5B2KA 3TV4A 1IEPA 4GT5A 5L2SA 4EH9A 2NRYA 3Q60A 4JVGA 1I44A 4ZIMA 4D5KA 1OL2A 2C5OA 3DA6A 4PPAA 3G9LX 1PYXA 1ZWSA 3DNEA 3EYGA 3PRFA 4MYGA 4CTBA 2GQRA 4GKIA 2RIOA 3VF8A 1YHVA 2FH9A 2OXXA 4I5MA 5DOSA 3UJGA 4BBMA 3F5PA 2F4JA 2C6OA 2J7TA 5HX8A 1UWJA 3SD0A 4HGEA 4F0FA 5DPVA 4KKHA 1GJOA 2VU3A 3ODYX 4JG6A 2DYLA 2E9PA 2R3NA 2ITZA 5AR3A 3WE4A 2ERZE 4IC8A 4X3JA 2X81A 3SW4A 3WIKA 2HIWA 4NCTA 2XBJA 4MXOA 1MQ4A 2JC6A 4EZ3A 4DH1A 2VO6A 5M09A 3BV2A 2VUWA 5E8UA 4IZYA 3GC8A 2YDJA 3O8TA 3QALE 2ITVA 5IEYA 2CKQA 5KBRA 2W5AA 4FTQA 4FVQA 4QQCA 4I5PA 4FV8A 4A7CA 3ITZA 1JOWB 4CLIA 3CR0A 3HKOA 4L7SA 3LQ3A 3UE4A 3PP1A 3C13A 5A4EA 2GFCA 5M06A 4UWCA 2BALA 1ERKA 5HBHA 5HNIX 5CANA 3RWPA 4QPAA 3OY3A 3DKCA 4FL3A 4GIHA 3T3VA 3ZM4A 1JBPE 4R1YA 2UZTA 1XHAA 3IS5A 4FV3A 5EM7A 5CEPA 3EKNA 3MGYA 4I0SA 4QMXA 5L2WA 2PVKA 1H01A 1BL7A 1JPAA 2OIDA 2ITQA 2YZLA 2ZM1A 2PK9A 3MPTA 2W1FA 1PMNA 5E91A 4AE9A 4C4GA 4AGDA 5CVFA 3GOKA 3BU5A 3R00A 4MNEB 4P90A 4ZJIA 2BRBA 2PL0A 2V0DA 4RX5A 2ZV7A 3PE2A 3E93A 3GU8A 3CC6A 1QPCA 4D2PA 4ZP5A 2B9JA 2F49A 2G01A 1VEBA 4MWIA 3PYYA 3ULZA 4ACGA 5L8JA 5HX6A 2YJSA 3VUIA 4LOPA 2IW6A 2A4LA 2WQEA 5IH6A 5JH6A 2J5EA 5EFQA 2X0OA 2CLQA 4YGAA 1H00A 4DG0E 2V5QA 3IW6A 2PE1A 3DB8A 1IA8A 3PFQA 4RRVA 3RM6A 4EQMA 1G8KA 3LFNA 3LXKA 4G34A 3OEZA 5CVHA 5JGBA 1PRYA 2ZFYA 3V5WA 4JQEA 2Z60A 3V3VA 4DT9A 1VZOA 3BV3A 3DBDA 2UZOA 3EQBA 3KY2A 3V8WA 4B4LA 1W2FA 2XAOA 1GZ8A 4I92A 2GSFA 5AR5A 3FQHA 4V0GA 3F3UA 5I5ZA 3QYWA 4O7VA 1YWRA 4YO6A 3DGKA 1OI9A 3RI1A 4TWOA 4MCVA 3W0NA 2X8DA 5GHVA 4XG7A 3ZU7A 1UVRA 1S9IA 3O71A 3QGWA 2W9FB 3COMA 4M69B 5KMKA 1U46A 1IA9A 5IF1A 3TCPA 5JRSA 3NPCA 2RFDA 4TKSA 2WTDA 