4K9YA

Focal adhesion kinase catalytic domain in complex with 1-[4-(6-amino-purin-9-yl)-phenyl]-3-(5-tert-butyl-2-p-tolyl-2h-pyrazol-3-yl)-urea
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
271
structure length
271
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Fragment-based discovery of focal adhesion kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 271
sequence length 271
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4k9yA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4k9yA01
2I0YA 1WFCA 2OO8X 4FOBA 3L9LA 3QYWA 2OIDA 3FHRA 5CSPA 2WQBA 3NVKI 3IKAA 3QYZA 2V7OA 1GZ8A 5E91A 2JKKA 3GOPA 1U5QA 4AN3A 1L3RE 3PP1A 4O2ZA 4QTBA 4DG2E 5M4IA 1YXUA 3CKWA 3KEXA 4HYHA 4GFGA 4QP8A 4NFMA 4PP9A 2FGIA 4C34A 3OFMA 1PKGA 2FSOX 2PVJA 2Z7QA 4R1VA 4O86A 2QOBA 3KF4A 3MVLA 1E9HA 5CSXA 4A7CA 4OT5A 3VBVA 1P14A 2CGXA 3HECA 3LXPA 2PYWA 4R7BA 4EOSA 3ZZWA 2A2AA 4XOZA 2J0IA 2XEZA 3NUUA 4IFGA 4EOOA 1OL6A 3MH3A 2BIYA 3WARA 4X21A 3R7OA 3WIKA 4CT1A 3ULIA 3IOKA 1KUTA 4NKAA 3NS9A 2X6EA 4DEGA 4I24A 3MYGA 5EDPA 4I5CA 4F99A 4KKEA 3F7ZA 4PDYA 3DAKA 2ITQA 1ZRZA 4EUUA 2XKFA 2JFLA 3QALE 3VVHA 4EQUA 4EZ5A 1PHKA 4DGOA 1QPCA 2VD5A 2I1MA 4DGLC 3SG8A 5K5NA 4CCUA 3Q4CA 3W18A 4BC6A 3DDPA 4XRLA 3VJOA 1BMKA 2C0TA 2PSQA 4D2PA 4O0RA 5BQ0A 5CF5A 3OUNB 1Y8YA 2G2IA 3O8TA 4I0SA 2O0UA 3KCFA 5EM6A 3SOCA 5LWMA 4KRCA 3UMWA 2X7OA 3QZHA 4X3FA 5C4LA 2G2HA 3FXWA 1T45A 4CYJA 3L9NA 2R3JA 3UC3A 3ZFYA 2HYYA 2YDIA 3E8EA 4FVQA 1W82A 4LRMA 2R3LA 2HZNA 4ANLA 4TKSA 2RF9A 3MY1A 1UNLA 5HCZA 5E7RA 4EZ7A 4WNMA 3ROCA 3PJ2A 4BDDA 4D4RA 3EKKA 3O23A 3DKGA 3E7VA 2SRCA 4KINA 5AP1A 1XQZA 1IASA 3LIJA 3SQQA 2YABA 2ESMA 3GC8A 3Q4TA 5CYIA 4MAOA 3WZUA 5IG1A 5ETCA 1I44A 5TT7A 2W4JA 3ENHA 4IJ9A 2VTLA 1WBNA 3Q9YA 4UZDA 4O83A 2QO7A 2ZV8A 3KREA 4IEBA 1OVEA 3R83A 4RZVA 3FV8A 5BUJA 4YZBA 1OL5A 4USFA 2GCDA 4ZOGA 2E9VA 4PX6A 2WTKB 5AR8A 3FLWA 2HY0A 4I20A 1ZOGA 4UXQA 2FUMA 1JSUA 5E8VA 2XRUA 4NCTA 3TZMA 4NK9A 3GU4A 4KBCA 1UV5A 1CDKA 3EFJA 4JIAA 2QR8A 4HPTE 4Q5HA 4K18A 1NT2A 1Q99A 3R21A 1GIIA 3UG2A 4F6WA 5CEQA 2W5AA 2XF0A 2BR1A 3Q2MA 4HJOA 4G5PA 3FQSA 1KE9A 1DAWA 3MFRA 4IACA 5JZJA 1MUOA 4GT3A 4Y5QA 2VAGA 2VTHA 2CGVA 3IW5A 4Y83A 2PZ5A 2VX0A 3V6SA 3QL8A 3IGOA 1KSWA 4DH1A 4X2JA 5AX3A 4QQJA 4FKRA 4MD7E 1F0QA 2YAKA 3CIKA 3GU6A 3NYVA 4O6LA 5C01A 2ZOQA 4AOJA 2XM8A 2UW7A 2IWIA 3TNIA 5IA3A 5ANJA 4CZUA 2OF2A 2G1TA 3ORTA 4K8AA 2C47A 3DXNA 4DGNA 1DI9A 1PXPA 3DFAA 1M2PA 2QKWB 3BYVA 3R9HA 5HQ0A 4GJ3A 3HAMA 4FV7A 1XBAA 4WBBB 2XP2A 4EOLA 1Q41A 2JD5A 4JG7A 4O21A 4ZZNA 4CMTA 3ZC5A 1JKLA 3I0QA 4GU6A 4FG7A 4QMZA 3CJFA 4MD9E 4UXLA 3SKCA 2QLUA 4N4SA 3P5KA 2G01A 2GDOA 3L8XA 3RHKA 3ZM4A 4O84A 5AFVA 2X0GA 3E92A 3EQGA 4BYIA 5KKRB 1H1PA 4FEQA 4MWIA 3JY9A 4IJPA 4U9AA 5FTOA 1OL7A 4J97A 5BMSA 3R71A 1OKYA 2F57A 1IAHA 3S1HA 5ANKA 5AP3A 3VUHA 3I6UA 5DRDA 3DJ6A 1SVHA 3F82A 4TYHA 2YLEA 3N51A 5DBXA 5AP0A 5EH0A 2HY81 3QHRA 2ZV9A 4WD5A 1OKWA 3NR9A 2PTKA 4H36A 2J0MB 2B9HA 1AD5A 3I79A 4IHPA 5FM3A 2XNEA 1XJDA 5EQYA 5LXMA 3L9MA 1DS5A 4V0GA 3DQWA 5LMKC 3LFBA 1JKKA 4O7TA 5AV2A 3KK9A 5TF9A 5TR6A 1MQ4A 4ITJA 4L9IA 4JLCA 3NW7A 3ZUVA 5IH4A 1AQ1A 1Q4LA 4GV1A 5KMJA 4IWOA 3RK7A 5C27A 2NO3A 3BYUA 3UIMA 2V22A 4A9YA 2IW9A 4BCOA 4FIGA 3LCDA 5HE1A 5IQGA 3FMDA 5I5ZA 4NEUA 3LCKA 4YGAA 2DQ7X 2C5XA 1O9UA 1TVOA 2QI8A 