4K9YA

Focal adhesion kinase catalytic domain in complex with 1-[4-(6-amino-purin-9-yl)-phenyl]-3-(5-tert-butyl-2-p-tolyl-2h-pyrazol-3-yl)-urea
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
271
structure length
271
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Focal adhesion kinase 1
publication title Fragment-based discovery of focal adhesion kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 271
sequence length 271
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4k9yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4k9yA01
2UZUE 3OCGA 3QCXA 3FI2A 4IEBA 3NNUA 3BCEA 2DWBA 3RNYA 5JGAA 1H28A 5IH4A 5B2KA 4F9YA 3BRBA 3T3UA 3R0TA 4S30A 5BYZA 1OIUA 3OG7A 1ZAOA 4A9YA 1QPDA 4ANLA 3WF7A 3ZSGA 3TZ9A 2NPQA 3IONA 1PXMA 2G01A 4HZRA 4IWPA 4DEHA 3DKOA 3ELJA 5EKNA 2O8YA 1H0WA 2UZTA 4NCTA 3Q9ZA 2CGVA 4F08A 5AEPA 4O81A 2V7AA 2HZ4A 4U8ZA 4IM2A 4IVDA 4RWIA 1V0PA 1NVQA 2GTNA 4DG3E 3JUHA 4NZWB 2E2BA 3LFCA 5KNJA 4BR3A 3QBNA 2IN6A 3PG3A 4FKRA 5FXQA 3FLYA 4YZCA 4QQTA 4PL3A 1A9UA 1OKZA 3DB6A 4G3EA 4BKJA 4DEEA 4PMTA 4YURA 4FL1A 4LOPA 3VS2A 4APCA 5BYYA 1PRYA 2RIOA 5GINE 3R6XA 5DA3A 3ODZX 3C4FA 3PXYA 5HIDA 2W1DA 2J50A 4RT7A 1WFCA 2OH0E 3TJCA 4BZDA 4F0GA 2WOTA 3RM6A 4HVGA 1YI4A 3OEZA 3KF4A 3E5AA 3EKKA 4JXFA 4CVAA 2C3LA 4YJQA 5L3AA 4PP9A 2GFSA 2HW6A 2J9MA 5CNOA 3ZO3A 3G6HA 4ZZOA 5G6VA 5JK3A 5J8IA 4QRCA 4EQMA 2GSFA 2OK1A 4OR5A 3W8QA 3MVHA 4G17A 4ASDA 3QRTA 3NIEA 4TW9A 2B4SB 3ZH8A 4A9UA 4AGDA 2PVYA 3A2CA 5CU6A 5A4LA 3T3VA 3A7IA 2ZMDA 2OXDA 2FVDA 2PVJA 4IAKA 5EOBA 2BCJA 1R3CA 4FV9A 2DUVA 4ZTRA 4X7QA 2WMVA 3E7OA 3GCSA 5J87A 3QGWA 1Q8WA 4CV8A 3PDTA 1QCFA 4DH8A 4QYGA 4EH8A 3KXMA 2YJRA 1R39A 2UW4A 4O7VA 2WU7A 1YHSA 5HOAA 3HUCA 4RJ7A 5CEIA 5HLNA 5KX8A 3GI3A 3FMHA 2OFUA 4IZ5A 3RMFA 5KUPA 2J0LA 2HZNA 2C5XA 1Y6AA 4XV1A 3V3VA 2E9NA 4FG7A 4X2GA 2IVUA 4BDDA 5AA8A 2C1AA 5IQDA 4IHPA 4RWKA 2X2MA 3CCNA 5D12A 4IBMA 4G3FA 1W7HA 5DEWA 3DKFA 3EMGA 2BKKA 1GNGA 5E92A 2ITNA 5FBOA 3ZSHA 3UVRA 1KE8A 2OF2A 4G34A 3WE4A 2ZAZA 1OIQA 3KULB 3OWKA 3QWJA 1BYGA 4FNZA 1B38A 3VVHA 4AA4A 3SKCA 4MQ2A 2W0JA 4DGOA 4XBRA 2PVHA 2PWLA 2W1HA 1IA9A 1OI9A 2C4GA 2ZV9A 4L7SA 4UMRA 4YJNA 4P5QA 5TR6A 3SHEA 4DN5A 4YR8A 3JR1A 5ANOA 1TQIA 2KTYA 2F7XE 4OLIA 3RWQA 4YTCA 2WHBA 4L01A 4FG8A 4X3FA 3E8EA 1JNKA 4AA5A 4ENXA 3HMNA 3ITZA 4WG4A 1OIRA 1XQZA 4R8QA 2B52A 3UO6A 4XG8A 5A4TA 3GCUA 2Z7LA 3LM0A 4NIFA 4M66A 3BU6A 5FM2A 4C8BA 2W5HA 4JBOA 5FXSA 4F7JA 2WMSA 4TPTA 1OL2A 2X1NA 3EQRA 4X6RA 4FF8A 5AUZA 1UNGA 3R04A 3VUKA 4APPA 4K33A 1IASA 4BCHA 3OUNB 4QO9A 5GZAA 3CY3A 3VHEA 4GKIA 2XK9A 4E93A 2C5VA 3Q4UA 4E5BA 4I5PA 5KHWA 5CTPA 3R01A 3H10A 4O96A 3HDNA 3UIXA 5LOHA 4FEVA 1K2PA 1VZOA 4TL0A 3LFQA 5IA3A 3U55A 3VS1A 3VUHA 3A8WA 3GVUA 3QTSA 1H1PA 1UNLA 1W84A 3I0OA 3L8SA 4FTNA 4USFA 3ZO2A 4XG3A 2ZB1A 3V5JA 3CKXA 5T6KA 4XG9A 5I5ZA 5CALA 4HYIA 3O51A 4ZSGA 2HELA 2R3GA 5JRSA 4E1ZA 4DEAA 4LFIA 4K77A 4WRSA 4PV0A 3L9PA 4NUSA 4DF3A 1WMKA 2PULA 4CZYB 4O1OA 3QZGA 4GS6A 3AC1A 2XJ2A 4FKOA 3U4UA 3MPTA 4QYYA 3W8LA 4DEGA 2ACXA 4U80A 3TUBA 3DTWA 3BHUA 1H00A 2H96A 2WQBA 5BYLA 3MTLA 1TVOA 2SRCA 4C4HA 1KOBA 3R9DA 4UWYA 3QHRA 3O17A 4M7IA 4FV0A 2QCSA 3H0YA 4X2FA 5AR4A 4ZTHA 4KIQA 3Q4CA 4FKJA 2G1TA 4R6VA 2VTOA 3CIKA 3KXNA 5ETAA 5DI1A 3SXFA 4DYMA 2W4KA 1JKLA 2OH4A 3FC2A 3OXIA 1YKRA 3H9FA 3MA3A 5AUXA 4O82A 2W9FB 5D11A 3UG1A 1YHWA 2ZDUA 4AU8A 1ZXEA 5JFWA 3DLZA 1VR2A 3RPSA 5BVKA 5LVPA 5CT7A 3CXWA 3PA4A 2O5KA 5HLWA 3QYZA 1KE7A 1PYEA 1Q3WA 1CKJA 3PRIA 1ZZ2A 3VRZA 3ZC6A 4HPTE 2BRHA 4IZ7A 4FG9A 4EK5A 3PPKA 2WTIA 4EHEA 4FTIA 5B0XA 5EYKA 5EW9A 2DYLA 1JWHA 4LG4A 4JL9A 2CGUA 2W17A 3FKLA 3FZTA 3LXKA 4PL5A 4AN3A 2HENA 2E9OA 5CAQA 2QO9A 5DVRA 5HICA 4R78A 4DH1A 4G3DA 3RP9A 3LFBA 2F7EE 4JR3A 2BTRA 4RC2A 1M7QA 3LFFA 3O96A 2QI8A 2WQOA 3GQLA 2YLFA 4EH5A 4TYHB 3TM0A 4H1JA 4EOQA 1DS5A 2VWUA 3KN6A 5CY3A 5M09A 2X9FA 1WBSA 2X7OA 2XKFA 4RIWA 4O2PA 3RNIA 4BCNA 3ROYA 3MW1A 2AUHA 4MWHA 4HNFA 3R8ZA 3IDBA 2RG5A 3IECA 4TWNA 3LXPA 2VO7A 4M67A 3CLYA 5HEZA 2Z7SA 4DHFA 3NPCA 3PSDA 2O63A 3NSZA 1UKIA 2WFYA 3KGAA 4H3BA 5CF8A 2X39A 3ENMA 3LE6A 4AZSA 4F9WA 2J4ZA 3F6XA 3NR9A 2P3GX 3OWPA 4RJ6A 2YITA 3H30A 1P14A 4CZTA 5LMBA 1OKYA 3OCSA 1WAKA 4JAIA 3RK7A 1YVJA 2YM4A 3LCSA 4QOXA 3VUMA 2QD9A 4D4SA 2CGXA 4Q2AA 3FLZA 4QP8A 5DWRA 3DS6A 2UW5A 2J0JA 4AZWA 3L8XA 4IVCA 3SG9A 4X3JA 1OM1A 1XH4A 2C5OA 2CJMA 2Z2WA 5HG8A 5ANEA 4EYJA 3O0GA 5BX0A 4MD8E 4DGGA 1TKIA 3CTJA 1MQ4A 4P7EA 4DTBA 2QVSE 5AV0A 3PYYA 4O83A 3Q60A 5IG1A 4GG7A 4UB7A 3MVLA 4KIOA 3I6UA 3SA0A 4FSZA 4OTGA 3LJ1A 2WMUA 3G90X 3PPZA 4XUFA 5E7RA 5LVMA 2B9IA 3PE2A 2BFXA 4YBKA 3QTIA 4OUCA 4U6RA 4D55A 5ANIA 4K6ZA 3ORMA 1WZYA 3D7TB 4RX7A 2PZYA 4X3FB 2BUJA 2OGVA 3C7QA 3II5A 5B2MA 4NYEA 3IGOA 3Q9WA 3NCGA 3NMUF 4P5ZA 4YJUA 3ZM4A 4RX8A 2IW6A 2G2FA 4NIFB 3AC8A 4EOIA 4KIKA 4GIHA 3P0MA 3UE4A 4CSVA 3BIZA 4DFNA 5E1SA 3U6JA 1YOJA 4BDGA 4FYOA 3OCBA 2CNVA 3LLAA 5DGZA 2UW3A 4I6BA 4R3RA 3CGOA 4BZNA 2GDOA 4IM3A 2RSVA 3GOPA 4KRCA 2XZSA 3O71A 3M2WA 3PJ3A 4J99A 4C34A 5A4QA 2CKQA 4FOBA 4RMZA 4DE4A 5LVNA 4MBLA 4JIKA 3NUUA 1UWJA 4JDJA 4M69A 2ITUA 2XCHA 3PWYA 3H0ZA 