4RX8A 2XRUA 3QCQA 4IAYA 2J50A 2XK7A 5CENA 4QQJA 3W0PA 3Q2JA 3LM5A 4QP9A 4B8LA 4FTCA 4RJ6A 4F09A 4C34A 4J96A 2VO7A 3D94A 4TW9A 3UOLA 5IMXA 4LRJA 3MS9A 4BDJA 5BMSA 3LCTA 4PL3A 4IFGA 2OH0E 3LVPA 3R28A 3R73A 4FV7A 4HYHA 4FKUA 5F94A 3DKGA 4O7WA 5DYJA 3QQJA 4XOYA 3W0MA 3N4TA 3R7EA 2R7IA 1MRYA 3WZJA 3DS6A 3V5LA 5K0XA 3NUUA 4L00A 5CT7A 4CMTA 2VWWA 3EKKA 4G3CA 4RZVA 2XARA 3U6JA 3QLFA 5HICA 1SYKA 3DFAA 2XBAA 3LZBA 3FI3A 4RIOA 2UZBA 4NIFB 3FLWA 5KBQA 4D2SA 4J71A 2HW7A 2O0UA 4YJSA 4AX8A 3OW4A 1OKVA 4FTIA 1PXKA 3PJ2A 1WBTA 3A2CA 1BX6A 3OS3A 3E87A 5L6OA 4N57A 2UW7A 3QKLA 1OL5A 4MNFA 3MB7A 4XV1A 3VQUA 2WEIA 3Q4ZA 3U54A 1IASA 5J79A 4JT3A 5IQDA 4GYGA 2BHEA 4FKIA 4PDOA 4CNHA 4EOLA 5DVRA 3NNXA 4I4FA 4CKIA 2IEWA 5DT4A 1XH7A 2X2LA 2IZTA 3KL8A 3QTQA 4X3FA 3EL7A 4XV3A 1KE7A 5I9ZA 4CLJA 2F2CB 4QTEA 3SC1A 4TYEA 5FTGA 3E92A 4IX6A 3ALNA 3D2IA 4QP3A 3ALOA 5FBNC 1OBDA 2WMRA 3ELJA 4CRSA 1AD5A 2GHMA 1KOAA 2P4IA 2QR7A 4S31A 5A3XA 3ROYA 4BC6A 2PULA 3C5IA 3ZC5A 1FINA 2XK6A 1XWSA 3NNUA 3TYKA 2VTJA 3CIKA 3Q4TA 3WBLA 1YWNA 4DFZE 1NY3A 5A6NA 4UMQA 4B7TA 4G31A 3JUHA 4O7NA 3IECA 2WHBA 4M15A 5TKDA 3MY1A 5F95A 2Z8CA 3A61A 3ODZX 2IWIA 3TNWA 3FMEA 4D4YA 2JBOA 4PPBA 4USFA 5LVOA 5AP6A 1FVRA 2QOFA 3E64A 4AACA 2XEYA 3VS0A 5KMOA 4IB3A 4RIXA 4BJJA 4O7TA 1LEZA 4BGQA 5HVJA 3LOKA 3OD6X 3OXTA 4G5JA 5FXRA 1R39A 1BI8A 4Q2AA 4ZK5A 1XH4A 3TNIA 1Y6BA 3ZLSA 3C4FA 4KBCA 3EN7A 5BNJA 2WXVA 3W0SA 2WB8A 3F2RA 3ENHA 3DCVA 1WBWA 3QZGA 3F88A 3I60A 2WMTA 2XH5A 3VO3A 1WCCA 3VONA 4EL9A 2QOQA 1SVEA 4LDTA 3K2LA 3UP7A 4UMUA 3CQEA 4XG8A 1JNKA 4E73A 1AQ1A 5CEOA 4YBJA 3LJ0A 1BKXA 4TXCA 3CGFA 4JDIA 3ORKA 2QOIA 4UALA 4DEEA 2JFMA 