4EK4A 3PE2A 2XCKA 3HEGA 3P86A 3UZRA 5M53A 3OTUA 1Q97A 3T9IA 3T8OA 3BX5A 3KGAA 4UV0A 3PXYA 1WBTA 4MQ2A 2B55A 3DZOA 4PUZA 2ITOA 4PTEA 2Y4PA 2F2CB 4WSQA 4FTMA 1XBBA 2Q83A 2I0VA 2XNOA 4BKYA 4EWQA 3T9TA 4Q5EA 3IK3A 1IA8A 4EHVA 3PRIA 4YLKA 1XH4A 5A9UA 4O7VA 4KNBA 3VUGA 4LOQA 2XK6A 2B4SB 4FKJA 2HIWA 4ASDA 3UJGA 2X9FA 3NYNA 4RJ8A 4BCGA 4XEYA 3W16A 4IZAA 4X7QA 4BZOA 3PXQA 2X4ZA 4NH1A 5BVNA 1NXKA 5LCKA 3MA3A 4XH6A 2O3PA 4X3FB 4PNKA 4QYHA 2J2IB 2P0CA 4N70A 4Q2AA 2CHLA 1OI9A 4L53A 4UY9A 5EHYA 3W10A 4IZYA 4DITA 4DLJA 3QTWA 3OXTA 1Z5MA 2FH9A 3EQIA 5LOHA 4HVHA 2WMTA 5IQBA 4GFOA 3OS3A 3NYXA 4PPCA 4F0FA 2PHKA 2FSTX 4IWQA 1NA7A 2HXQA 3VHKA 5HESA 4DF3A 2W1GA 4O91A 4MXAA 5CVFA 4PL3A 4YLJA 4AZEA 3BLHA 3H9RA 2PY3A 3F88A 4R5YA 5JK3A 3S00A 3UTOA 4CFVA 5DWRA 1VYZA 5J5SA 4BWXA 3KFAA 2YISA 4TNDA 3N9XA 2C6KA 5IUGA 3PPKA 5M09A 4F7JA 4EBVA 2V5QA 4MBLA 4YNEA 4BDIA 2XNMA 3P78A 3GQIA 3PP0A 4GVAA 5IH6A 4GUEA 2VTAA 4M7IA 4N0SA 4ZAUA 4DBXA 4YPSA 3IONA 5CEMA 2VX1A 3KXZA 4UN0C 3PG1A 4RA5A 5E92A 3MTFA 2XNPA 5ETIA 4BI0A 4FSWA 1RQQA 4QYGA 4AT5A 3M11A 3FC2A 4NW5A 5DR2A 2JFMA 1XWSA 4GIIA 3BWJA 1ZY4A 2HWOA 3UE4A 4RIOA 1BKXA 5L8LA 3VUIA 2XCHA 3H3CA 3HNGA 5I9XA 3FLZA 3ZXZA 4OTQA 2IVVA 3P7BA 4ZSLA 4QMPA 2VTOA 1JQHA 3OWKA 4O38A 4D4YA 4O7NA 2YM4A 3JUHA 2BDJA 5AAFA 2H6DA 4M12A 4QMVA 4FKOA 1LP4A 4L67A 5CF8A 4F09A 4WO5A 5CT0A 5FTQA 4S31A 4M8TA 3UQGA 2Y8OA 5IA2A 1PW2A 4I0TA 2E9NA 2VU3A 2GNIA 1Q3WA 3C13A 3RAHA 4HVDA 5FTGA 4BHZA 2PVFA 1U4DA 2RKUA 3HRCA 4USEA 5ETFA 3QZFA 5EKOA 2E2BA 4C4JA 1IR3A 5HD4A 1R1WA 1UNGA 4QMMA 1Q5KA 2BRGA 2VWIA 3BEGA 4JDKA 3S4QA 4QMSA 3R8UA 2WU7A 3RVGA 5KX8A 4I41A 3Q9WA 2YCRA 4QP2A 1RW8A 3D5WA 5BYLA 3BLRA 3CQEA 4LMUA 1A9UA 3V6RA 2VGOA 3TIYA 4A07A 5FBOA 4HOKA 3R00A 3KXHA 3QCYA 4C3FA 2P2HA 2XS0A 5JRSA 5IA4A 1J7LA 1APME 5EM8A 3I81A 2H9VA 2GU8A 1SVEA 3DOGA 3P79A 2WEIA 4JX3A 5CSWA 5AR2A 3WF9A 3R8MA 4DEAA 3EB0A 3QD2B 4YU2A 5JH6A 4CKIA 1OM1A 4G34A 1WMKA 3DTCA 1PYEA 2YJRA 4TYHB 2ZYBA 3TN8A 4BTMA 4L8MA 4BTJA 1JOWB 5CEPA 2RG6A 2QG7A 3ZMMA 4IZ5A 1M7NA 1OECA 5EYKA 4RSSA 2EUFB 2QLQA 4D2WA 5IU2A 4HGTA 3PYYA 4V0GB 4RIYA 3FDNA 4ZS4A 4ZTSA 3R0TA 2B52A 3MH2A 4ARKA 4ZZMA 4YO6A 4JR7A 1GZNA 4C62A 4V04A 3B2TA 2WTKC 3ODYX 4OTPA 2QG5A 1XH6A 4FV1A 2C3IB 4MXOA 4IB0A 4L6QA 2CKOA 2W1CA 3KQ7A 3BELA 3Q32A 4TWOA 1XH5A 3O7LB 3R1QA 4GUBA 3THBA 3JPVA 5J79A 1DM2A 1SZMA 4UMUA 2CGWA 4OAUC 5HU3A 1Q8WA 5EQEA 3PA3A 2VV9A 3R22A 4O22A 3UP2A 4J98A 5TOZA 3A4PA 5K0XA 1OUYA 2Z8CA 3OT8A 5IEVA 3FKLA 4BR3A 5DNRA 2WELA 3BE9A 5BPYA 2ITYA 2IJMA 4GK4A 2R3OA 4JQEA 5AAEA 4DEDA 4BCFA 1H1WA 5AADA 3C5UA 4FIFA 1FGKA 3IPHA 3R1SA 1V0BA 4XG6A 4XOYA 2XIRA 3UBDA 5CT7A 3DKCA 2BTRA 4DTBA 5AP2A 3IECA 3CQUA 2X4FA 4W8DA 3C4ZA 5C03A 4IAZA 4WSYA 5C4KA 5JGBA 4DN5A 2C3JA 5CVHA 2W4OA 4XP2A 2R4BA 2WQOA 4FEUA 1Q61A 4C4FA 4PMPA 3BEAA 3O51A 2UVXA 3FZ1A 4CRSA 2W06A 3TJCA 5IDPA 4R3PA 5E8YA 4YC8A 4FTLA 1O6YA 2Y9QA 3GU8A 4KSQA 3ZSGA 4IVBA 3Q04A 3NSZA 1YDSE 3FL5A 5FM2A 2EWAA 3WI6A 4CMUA 3OP5A 4FNXA 3RWQA 2B7AA 3QWKA 3SHEA 3RAWA 2B0QA 4EH9A 3OF0A 4NM3A 4E1ZA 4MX9A 3DCVA 1M2QA 1R3CA 2HELA 5HICA 4E7WA 5BYYA 5KKRC 1URCA 5IQHA 4JVGA 5AM6A 3OZ6A 5I9VA 1YXVA 4QTEA 3RAKA 5CAVA 3GI3A 1OPKA 1M52A 3K3JA 4BDEA 3TI1A 4CZTA 5IA0A 4IANA 3OT3A 1PXJA 4RT7A 3ZCLA 2PZPA 5KMIA 1IRKA 3PA4A 4DYMA 5CU6A 1ZLTA 4W4WA 5HD7A 