2ETRA 2W1IA 4HGLA 3TG1A 2IVTA 2XNOA 4PTCA 3VS0A 3QQJA 5KMKA 4DFUA 4G3CA 3ZZEA 4BI2A 2R3IA 1OUYA 4GT3A 4ALVA 2JBOA 4MNEA 2E9PA 3RGFA 5L8KA 4O7WA 3UOJA 4IANA 2V22A 1H26A 3COHA 4FOCA 3HAVA 2JDOA 4OBQA 4OBPA 4YLLA 5IF1A 5EYCA 5JMSA 2NNWB 2R3MA 3OW3A 5C01A 4ITJA 1Q99A 2J5FA 2B0QA 4BDAA 3R8VA 4AWIA 5L6WL 2BRGA 5IEXA 1XWSA 3R1NA 3U9CA 3GCQA 4FV7A 2R0IA 2BR1A 2Y9QA 3DY7A 3COMA 3F5XA 4BICA 4C4JA 5A9UA 3Q6WA 2UZOA 5KMOA 4NM3A 4XG2A 5CXZA 4LM5A 2G2IA 3TNQB 3JYAA 5CYIA 5AP7A 4UYNA 3DJ6A 3JY0A 4FGRA 2QOHA 3NYXA 4XOYA 1OL7A 4AGWA 4RFMA 4NL0A 4RJ8A 3LXNA 4JG6A 2ETMA 3CQEA 4ANBA 4GJ2A 3AD4A 3TL8A 2JKMA 2UZLA 3F5GA 1J91A 5BVNA 2W5AA 2I6LA 4PTEA 4UY9A 4FT9A 4QQJA 5FM3A 3BHVA 4XOZA 4HVIA 4BRXA 1GZ8A 4RC4A 2IPXA 3ETAA 2GNLA 3P7CA 3TKHA 3ZMMA 4H36A 3PLAE 4FKGA 4QD6A 2WD1A 1PKGA 2RKUA 3QRKA 3GNIB 5L8LA 3KA0A 4TZRA 1OVEA 2Z8CA 2IWIA 2EWAA 4IDTA 4MXZA 4FEQA 4LYNA 1QMZA 1ZZLA 4WKQA 4NSTA 3VBXA 3CEKA 4J53A 3NUNA 3U6HA 3F3ZA 4X2NA 3DZQA 3QA0A 2UVXA 4ZTLA 5AR8A 2GNHA 2BILB 1YWVA 4FL2A 4H58A 5FQDC 2A2AA 3SOAA 2WELA 3D0EA 3MPMA 3OHTA 2WMBA 4IQ6A 3CTQA 3I81A 5KO1A 4U97A 4M0YA 2X0GA 2PVRA 1GZOA 3N4UA 2OXYA 3W2PA 1Q24A 5AAEA 2OO8X 3DCVA 4HYUA 4RIWB 5I9UA 2WXVA 1H08A 5E8YA 3MJ2A 5CVFA 3B2TA 1MRYA 4MHAA 3E8CA 4KBAA 3TIZA 2XKCA 5CF4A 1G5SA 5HCYA 5I9XA 3NUXA 4ZOGA 2OJ9A 1KV2A 3F3UA 3R02A 3TKIA 2B55A 3E63A 4XRLA 2VX3A 3RHXA 5T3QA 2Y6OA 4O27B 4V04A 1UU7A 1M7NA 4IC8A 3ZUUA 4ALUA 4EK3A 4ZK5A 3KMWA 1ZYLA 5DR9A 4J98A 3EQPA 4AN9A 1PXOA 4G2FA 3FMDA 1E1XA 3D2KA 1GZKA 3PUPA 4U40A 3ZBXA 4D5KA 1O9UA 3ALOA 5AJQA 3ET7A 4LMNA 3KXXA 1YXUA 4IZYA 2B53A 1NXKA 2VTHA 3MFSA 4KINA 4O22A 3CC6A 5DRBA 5CS6A 4YJPA 4IFCA 3P7AA 1WBWA 2JIVA 4GV1A 5AUVA 4YGAA 3EL7A 3KXGA 3R71A 5AP1A 3P7BA 5HTCA 2UW6A 4PDYA 2WMTA 3JXWA 3KRJA 1BL6A 3P79A 3WZJA 2R3OA 3PPJA 2YIWA 4XG4A 4K2RA 4QMNA 4ZY4A 1X8BA 2IZRA 5AADA 3L8PA 5HE2A 4FE2A 3AXWA 3V5TA 2VWVA 1CKPA 4D2WA 4F9AA 2AC5A 1PMUA 2WMRA 5IA5A 5C26A 1W83A 4I20A 5JFXA 5JEBA 5AV4A 4LMUA 2EB3A 2FSLX 5EFQA 3EJ1A 3UPZA 4WHZA 4R77A 3R28A 3LXLA 4KIKB 4G5PA 1ZY5A 5M4UA 3R1SA 5C1QB 1XJDA 4Z55A 3FQEA 2BPMA 1JSVA 1H1RA 3MTFA 1ZYCA 5DRDA 5AR2A 5AX9A 5K5NA 4F65A 1ZWSA 4DAWA 4PMMA 3C4WA 4OGRA 1PF8A 5AAFA 4KUJA 5LCJA 3C0GA 2GNIA 3C9WA 3N9XA 5GJDA 5IQGA 4XS2A 4IX5A 5CT0A 1YHVA 3M11A 3UJGA 2XK8A 4ALWA 2ITVA 4QP3A 1H1QA 5F9EA 4O91A 4QNAA 4EWHA 2WO6A 4Y8DA 3BELA 4M68A 5CANA 2IZSA 4M69B 2C6OA 1Z57A 4TKSA 4MKCA 2VU3A 2BIKB 3R2BA 4LGGA 5ACKA 5D10A 3KVXA 4JX7A 2WMQA 2ZV7A 3LCOA 4GVJA 5DT4A 4GSBA 1KE6A 3DV3A 3MFTA 3R73A 5C8MA 3MY1A 3R1QA 4FTCA 1UVRA 4GJ3A 3IK3A 4FKLA 2RF9A 4MNEB 4DEBA 3ULZA 4DEIA 1UNHA 3G0FA 3VBTA 2JDRA 3EYGA 3UIBA 1ND4A 1FVRA 4QPSA 4O7RA 3PA3A 3I5ZA 4I21A 4WNOA 3TKUA 4BIEA 4DH3A 3JVRA 5I9YA 3ENHA 4C62A 1JKTA 3DA6A 4MX9A 3RAHA 3LFDA 4FEUA 3M1SA 3PP1A 4ENYA 4FKSA 2Z60A 4DG0E 2W7XA 2ZM3A 2R5TA 5IQIA 2JFMA 4R7IA 4S31A 5AR3A 4USDA 5ANGA 4HVDA 5IDNA 4C7TA 4C2VA 1PY5A 1Q8TA 2YJSA 1CMKE 4KD1A 2UZVA 5EYMA 4D58A 4YU2A 1GY3A 4PL4A 4XEYA 3KMUA 3E3BX 4XP2A 5IA0A 1REJA 3HRBA 1AD5A 3QZFA 3V04A 2J6MA 3OF0A 2B7AA 3OUKA 3Q52A 4FUXA 4ONAA 2VX1A 4XYFA 4NEUA 4FTUA 4C3PA 3MPAA 3Q53A 5M57A 5KMMA 2XNBA 4L3LA 4QMZA 4V0GA 2B9HA 3KCKA 1H25A 4K0YA 1Q8ZA 4RJ4A 4YZNA 3DBFA 3K5VA 5DT0A 5IH6A 3O8TA 4FT7A 4NKSA 3NAXA 4HYHA 4P90A 1DAYA 3K2LA 1ZYDA 4MWIA 2AC3A 4CFUA 2Y4IC 2JC6A 4FVPA 4F09A 5EKOA 4CTCA 2XK3A 4IVAA 4FNYA 3PXZA 4ZLOA 2BMCA 2GQRA 4TYIA 2XB7A 1SVGA 3BHYA 4NM5A 3F7WA 5LXMA 4EK4A 2YN8A 2VTMA 3CP9A 3L9MA 4JDKA 4ITIA 1OPJA 3ZHPC 4AQCA 4AW2A 4J8MA 4L43A 3VQHA 3ZLWA 5CU2A 2PUNA 5ETIA 3MV5A 3PSBA 1JOWB 4QMQA 3OC1A 3MSSA 3NUYA 3FI3A 5CENA 4MXAA 4HVHA 5L8JA 2X8DA 2R3HA 5FDPA 4ZEGA 4L67A 5L2TA 4HZSA 4JNWA 3DBEA 3GU4A 3OXZA 4O2ZA 3QRJA 3VBVA 4YJOA 3QRIA 3ODYX 4V01A 3NAYA 3PJ8A 4MEDA 4CRLA 3EB0A 4UMQA 3OOGA 4D1ZA 2UZNA 2PZRA 5HU3A 5CI7A 2VTAA 2XMYA 4ZY6A 3SW7A 3FSFA 4FKQA 3VC4A 1U4DA 3MVMA 3U6IA 2IZTA 4FTAA 4YP8A 4WRGA 3DGKA 2PVNA 4GYIA 4BIDA 1PMEA 2BRMA 4ZSAA 3RVGA 3WILA 2YM6A 3QTUA 1NVRA 3AQVA 4M15A 4WNPA 4ERKA 2CNUA 3HP5A 2JLDA 3EN9A 2XKDA 3MA6A 1YQJA 3EFKA 3P9JA 3QTZA 4RWLA 4FK3A 4CFWA 2VWYA 4FZAB 3IDPA 2I1MA 2VO0A 5I3OA 4WD5A 3V6RA 3LCKA 3C4CA 3DJ5A 4D2SA 3U54A 1SVHA 4N57A 2FUMA 4RC3A 4ANOA 4RVMA 2WEVA 3BYOA 5AUYA 4W9XA 2XM9A 4GRBA 4BGGA 4CYIA 5IUIA 3C4EA 3KC3A 1WBTA 3R7YA 2HWOA 1YW2A 3D83A 4UMPA 3S00A 1BKXA 2JBPA 2BAJA 4Q5EA 3WF5A 3BLHA 1WVXA 5DLSA 1P4OA 4BGHA 5J7HA 4MXXA 1MUOA 3RZFA 3BYSA 1Q4LA 4IACA 4ZIMA 4ZLYA 3UNKA 3THBA 5IMEA 3NEWA 3OBJA 4JI9A 3UOKA 2EB2A 4YSJA 5DR2A 1FMOE 3BHTA 3OTVA 4XCUA 5DBXA 4HPUE 5F20A 4AUAA 2A19B 4KAOA 2P2IA 3HECA 4AZFA 2YIYA 3ZXTA 1XH9A 3QCYA 4HJOA 4GT4A 3NUPA 4N6ZA 4U5JA 4R7BA 3L8VA 3UGCA 1B39A 1L8TA 5ANJA 5KMJA 4YO4A 5DFPA 2VNYA 2CGWA 2XJ1A 1KE5A 1PMNA 2QG5A 1PXJA 2JKQA 5HG5A 1XKKA 2IZUA 1IAJA 4YUQA 5BVFA 3A62A 3SLSA 3R7VA 4E5AX 2FSMX 3SQQA 3VQUA 4BYIA 4JX3A 4XBUA 2C3JA 2YM8A 1TQPA 4ZTSA 4E8AA 4RFZA 5AM7A 4O0TA 5T68A 2JAMA 4FV1A 4KA3A 4D0WA 3WE8A 4UMUA 4MXOA 2ITTA 3RWPA 2XM8A 4GKHA 1Q61A 1SM2A 4BCKA 1H4LA 5FEDA 4HGSA 2C69A 4BWXA 4G5JA 3MN3A 2WTVA 2VV9A 5LMKC 1U54A 1IG1A 