1XBBA 4PMMA 4DG2E 5IZFA 3L8VA 5IA1A 3KB7A 2R3IA 3DBCA 2P2IA 3RAKA 1PXOA 2Z7SA 4I20A 2C5VA 4O7LA 4IHPA 4HNFA 4O1PA 5CNNA 1VYZA 3VWAA 3EQPA 3KN5A 4FK6A 2O65A 3QD3A 4YU2A 1R0EA 3VF9A 5HE2A 4DGGA 4DFUA 3BGPA 4IWQA 1Q99A 4PTCA 4QMWA 4ACHA 4FIFA 4UWBA 1OZ1A 2PZ5A 4UMPA 3BLHA 2R3KA 5CNOA 3LM0A 3D5XA 1PMEA 4QDVA 4D2RA 1ZYJA 3OFMA 4JR3A 2XUUA 4YJRA 5CSVA 2GPHA 3MWUA 3KXGA 2A1AB 4MWHA 4FTOA 2PMLX 3GENA 4QMSA 4EH6A 3FI2A 4TWCA 2JKQA 1R3CA 5HE3A 3HP5A 1BLXA 2C47A 3C5UA 5AUXA 1OKZA 4L53A 4DFYA 5IDNA 4GEOA 4TN6A 4WSQA 4ZSAA 2Q83A 4ZSEA 3ATSA 4O21A 4JQ8A 4BBFA 3MA6A 4PX6A 1F3MC 2LAVA 5B0XA 3E8CA 1JWHA 5HVKA 2GNFA 3BI6A 5EHLA 4JBQA 4LUEA 3OCTA 4XG3A 5CWZA 4FEQA 1JKSA 3H4JA 3R01A 4K2RA 3R8VA 3DK3A 3R0TA 4U80A 4DTKA 5IQHA 5EW9A 4NK9A 2WO6A 3RZFA 4CFMA 1REJA 2CCHA 3UIMA 2VNWA 3I7CA 3W2CA 2WQBA 3PJ8A 4I21A 5AADA 1Y8GA 3FE3A 2VWUA 4D55A 3G2FA 2YCSA 3NAXA 3VBYA 3O51A 3MTLA 4QP2A 2WU7A 4QTDA 5LVMA 2WAJA 4OBOA 3RM7A 3WYYA 1IR3A 4R8QA 3QQHA 4NJ3A 4BCJA 3IOKA 4GYIA 4R1VA 5E1EA 5HTBA 2GNHA 4Y46A 3ZO3A 2XIXA 4AA5A 1YXVA 3LXPA 4IQ6A 3ZM9A 3TTIA 4YP8A 4GG7A 4FODA 4I1ZA 5AX3A 3TKUA 1YWVA 3RALA 3U8WA 3UDSA 4DHZA 5EI8A 2NYAA 4OAVB 4B0GA 2J0MB 4LUDA 2CJMA 3VS6A 5K5XA 3Q6WA 1CMKE 2Q0BA 2ZDUA 3OUNB 4WG4A 3SV0A 4YHJA 4RJ8A 4RIWB 3HA8A 3NIZA 4YBKA 2VWYA 4TPTA 4EK8A 4LV5A 2C1BA 4FTNA 4NM0A 1B39A 4L3JA 3T8OA 1LUFA 4BJJB 4EOJA 4E4MA 3LLTA 4QQ5A 3TN8A 5ANOA 3ZTXA 4R3CA 3KMUA 3MVJA 3PVUA 4E3CA 4E4NA 4U7ZA 4M0YA 3G6HA 2JGZA 2YIRA 3DQWA 4DBXA 2PHKA 2W1HA 3BYMA 5CT0A 1IAJA 4BDDA 4F4PA 3OMVA 1J1BA 4FA2A 3DAEA 4UXLA 5FM2A 3SXFA 3S00A 4MVFA 3R8UA 3ZUTA 1O6YA 1U54B 2PE2A 3EN5A 3R30A 3E63A 4GJ2A 4O4CA 