4CEGA 3ORLA 4FSTA 4AOIA 4C4GA 3LCTA 3I5ZA 4U5JA 2C5YA 3AT4A 3W2CA 4JRNA 3F7WA 3DJ5A 5AWMA 5L8JA 5LCJA 3SXSA 3PDTA 3I7BA 1B39A 4KKGA 4O7LA 4LG4A 3V5TA 2QOLA 4QD6A 2WXVA 2X2LA 4JT3A 3PJ3A 4FE2A 1R0PA 4IM3A 4QP9A 5HVJA 3OROA 4EJNA 3PSCA 3TV4A 1OGUA 1QPEA 2R5TA 4F0IA 1PY5A 4OLIA 2GNHA 2JEDA 3IO7A 5CY3A 3I0OA 4PMSA 4O0YA 2I0EA 4JRVA 4XG8A 2UZUE 4RJ3A 4V01A 2WU6A 3DA6A 4W9WA 4XS2A 3R7YA 2WGJA 3FZRA 1CM8A 3QXOA 2YCFA 3EJ1A 5BMMA 2OJJA 2VN9A 1Y6AA 3DZQA 3E7OA 2XIZA 3PUPA 4XV2A 4EK5A 1MRUA 2J4ZA 2W5HA 2F49A 3CBLA 3UVRA 1YWRA 4AZTA 1Q62A 3RNYA 4NM0A 5CSVA 3WZJA 5ACBC 4L7FA 2ETKA 2NRUA 3AD4A 4W4VA 2BHHA 3LFSA 4P5QA 3AD5A 4C02A 5LARA 5KZ0A 5AUWA 4AQCA 2XNGA 4F1OA 1TQPA 3H9OA 3ZEPA 1FVVA 3PFQA 4MBIA 4R8QA 1KE6A 4E4LA 4L52A 4D2TA 2BROA 2JAVA 1BYGA 4M84A 2GPHA 4GG7A 4RJ4A 3FLNC 1KOBA 4X3FC 4ITHA 1ZMUA 3FPMA 3FZTA 3RK9A 3I5NA 5GJGA 3V5PA 1G8SA 3BQCA 3BGZA 3VULA 2W9FB 4WNOA 5DR9A 3MY0A 4FSNA 3GGFA 3LXKA 5AV3A 4BDJA 5AR7A 3G15A 1GIJA 5CAPA 3R8LA 2PK9A 3AT2A 1XR1A 3LMGA 2UVYA 4QP6A 3EFWA 2HK5A 4U7ZA 2V0DA 2XUUA 4TTHB 3SOAA 1UU3A 2C0IA 3E8NA 3OY1A 4EOMA 3WOWA 1W84A 2W1IA 4PDOA 4DH5A 2C6OA 2Y0AA 4QMXA 3ULZA 3VF9A 2QONA 4PDPA 5ANGA 3FMJA 5EHOA 5AUXA 5CLPA 4RIYB 3W2PA 3GCUA 5FG8A 1K2PA 5FP6A 4IIRA 2X8EA 3OEFX 4JQ7A 5E1EA 4DEHA 4II5A 4NWMA 3AC5A 4BI2A 4IX3A 4QQCA 3WBLA 5E8WA 4CVAA 1J91A 3DBQA 4XLVA 3BGQA 2J5FA 5AMNA 2HZIA 4I5PA 4GT5A 4XMOA 2OK1A 4L01A 4W8EA 1PXLA 2RSVA 2WHBA 2WOUA 3D0EA 2NPQA 2XM9A 4AFEA 4ZEGA 3LE6A 3Q6UA 3LMIA 3HYHA 4FV9A 3QRJA 4Z9LA 3SRVA 2JKMA 1YOLA 3MVMA 4QO9A 3RKBA 3RPOA 2OBJA 3FYJX 3OCSA 3U6HA 4MD8E 4E6AA 3U9CA 4IX4A 4YC3A 3VS4A 3PSDA 3TNQB 1TQMA 3R7IA 3BHTA 3BCEA 1P4FA 4IBMA 4QMYA 1MP8A 5B7VA 4CV9A 3QF9A 4YZMA 3CPCA 4F7NA 2VTQA 5CU4A 3BYMA 3O7LD 4X6QC 4IAAA 4M14A 4AOTA 4IVCA 2V55A 4FEWA 2Y6MA 4QYFA 4S32A 3UQFA 3IDPA 1PYXA 2OJ9A 3L8VA 3GC0A 4DGGA 4QP1A 2QHMA 5FRIA 2UZVA 3EQPA 2WQNA 1YI6A 2F2UA 3BRBA 1YOJA 4FUYA 2C0OA 4IX6A 4A4OA 3QRTA 5HG7A 1Q8ZA 2Z60A 3KXNA 3MGYA 5HI2A 5AX9A 2PUPA 3ROYA 3QFVA 2GFSA 3UNJA 5C1QB 2OWBA 4CYIA 1U46A 3A8XA 4RX7A 4Z55A 5BVEA 1TKIA 1I09A 4YJTA 3TKIA 3GC7A 4XRJA 3ZEWA 4LRJA 2GQGA 2CMWA 4RWKA 2VWVA 5CAUA 5HVYA 2RIOA 3ZS5A 3G0EA 3H30A 4PTCA 4BBMA 5A4TA 3MB7A 2JITA 2OW3A 2HZ4A 2ZV2A 3KRLA 4RBLA 5HE2A 4AT3A 3D15A 3DY7A 4FTQA 3PLAE 4WNPA 1GJOA 3TUCA 5C8NA 2PMNX 4R77A 3S0OA 4ERWA 2R3RA 3V51A 3PSBA 3PIZA 5EHLA 4QMNA 3OOGA 4EH5A 3DNDA 5AP6A 3LFNA 4IB1A 5DHJA 4A4LA 3CLYA 3POOA 4FKPA 4PRJA 1YW2A 4TWNA 4I94A 4OTFA 5HBEA 2ITTA 4ZLYA 5CQUA 1VEBA 5CALA 2OFVA 3CD8A 4FMQA 4C4HA 4FF8A 1FQ1B 5J8IA 4YHJA 5ICPA 3BHVA 3UOHA 3DBEA 2EXMA 2YIWA 3RPRA 3EN7A 2WEVA 1HOWA 1JSVA 4G3GA 4JDJA 1SM2A 3COIA 3U8WA 3R28A 2E9OA 3Q9ZA 4EKLA 1PMVA 2A4LA 3CE3A 2IZUA 4I93A 4CT2A 4GCJA 5CXHA 3FQEA 4RIWA 3RZBA 1ND4A 2BRNA 2OU7A 3W1FA 4ENYA 2BAQA 3R7VA 5D7AA 4CFMA 4DCEA 3ZBFA 2Y4IB 2XK8A 4I1ZA 3A7JA 1Z57A 3HVCA 4R5SA 4FT0A 4RX5A 3DBFA 3OVVA 3FC1X 3O50A 4UWYA 5G6VA 3CGFA 3ORPA 3QTRA 2WFYA 3A7HA 2A0CX 4JS8A 2XKCA 3GT8A 1J3HA 1BL7A 2JBPA 3FLSA 3VBTA 4U40A 5J95A 3DLSA 5EYMA 2GQSA 4D55A 4O0SA 4AW2A 3FYKX 2WOTA 5G1XA 2I0HA 4BCMA 5CAQA 1IA9A 2ZMDA 4DEIA 4DFUA 1JKSA 3P1AA 3C4XA 5BNJA 2OF4A 2P33A 4NIFA 4E20A 2RL5A 4U45A 2XBJA 4IX5A 3TIZA 1H00A 4ZSAA 4O81A 2ONLA 3BU3A 3U51A 3CPBA 1Y91A 4FZ7A 4O0XA 3GP0A 5D12A 4C0TA 