2F2UA 3U87A 3SGCA 5EM5A 2GFCA 2HYYA 4IVBA 4U44A 2HOGA 5BVEA 2PZIA 4IX6A 3DBDA 4AZEA 4MVFA 4D28A 2UV2A 4MXYA 3OY1A 5CEPA 4KBKA 2IVSA 5KE0A 4WNMA 4EH2A 4N70A 1ZMWA 2PHKA 1FQ1B 2YCFA 4TYHA 4KABA 2WQNA 2PE1A 5AV3A 4C38A 3IW4A 4J52A 2J5EA 4MF0A 3TI1A 5HTIA 4FBXA 2WIPA 3BE2A 2C0OA 4FGBA 3ZU7A 3GOKA 3HL7A 1WCCA 2OFVA 4TNDA 5CNNA 4F4PA 4FIGA 3LIJA 4QT1A 4TWOA 4HGTA 4RJ5A 4RPVA 3V01A 2EU9A 3QC4A 2R3FA 3CR0A 3QQFA 5E8UA 5E8TA 5HG7A 2XF0A 4EK8A 2XIXA 4CFVA 5IEVA 4FTMA 1PW2A 1OUKA 3HDMA 3A7HA 5DH3A 5KZ0A 4DLIA 3VS7A 2UW8A 2VTSA 3BLQA 4IW0A 4V0GB 5I9WA 3VS5A 5AP0A 4DINA 3FMNA 2PUPA 4BCJA 4NJ3A 2UVZA 4A9SA 2C6MA 3BHHA 2VRXA 4ASZA 4MQ1A 3TXOA 2I7QA 5KBQA 3U4WA 3I7CA 3UIUA 2W96B 3OWJA 3QD3A 2VTJA 4IZAA 2Q0BA 4L46A 4Y46A 5CSVA 5FP5A 4CMTA 3ZS5A 3WIKA 4QMWA 2CN5A 3QD4A 3R9HA 2VTNA 3NVKI 3GFWA 4MF1A 2WMWA 3IG7A 2VX0A 5EDPA 2YIQA 3BU3A 1OMWA 4BDEA 3BGZA 3KRWA 3UP2A 4GK2A 4AE6A 3I60A 3LFNA 4FTTA 4AOTA 3TTIA 3UBDA 4BWKA 4BKYA 3D7TA 1JSTA 3KN5A 3KRRA 4AN2A 3ERKA 2ZDTA 4AOJA 2NRYA 4BYJA 4F7NA 4W8EA 2OW3A 3WBLA 5K4JA 3QWKA 3NYVA 1OITA 5I9VA 4O7LA 3LQ8A 4RWJA 5BMSA 4DLJA 4UWBA 5G1XA 4E3CA 3DAJA 2GHGA 4L52A 2PMLX 4EKLA 3EOCA 1BI8A 1PXKA 4EH7A 2XNMA 3F69A 4WO5A 4I41A 4Z9LA 2Y8OA 4FNWA 3VJNA 5CASA 4NCTC 4C4IA 4FEWA 4K11A 2FSOX 5AP4A 3PE1A 1YRPA 3C50A 4FL3A 4EOSA 3LM5A 4P4CA 3G0EA 3NW6A 1WVYA 5J79A 1APME 1H0VA 3DPKA 4PMSA 1H27A 2YEXA 4XP3A 3RAKA 2YLEA 4OTDA 4AS0A 3ZONA 4S34A 2G15A 5CAVA 5HU9A 3QCSA 5FUTA 2X81A 3C4XA 3I4BA 3FL5A 3MH0A 3BYMA 4YPDA 3UVPA 3V8WA 4A9TA 1MQBA 5EHOA 3P4KA 3TZMA 4I3ZA 4CEGA 3BZ3A 4D1SA 5LCKA 4U79A 4UWCA 4BBMA 2KULA 3DBQA 5EW8A 5B7VA 2GS2A 3QA8A 3VAPA 4EHVA 3S1HA 2YAAA 5IQBA 2ZOQA 4ANSA 4EUTA 3MESA 4FT5A 1G8AA 3GUBA 3B8RA 1M17A 4KS7A 2CDZA 4I6QA 3R7IA 3I0QA 4E6AA 2REIA 4MBIA 1FGKA 3NNXA 4IAAA 4YJSA 3UNJA 3DDPA 3R30A 2W1FA 4QMTA 4ACMA 3ANRA 2OJGA 4BCQA 2Q83A 3BYUA 3L9NA 4JRVA 3IS5A 3F88A 3MH2A 4C58A 4QPMA 4C3FA 5LMAA 2HZIA 4FSRA 4YJVA 1JKKA 1T46A 4IX3A 3L9LA 5FRIA 3LKMA 1GOLA 3ZYAA 3NW7A 5FBNC 2PMNX 2XIRA 5DMZA 4LI5A 2X8EA 5I0BA 3GCVA 3SAYA 2QHNA 4GU6A 2RFNA 3DK6A 3W2SA 2HAKA 3E62A 5AP6A 4F1TA 4O0WA 1NT2A 3QTQA 4YZ9A 2QU5A 2R9SA 4JS8A 2PZ5A 3VW6A 3DFAA 3UODA 2P0CA 3V8TA 2I40A 3SOCA 3FSKA 4KSPA 4QMSA 3WZUA 5FEQA 4UBAA 3VS3A 1OECA 3O7LB 4RFYA 4YZBA 4YJTA 3LAUA 4XLIA 3SXRA 4ANQA 4BDBA 4H39A 3PTGA 1Z9XA 3O8UA 2VN9A 5HO7A 1VEBA 3C0IA 5CSPA 3ZFYA 4EEVA 1HCKA 2XK6A 4F9CA 4H05A 4R3CA 1U54B 4I0TA 2XJ0A 2WIHA 5AUTA 3ZC5A 5KMNA 5ITAA 2JKOA 2QU6A 3NYNA 4AA0A 2NP8A 4F1MA 3PVBA 2C47A 4B8LA 4EH4A 4LOOA 3OMVA 4QMLA 3PJ2A 4E26A 5E8SA 4ZS4A 5A4EA 3DQXA 3GB2A 3SX9A 2VWXA 4BB4A 4HYSA 3UYTA 5IQAA 4DFBA 3EL8A 2ZM1A 4ITHA 2YACA 4QTDA 4ACDA 4BDFA 4D2RA 1UU8A 2V5QA 1BMKA 4QP9A 5CVHA 2ITZA 5AR5A 4ZAUA 4FT3A 5F1ZA 2R7BA 3RK5A 5DE2A 5GZ9A 5EM8A 5HORA 4X3FC 3ZM9A 2B54A 5H8GA 2XEZA 3ORPA 5DIAA 4KIPA 4NW6A 4ZMEA 2VGPA 4BCIA 3UDBA 3NS9A 4E73A 5CX9A 3HVCA 3KVWA 3VF9A 5IQHA 4DTKA 2PYWA 4M84A 4PDSA 5CEKA 3ACKA 4BCPA 3OT3A 3V5LA 5HNGA 3UOLA 4BN1A 2GQSA 2PVMA 3TTJA 3H3CA 1MRVA 3CPBA 3O2MA 3F2RA 3RAIA 1NY3A 1BX6A 2WTKB 5K0XA 3EH9A 3KB7A 3R8PA 4KSQA 4M8TA 2RFSA 4C33A 2JIUA 4JIAA 3KK9A 5LARA 5K3YA 4IAZA 4WSQA 2H34A 2F2CB 3BBTB 4R5SA 4RX9A 1F3MC 4FODA 3WF6A 4FKVA 4TT7A 2ZV8A 3ZFMA 4AOIA 4Y5QA 5DNRA 2VWIA 4I93A 3QLFA 4RA4A 4U3YA 2Y4PA 4B6LA 3PY0A 3GBZA 3LJ2A 2XIKA 1KV1A 2FYSA 1S9IA 2QG7A 2E9VA 3DK7A 3G6GA 3QXOA 4U3ZA 3QLGA 5EDQA 5IA1A 3QCQA 5CQWA 5IQFA 3PSCA 3ZLXA 4CNHA 1OKVA 5AM6A 3EFLA 2HWPA 1UKHA 4L45A 1Q41A 3ZCLA 4A06A 1M2RA 2R3PA 1W0XC 2UZWE 3GC8A 3Q32A 2RG6A 4RG0A 4W4VA 4YHJA 3RPRA 4NH1A 3NX8A 1JLUE 3PP0A 3KEXA 5F94A 4OTQA 1OL1A 3PIZA 1LR4A 4FV5A 2J0MB 3GT8A 4GK4A 3NDMA 3VBYA 3GFEA 4B99A 2OIBA 5AA9A 5CLPA 4UXLA 5CVGA 2QODA 3V5WA 4J71A 1QPJA 3W32A 2X2LA 4A07A 4DGNA 3T9TA 2QOOA 5C8KA 2ERKA 4FSUA 4WBBB 2JIIA 3OWLA 4EH6A 2G2HA 3TZ7A 3RK9A 2WZJA 4FTJA 4QPAA 3TV7A 4O7ZA 3IPHA 4BDKA 2FSTX 2ITPA 4ZXTA 5HTBA 3FQSA 2X4FA 3HGKA 4LRMA 2HK5A 1ERKA 4DFXE 2FO0A 4FTKA 4C4FA 4UN0C 3LLTA 1XH7A 4YNEA 5EK7A 4WG5A 5HE3A 2CPKE 3QRUA 3W10A 2UW0A 3CE3A 2W1CA 4D4YA 3C13A 3ORXA 1U46A 2ONLA 3C51A 4NK9A 3G9NA 1IA8A 3FHIA 3QZIA 2J0IA 4U7ZA 5AX3A 2YDJA 4IIRA 1ZMVA 5TO8A 5BVDA 3FYJX 3IW6A 3DFCB 5AMNA 5JZNA 3V5QA 3D9VA 4WBOA 2CKEA 3ZEPA 2F7ZE 3KREA 3QC9A 3RJCA 2BHHA 3ZEWA 2RL5A 4C57A 3E8NA 1W82A 3AC5A 3F3WA 4M3QA 4IDVA 1KWPA 4TYJA 4ACHA 4O7NA 3U9NA 3UTOA 4N4SA 4FI1A 4B4LA 4CFMA 5LWNA 3CTHA 4RJ3A 3LQ3A 4MYGA 4EH9A 4R5YA 2O3PA 4A7CA 2FH9A 3CQUA 3R00A 4XP0A 3L1SA 2XVDA 3ZLSA 3FJQE 4EC9A 3E3PA 4YNOA 4C3RA 2YWPA 4YSMA 5JKGA 2QLUA 3HV3A 5J5TA 1HCLA 2VGOA 3EZRA 2BKZA 4FC0A 3CD3A 4BCGA 5CF5A 5HNBA 4G31A 5E9EA 3DZOA 4D9TA 4EK6A 3QL8A 4NM0A 3O50A 2LGCA 3G2FA 2BRNA 4J96A 3WOWA 5JT2A 5FP6A 2FGIA 4FV6A 3PIXA 2EXMA 3EYHA 4TYEA 3E93A 5EDRA 1Q5KA 3M42A 2I0YA 2F9GA 4IMYA 4FSNA 4JJRA 3W1FA 3E64A 3TV6A 3UYSA 4CRSA 1O6KA 2Z7RA 1STCE 3EN5A 4XHKB 4HCTA 5A6OA 5BQ0A 3UC4A 1SNUA 1VYWA 3G51A 3Q2MA 1OBDA 2VTRA 3RI1A 3TZ8A 3QUEA 3NUAA 3LFEA 4RA5A 4FZFB 2B1PA 2VD5A 3QZHA 5A4CA 3SG8A 3OY3A 4E6DA 5IMXA 2QKRA 1SZMA 5E8XA 1BL7A 5DN3A 2XS0A 2GMXA 