5J9YA 4OGRA 4FYNA 4X2FA 4EQCA 4I6LA 4ZZOA 2WTVA 4ZXTA 4CD0A 3R7OA 3CD3A 3AMYA 4A9UA 4WOVA 4ZMEA 4LOOA 5K4IA 2JITA 2W1DA 3B8RA 2B4SB 4FTKA 3C0GA 1Q4LA 4AZSA 3VUKA 1G3NA 4XP2A 5M4FA 2XEZA 3RAIA 1JQHA 2UVXA 3FZSA 3L9PA 2JIUA 2JEDA 3QLGA 1X8BA 4FI1A 5AR2A 3TV7A 4HVIA 5A4LA 2NP8A 2PVFA 1ZMUA 4O7SA 3Q5ZA 5JFVA 4JG8A 3R9OA 4KKEA 4Z16A 3FPMA 3ZO4A 4O7RA 3BELA 1OL7A 4DEIA 4ENXA 4E7WA 5DMZA 4O82A 4EUTA 3NLBA 3QRUA 3G90X 3QA0A 4F9CA 5I9XA 4C61A 5KE0A 4DT8A 2CKPA 2J51A 3WF8A 1UNGA 2VWBA 4BI2A 3N4VA 4FIHA 1H1RA 3W16A 3II5A 3C4WA 4GT3A 4OBPA 5CSXA 5D7AA 3NW7A 4O4EA 3VNTA 5EM5A 5AM7A 3NEWA 4QYEA 5FEEA 5HKMA 3NX8A 4JX7A 2OFVA 3SOCA 4JMQA 4C4FA 2AYPA 5FEDA 2YCFA 4Y5HA 5L3AA 3UMXA 2ZMDA 2RKUA 5KCVA 4FUXA 4RMZA 3TZ7A 3VRZA 2C3IB 2UW0A 2CNUA 4AT4A 3KREA 2EXCX 4XH6A 3MA3A 2FSMX 2BZIB 3FMMA 4RIYA 1QPDA 1ZOGA 1PMUA 4W9WA 3KRXA 4YTIA 4E20A 1FQ1B 5FDPA 3PZHA 3AD4A 2VTPA 4G16A 5C01A 3UOJA 3FI4A 4DG3E 1JSUA 5CEQA 3HNGA 4YSJA 3BBTB 4ANSA 1OIUA 4WHZA 3V04A 4DYMA 1DI9A 4ZTQA 1XH9A 5HCZA 2QOLA 2XS0A 4FZDB 3ORLA 4A9SA 2XCHA 3DBQA 4BCQA 4IJ9A 2JLDA 3WZKA 4EBVA 4U6RA 4W8EA 5LVPA 4CV9A 5A14A 5DNRA 2OICA 2QU5A 2C5NA 3ZSHA 4TT7A 3TMOA 1HOWA 4QYYA 5F4NA 3HUBA 3V8TA 5HLNA 1XMLA 2YITA 1KV2A 1OUKA 2W1EA 3D2KA 4IANA 3R9RA 1XBCA 3BCEA 4FZ7A 4J7BA 4FGRA 1SNXA 4FV9A 5DRBA 4XHKB 4EJ7A 1Y91A 1P5EA 4OT5A 5AX9A 2PUUA 4F9YA 4FVRA 4GCJA 3QTIA 4TWNA 2QLUA 2Z7LA 3FKLA 1H24A 2WTJA 4F70A 4CFWA 4DTAA 4ACCA 2E9VA 3Q52A 5D1JA 4IAKA 4TYHB 3UVPA 4GIIA 4XLIA 4MBIA 2PMIA 4EC8A 4TY1A 3MI9A 2UUEA 3I5NA 2BZHB 3LFAA 4ASZA 4UX9A 4ASEA 3VJNA 2IZRA 3WZEA 1ZRZA 4PF4A 1YI4A 3HLLA 1CKJA 4QT1A 1SM2A 2C30A 4KUJA 2BAQA 3R63A 