2OJGA 3DAJA 2Z7LA 3ACJA 2YERA 3CD3A 5AV1A 3LQ3A 2H96A 2RFNA 4J96A 4OGRA 4XG2A 4RVKA 1QL6A 2OZAA 2C6IA 2G9XA 2QU5A 3F3ZA 1Q8UA 1SNXA 3CS9A 3IG7A 4FKTA 1JAMA 4O6EA 3QCSA 3OW4A 4E6DA 2F4JA 4TPTA 1KV1A 1YXXA 2GTMA 3ELJA 3ALOA 4C57A 5HTBA 5E8UA 3ZBXA 2O63A 1YHVA 3P7AA 4FZAB 5AJQA 2DYLA 4IAKA 2R3NA 5TO8A 3G33A 5M56A 4EL9A 4N6ZA 4L3PA 4AN2A 4BN1A 4EH2A 1BX6A 4JAIA 3QGYA 3QX2A 2QOKA 2JDRA 2VTPA 3FKNA 3IS5A 5EFQA 3UOKA 4CLJA 3OW3A 4BIDA 2R9SA 5BX0A 4CQGA 2C6TA 4GH2A 3VW8A 4CTCA 3VW6A 4O7SA 4YHFA 4GU9A 5L8KA 3K54A 5EM7A 2YJSA 1YQJA 3DK7A 3KL8A 3TACA 2WAJA 4U42A 4BFMA 4BCKA 4GKIA 2BKKA 4YJUA 4YP8A 2W99B 4IVAA 5EDRA 5L2SA 5LVPA 4HPUE 3R7EA 4ZTQA 3SAYA 3SRVB 1FINA 3BV3A 1R39A 4FTAA 3G5DA 4RLKA 3UYSA 3W55A 2V7AA 3V5QA 5K4IA 3AC2A 3LLAA 3W2SA 3TTJA 4FT9A 3R1YA 4AZFA 3ZOSA 5IPJA 4MCVA 4XNEA 1WBSA 1Q24A 4AZVA 5HU9A 2NNWB 1R78A 3EQBA 4BCPA 4A9RA 1WAKA 3BLQA 4XG9A 2X8IA 4C38A 3I1AA 1ZMVA 4B0GA 1BUHA 3V5LA 1PF8A 4YTFA 4WNKA 3PVBA 3EZVA 2JBOA 3CTQA 3NDMA 2VTRA 5HBJA 2ZJWA 4EH3A 3I60A 4EONA 3F2AA 3Q4ZA 3DK6A 3R04A 4RFZA 3HZTA 3NNWA 3AD6A 3MPMA 3ODZX 3W2RA 5J7HA 3I6WA 3N4TA 3ZXTA 4I92A 1ZYJA 4YJPA 4FV2A 4A4XA 5IF1A 3M2WA 3EQHA 1JPAA 4PY1A 1JSTA 4XUFA 4YBJA 2P4IA 3UVPA 4F9CA 3GENA 5DYJA 4MKCA 2YCQA 3QA8A 5DLSA 1RJBA 3RCJA 4WRGA 4J8NA 3SXFA 5E8ZA 3F3WA 4UMQA 1XHAA 3RNIA 3KK8A 2WTIA 4HCVA 5HOAA 3LZBA 4FNZA 5CENA 4F65A 2OG8A 5EI6A 3MDYA 5B0XA 4RVTA 3ZLXA 3UG1A 4Z16A 5FP5A 3ZRMA 1H1QA 3FL4A 4CFNA 4YUQA 4ZZOA 5BVDA 4BY9E 5B2KA 5DT0A 5I9UA 1WVYA 2J6MA 4FYOA 4G2FA 2B53A 5ANOA 3PWYA 4RFMA 4U97A 4F7SA 1OB3A 3QQFA 3VBWA 3QU0A 5DEWA 3RM6A 2XIKA 5HEZA 4AXAA 4EH4A 3UOLA 1WVXA 4HGLA 1CKJA 2ERKA 4C2VA 4ZMEA 5AP7A 3LXNA 3L9PA 4DFYA 4E93A 3POZA 4FSQA 4B9DA 4D4SA 3FUPA 2CNQA 4R3CA 1B6CB 4DFNA 1P5EA 4FSYA 2J50A 3MIAA 4YHTA 4ALUA 2QOFA 3NNUA 4RX9A 3GCSA 4R78A 1QMZA 3RJCA 5HE0A 4G3FA 4RIWB 3LFCA 3PPZA 3FI8A 2R0UA 3OCBA 4YJNA 3LFAA 4A9TA 5FQDC 4YR8A 2VRXA 2W1HA 2XK9A 2VWUA 3VWAA 4DT8A 2UZWE 3NUAA 4W9XA 3P4KA 5FDXA 1OMWA 3A99A 5JFXA 4QMUA 4RJ5A 4PP7A 2YM8A 3GCQA 4MH7A 4M97A 5J7BA 3P08A 5ITAA 3KB7A 1FMOE 3CR0A 3ORMA 5CZIA 4IW0A 3RPVA 4QPAA 2Z2WA 3RAIA 2J5EA 4ANBA 3UO5A 4UWCA 3H4JA 1PMUA 2YWVA 1YHSA 1WBVA 3QUEA 2JC6A 3FE3A 4RQVA 1Q8YA 3AG9A 5DG5A 4BVUA 4DINA 5A4LA 3NVMB 2PWLA 1FPUA 4GT4A 4NIFB 4W4XA 4I6FA 5LMAA 5JFWA 1W7HA 4Y85A 4ALWA 3SLSA 3EN6A 3QD3A 4B8MA 3F9NA 4HGEA 4FSRA 4HNFA 4A9SA 2DS1A 3OD6X 1LEWA 4D58A 2BZHB 3QRKA 4YPDA 4R7HA 2YIXA 3A7GA 2OICA 3PXKA 4GL9A 4IAYA 5JSMA 5M44A 5GZ9A 4BL1A 1PMNA 2OZAB 1JWHA 2C5OA 1DAYA 1OL2A 4WKQA 4Y95A 1Z9XA 5HCYA 1H8FA 2AC5A 4DHFA 4IC8A 1ZARA 5J1VA 2C6MA 3C9WA 3G90X 2ITWA 4U3YA 4JAJA 2CKEA 2R7IA 5BYZA 4IAIA 3EQDA 4AW5A 3WYXA 3V5JA 3MS9A 4ZY5A 2HZ0A 2BDFA 4RVLA 4YBKA 4GYIA 2XJ1A 3DV3A 3ZSHA 4KIPA 4RG0A 3TUBA 2PVKA 4BCJA 3QTZA 3NMUF 2CGUA 2WTVA 1GY3A 4LQMA 4GFMA 4J71A 2C6LA 3KRXA 3KVXA 5EDQA 3GFEA 4FT5A 5L6PA 3LKMA 4D9UA 2Z7SA 2QHNA 3AXWA 4M0YA 2W05A 5CS6A 4C59A 4DG3E 5D41A 2YDKA 4NTSA 3LMHA 3TG1A 2IVSA 3BI6A 3QLGA 1OIQA 1VR2A 2ITVA 3NNXA 4XV3A 4HCTA 4E6QA 3TV7A 5EG3A 3PJ1A 3ZDUA 2F7EE 2YIRA 3L8PA 5D10A 4D2SA 5DOSA 4QNAA 4ZJJA 3OEZA 4C3RA 2Y4IC 4EOIA 3ZZEA 4H3PA 2WMXA 3DTWA 4FSUA 4ZXTA 3WZDA 4CG9A 3V04A 5HLWA 2BUJA 2I6LA 4ANMA 4F0GA 5A54A 5CU2A 3C50A 3KN6A 4CMOA 4JBOA 4F1TA 4G1WA 3D2IA 3C4CA 