4U81A 3LPBA 1ATPE 4R1YA 2CKPA 3GU5A 2LAVA 5M51A 3G5DA 3OEFX 4TNBA 4HNIA 3EKNA 5CSHA 2VTPA 5TKDA 4CFXA 5AIRA 2QKWB 3F82A 3KQ7A 4JDHA 4PTGA 3OROA 2VTLA 4I94A 3AT3A 2X4ZA 4NTTA 3S2PA 2BDWA 2CCIA 4FIHA 3CSVA 1CSNA 2X6DA 2HXLA 3BPRA 4JR7A 4BTJA 3F7ZA 1ZOGA 3COKA 2IVVA 4MTAA 2PMIA 4BI1A 2C1BA 2AYPA 4JG8A 3D5WA 3FI4A 2Y6MA 3FEGA 2OF4A 3KCFA 2GTMA 1DI8A 1KE9A 5EOLA 5TT7A 5BUIA 4N0SA 4LGHA 3V8SA 1QPEA 4CQGA 3RPYA 3QQLA 2QO2A 3QF9A 5E8WA 4FIJA 4TWPA 5JQ5A 4H3PA 3ZBFA 1Q8YA 3BQRA 5KMIA 4D0XA 1Y6BA 5HO6A 4AT5A 3MWUA 3BX5A 5B2LA 4FKPA 1O6LA 3ZUVA 5HGIA 4O0UA 3D14A 3COIA 4EHZA 4BY9E 2ITOA 2Y7JA 2R3LA 3ORKA 3PJCA 3QD2B 4MAOA 3DB8A 3W2RA 1BUHA 4J95A 3R8LA 4D5HA 4O86A 5K0KA 4QTEA 5HKMA 2PSQA 3BEAA 3ZRMA 4YMJA 4QP7A 4BDIA 4ERWA 3UZPA 5H8EA 4C0TA 2BDJA 5HD4A 2VTQA 4CD0A 4QMMA 2HW7A 2C6IA 3AMYA 3DNEA 2IO6A 2PVKA 3MI9A 3HMPA 4GMYA 4M13A 2DQ7X 5AV1A 3ANQA 3SRVA 5IZFA 4FZ6A 2VTIA 5HVYA 3OOMA 3HRFA 4EOOA 3FDNA 3FBVA 3ORIA 3W2CA 4MCVA 5HX8A 4WOVA 5JGDA 2I0EA 4EC8A 2JAVA 1NVSA 3BI6A 4FTQA 2ESMA 3A99A 2VNWA 3FL4A 3HMMA 2R3QA 5KKRC 4CKJA 3I79A 2VWZA 3O7LD 2ZV2A 3DNDA 4IX4A 1M2QA 5I4NA 2RFDA 3C0HA 4RLLA 4AGCA 3ZDIA 5D7AA 4C37A 3FMMA 5FTGA 2GQGA 4IC7A 5HESA 1OGUA 4BI0A 3A4OX 4OTWA 5EM7A 3PJ1A 3CQWA 4RSSA 3LZBA 4QQCA 2PVFA 3QXPA 4F99A 1A48A 4O84A 1LEZA 3A7GA 4FSTA 3MB7A 3UP7A 1PXNA 4PP7A 4QYHA 4IB3A 1H1WA 2P55A 4KNBA 4FEXA 5E90A 4CYJA 1U5QA 4AT3A 2WB8A 4DEDA 2B9JA 4O7TA 4TYGA 5CZIA 3ZRKA 3K3JA 4LQMA 3D7ZA 3KRXA 2BAQA 3MGYA 3VBQA 5M55A 4L3JA 2GU8A 5JGBA 3TUDA 2OWBA 1XHAA 4D2VA 4ZTNA 3Q04A 4IB1A 4EUUA 4IAFA 4GW8A 3QU0A 3VUDA 3S0OA 5HIEA 3NZ0A 4JG7A 5TE0A 4IH8A 4QYFA 3QYWA 3UQFA 1IEPA 3GEQA 3EQCA 4YHFA 5LQFA 4KS8A 3IQ7A 4LV8A 3GU8A 1V0BA 2A27A 4FTOA 5A54A 4DBXA 5EG3A 5E1EA 4YTHA 3PA5A 1JSUA 1FOTA 3FMEA 4DFZE 3KL8A 1CDKA 2GNGA 1J1BA 1P5EA 4GFMA 2X9EA 4WUAA 3AT2A 3ZO4A 2JFLA 1GIIA 3BGQA 3TNIA 4UYAA 1UU9A 4RBLA 4WNKA 1YDSE 3KXHA 4CXAA 2O2UA 3PZHA 5GJGA 3ZSIA 1UWHA 2I0VA 3EIDA 4NT4A 3T9IA 4E4MA 4DTAA 3RM7A 4YZDA 5EW3A 5DR6A 4QMYA 4MBJA 3QKKA 1ZYSA 2YCRA 3K54A 3AC4A 3ORTA 3HV5A 4IXPA 2PE2A 5ANDA 3FPQA 2XBJA 1L3RE 5L2IA 4HOKA 3FZSA 5CXHA 4KKGA 4D4RA 4OTFA 2YERA 4W4XA 3RHKA 3DDQA 2XCKA 1A06A 4HCUA 4G6LA 2WTDA 4CCBA 2GNFA 5DOSA 4CGAA 2ZB0A 4I5HA 2W99B 4QP1A 3DXPA 1RE8A 2P4IA 2YFXA 3FMKA 3F9NA 2XRUA 3PXQA 3HV4A 5L2QA 1OZ1A 3BE9A 2BAKA 4JOAA 2CN8A 5AFVA 4L6QA 4V05A 4UZDA 3R8UA 3ATSA 1JPAA 4C59A 3AGMA 4DC2A 3UO5A 2O0UA 1OL6A 3FLSA 2X6EA 3R2YA 4D2TA 3OVVA 4AXAA 1XBCA 2CHLA 3HYHA 1Q3DA 5ACBC 4OT6A 2OIDA 3VUTA 3R22A 2CNQA 4EKKA 4PUZA 3QTXA 4X6QC 2Y0AA 4NWMA 3BWFA 2XNNA 4ANMA 4RZWA 3NVMB 5M08A 4WIHA 4FSWA 3TACA 2CLQA 4NKAA 5E8VA 1FBNA 4L53A 4YTIA 4KB8A 4MNFA 4L9IA 1OL5A 5AUUA 1B6CB 2C6KA 3R21A 4KWPA 4JVGA 3VWAA 4AP7A 4II5A 4FIIA 1NA7A 2J0KA 1R78A 3HA6A 3O23A 5CU4A 3TWJA 4OAUC 2XNEA 4Z7GA 4XH6A 4ACCA 2J51A 5KCVA 1XBAA 4YC8A 1Y8GA 4LUEA 4QMXA 3PY1A 2J90A 2R4BA 3PVUA 5CSWA 4E6QA 2YDKA 4PDOA 3VULA 4CT2A 2BZIB 3N4TA 4EI4A 4BC6A 4IAIA 4YC3A 3OCTA 4HCVA 5AP2A 2Z7QA 2OJIA 1XH8A 3ZXZA 2Q0NA 4AT4A 2UUEA 5CQUA 5HIBA 4I5CA 3WIGA 2OSCA 2CSNA 4IM0A 5D41A 4IB0A 3R83A 2OXXA 3SRVB 3BEGA 2WQMA 1YXXA 4L8MA 4USEA 3CJGA 5EI6A 3TN8A 4RIXA 4ZMFA 1SVEA 5HD7A 4UMTA 3RZBA 5IA4A 1WBPA 2XUUA 1UU3A 4GVAA 2PL0A 4JQ7A 3Q6UA 4MXCA 1IR3A 2X7GA 2UVYA 4CMUA 2WNTA 1O6YA 3LCTA 5DEYA 3QALE 2OKRA 1Q62A 3RPOA 3UOHA 5BNJA 2HY0A 3PWDA 4A4OA 4Q9ZA 3HNGA 4A4XA 3FXWA 3GU6A 1Q8UA 3CBLA 5M44A 4W4WA 4WG3A 3UMWA 4EOLA 4FTRA 4LL0A 5EHLA 3DAKA 3MY5A 4G1WA 4EHGA 4F63A 5J9LA 2RFEA 2YZAA 3EFJA 3PIYA 4RX5A 3QKMA 2XBAA 2QR8A 5M53A 3MJ1A 4I6HA 4ASXA 5EI8A 4EL9A 3QUDA 2X2KA 1IRKA 2E9UA 3NLBA 4ZTQA 5HQ0A 4AW1A 4EOKA 1T45A 3BWJA 2WTWA 3H4JA 4DITA 5CSXA 5L6OA 3BV3A 3P23A 3MBLA 3R8MA 4EORA 4IWOA 1LPUA 4Q5HA 3PZEA 3W2OA 4CFNA 4Q9SA 5AWMA 5K4IA 1SYKA 2JKKA 4D1XA 2QO7A 4L44A 4WSYA 4C4EA 2WMAA 3RALA 2YDIA 3ZTXA 2WQEA 2W4JA 5EHYA 1J7LA 1GIHA 3C5UA 5HI2A 3VNTA 4RLKA 4CLIA 3PLSA 4CZUA 3PG1A 2C68A 3QHWA 4F6WA 3CJFA 3WZKA 2PTKA 5DT3A 2IJMA 5HVJA 2H9VA 3R63A 2OU7A 3TUCA 4DG2E 4BBEA 2GCDA 1ZARA 4O6EA 1EH4A 5TOZA 3I6WA 5HX6A 3ZO1A 2R3JA 3AG9A 4IJPA 4AF3A 4O0RA 3KF7A 4ZJVA 3MIAA 3OFMA 3GP0A 3LHJA 3R7OA 3D2IA 2ITWA 5J9YA 3WYYA 1K3AA 1LEWA 1YXTA 5BVWA 3VHKA 4G9CA 2OZOA 2XNPA 3GC7A 2R3RA 5A46A 2DS1A 3IW5A 4IFGA 5D1JA 3W18A 4XX9A 3EQHA 5ETFA 4FKTA 4RRVA 2QOQA 4F7SA 2YCQA 3JPVA 3MH3A 2W5BA 4FVQA 5HLPA 3NYOA 3G15A 3ALNA 4FK6A 4XG6A 4AW5A 4E5WA 5EH0A 1CM8A 3VBWA 2C5YA 4OAVB 4GIIA 1PYXA 3ACJA 5A3XA 4TN6A 5BPYA 2OZAA 3AGLA 2VO6A 3KKVA 4EBWA 4JBQA 5CEOA 3UPXA 2NO3A 4BFMA 4M0ZA 5H9BA 4I5MA 4YJRA 5BVOA 2PUIA 5EQYA 4EBVA 3FZRA 3HLLA 1TQMA 4YC6A 3F61A 5CZHA 5J1VA 4EJ7A 1WBOA 4EYMA 1F0QA 4DBNA 2UW7A 5K9IA 3E7VA 3SD0A 2ITYA 4F1OA 4K18A 5CU3A 5JRQA 3CGFA 4QNYA 3FHRA 3QQUA 4LOQA 2XA4A 3NCZA 3O8PA 4I0SA 1PXPA 1YDTE 3U8WA 4M12A 5AUWA 2H6DA 1JAMA 3POOA 3MH1A 5IEYA 1G8SA 4BTKA 4QMVA 2X8IA 1PJKA 1AGWA 2EVAA 3G9LX 1YWNA 2ITXA 3NIZA 5KZIA 3ROCA 5C8NA 5I9ZA 2JDTA 3P1AA 4G16A 1PXIA 2C0TA 2QOCA 3VUGA 3AD5A 4GCJA 5M56A 4Y73A 4CG8A 5D7VA 3MYGA 3OD6X 4YZMA 5FWKK 3EQBA 5CEQA 4XG7A 4B9DA 