4AWIA 3HYHA 5E92A 4FKVA 3ORNA 4ANQA 3SVVA 4IM0A 1Q8UA 3TI1A 2EVAA 4Y95A 3WF9A 2C6IA 2BRNA 3QD4A 1U5QA 1W84A 1V0PA 3BKBA 3WF7A 1NA7A 4NUSA 4KIQA 4TYIA 3R21A 1ZXEA 3QTXA 4LYNA 1V1KA 3SHEA 4HVHA 4FSQA 2VWXA 1K9AA 3F3ZA 3OTVA 5IQAA 4XP0A 4WT6A 3S0OA 1W0XC 3C4CA 5DG5A 3D0EA 3RNYA 2WQOA 4FZFB 4FT9A 5AEPA 3CY2A 5FGKA 3NFFB 5E9EA 3W1FA 2C0OA 4N70A 1OVEA 4AT5A 1Q3DA 2VO0A 3OTUA 4FX3A 3RHKA 1ZZLA 3Q9ZA 4OUCA 5IUIA 1M2QA 4GS6A 5ETIA 3L8PA 3ET7A 2ZAZA 1PJKA 3AC4A 4CQEA 3QUPA 2OJIA 3RBWA 2QHMA 1WBPA 2VTQA 4YC8A 4OTQA 4WBOA 1PXMA 3IGOA 2FVDA 3CD8A 3C0HA 3LXLA 2RFNA 3U55A 3BQRA 3FY0A 3MH1A 3AOXA 1TFFA 4PRJA 3AG9A 2GHLA 4L6QA 5GNKA 2BDJA 3QCYA 4W4XA 5KMIA 5KUPA 2OLCA 1ZY4A 4F9AA 3AC1A 3RPOA 4IWOA 3OROA 4H3BA 4FEVA 4FNWA 1OGYA 5C27A 1WMKA 2VTMA 3MY5A 5HE0A 4BCGA 5CEMA 5H9BA 3CQUA 3L9LA 4BL1A 4O6LA 4RJ5A 2IJMA 4F6SA 3UO6A 4W4YA 2A98A 4BCFA 1OMWA 3ORPA 4TNBA 4B6LA 2JDRA 1DI8A 4I0TA 4RBLA 3R9NA 3P7BA 3U9CA 2X8IA 3PE1A 4CMOA 4WRSA 4PMTA 4V04A 3FZRA 3O2MA 5BVDA 4FKSA 4AGUA 2YJRA 5EYKA 5EG3A 5CSPA 3UO4A 3LAUA 3ZO2A 2JKMA 5CF8A 5IMEA 2Z7RA 1GAGA 5EHYA 4FICA 2QC6A 3COKA 4RQVA 5BVKA 4AGWA 5HBJA 3FL5A 4G5PA 3BYUA 1YVJA 3CSVA 3HDNA 4YZMA 5BPYA 3W0OA 4WG5A 3B8QA 5C26A 4G6LA 2YISA 4YTCA 4QMOA 2YN8A 5B2LA 5L2TA 4M8TA 5LARA 5LWNA 2CSNA 1M14A 2OFUA 3D15A 3W0RA 3HX4A 4C2VA 5DEYA 3I1AA 4PDPA 5BQ0A 4ARKA 3TJCA 5DGZA 3H9OA 3CTHA 4L8MA 4I6HA 4FTJA 4RVLA 1OB3A 1YKRA 3QUEA 3QCXA 4LRMA 3HZTA 3CGOA 3KXMA 4FG7A 1CKIA 4U44A 3W32A 3ZBXA 4D0XA 2HY81 4YHTA 2NRUA 2YHVA 2HWPA 3BGQA 2BKKA 4KKGA 1HCLA 3LJ2A 2W0JA 3NUNA 4ACDA 4FTUA 4IZ5A 3CKXA 3HMOA 3KXZA 3PJCA 4I5HA 4U97A 1P4OA 4BB4A 2YFXA 3QTSA 