3WF7A 5FXQA 4EH8A 4DAWA 4U8ZA 1RDQE 3DPKA 3R01A 5KZIA 4GKHA 3DKFA 4YSMA 3RALA 4ANNA 5AUTA 3UYTA 3UZTA 3OCTA 4O1OA 2KTYA 3TM0A 4JQ8A 1YI4A 2WMQA 3COKA 4I6HA 4E4MA 5IQFA 2EXEA 2PVLA 4O2PA 4EHZA 4ZLOA 4OTIA 2UZDA 3BKBA 4IM0A 3MB6A 3RPYA 4ANSA 5FEEA 1CKIA 3DK3A 3LLTA 5FUTA 3EQRA 3D14A 4B8LA 5E9EA 5GZAA 2HW7A 4F9AA 5IEXA 4GG5A 3JY0A 2W9ZB 2DUVA 5F1ZA 3F3TA 3OBGA 2FVDA 2AUHA 4OTHA 2R3HA 4ZIMA 3CQWA 4I5MA 4P2KA 2CCHA 4M3QA 2PMOX 3DS6A 4IZ7A 2GNFA 3VBYA 2IZSA 3MESA 4YJOA 3PZEA 4RJ6A 4RC2A 2ETRA 2A27A 4R1YA 5AIRA 4F9BA 1GNGA 3EYGA 2O2UA 4YZ9A 4IFCA 2F9GA 2XZSA 3C1XA 3VS1A 3U55A 2VWBA 1OIYA 3T3UA 4U0IA 4PPBA 4D28A 5A4EA 4KBAA 3JYAA 4NZWB 2R3KA 4BCIA 4ZTRA 4HVSA 3PVUA 4OBPA 3E3BX 4XG4A 2YWPA 3PG3A 3F5GA 4DC2A 2XJ2A 1URWA 4IH8A 4WRSA 4FX3A 2RFEA 4QQTA 4DA5A 4QMTA 3FMMA 3BE2A 3TUDA 5C8MA 4FOCA 2CLQA 1F3MC 4IC7A 4CFWA 4AAAA 3R9RA 2CSNA 4PNIA 3OUKA 3BGPA 3QC9A 3HV3A 4CNHA 4E4NA 5L2WA 3I4BA 2XK7A 4O82A 2VTNA 4FNWA 3FPQA 4ACCA 4MXYA 4I6QA 4IM2A 4APPA 4ZTLA 4TWCA 4QTCA 2XA4A 3CP9A 1FMKA 3GNIB 3VS5A 5HVKA 3R2YA 4TYGA 3WZKA 3HP2A 3E8DA 3E5AA 4X2NA 4BCNA 1ZOHA 3OC1A 4QP3A 1PKDA 2XYUA 2YM5A 4RMZA 4D0XA 3MTLA 1KV2A 3G2FA 3LFQA 3O2MA 4DEBA 4FVRA 5K3YA 1WVWA 2H34A 3OG7A 4FZFB 4LUEA 5KMMA 1H1RA 3MPAA 3V01A 3DT1A 5KMOA 2XNBA 3HDMA 1MRVA 4KS8A 3RWPA 3WF5A 3II5A 3SW7A 1UKIA 2EU9A 3HA8A 4XJ0A 5H9BA 3IW4A 3AC3A 3PRFA 4BDFA 3BBTB 4C58A 3AGMA 2WPAA 2YAAA 3C5IA 4AT4A 5J87A 2CJMA 2VGPA 4OTWA 4C4IA 4L00A 3ZO2A 1OL1A 5IKWA 3UIUA 3NW6A 3A4OX 3QUPA 5HG8A 4XP0A 3DNEA 4AZWA 4FIHA 4ASZA 3QQKA 5HGIA 2ITUA 5I0BA 4DH3A 4TL0A 4MXZA 2ZDUA 4JNWA 3ZLSA 4CV8A 4NT4A 1LUFA 3HV5A 2XVDA 5M08A 3FLQA 4LGDA 4YLLA 3K3IA 3R8ZA 4NL0A 5F95A 4EHEA 2IVTA 1M2RA 4G3CA 4FV4A 1S9JA 3E93A 2VTIA 4AX8A 2XK3A 3E62A 4ONAA 2PULA 2XKEA 2I40A 5AP4A 2GS6A 2ZV7A 3EHAA 2OH4A 4GK3A 1YDRE 2B9FA 2R3GA 2OZOA 3DQXA 2YLFA 3WE8A 5A6NA 1XH7A 3DB8A 4X2KA 5L4QA 2CLXA 4HYSA 2V62A 4LRKA 3C0GA 4MWHA 4S2ZA 4HW7A 5A46A 3O8PA 3ZM9A 2WZJA 1W0XC 4X0MA 4BGQA 5GZ8A 1GAGA 1O6KA 2OLCA 1G8AA 3ZO3A 5L2QA 2JDSA 2PPQA 4FV3A 3R02A 4KIOA 1ZZLA 3UIBA 3NIZA 3TJDA 4CXAA 4D1SA 3F66A 4NW6A 3PE1A 1VYWA 4YJVA 3V8SA 3UPZA 3EIDA 4XBUA 3RM7A 5LVLA 3EMGA 4U80A 4FV6A 4IDTA 4FTRA 5FDPA 5HHWA 4EOQA 2UZLA 3WE4A 1UNHA 3KU2A 1XH8A 5TE0A 3ZUTA 5FXRA 3T3VA 3WYYA 2PZYA 3H0YA 3SG9A 5CASA 2QOOA 4IB5A 4QNYA 2B54A 2HWPA 4H39A 5JRQA 2GS7A 5M4CA 1G3NA 1CTPE 3UODA 4RX8A 4PWNA 4WBOA 3V5WA 2VX3A 2B9JA 2VO7A 2AYPA 3PJCA 4BCQA 2G2FA 4CQEA 3QLFA 1ATPE 1WBWA 1ZYSA 5AUUA 5IH5A 3ZSIA 2NP8A 2C4GA 1XO2B 3UP7A 4DTKA 1H24A 4AW0A 5IMEA 2ONLC 4KWPA 3HMOA 4G6LA 4XV9A 2C3KA 2X39A 4BICA 3ZTXA 2QOCA 4EYMA 5I3RA 5K5XA 3AMAA 3TEIA 3C51A 3AT3A 3LOKA 4EH7A 4BWPA 5IUHA 4DG0E 5DN3A 3CTJA 3EL7A 4L68A 4YTIA 4EK3A 2PUNA 1B38A 2B9IA 5I4NA 4L46A 4O7ZA 4OTRA 4APCA 2HOGA 4F4PA 4CZYB 4K2RA 4AZSA 4O7WA 3ZRKA 3MSSA 4PV0A 2YN8A 4XG3A 3TZ8A 3TKUA 1NW1A 2WQMA 3QQHA 3DU8A 2AC3A 4B4LA 1KE7A 5I9ZA 3IDCA 3QHWA 2WMBA 3F5PA 3JXWA 4LFIA 5KUPA 2F7ZE 2J0LA 4EOPA 1QPJA 5ANDA 3F3UA 1A06A 2ERZE 4JXFA 2X7FA 4CFXA 4FR4A 1FOTA 2CN8A 2YDJA 3MJ2A 4EOJA 4MXCA 3ATSA 4FKLA 4FGRA 2UW8A 4TY1A 2X7GA 4TYEA 3IDBA 3U4WA 3C0HA 4UZHA 2GSFA 4Y73A 3KMUA 4JG8A 5KHXA 1WBOA 3A7FA 5FXSA 1LR4A 1OBDA 4H58A 2C1AA 3GVUA 2Z02A 1J7IA 3PY0A 2WIPA 3W2QA 3G51A 3CJGA 1Q8TA 5HNBA 2YM3A 5DT3A 3MI9A 