1YOLA 2W1ZA 2XYUA 5L6PA 4ID7A 4CQEA 3AMBA 1XR1A 4GH2A 1RQQA 5JN2A 5BUEA 5ICPA 3QTWA 2BRBA 3HAMA 2UZEA 1JQHA 4JQEA 4U45A 4CG9A 4GYGA 4P2KA 3Q9XA 4RZVA 4RIYA 5HBEA 4ZTMA 4TWCA 2WAJA 4CT1A 3TIYA 3FZPA 3N4VA 3LQ5A 3C4ZA 4W8DA 1Y91A 1YWRA 3ORZA 2WTCA 4Y83A 3POZA 2HZ0A 1MRUA 2W05A 3FY0A 4BDHA 4QMUA 5F95A 4XV3A 3DQWA 3RINA 3IGGA 4FKWA 2QHMA 4R7HA 4O0YA 4BGQA 2YAKA 4F7LA 3LMIA 2C6LA 4NJDA 5CAUA 3I7BA 3AC3A 4DCAA 1JKSA 5IUGA 1KOAA 2ZM4A 4GUEA 4O6LA 1ZOEA 3R7UA 4E20A 2VZ6A 2Z02A 2YCSA 4F9BA 4PY1A 5LVLA 4DH5A 4LRKA 3RCDA 1ZYJA 3FKOA 1OPKA 3PXRA 3ZDUA 2JD5A 1J7UA 4GL9A 3FI8A 5A14A 5CAOA 1KSWA 3IOKA 4IADA 5JZJA 3TDWA 3JY9A 3HMIA 4GT5A 4RIXB 5JQ8A 3LJ0A 2OJJA 1W98A 3DTCA 3WZEA 4AFJA 4PF4A 4S33A 3BKBA 1OIYA 3R9RA 1VYZA 3P5KA 4O21A 3ZUTA 1J3HA 4EZ5A 5HE1A 5FD2A 3WZDA 3KY2A 4GEOA 4ZLZA 5LVOA 3VJOA 3H9OA 3R9OA 4G6OA 4U43A 5GJFA 1Y57A 4NTSA 2BZJA 2JEDA 4ZZNA 4Z3VA 2ZYBA 3OS3A 3QUPA 2XIYA 4JQ8A 2WTKC 4FV8A 4E4NA 4F70A 3FPMA 5C4KA 3EN4A 5M07A 2QOLA 2ERZE 4FTLA 4KKHA 4BHNA 4EJNA 3A7JA 4I92A 4G3GA 4XJ0A 4DGLC 4FNXA 3SV0A 4MH7A 1RDQE 4H1MA 4LUDA 4RQVA 5EI2A 4BF2A 4Z7HA 1FVVA 2WOUA 3EQGA 3KXZA 3MB6A 3FMJA 4J97A 3SC1A 3V6SA 3WI6A 2IG7A 5AAGA 2W1GA 1GIJA 3R9NA 1PKDA 3BLRA 4F6SA 2BZHB 1DAWA 2IW8A 1F5QA 3LCDA 3Q5ZA 5H2UA 3TJDA 4DT8A 4XLVA 1YOMA 2YISA 3UO4A 2RGPA 4OTRA 2G9XA 4DH7A 5FGKA 4F64A 2VO3A 4FT0A 4UX9A 2VAGA 4O0SA 3EHAA 2R3NA 1H24A 5FTQA 3TV4A 1ZLTA 2J2IB 3NNWA 4YPSA 1GJOA 4EH3A 5AV2A 2PE0A 3AMAA 2A1AB 1QL6A 3VS6A 2JGZA 2OLCA 3G33A 1E1VA 3BU5A 2C3KA 2V55A 4QTCA 5IQCA 1OKWA 3QFVA 5IU2A 1MP8A 3SW4A 3DJ7A 1M2PA 2OJFE 2HXQA 5IH5A 4BTFA 4IJ9A 4F0FA 4QTAA 4RQKA 4K1BA 2QQ7A 1XH6A 2V62A 3K3IA 5H3QA 2XYNA 3FV8A 1YI6A 2BFYA 2OZAB 5KHXA 3HV6A 2YM5A 4R3PA 4PMPA 2QURA 3IDCA 3E8DA 4QP2A 3GC9A 3WARA 4F6UA 3PY3A 4PPAA 4EZ7A 5C9CA 2BROA 3UIMA 3VRYA 1U59A 1FGIA 5M4IA 3LFAA 3KMMA 3MFUA 1J1CA 2BZKB 3NWWA 4I23A 4M97A 4Y95A 4S32A 4AGUA 3OXTA 4BTMA 4EWQA 4BHZA 4LL5A 3A61A 3Q9YA 4E4XA 5K5XA 1QPCA 5L2SA 2PUUA 4GFOA 2C30A 3HMOA 5HHWA 1JBPE 3DU8A 4MD7E 5M4CA 3LMHA 3FXXA 2GPHA 4WA9A 1OBGA 3KRLA 5IUHA 4EQCA 1SNXA 1R1WA 3FQHA 5TF9A 2WTJA 2QOKA 3OP5A 3UQCA 1FINA 2GS6A 2NRUA 3P78A 5HO8A 5LWMA 2XK7A 4QYEA 5A6NA 3JS2A 1YXSA 2GHMA 4XNEA 5FTOA 1RW8A 4ZJJA 2H8HA 1K9AA 3CPCA 3KK8A 1R0EA 5HE0A 1H8FA 4BL1A 4PQNA 5JH6A 3E87A 3S3IA 4RIYB 4BVUA 1ZRZA 3K5UA 3S4QA 4H3QA 1URCA 5H8BA 4A4LA 4B0GA 3UZRA 5KKRB 4CKRA 3VO3A 3F2NA 1PMVA 2CLXA 3RAWA 2QOBA 4IWDA 1CTPE 1VJYA 4LGDA 4MD9E 1W8CA 3ZLYA 4AAAA 3BQCA 3UVQA 3FMLA 4I4EA 1GAGA 2WGJA 2PVLA 4XV9A 3VUIA 2PMOX 1XBBA 2GS7A 3VF8A 4PNKA 2HCKA 5GIOE 3HRCA 2A0CX 1E9HA 3ULIA 4FZDB 4EZ3A 4BDJA 3HUBA 3P08A 4BKZA 3NGAA 3EFWA 4PDPA 3PVWA 3ZFXA 2C6DA 5GHVA 4O0VA 3A60A 3UG2A 5GNKA 2XK4A 4QQ5A 1P2AA 3IOPA 2C6EA 2QOIA 4I1ZA 5J95A 4D9UA 3FLWA 3FY2A 4UV0A 4X2JA 1OPLA 2YABA 5AR7A 2W06A 3MFRA 2YHVA 3ZZWA 4DFLA 3CD8A 4U9AA 4NW5A 3QQHA 5DYJA 3BV2A 2XEYA 3EQIA 3DOGA 3JVSA 4FUYA 4HW7A 2BHEA 3EN7A 4ZSLA 4I24A 2QONA 4QP6A 3IO7A 3TCPA 4BBFA 5JSMA 2F57A 3D94A 3UC3A 2CCHA 3ZRLA 3QGYA 3N51A 2WMXA 4O38A 4AW0A 3W33A 5DHJA 4CLJA 4ZP5A 5M06A 3D15A 3GGFA 2ZMCA 4K9YA 1URWA 4K8AA 3FXZA 3PRFA 3W16A 5M4FA 3HKOA 2ETKA 4EOPA 4GFGA 1H1SA 4TXCA 3RKBA 2B9FA 3NW5A 4XMOA 4AZVA 2UZDA 4RVTA 5E4HA 3EZVA 2VWBA 3IKAA 4C35A 3AC2A 3DKGA 3TEIA 2UZBA 5KMLA 1U5RA 5IA2A 4PPBA 4QP4A 2VUWA 4CV9A 4FA2A 5J5SA 4ZY5A 1Q97A 3FLQA 3SVVA 2YIXA 2OICA 4PPCA 4S2ZA 3MY0A 4ORKA 3DLSA 5CI6A 4NFMA 3Q96A 4KBCA 4HVSA 5F4NA 4ANNA 3MVJA 2BIYA 2O65A 4LRJA 4WT6A 5IISA 2YM3A 2R2PA 4UXQA 4Y72A 4FVRA 4OT5A 4RIOA 3BYVA 5DPVA 4C4GA 1LUFA 3GQIA 4AG8A 3FZOA 3SXSA 5HNIX 1WBVA 1OB3A 3QTRA 2FA2A 1V0OA 2YIRA 5BUJA 1UA2A 4QTBA 5JFSA 2ZJWA 1NW1A 2OBJA 2R3KA 4DGMA 3DT1A 3TT0A 4YLJA 4JRNA 4J8NA 3GU7A 2O64A 5CAPA 3F3TA 3FKNA 3W55A 2C0IA 3LOKA 5E8ZA 4EOJA 4E7WA 3A8XA 1R0PA 2A4LA 3R1YA 3I1AA 2EXCX 3F3VA 2CKOA 3PXKA 4ZZMA 3Q2JA 4R1VA 4ZSEA 4AFEA 4Y85A 5CWZA 1M14A 3FWQA 3PXFA 3FUPA 3HV7A 1I09A 2PPQA 5JFVA 4KRDA 2XH5A 3NNVA 1ZY4A 1BI7A 2VWWA 4U42A 3FE3A 3LMGA 4PWNA 4PNIA 3S95A 4OBOA 4TY1A 4BIBA 3BBWA 5HBJA 3QQGA 3FZ1A 4O7YA 2XRWA 2X7FA 3IW8A 4FIEA 4O1PA 3W2QA 2JDVA 5IQEA 1G3NA 2GHLA 3F5UA 2PK9A 4EQUA 2ONLC 5J7BA 5J1WA 5ANKA 3GXLA 4DT9A 3HZTA 5IKWA 3QQKA 5AP5A 1V1KA 5HCXA 4HGEA 4BDCA 4D2PA 3BGPA 4GK3A 4OTIA 3WF8A 2VTTA 4G6NA 4BZOA 2BALA 4J1RA 3MDYA 3GENA 3I5NA 4FV2A 2R0UA 4L00A 3D5VA 3DKCA 1YDRE 2JDSA 2F4JA 4UZHA 4Y5HA 5CU0A 2QLQA 5FDXA 4JLCA 1FMKA 2I0HA 3UMXA 1S9JA 4CKIA 2J7TA 4FZ7A 4AE9A 4JT3A 3B8QA 3CKWA 3ID6C 3D4QA 1FPUA 1AQ1A 3AD6A 3A7FA 2ZVAA 3AOXA 3Q4ZA 4UALA 3RTPA 4CMOA 4FV4A 3QKLA 3Q3BA 1FVTA 2EUFB 5HG9A 3WF9A 5CEMA 3F66A 2PY3A 4N6YA 4I6FA 5CF6A 3ATTA 3LVPA 4WUNA 2W1EA 3F5PA 3RCJA 4E4LA 4FIFA 5EM6A 2CMWA 4U41A 4EOMA 4O0XA 1YI3A 4JBVA 3RPVA 2YA9A 3D5UA 5E91A 2IW9A 1ZMUA 2V0DA 1Y8YA 3B2WA 2R7IA 4UEUA 4FSQA 3Q5IA 4RVKA 4AX8A 5HVKA 2WPAA 3MS9A 2FB8A 2HY81 5D9HA 3A4PA 2C3IB 4ZJIA 3V51A 4G9RA 4JAJA 4L68A 3VIDA 4BWPA 3UZTA 2QC6A 2C6TA 3C1XA 4XRJA 5DG5A 5HZNA 4NM7A 2OIQA 2BDFA 4J7BA 3TDVA 3OT8A 4YBJA 3HA8A 4FKIA 4L7FA 4E6CA 5J9ZA 3NRMA 2GNJA 5FLFA 5KBRA 4O7SA 