4QPMA 4O84A 1WAKA 4YJNA 4IXPA 4YJPA 4C37A 5CAQA 3HV7A 1KSWA 4H1MA 4J95A 5HG8A 4QMYA 3TKIA 4O0XA 3NUPA 2WZJA 5DR9A 1IG1A 4IMYA 4YJVA 2XZSA 3E7OA 5ICPA 2PUNA 1UU3A 2W99B 2J0KA 4AG8A 4M7IA 3QX2A 4IVCA 3PG3A 5ANJA 3N4UA 3UPXA 1YQJA 1ZYDA 2AC5A 2H8HA 3VS1A 1UKHA 2PZYA 3W2OA 2RSVA 5IKWA 3ERKA 1H8FA 4AZTA 4ZZNA 1PY5A 4PP9A 3GFEA 3LHJA 3VIDA 3W2QA 4N0SA 3B2TA 5CZHA 4C33A 2ITXA 4U3ZA 3RMFA 4ASXA 3F66A 5AR7A 5HBEA 3D5UA 4H36A 3VW6A 3MIAA 3ZRLA 4C35A 1IRKA 1UKIA 1WVXA 5AR4A 4D58A 5IQCA 3Q2MA 4NL0A 3UC3A 4C0TA 3OCGA 4Q9SA 4D9TA 2XKDA 5DBXA 4LV7A 5AP7A 1H1SA 4PWNA 3QZIA 4LQMA 5T6KA 3EZRA 3BHUA 3U4WA 3FAAA 5AUWA 5C4KA 2XK9A 4EWQA 3ZEWA 2R3FA 4EHGA 5FEQA 3ANRA 4CFXA 2BRGA 2O2UA 3SX9A 4X2NA 1TQMA 3PVGA 4IC7A 3AGMA 3IDCA 4GK2A 4I23A 1NVSA 2BZJA 4MD9E 3FSKA 1PKDA 5AP1A 5FG8A 3VUMA 5EDRA 2UW8A 2YM8A 4U41A 3ATTA 1W82A 3DQXA 4F99A 4NFMA 4NKSA 4J52A 2GNIA 4D4SA 4YUQA 4FSTA 2BAJA 4FOBA 4IVDA 3KCKA 3JXWA 3GUBA 1NVRA 2YIQA 5HNGA 4MUQA 2IW8A 4YR8A 4EOQA 2G2HA 2CNQA 2J6MA 2Y6MA 3WYXA 4DHJA 2Y6OA 4CFVA 3D7TA 3F5GA 3FKOA 5TF9A 3TNHA 3DDQA 2YWPA 2B53A 2XM8A 2A0CX 3EB0A 3F69A 3LFCA 3NW6A 4M68A 5CI6A 2FA2A 4IW0A 3ORXA 2W06A 4TNDA 5FRIA 5JEBA 3IW8A 4BDKA 4EORA 2XA4A 3CS9A 4RC2A 3UIBA 4RX7A 3P1AA 2WIPA 4BI0A 2R5TA 4L52A 4ZMFA 4IB1A 4KRDA 3LQ5A 2WMSA 2VX1A 3AT3A 3TZ9A 1XKKA 3KIOC 5FTQA 3U9NA 3O17A 3PSDA 4AFJA 4IB0A 3QX4A 5D7VA 1Z57A 2BFYA 4EJNA 5CQUA 1ZOHA 2RFSA 4DHFA 1XO2B 3PIZA 4WBBB 4BGGA 4O86A 5C8NA 2YDIA 2X0QA 2WFYA 4O22A 4G2FA 1YDTE 3GFWA 2OG8A 4KD1A 4USEA 3W0QA 5GINE 4HCVA 4ZSLA 3H0YA 4U3YA 4K1BA 4AOIA 1H1PA 5EQEA 3A7HA 3A8XA 3GT8A 3PJ1A 3QQUA 1TZDA 4AAAA 3BHVA 3JVSA 4OTIA 2JBPA 