5IUIA 2LGCA 3KKVA 5LVMA 1PXIA 3LW0A 2UZNA 3DBCA 4H1MA 4WHZA 5AV0A 3U4UA 2QOIA 5HO6A 4NCTC 4F9WA 5DA3A 3MVHA 3TT0A 3IW7A 4KRDA 2WKMA 4FTUA 4WT6A 4BI1A 3UGCA 5EOBA 2JIUA 4EWHA 5M06A 3FHIA 4AA5A 4MXXA 2OIQA 2BMCA 4DEEA 3R9OA 2R64A 3ENMA 3MWUA 3Q3BA 3B8RA 4R3RA 4AS0A 3F2NA 4MQ1A 3QA0A 1UWJA 4J99A 5AR5A 3ZFMA 4OBQA 4WA9A 1MQBA 2BCJA 2WQEA 5CU0A 2P3GX 4IDVA 1YOMA 5KMLA 4OT6A 4TW9A 4KIKA 4BDCA 2VTSA 4IE9A 4MNEA 4DLIA 3SC1A 5GJDA 5HG9A 5KMNA 4FVPA 4O7RA 3AC8A 4QRCA 3QRUA 2Y6OA 3QQGA 2YIYA 2PVYA 4G6OA 3A2CA 4TWPA 4F70A 5AIKA 2WMVA 2XKDA 3NUYA 4FZDB 4HNIA 4RC3A 2JLDA 4AP7A 2CNVA 4ZSJA 4PF4A 2C1BA 2W1ZA 3Q5ZA 2QOQA 3GEQA 4NUSA 4AUAA 3BHHA 2VO3A 2XYNA 2IZTA 2W7XA 3DAEA 2Z7RA 1SVGA 3ZUUA 4YZDA 5C9CA 3IGGA 5HZNA 2JIIA 3EFKA 4AACA 4DT9A 3DLZA 4YJRA 3HRBA 4BB4A 4BDGA 2ZM4A 4RZWA 1O6LA 3QQUA 5AR3A 3JVRA 5HG5A 3VNTA 5GHVA 4V05A 2P2IA 4FZ6A 4GK2A 3QTXA 4EOKA 5CSHA 3JR1A 3HUCA 1PJKA 3FXZA 3SX9A 5ACKA 2XK4A 3CGOA 4ZP5A 5KO1A 4KBKA 1YI3A 2IN6A 4PMTA 3BV2A 1Y6BA 3FMHA 4O27B 2YA9A 2C3LA 4NTTA 3UOJA 4K77A 1CMKE 4MEDA 3HA6A 2PVNA 4E6CA 2YACA 2ETMA 5CTPA 5HX6A 3WF8A 3OCGA 4X2FA 3FAAA 2YM6A 5F94A 3HV6A 3Q6WA 2YZLA 4P90A 5IQCA 2R3FA 4AWIA 4EK8A 5CU3A 4AE9A 4ZY4A 3BU6A 3QKMA 1FVRA 5IA5A 3EL8A 4NYEA 1H25A 5A14A 4UMRA 4EC9A 3FEGA 5CNOA 3MW1A 3UNZA 5E90A 5HO8A 2R0IA 4JDHA 4LL5A 5H8EA 5CQWA 3NYOA 4NKSA 4ENXA 1SMHA 2ITZA 3NUNA 3SA0A 2VWWA 3U6IA 3NUXA 4QP4A 2HAKA 4XHKB 2BAJA 5EW8A 3NIEA 5BUEA 5D9HA 4B7TA 2XB7A 4DE4A 1REKA 3IQ7A 2WMAA 4ALVA 4IWDA 2EVAA 5DFPA 3HRFA 1HCKA 4M68A 3W8QA 2GNLA 2C5NA 2OXDA 4ZSGA 4YSJA 1UKHA 1J1BA 2BZIB 4ANQA 4QTAA 4D2VA 4NM7A 3TZ9A 4FT3A 2XJ0A 1OKZA 4JOAA 4X3JA 2GMXA 2Q0BA 3VO3A 2VO0A 5HNIX 3EH9A 3F3VA 2X2MA 3BPRA 3NUSA 1UWHA 4RRVA 3D7ZA 5K9IA 4BZDA 4N57A 4TT7A 4CCBA 1U5RA 2QO2A 3CC6A 4ZSEA 5CEIA 5CEKA 3TNPC 3LFEA 4BGHA 3TZ7A 1RE8A 5IZFA 3OXIA 5E1SA 2R3IA 4M13A 4O0UA 2W1FA 4D1XA 4CKJA 1JLUE 3ETAA 3PA5A 2GNGA 4G9CA 1XBCA 3AQVA 4JDIA 3FQHA 2G15A 4XV1A 2JIVA 3EQCA 3LXLA 4Y5HA 4Z7GA 1ZMWA 5CZHA 1H4LA 3MH1A 3ORIA 5L6OA 3PVGA 4NFNA 1DI8A 5L2IA 2GFCA 2CCIA 2WO6A 4FKQA 3LQ8A 5HTCA 1PRYA 3GFWA 5JMSA 3QZGA 4CFFA 3QBNA 4O0VA 4H3BA 1GIHA 4TXCA 4EHGA 1PXOA 3PWDA 2XIYA 2ZMCA 3EQFA 5AR4A 4L3JA 4M69A 3FJQE 5J1WA 4JJRA 3P23A 4G3EA 3VS7A 4CSVA 1WCCA 4FSZA 4XG7A 4K11A 2OFUA 5EOLA 2W96B 2YM7A 4IADA 3MJ1A 4GMYA 5FEDA 3LM5A 4KD1A 3OY3A 3ZO4A 5HCXA 3F5UA 3K5UA 4JX7A 3P9JA 5DR6A 3U6JA 5GIPE 3AC1A 3KC3A 3FY2A 4PMMA 2OXXA 3HX4A 1WBPA 3E3PA 3NW5A 4GW8A 4G3DA 4I4FA 4FKUA 3FZSA 3NRMA 3PIXA 4LI5A 2PE2A 2XBAA 3LPBA 1M17A 3CKXA 1XKKA 2VUWA 3DFCB 4U41A 3PIYA 4M67A 4HGSA 1ZXEA 3FSKA 4AA4A 1MRYA 4OTGA 3AGLA 2UZBA 2FO0A 5JQ5A 4XYFA 4BF2A 5ANIA 1IEPA 4KIKB 4RQKA 4MNEB 5ANEA 1PXKA 3VS2A 1OPLA 4XX9A 4QOXA 1U54A 1OUKA 4JI9A 4L44A 3H9FA 4FL2A 4BKJA 4NJ3A 4FC0A 4D4VA 4DTAA 5D1JA 2VWXA 1ZAOA 2WTCA 3PVWA 1J7UA 4JBPA 5GNKA 5IQIA 4ORKA 1YWVA 1H26A 3MA6A 5M4FA 4EJ7A 2R7BA 1XH9A 2C68A 4BDBA 4FSMA 4A06A 2OKRA 2JDVA 4AFJA 2W4KA 4EEVA 5J9LA 4BKZA 2YCSA 4QP7A 1NVRA 2P55A 4EQMA 3TDWA 3EKNA 4KKHA 4TYIA 1IAJA 4J95A 2C69A 3WIGA 3R9DA 1H08A 2BHEA 3KRWA 5HNGA 4DFXE 3ACKA 4L3LA 5KCVA 2QQ7A 4KUJA 3KN5A 4GEOA 2HXLA 4H3QA 3F2RA 3G6GA 3LQ5A 4FI1A 5DVRA 3UO6A 4ASXA 5HIDA 4FV5A 4P5ZA 4Q9SA 3ZHPC 4TNBA 3CY3A 4FUXA 4I23A 4JBQA 5EW9A 2QCSA 5BUIA 5CXZA 1V0PA 4BCHA 