4C2WA 4QMPA 1H07A 3OW4A 4IB5A 3ZOSA 5AIKA 1KUTA 2QNJA 4L42A 5IPJA 4I4FA 2XNGA 3FLNC 3QAME 3TNWA 3OTUA 3F2AA 2PU8A 3NUSA 3OBGA 5BMMA 4FMQA 5HBHA 5LJJA 1JVPP 3ORLA 1WVWA 4IWQA 4YLKA 1YXVA 3R7GA 5ETCA 4GU9A 1Z5MA 3E92A 3EWHA 2WKMA 4NU1A 4BCOA 4DCEA 3QD0A 2P2HA 2W9ZB 3HP2A 5C03A 4C36A 3VN9A 2ITQA 1I44A 1UV5A 2HIWA 4LV5A 2P33A 3U51A 2OI4X 3DAEA 5GIPE 3MIYA 4JDIA 4CFFA 2R64A 4X2KA 5C27A 1XH5A 4X21A 4FSMA 3PFQA 3KFAA 4OW8A 3ORNA 5I3RA 1M52A 3AT4A 1DM2A 3UQGA 5HCZA 4Z16A 5IDPA 3RBWA 5LMKA 4U0IA 4CTBA 5EQEA 3KU2A 1ZOHA 3HX4A 4TRLA 4YTFA 4CCUA 3FYKX 4FYNA 1HOWA 5EQPA 3KULA 3FC1X 4M14A 2XKEA 2EXEA 1BLXA 3D5XA 3R7EA 4RGJA 1CKIA 3QX2A 4GG5A 2WEIA 4YO6A 3WYXA 1XO2B 2YWVA 1SMHA 5FXRA 3VS4A 4F0IA 4B8MA 2BVAA 3IW7A 3P86A 3DXNA 3TNHA 4D4VA 4OTPA 4EONA 5EYDA 2QR7A 4NFNA 1GZNA 4FSYA 4IE9A 3C5IA 5FEEA 4DA5A 1REKA 2XIZA 2XP2A 3PVGA 4FX3A 4PX6A 2OG8A 3CS9A 4FV3A 5FG8A 2QOFA 3OZ6A 3FAAA 5AP3A 3SDJA 3EQDA 4XV2A 3TNPC 4DFYA 4ARKA 3DBCA 3GCPA 4TTHB 2C5NA 4I22A 4FICA 1IAHA 2V7OA 3DXQA 4ZS0A 4ZSJA 3EQFA 5L2WA 1DI9A 1P4FA 4MK0A 4ACGA 1LP4A 3HEGA 4YHTA 4BCFA 2YZLA 5C4LA 4QMOA 4PRJA 4I0RA 4ASEA 5L4QA 1H01A 1PXLA 2PZPA 2WU6A 3GC0A 3LFSA 2UW9A 4AZTA 4B7TA 2W4OA 4W9WA 1J7IA 3UNZA 2JITA 2Y4IB 4IAYA 4A9RA 1RJBA 4GUBA 4JBPA 3QX4A 4BCMA 3H9RA 4W4YA 3REPA 3T8OA 4AACA 3EN6A 3LW0A 2BTSA 2YM7A 4X0MA 1WBNA 4RVLA 4C61A 3E88A 3VW8A 4FR4A 4OTHA 3DK3A 1PHKA 3Q4TA 2F49A 3V5PA 4C02A 3CY2A 4L3PA 5GZ8A 4KKEA 4FKUA
chains in the Genus database with same CATH superfamily
2UZUE 3OCGA 3QCXA 3FI2A 4IEBA 3NNUA 3BCEA 2DWBA 3RNYA 5JGAA 1H28A 5IH4A 5B2KA 4F9YA 3BRBA 3T3UA 3R0TA 4S30A 5BYZA 1OIUA 3OG7A 1ZAOA 4A9YA 1QPDA 4ANLA 3WF7A 3ZSGA 3TZ9A 2NPQA 3IONA 1PXMA 2G01A 3ML1A 4HZRA 4IWPA 4DEHA 3DKOA 3ELJA 5EKNA 2O8YA 1H0WA 2UZTA 4NCTA 3Q9ZA 2CGVA 4F08A 5AEPA 4O81A 2V7AA 2HZ4A 4U8ZA 4IM2A 4IVDA 4RWIA 1V0PA 1NVQA 2GTNA 4DG3E 3JUHA 4NZWB 2E2BA 3LFCA 5KNJA 4BR3A 3QBNA 4DHIB 2IN6A 3PG3A 4FKRA 5FXQA 3FLYA 4YZCA 4QQTA 4PL3A 1A9UA 1OKZA 3DB6A 4G3EA 4BKJA 4DEEA 4PMTA 3AKLA 4YURA 4FL1A 4LOPA 3VS2A 4APCA 5BYYA 1PRYA 2RIOA 5GINE 3R6XA 5DA3A 3ODZX 3C4FA 3PXYA 5HIDA 2W1DA 2J50A 4RT7A 1WFCA 2OH0E 3TJCA 4BZDA 4F0GA 2WOTA 3RM6A 4HVGA 1YI4A 3OEZA 3KF4A 3E5AA 3EKKA 4JXFA 4CVAA 2C3LA 4YJQA 5L3AA 4PP9A 2GFSA 2HW6A 2J9MA 5CNOA 3ZO3A 3G6HA 4ZZOA 5G6VA 5JK3A 5J8IA 4QRCA 4EQMA 2GSFA 2OK1A 4OR5A 3W8QA 3MVHA 4G17A 4ASDA 3QRTA 3NIEA 4TW9A 2B4SB 3ZH8A 4A9UA 4AGDA 2PVYA 3A2CA 5CU6A 5A4LA 3T3VA 3A7IA 2ZMDA 2OXDA 2FVDA 2PVJA 4IAKA 5EOBA 2BCJA 1R3CA 4FV9A 2DUVA 4ZTRA 4X7QA 2WMVA 3E7OA 3GCSA 5J87A 3QGWA 1Q8WA 4CV8A 3PDTA 1QCFA 4DH8A 4QYGA 4EH8A 3KXMA 2YJRA 1R39A 4O4FA 2UW4A 4O7VA 2WU7A 1YHSA 5HOAA 3HUCA 4RJ7A 5CEIA 5HLNA 5KX8A 3GI3A 3FMHA 2OFUA 4IZ5A 3RMFA 5KUPA 2J0LA 2HZNA 2C5XA 1Y6AA 4XV1A 3V3VA 2E9NA 4FG7A 4X2GA 2IVUA 4BDDA 5AA8A 2C1AA 5IQDA 4IHPA 4RWKA 2X2MA 3CCNA 5D12A 4IBMA 4G3FA 1W7HA 5DEWA 3DKFA 3EMGA 2BKKA 1GNGA 5E92A 2ITNA 1XMMA 5FBOA 3ZSHA 3UVRA 1KE8A 2OF2A 4G34A 3WE4A 2ZAZA 1OIQA 3KULB 3OWKA 3QWJA 1OGYA 1BYGA 4FNZA 1B38A 3VVHA 4AA4A 3SKCA 4MQ2A 2W0JA 4DGOA 4XBRA 2PVHA 2PWLA 2W1HA 1IA9A 1OI9A 2C4GA 2ZV9A 4L7SA 4UMRA 4YJNA 4P5QA 5TR6A 3SHEA 4DN5A 4YR8A 3JR1A 5ANOA 1TQIA 2KTYA 2F7XE 4OLIA 3RWQA 4YTCA 2WHBA 4L01A 4FG8A 4X3FA 3E8EA 1JNKA 4AA5A 4ENXA 3HMNA 3ITZA 4WG4A 1OIRA 1XQZA 4R8QA 2B52A 3UO6A 4XG8A 5A4TA 3GCUA 2Z7LA 3LM0A 4NIFA 4M66A 3BU6A 5FM2A 4C8BA 2W5HA 4JBOA 5FXSA 4F7JA 2WMSA 4TPTA 1OL2A 2X1NA 3EQRA 4X6RA 4FF8A 5AUZA 1UNGA 3R04A 3VUKA 4APPA 4K33A 1IASA 4BCHA 3OUNB 4QO9A 5GZAA 3CY3A 3VHEA 4GKIA 2XK9A 4E93A 2C5VA 3Q4UA 4E5BA 4I5PA 5KHWA 5CTPA 3R01A 3H10A 4O96A 3HDNA 3UIXA 5LOHA 4FEVA 1K2PA 1VZOA 4TL0A 3LFQA 5IA3A 3U55A 3VS1A 3VUHA 3A8WA 3GVUA 3QTSA 1H1PA 1UNLA 1W84A 3I0OA 3L8SA 4FTNA 4USFA 3ZO2A 4XG3A 2ZB1A 3V5JA 3CKXA 5T6KA 4XG9A 5I5ZA 5CALA 4HYIA 3O51A 4ZSGA 2HELA 2R3GA 5JRSA 4E1ZA 4DEAA 4LFIA 4K77A 4WRSA 4PV0A 3L9PA 4NUSA 4DF3A 2NYAA 1WMKA 2PULA 4CZYB 4O1OA 3QZGA 4GS6A 3AC1A 2XJ2A 4FKOA 3U4UA 3MPTA 4QYYA 3W8LA 4DEGA 2ACXA 4U80A 3TUBA 3DTWA 3BHUA 1H00A 2H96A 3TYKA 2WQBA 5BYLA 3MTLA 1TVOA 2SRCA 4C4HA 1KOBA 3R9DA 4UWYA 3QHRA 3O17A 4M7IA 4FV0A 2QCSA 3H0YA 4X2FA 5AR4A 4ZTHA 4KIQA 3Q4CA 4FKJA 2G1TA 4R6VA 2VTOA 3CIKA 3KXNA 5ETAA 5DI1A 3SXFA 4DYMA 2W4KA 1JKLA 2OH4A 3FC2A 3OXIA 1YKRA 3H9FA 3MA3A 5AUXA 4O82A 2W9FB 5D11A 3UG1A 1YHWA 2ZDUA 4AU8A 1ZXEA 5JFWA 3DLZA 1VR2A 3RPSA 5BVKA 5LVPA 5CT7A 3CXWA 3PA4A 2O5KA 5HLWA 3QYZA 1KE7A 1PYEA 1Q3WA 1CKJA 3PRIA 1ZZ2A 3VRZA 3ZC6A 4HPTE 2BRHA 4IZ7A 4FG9A 4EK5A 3PPKA 2WTIA 4EHEA 4FTIA 5B0XA 5EYKA 5EW9A 2DYLA 1JWHA 4LG4A 4JL9A 2CGUA 2W17A 3FKLA 3FZTA 3LXKA 4PL5A 4AN3A 2HENA 2E9OA 5CAQA 2QO9A 5DVRA 5HICA 4R78A 4DH1A 4G3DA 4FJVA 3RP9A 3LFBA 2F7EE 4JR3A 2BTRA 4RC2A 1M7QA 3LFFA 3O96A 2QI8A 2WQOA 2X0PA 3GQLA 2YLFA 4EH5A 4TYHB 3TM0A 4H1JA 4EOQA 1DS5A 2VWUA 3KN6A 5CY3A 5M09A 2X9FA 1WBSA 2X7OA 2XKFA 4RIWA 4O2PA 3RNIA 4BCNA 3ROYA 3MW1A 2AUHA 4MWHA 4HNFA 3R8ZA 3IDBA 2RG5A 3IECA 4TWNA 3LXPA 2VO7A 4M67A 3CLYA 5HEZA 2Z7SA 4DHFA 3NPCA 3PSDA 2O63A 3NSZA 1UKIA 2WFYA 3KGAA 4H3BA 5CF8A 2X39A 3ENMA 3LE6A 4AZSA 