5K4JA 3DK6A 3HRCA 3NR9A 5M4IA 1Z5MA 3H9RA 5HTIA 5IEVA 2QONA 3M1SA 4L46A 2UZNA 4DEDA 3MH0A 4AN2A 3QU0A 4YNOA 4GG5A 4C4EA 2B55A 4XBRA 1CSNA 3K3IA 2QO9A 3L8SA 4X21A 4YTHA 4FR4A 3SOAA 2SRCA 5D10A 3UQGA 3LFFA 3E3PA 3E8NA 3LIJA 4P5ZA 2XK8A 5CQWA 5EI6A 4UWYA 4FSNA 4NJDA 2XNPA 3KKVA 3O8PA 4PDSA 4QMVA 3SQQA 4I4EA 4E6AA 1OBGA 4H3QA 4FGBA 5TOZA 4MBJA 4F0GA 3LLAA 2P2HA 1H08A 4QRCA 2YM7A 5IU2A 5LCJA 5KX8A 5HD4A 3C4XA 2XNEA 4IB5A 3BHTA 1E1XA 3KN6A 3KRRA 4HOKA 3ZFMA 3P7AA 4FKLA 5J7HA 4TZRA 4ENYA 3OT3A 4K6ZA 5AMNA 4FTAA 2X6EA 4QMTA 3ZBFA 2C3LA 2J90A 3QHRA 2CHLA 4M3QA 3FMKA 2IW9A 3TDWA 2C0TA 3KULA 2VN9A 4U43A 2JDSA 4K11A 3Q4CA 1XMMA 5J5TA 2GHGA 3ZSIA 4AA0A 3R1QA 3ORZA 3LFSA 3MIYA 3Q96A 3EIDA 2RFEA 4OTFA 2WEVA 4DAWA 4LRKA 1FOTA 2WMQA 5AJQA 4DFLA 2R2PA 4L7FA 3SXRA 4IAZA 5FM3A 3VS5A 2XANA 4O96A 1H26A 5LXMA 4TWPA 4LG4A 4FNYA 4RC3A 3ZUVA 4JXFA 1NW1A 1IAHA 3OWPA 2XYNA 1PHKA 1Y6AA 1AGWA 4KS7A 4X2GA 4ZTMA 3A99A 2WOTA 3VBQA 5HG7A 4XCUA 5T3QA 2ZB0A 3EFLA 5E1SA 3KMMA 3F3TA 5HG5A 2V7AA 2PTKA 3OWLA 3FZPA 5IG1A 5CEKA 4FV2A 2IVSA 3G51A 3NRMA 4G6OA 4BWKA 3AC5A 2FO0A 3QTRA 4FIEA 2PUPA 5TO8A 3MH2A 4F1OA 4CT1A 3NGAA 3ZYAA 5CAUA 3R02A 4L42A 3ZS5A 3WF5A 4HGLA 2Z2WA 4FKRA 2WELA 4I41A 3WZUA 4MXCA 3IDBA 4HJOA 4Q5HA 4YSMA 5CALA 4LL0A 3NMUF 1U59A 2CKOA 1REKA 4D9UA 2C5XA 5GJFA 2PMOX 4TYJA 5E7RA 2QNJA 2RG6A 3MB6A 3N51A 3W8QA 3BZ3A 1KE6A 4U81A 4V05A 5AUVA 3KA0A 2W7XA 3NDMA 1VR2A 2GU8A 4EOOA 3F82A 4NW5A 2B52A 3FMJA 4C8BA 2ZOQA 4PNIA 2CDZA 2Y9QA 3TG1A 2IPXA 2O63A 4IH8A 4O7ZA 5HTCA 2AEGA 2OH4A 3AT4A 4DN5A 4C02A 4ZJJA 5F20A 2BVAA 4CCUA 1KUTA 3VUDA 4BRXA 3CJFA 1OECA 2JAVA 3DT1A 4YHFA 3ETAA 4WUAA 1H1WA</