2O5KA 3KXGA 1K3AA 3PXZA 4ACHA 4LOOA 3HDNA 5H2UA 2R2PA 4GIHA 4RC4A 3FI3A 4D0WA 1YKRA 4KAOA 3V8WA 2BVAA 3MV5A 3VBXA 1ZZ2A 3OWLA 4E26A 3C0IA 1H0WA 2QKRA 4FL1A 5CWZA 5T68A 1K9AA 3OMVA 4LYNA 3BWFA 5FBNC 1Y57A 3RP9A 2VTMA 3FI2A 2YITA 3BYSA 1Q3DA 4MHAA 3TKHA 3UC4A 3VS0A 1YXTA 4RWJA 3PLSA 5IA1A 2DWBA 4DGMA 4DH8A 3HMMA 2WTJA 3MH0A 3VUTA 2OI4X 4MF1A 2WNTA 2YZAA 2PE1A 2GNJA 3KCKA 2C6EA 2QR7A 1KE5A 4J8MA 2LAVA 4ANOA 5LJJA 4NSTA 3FXXA 5EQPA 4C36A 1FBNA 1W83A 5HLPA 3TXOA 5IQDA 3PJ8A 4I5HA 2QNJA 2A19B 2REIA 5GIOE 5ETAA 4ZMFA 3VS6A 5K0KA 4YURA 5CNNA 2OJFE 3RCDA 2EB2A 5CI7A 3OHTA 3SVVA 4PTGA 1H28A 4QPMA 1FGIA 3TV6A 1UU7A 5GJFA 2WMWA 3PPJA 4MF0A 3SGCA 2IVUA 1YDTE 2QD9A 2RFSA 1NY3A 3DXPA 3B2WA 4BGGA 3R6XA 4I3ZA 5C26A 3COHA 4ZTHA 2JKQA 3Q9XA 1LPUA 4QYYA 5GINE 3HLLA 5EKNA 1A48A 4FEXA 4M0ZA 5HX8A 3GU5A 2PUIA 3FY0A 2J90A 4X2GA 1REJA 1YHWA 2UW4A 2XH5A 2J9MA 5IDNA 3ATTA 1M7QA 3NZ0A 4BBEA 5M57A 5KE0A 4QQ5A 3QTIA 3GB2A 2X8DA 2BRHA 3BBWA 2VNWA 4FKWA 2JKOA 5J9ZA 5AUYA 4OW8A 5H3QA 4U79A 3WF6A 1L8TA 4RPVA 4O0WA 4NU1A 4H1JA 4C2WA 4CTBA 4KB8A 3N4VA 3LAUA 4ZLZA 4DBNA 4TRLA 4M69B 4JIKA 5CF4A 2JDTA 4AU8A 5LVOA 3BQRA 4HYUA 4ZTMA 3ZU7A 3NAXA 2FA2A 2UW9A 3VUMA 3ZLYA 4UMPA 5KNJA 1OKVA 3VRYA 2CKPA 3W2OA 1VJYA 3MIYA 3A60A 4AGDA 4OUCA 3UVQA 5JQ8A 3FKOA 1ZY5A 5A4QA 2IW6A 3IOPA 2ZVAA 3DB6A 5DPVA 3HV4A 1YRPA 4BIBA 1BI8A 4LOPA 1H07A 1OZ1A 4BDAA 4EZ3A 2R3QA 4IXPA 4WG3A 5BVWA 4DFLA 5EI8A 1UU8A 3LCOA 5FWKK 3ORKA 5T3QA 4QMOA 4U3ZA 4F6UA 4A9UA 4BBFA 3BZ3A 3D5VA 4QMLA 1P2AA 2X9EA 4Q9ZA 4OAVB 1H1SA 1H0VA 5JEBA 2UZOA 1GZOA 5JGDA 3KMWA 3FWQA 4CG8A 5I9YA 4HZSA 5DGZA 3QCXA 3EWHA 3QRIA 2J7TA 4KIQA 2W0JA 2E9PA 5M4UA 4FEVA 3CCNA 3GQLA 3QKKA 3Q53A 3VUDA 5L2TA 2CPKE 1ZYDA 2H8HA 2XRWA 4U81A 4UB7A 2XMYA 1NVSA 3VF8A 4BWKA 3Q52A 4C37A 3KF7A 4KS7A 5EYDA 1ERKA 2ITPA 3P0MA 4FA2A 4QMQA 4W4YA 3N4UA 1U54B 3Q5IA 2WTDA 3D5XA 2IZRA 3GUBA 3PXFA 3CY2A 1P4OA 2VWYA 4XLIA 2I7QA 4ZS0A 4EYJA 3FMNA 5BVFA 1OBGA 3QQJA 4HYIA 3GC9A 2QOHA 3TCPA 3L8SA 3ZRLA 3HMNA 3DKOA 4QTDA 3K5VA 1G5SA 3MVJA 4J7BA 3O0GA 4TN6A 3LFDA 5TKDA 3CSVA 5D11A 4G5JA 4FT7A 2XNNA 5LQFA 3HV7A 2PE0A 3PY1A 3FMKA 3R63A 4FK3A 5CVGA 2FSLX 4FGBA 3REPA 1CSNA 5E8SA 4K1BA 2BALA 2F7XE 2R3PA 4AF3A 4F63A 2VNYA 4U43A 3V8TA 4CKRA 5HTIA 2QO9A 4FIEA 2NRYA 2BFXA 4JR3A 3QTQA 3IW6A 2WMSA 5AP5A 5KBRA 2KULA 4FKSA 4ID7A 2GHMA 2UW6A 5CI6A 2ZAZA 3LJ1A 4OBOA 4MK0A 4HVIA 2O8YA 3LVPA 3SD0A 4E4XA 4QMWA 4RIXA 3NNVA 4G17A 4M15A 3LJ0A 1V1KA 1PXMA 3TNHA 4GS6A 1UU9A 4ACMA 3DGKA 3G0FA 5IEYA 4U44A 3EZRA 4C33A 5M55A 3QTUA 3ID6C 2BZKB 5DE2A 4RFYA 2PMLX 3KRJA 1JBPE 2O64A 2OGVA 4UYNA 3NLBA 3R73A 2PMIA 2BKZA 1BI7A 1IG1A 3QC4A 4G9RA 2JAMA 4K33A 1T46A 3VQUA 5I9WA 1Y8GA 3D9VA 4LGGA 3W32A 3VAPA 2VTTA 5JKGA 5C8KA 4PL5A 3DDQA 4O96A 5KHWA 3KULA 3OWPA 4HZRA 3PTGA 1JNKA 3K2LA 2J0KA 2PZIA 5FGKA 3H0ZA 3VUKA 3SW4A 2OSCA 4FV8A 3VIDA 2YHVA 3ZDIA 2Q0NA 4B6LA 4CGAA 4H05A 2OH0E 2XIXA 3HMPA 1QCFA 4QYEA 2QODA 4ACDA 5AUZA 2J51A 4ERKA 3ORXA 3RINA 3KMMA 2X6DA 4FKGA 1OITA 2UVZA 4EI4A 5IQAA 4FTTA 4AGWA 3FLYA 3HL7A 3C7QA 1E1XA 5EYCA 2UZTA 3C4FA 3C4EA 4E73A 3FZOA 2IG7A 4UALA 4BRXA 1GZKA 5T6KA 4MNFA 4EUTA 4TZRA 3PXRA 4DCAA 2PZRA 4RVMA 5EW3A 3D7TA 2CDZA 4GSBA 2UZEA 3HKOA 4IB3A 4U6RA 4X6RA 5DEYA 4E8AA 4IWPA 1BL6A 2WTWA 3F5XA 5DMZA 4FODA 4I0RA 5A6OA 4ZK5A 3EOCA 3Q96A 4FTIA 