4F9WA 2J4ZA 3F6XA 3NR9A 2P3GX 3OWPA 4RJ6A 2YITA 3H30A 1P14A 4CZTA 5LMBA 1OKYA 3OCSA 1WAKA 4JAIA 3RK7A 1YVJA 2YM4A 3LCSA 4QOXA 3VUMA 2QD9A 4D4SA 2CGXA 4Q2AA 3FLZA 4QP8A 5DWRA 3DS6A 2UW5A 2J0JA 4AZWA 3L8XA 4IVCA 3SG9A 4X3JA 1OM1A 1XH4A 2C5OA 2CJMA 2Z2WA 5HG8A 5ANEA 4EYJA 3O0GA 5BX0A 4MD8E 4DGGA 1TKIA 3CTJA 1MQ4A 4P7EA 4DTBA 2QVSE 5AV0A 3PYYA 4O83A 3Q60A 5IG1A 4GG7A 4UB7A 3MVLA 4KIOA 4DDIA 3I6UA 3SA0A 4FSZA 4OTGA 3LJ1A 2WMUA 3G90X 3PPZA 4XUFA 5E7RA 4JMQA 5LVMA 2B9IA 3PE2A 2BFXA 4YBKA 3QTIA 4OUCA 4U6RA 4D55A 5ANIA 4K6ZA 3ORMA 2X0QA 1WZYA 3D7TB 4RX7A 2PZYA 4X3FB 2BUJA 2ZFYA 2OGVA 3C7QA 3II5A 5B2MA 4NYEA 3IGOA 3Q9WA 3NCGA 3NMUF 4P5ZA 4YJUA 3ZM4A 4RX8A 2IW6A 2G2FA 4NIFB 3AC8A 4EOIA 4KIKA 4GIHA 3P0MA 3UE4A 4CSVA 3BIZA 4DFNA 5E1SA 3U6JA 1YOJA 4BDGA 4FYOA 3OCBA 2CNVA 3LLAA 5DGZA 2UW3A 4I6BA 2IF8A 4R3RA 3CGOA 4BZNA 2GDOA 4AXDA 4IM3A 1W2FA 2RSVA 3GOPA 4KRCA 2XZSA 3O71A 3M2WA 3PJ3A 4J99A 4C34A 5A4QA 2CKQA 4FOBA 4RMZA 4DE4A 5LVNA 4MBLA 3O5AA 4JIKA 3NUUA 1UWJA 4JDJA 4M69A 2ITUA 2XCHA 3PWYA 3H0ZA 2ETRA 2W1IA 4HGLA 3TG1A 2IVTA 2XNOA 4PTCA 3VS0A 3QQJA 5KMKA 4DFUA 4G3CA 3ZZEA 4BI2A 2R3IA 1OUYA 4QDEA 4GT3A 4ALVA 2JBOA 4MNEA 2E9PA 3RGFA 5L8KA 4O7WA 3UOJA 4IANA 2V22A 1H26A 3COHA 4FOCA 3HAVA 2JDOA 4OBQA 4OBPA 4YLLA 5IF1A 5EYCA 5JMSA 2NNWB 2R3MA 3OW3A 5C01A 4ITJA 1Q99A 2J5FA 2B0QA 4BDAA 3R8VA 4AWIA 5L6WL 2BRGA 5IEXA 1XWSA 3R1NA 3U9CA 3GCQA 4FV7A 2R0IA 2BR1A 2Y9QA 3DY7A 3COMA 3F5XA 4BICA 4C4JA 5A9UA 3Q6WA 2UZOA 5KMOA 3UDTA 4NM3A 4XG2A 5CXZA 4LM5A 2G2IA 3TNQB 3JYAA 5CYIA 5AP7A 4UYNA 3DJ6A 3JY0A 4FGRA 2QOHA 3NYXA 4XOYA 1OL7A 4AGWA 4RFMA 4NL0A 4RJ8A 3LXNA 4JG6A 2ETMA 3CQEA 4ANBA 4GJ2A 3AD4A 3TL8A 2JKMA 2UZLA 3F5GA 1J91A 5BVNA 2W5AA 2I6LA 4PTEA 4UY9A 4FT9A 4QQJA 5FM3A 3BHVA 4XOZA 4HVIA 4BRXA 1GZ8A 4RC4A 2IPXA 3ETAA 2GNLA 3P7CA 3TKHA 3ZMMA 4H36A 3PLAE 4FKGA 4QD6A 2WD1A 1PKGA 2RKUA 3QRKA 3GNIB 5L8LA 3KA0A 4TZRA 1OVEA 2Z8CA 2IWIA 2EWAA 4IDTA 4MXZA 4FEQA 4LYNA 1QMZA 1ZZLA 4WKQA 4NSTA 3VBXA 3CEKA 3BL9A 4J53A 3NUNA 3U6HA 3F3ZA 4O4DA 3DZQA 3QA0A 2UVXA 4X2NA 4ZTLA 5AR8A 2GNHA 2BILB 1YWVA 4FL2A 4H58A 5FQDC 2A2AA 3SOAA 2WELA 3D0EA 3MPMA 3OHTA 2WMBA 4IQ6A 3CTQA 3I81A 5KO1A 4U97A 4M0YA 2X0GA 2PVRA 1GZOA 3N4UA 2OXYA 3W2PA 1Q24A 5AAEA 2OO8X 3DCVA 4HYUA 4RIWB 5I9UA 2WXVA 1H08A 5E8YA 3MJ2A 4O4EA 5CVFA 3B2TA 1MRYA 4MHAA 3E8CA 4KBAA 3TIZA 2XKCA 5CF4A 1G5SA 5HCYA 5I9XA 3NUXA 4DHZA 4ZOGA 2OJ9A 3W0PA 1KV2A 3F3UA 3R02A 3TKIA 2B55A 3E63A 4XRLA 2VX3A 3RHXA 5T3QA 2Y6OA 4O27B 4V04A 1UU7A 1M7NA 4IC8A 3ZUUA 4ALUA 4EK3A 4ZK5A 4O4BB 3KMWA 1ZYLA 5DR9A 4J98A 3EQPA 4AN9A 1PXOA 4G2FA 3FMDA 1E1XA 3D2KA 1GZKA 3PUPA 4U40A 3ZBXA 4D5KA 1O9UA 3ALOA 5AJQA 3ET7A 4LMNA 3KXXA 1YXUA 4IZYA 2B53A 1NXKA 2VTHA 1XMLA 3MFSA 4KINA 4O22A 3CC6A 5DRBA 5CS6A 4YJPA 4IFCA 3P7AA 1WBWA 2JIVA 4GV1A 5AUVA 4YGAA 3EL7A 3KXGA 3R71A 5AP1A 3P7BA 5HTCA 2UW6A 4PDYA 2WMTA 3JXWA 3KRJA 3PUFC 1BL6A 3P79A 3WZJA 2R3OA 3PPJA 2YIWA 4XG4A 4K2RA 4QMNA 4ZY4A 1X8BA 2IZRA 5AADA 3L8PA 5HE2A 4FE2A 3AXWA 3V5TA 2VWVA 1CKPA 4D2WA 4F9AA 2AC5A 1PMUA 2WMRA 5IA5A 5C26A 1W83A 4I20A 5JFXA 5JEBA 5AV4A 4LMUA 2EB3A 2FSLX 5EFQA 3EJ1A 3UPZA 4WHZA 4R77A 3R28A 3LXLA 4KIKB 4G5PA 1ZY5A 5M4UA 3R1SA 5C1QB 1XJDA 4Z55A 3FQEA 2BPMA 1JSVA 1H1RA 3MTFA 1ZYCA 5DRDA 5AR2A 5AX9A 5K5NA 4F65A 1ZWSA 4DAWA 4PMMA 3C4WA 4OGRA 1PF8A 5AAFA 4KUJA 5LCJA 3C0GA 2GNIA 3C9WA 3N9XA 5GJDA 5IQGA 4XS2A 4IX5A 5CT0A 1YHVA 3M11A 3UJGA 2XK8A 4ALWA 2ITVA 4QP3A 1H1QA 5F9EA 4O91A 4QNAA 4EWHA 2WO6A 4Y8DA 3BELA 4M68A 5CANA 2IZSA 4M69B 2C6OA 1Z57A 4TKSA 4MKCA 2VU3A 2BIKB 3R2BA 4LGGA 5ACKA 5D10A 3KVXA 4JX7A 2WMQA 2ZV7A 3LCOA 4GVJA 5DT4A 4GSBA 1KE6A 3DV3A 3MFTA 3R73A 5C8MA 3MY1A 3R1QA 4FTCA 1UVRA 4GJ3A 3IK3A 4FKLA 2RF9A 4MNEB 4DEBA 3ULZA 4DEIA 1UNHA 3G0FA 3VBTA 2JDRA 3EYGA 3BLAA 3UIBA 1ND4A 1FVRA 4QPSA 4O7RA 3PA3A 3I5ZA 4I21A 4WNOA 3TKUA 4BIEA 4DH3A 3JVRA 5I9YA 3ENHA 4C62A 1JKTA 3DA6A 4MX9A 3RAHA 3LFDA 4FEUA 3M1SA 3PP1A 4ENYA 4FKSA 2Z60A 4DG0E 2W7XA 2ZM3A 2R5TA 5IQIA 2JFMA 4R7IA 4S31A 5AR3A 4USDA 5ANGA 4HVDA 5IDNA 4C7TA 4C2VA 1PY5A 1Q8TA 2YJSA 1CMKE 4KD1A 2UZVA 5EYMA 4D58A 4YU2A 1GY3A 4PL4A 4XEYA 3KMUA 3E3BX 4XP2A 5IA0A 1REJA 3HRBA 1AD5A 3QZFA 3V04A 2J6MA 3OF0A 2B7AA 3OUKA 3Q52A 4FUXA 4ONAA 2VX1A 4XYFA 4NEUA 4FTUA 4C3PA 3MPAA 3Q53A 5M57A 5KMMA 2XNBA 4L3LA 4QMZA 4V0GA 2B9HA 3KCKA 1H25A 4K0YA 1Q8ZA 4RJ4A 4YZNA 3DBFA 3K5VA 5DT0A 5IH6A 3O8TA 4FT7A 4NKSA 3NAXA 4HYHA 4P90A 1DAYA 3K2LA 1ZYDA 4MWIA 2AC3A 4CFUA 2Y4IC 2JC6A 4FVPA 4F09A 5EKOA 4CTCA 2XK3A 4IVAA 4FNYA 3PXZA 4ZLOA 2BMCA 2GQRA 4TYIA 2XB7A 1SVGA 3BHYA 4NM5A 3F7WA 5LXMA 4EK4A 2YN8A 2VTMA 3CP9A 3L9MA 4JDKA 4ITIA 1OPJA 3ZHPC 4AQCA 4AW2A 4J8MA 4L43A 3VQHA 3ZLWA 5CU2A 2PUNA 5ETIA 3MV5A 3PSBA 1JOWB 4QMQA 3OC1A 3MSSA 3NUYA 3FI3A 5CENA 3W0OA 4MXAA 4HVHA 5L8JA 2X8DA 2R3HA 5FDPA 4ZEGA 2XAOA 4L67A 5L2TA 4HZSA 4JNWA 3DBEA 3GU4A 3OXZA 4O2ZA 3QRJA 3VBVA 4YJOA 3QRIA 3ODYX 4V01A 3NAYA 5BV3A 3PJ8A 4MEDA 4CRLA 3EB0A 4UMQA 3OOGA 4D1ZA 2UZNA 2PZRA 5HU3A 5CI7A 2VTAA 2XMYA 4ZY6A 3SW7A 3FSFA 4FKQA 3VC4A 1U4DA 3MVMA 3U6IA 2IZTA 4FTAA 4YP8A 4WRGA 3DGKA 2PVNA 4GYIA 4BIDA 1PMEA 2BRMA 4ZSAA 3RVGA 3WILA 2YM6A 3QTUA 1NVRA 3AQVA 4M15A 4WNPA 4ERKA 2CNUA 3HP5A 2JLDA 3EN9A 2XKDA 2X0OA 3MA6A 1YQJA 3EFKA 3P9JA 3QTZA 4RWLA 4FK3A 4CFWA 2VWYA 4FZAB 3IDPA 2I1MA 2VO0A 5I3OA 4WD5A 3V6RA 3LCKA 3C4CA 3DJ5A 4D2SA 3U54A 1SVHA 4N57A 2FUMA 4RC3A 4ANOA 4RVMA 2WEVA 3BYOA 5AUYA 4W9XA 2XM9A 4GRBA 4BGGA 4CYIA 5IUIA 3C4EA 3KC3A 1WBTA 3R7YA 2HWOA 1YW2A 3D83A 4UMPA 3S00A 1BKXA 2JBPA 2BAJA 4Q5EA 3WF5A 3BLHA 1WVXA 5DLSA 1P4OA 4BGHA 5J7HA 3TMOA 4MXXA 1MUOA 3RZFA 3BYSA 1Q4LA 4IACA 4ZIMA 4ZLYA 3UNKA 3THBA 5IMEA 3NEWA 3OBJA 4JI9A 3UOKA 2EB2A 4YSJA 5DR2A 1FMOE 3BHTA 3OTVA 4XCUA 5DBXA 4HPUE 5F20A 4AUAA 4DDGA 2A19B 4KAOA 2P2IA 3HECA 4AZFA 2YIYA 3ZXTA 1XH9A 3QCYA 4HJOA 4GT4A 3NUPA 4N6ZA 4U5JA 4R7BA 3L8VA 3UGCA 1B39A 1L8TA 5ANJA 5KMJA 4YO4A 5DFPA 2VNYA 2CGWA 2XJ1A 1KE5A 1PMNA 2QG5A 1PXJA 2JKQA 5HG5A 1XKKA 2IZUA 1IAJA 4YUQA 5BVFA 3A62A 3SLSA 3R7VA 4E5AX 2FSMX 3SQQA 3VQUA 4BYIA 4JX3A 4XBUA 2C3JA 2YM8A 1TQPA 4ZTSA 4E8AA 4RFZA 5AM7A 4O0TA 5T68A 2JAMA 4FV1A 4KA3A 4D0WA 3WE8A 4UMUA 4MXOA 2ITTA 3RWPA 2XM8A 4GKHA 1Q61A 1SM2A 4BCKA 1H4LA 5FEDA 4HGSA 2C69A 4BWXA 4G5JA 3PFYA 3MN3A 2WTVA 2VV9A 5LMKC 1U54A 1IG1A 2F2UA 3U87A 3SGCA 5EM5A 2GFCA 2HYYA 4IVBA 4U44A 2HOGA 5BVEA 2PZIA 4IX6A 3DBDA 4AZEA 4MVFA 4D28A 2UV2A 4MXYA 3OY1A 5CEPA 4KBKA 3VONA 2IVSA 5KE0A 4WNMA 4EH2A 4N70A 1ZMWA 2PHKA 1FQ1B 2YCFA 4TYHA 4KABA 2WQNA 2PE1A 5AV3A 4C38A 3IW4A 4J52A 2J5EA 4MF0A 3TI1A 5HTIA 4FBXA 2WIPA 3BE2A 2C0OA 4FGBA 3ZU7A 3GOKA 3HL7A 1WCCA 2OFVA 4TNDA 5CNNA 4F4PA 4FIGA 3LIJA 4QT1A 4TWOA 4HGTA 4RJ5A 4RPVA 3V01A 2EU9A 3QC4A 2R3FA 3CR0A 3QQFA 5E8UA 5E8TA 5HG7A 2XF0A 4EK8A 2XIXA 4CFVA 5IEVA 4FTMA 1PW2A 1OUKA 3HDMA 3A7HA 5DH3A 5KZ0A 4DLIA 3VS7A 2UW8A 2VTSA 3BLQA 4IW0A 4V0GB 5I9WA 3VS5A 5AP0A 4DINA 3FMNA 2PUPA 4BCJA 4NJ3A 2UVZA 4A9SA 2C6MA 3BHHA 2VRXA 4ASZA 4MQ1A 3TXOA 2I7QA 5KBQA 3U4WA 3I7CA 3UIUA 2W96B 3OWJA 3QD3A 2VTJA 4IZAA 2Q0BA 4L46A 4Y46A 5CSVA 5FP5A 4CMTA 3ZS5A 3WIKA 3AKJA 4QMWA 2CN5A 3QD4A 3R9HA 2VTNA 3NVKI 3GFWA 4MF1A 2WMWA 3IG7A 2VX0A 5EDPA 2YIQA 3BU3A 1OMWA 4BDEA 3BGZA 3KRWA 3UP2A 4GK2A 4AE6A 3I60A 3LFNA 4FTTA 4AOTA 3TTIA 3UBDA 4BWKA 4BKYA 3D7TA 1JSTA 3KN5A 3KRRA 4AN2A 3ERKA 2ZDTA 4AOJA 2NRYA 4BYJA 4F7NA 4W8EA 2OW3A 3WBLA 5K4JA 3QWKA 3NYVA 1OITA 5I9VA 4O7LA 3LQ8A 4RWJA 5BMSA 4DLJA 4UWBA 5G1XA 4E3CA 3DAJA 2GHGA 4L52A 2PMLX 4EKLA 3EOCA 1BI8A 1PXKA 4EH7A 2XNMA 3F69A 4WO5A 4I41A 4Z9LA 2Y8OA 4FNWA 3VJNA 5CASA 4NCTC 4C4IA 4FEWA 4K11A 2FSOX 5AP4A 3PE1A 1YRPA 3C50A 4FL3A 4EOSA 3LM5A 4P4CA 3G0EA 3NW6A 1WVYA 5J79A 1APME 1H0VA 3DPKA 4PMSA 1H27A 2YEXA 4XP3A 3RAKA 2YLEA 4OTDA 4AS0A 3ZONA 4S34A 2G15A 5CAVA 5HU9A 3QCSA 5FUTA 2X81A 3C4XA 3I4BA 3FL5A 3MH0A 3BYMA 4YPDA 3UVPA 3V8WA 4A9TA 1MQBA 5EHOA 3P4KA 3TZMA 4I3ZA 4CEGA 3BZ3A 4D1SA 5LCKA 4U79A 4UWCA 4BBMA 2KULA 3DBQA 5EW8A 5B7VA 2GS2A 3QA8A 3VAPA 4EHVA 3S1HA 2YAAA 5IQBA 2ZOQA 4ANSA 4EUTA 3MESA 4FT5A 1G8AA 3GUBA 3B8RA 1M17A 4KS7A 2CDZA 4I6QA 3R7IA 3I0QA 4E6AA 2REIA 4MBIA 1FGKA 3NNXA 4IAAA 4YJSA 3UNJA 3DDPA 3R30A 2W1FA 4QMTA 4ACMA 3ANRA 2OJGA 4BCQA 2Q83A 3BYUA 3L9NA 4JRVA 3IS5A 3F88A 3MH2A 4C58A 4QPMA 4C3FA 5LMAA 2HZIA 2AEGA 4FSRA 4YJVA 1JKKA 1T46A 4IX3A 3L9LA 5FRIA 3LKMA 1GOLA 3ZYAA 3NW7A 5FBNC 2PMNX 4AAYA 2XIRA 5DMZA 4LI5A 2X8EA 5I0BA 3GCVA 3SAYA 2QHNA 4GU6A 2RFNA 3DK6A 3W2SA 3NFGB 2HAKA 3E62A 5AP6A 1ST0A 4F1TA 4O0WA 1NT2A 3QTQA 4YZ9A 2QU5A 2R9SA 4JS8A 3UDZA 2PZ5A 3VW6A 3DFAA 3UODA 2P0CA 3V8TA 2I40A 3SOCA 3FSKA 4KSPA 4QMSA 3WZUA 5FEQA 4UBAA 3VS3A 1OECA 3O7LB 4RFYA 4YZBA 4YJTA 3LAUA 4XLIA 3SXRA 4ANQA 4BDBA 4H39A 3PTGA 1Z9XA 3O8UA 2VN9A 5HO7A 1VEBA 3C0IA 5CSPA 3ZFYA 4EEVA 1HCKA 2XK6A 4F9CA 4H05A 4MUQA 4R3CA 1U54B 4I0TA 2XJ0A 2WIHA 5AUTA 3ZC5A 5KMNA 5ITAA 2JKOA 2QU6A 3NYNA 4AA0A 2NP8A 4F1MA 3PVBA 2C47A 4B8LA 4EH4A 4LOOA 3OMVA 4QMLA 3PJ2A 2XAMA 4E26A 5E8SA 4ZS4A 5A4EA 3DQXA 3GB2A 3SX9A 2VWXA 4BB4A 4HYSA 3UYTA 5IQAA 4DFBA 3EL8A 2ZM1A 4ITHA 2YACA 4LV7A 4QTDA 4ACDA 4BDFA 4D2RA 1UU8A 2V5QA 1BMKA 4QP9A 5CVHA 2ITZA 5AR5A 4ZAUA 4FT3A 5F1ZA 2R7BA 3RK5A 5DE2A 5GZ9A 5EM8A 5HORA 4X3FC 3ZM9A 2B54A 5H8GA 2XEZA 3ORPA 5DIAA 4KIPA 4NW6A 4ZMEA 2VGPA 4BCIA 3UDBA 3NS9A 4O4CA 4E73A 5CX9A 3HVCA 3KVWA 3VF9A 5IQHA 4DTKA 2PYWA 4M84A 4PDSA 5CEKA 3ACKA 4BCPA 3OT3A 3V5LA 5HNGA 3UOLA 4BN1A 2GQSA 2PVMA 3TTJA 3H3CA 1MRVA 3CPBA 3O2MA 3F2RA 3RAIA 1NY3A 1BX6A 2WTKB 5K0XA 3EH9A 3KB7A 3R8PA 4KSQA 4M8TA 2RFSA 4C33A 2JIUA 4JIAA 3KK9A 5LARA 5K3YA 4IAZA 4WSQA 2H34A 2F2CB 3BBTB 4R5SA 4RX9A 1F3MC 4FODA 3WF6A 4FKVA 4TT7A 2ZV8A 3ZFMA 4AOIA 4Y5QA 5DNRA 2VWIA 4I93A 3QLFA 4RA4A 4U3YA 2Y4PA 4B6LA 3PY0A 3GBZA 3LJ2A 2XIKA 1KV1A 2FYSA 1S9IA 2QG7A 2E9VA 3DK7A 3G6GA 3QXOA 4U3ZA 3QLGA 5EDQA 5IA1A 3QCQA 5CQWA 5IQFA 3PSCA 3ZLXA 4CNHA 3KIOC 1OKVA 5AM6A 3EFLA 2HWPA 1UKHA 4L45A 1Q41A 3ZCLA 4A06A 1M2RA 2R3PA 1W0XC 2UZWE 3GC8A 3Q32A 2RG6A 4RG0A 4W4VA 4YHJA 3RPRA 4NH1A 3NX8A 1JLUE 3PP0A 3KEXA 5F94A 4OTQA 1OL1A 3PIZA 1LR4A 1W2CA 4FV5A 2J0MB 3GT8A 4GK4A 3NDMA 3VBYA 3GFEA 4B99A 2OIBA 5AA9A 4AXEA 5CLPA 4UXLA 5CVGA 2QODA 3V5WA 4J71A 1QPJA 3AKKA 3W32A 2X2LA 4A07A 4DGNA 3T9TA 2QOOA 5C8KA 2ERKA 4FSUA 4WBBB 2JIIA 3OWLA