3TWJA 4FIJA 3ZFXA 4G6NA 2W5BA 4E5BA 3CXWA 5JZNA 5LMKA 3NPCA 4K9YA 3P7CA 4WOVA 4LUDA 4GRBA 3R2BA 4QT1A 5HKMA 4MYGA 2A1AB 2HENA 3NEWA 4UBAA 1W8CA 3RBWA 4UX9A 2OJIA 3NX8A 3U9NA 3EYHA 5L6WL 3UMXA 4JBVA 1YXSA 4E5WA 3QTSA 3FBVA 4GJ2A 2WMUA 3AC4A 1NVQA 3LCSA 3O8UA 2QVSE 3R8VA 4E3CA 4K0YA 4UYAA 3VQHA 2ZB0A 2PVRA 3EFLA 3MY5A 3QCQA 4D5KA 2X81A 4XCUA 3R9NA 1W98A 1X8BA 4P4CA 3VS3A 4EKKA 4KABA 5FEQA 3UZPA 5HORA 1R0EA 4EC8A 4F64A 2ITXA 4FV0A 3D4QA 3E87A 4FG9A 3QD0A 3RHXA 5JGAA 2VZ6A 1BLXA 4C35A 4F1MA 4MVFA 4ZJIA 2BPMA 2EB3A 3NWWA 5F4NA 4E5AX 3Q2JA 3MPTA 1PMEA 4YZCA 4F9YA 5K4JA 3RZFA 2GHGA 3L1SA 3ZH8A 4C61A 3UQCA 4ZTNA 4MTAA 4FTKA 4RA4A 4BZNA 4ZY6A 3KXMA 1WZYA 3H10A 4PPAA 4UWBA 4BIEA 4FBXA 4FG8A 2BILB 3PY3A 3EN4A 2UW3A 2RGPA 3JS2A 2QC6A 4RJ7A 2IPXA 3VN9A 3EN9A 3NCZA 3HP5A 3RMFA 2CKQA 2ACXA 5JN2A 4YNOA 3O17A 4YZNA 5A3XA 1STCE 4D1ZA 2BAKA 4ASEA 2EXCX 5B2MA 4M66A 2BZJA 3VBQA 3RK5A 2BDWA 3D2KA 4D9TA 1ZYLA 3F6XA 1JVPP 3BHYA 4ITIA 5F9EA 1OIUA 3G6HA 1KWPA 4IVDA 3I7CA 4Y72A 4YC6A 1ZYCA 3FSFA 4R7IA 3ZYAA 3PZHA 3A8WA 5CANA 5JT2A 3GXLA 2GHLA 4ZJVA 3ZONA 4I22A 3HGKA 4CFUA 3NAYA 3LHJA 2X2KA 3V3VA 5E4HA 3QUDA 3D83A 3F69A 1U59A 4USDA 4EQCA 1OIRA 3ITZA 4JG6A 3EN5A 2VWZA 3RI1A 4FKVA 4MBJA 5HO7A 1KOAA 1F5QA 1V0OA 4LGHA 3R30A 4DFZE 3BU5A 5HIBA 3QKLA 5BVOA 4IMYA 3QXPA 4BTFA 1VZOA 2BTSA 1FVTA 4LL0A 5JFVA 2ZM3A 3ANQA 2YEXA 1PXNA 3SV0A 3TL8A 3UPXA 1YWNA 2OXYA 4L42A 3OBJA 4S30A 2GQRA 3QWJA 3QGWA 4DH7A 3HAVA 3KY2A 5DT4A 5AA9A 1OPJA 3M1SA 2W1EA 1H01A 4LV5A 4RGJA 4BTKA 5LWNA 4AN9A 1S9IA 1QPDA 2J0JA 3GOKA 3JVSA 4PQNA 1TQIA 3WILA 2FB8A 2O65A 5IISA 5JFSA 3ANRA 4RIXB 3HUBA 3R7UA 4FTNA 4FNYA 5DH3A 5H8GA 1J1CA 3TTIA 5CAOA 3UDBA 5IMXA 3QD4A 1JKTA 2WD1A 2WIHA 2ZM1A 4D5HA 1H27A 3U87A 3O96A 5J5TA 2PL0A 5EK7A 2Y7JA 4C4EA 3A7IA 2RFDA 2R3MA 3F61A 2RG5A 3ZC6A 5E8XA 4B99A 4RWIA 3R8PA 3S3IA 4EH6A 1CKPA 4OTDA 3OTVA 3G9NA 4YMJA 1LEZA 5AAGA 5LMBA 3KULB 3QX4A 4FTOA 3WZEA 4L45A 4Z3VA 2W17A 4YO4A 5A4CA 2E9UA 3D5UA 5FD2A 2PU8A 2ZB1A 4XBRA 2CN5A 3E63A 4BDHA 1M14A 1YVJA 4RLLA 4LV8A 4AGUA 4EBWA 5AEPA 4EORA 4UEUA 3OOMA 2BRBA 4YTHA 1GOLA 5HIEA 3MFSA 3R1NA 4KA3A 4UMTA 3KA0A 4P7EA 5IQEA 3UO4A 2UW5A 5D7VA 2BIKB 2UW0A 4F08A 2XEYA 4N6YA 5CX9A 5DI1A 5HE3A 3ORNA 3UNKA 3D7TB 4NJDA 5F20A 4AE6A 4HCUA 4F6SA 3MFUA 4O7YA 5AA8A 4GVJA 5EI2A 3AMYA 3FMLA 3COMA 3IW8A 1UVRA 2C30A 3BYOA 4L7SA 4YJSA 2FYSA 2W1DA 5AM7A 4YTCA 2PUUA 4BHNA 3Q60A 2IO6A 3LJ2A 2ITNA 4FL3A 4NM5A 3ZLWA 5EM5A 4AG8A 2WMRA 3D94A 4WUAA 3QAME 3QQLA 4S33A 4FICA 4Y8DA 3LFFA 3UIXA 2YIQA 4CD0A 2HW6A 3E88A 3Q4UA 4K6ZA 3RPSA 3S95A 1SNUA 4PDSA 3TNWA 3G9LX 3GCVA 1KE8A 2VTJA 4BDKA 3BHUA 4WIHA 3RGFA 3S2PA 3AMBA 3A61A 4C7TA 5FLFA 4L43A 4CRLA 5LVNA 4C3PA 2YFXA 4RWLA 3VJNA 4AGCA 2CNUA 3GU7A 4G31A 4OR5A 2ZDTA 4KSPA 3ERKA 2UUEA 3VHEA 4O1PA 3GBZA 3BIZA 3C4WA 1ZOEA 2FSMX 4FTJA 4JL9A 1E1VA 4LM5A 4S34A 3KVWA 3DJ7A 5DIAA 4J53A 3ZO1A 3MN3A 4TYJA 2C6DA 4FTCA 3VRZA 4AA0A 3U54A 5DRBA 4D2RA 2BFYA 3LM0A 5CF6A 5J9YA 5M51A 3DXQA 3AOXA 5B2LA 3RTPA 4WG4A 1HCLA 1EH4A 3NGAA 2JGZA 4J52A 3NUPA 4R6VA 2C5VA 4GYGA 2IW8A 4I6BA 1ZWSA 4O0TA 5AV4A 2PVMA 4HVGA 2JDOA 2PVHA 4IAFA 4Z7HA 3FI4A 1AGWA 4FYNA 3E64A 2GS2A 3OXZA 3ET7A 3R7GA 5HLNA 3SDJA 4C8BA 3KRRA 5KMKA 1SYKA 3SXRA 3QZIA 2OIBA 4BYJA 4WG5A 4PL4A 5E8TA 3TDVA 2UV2A 3OWJA 4FKIA 4DFBA 2BRMA 3W8LA 2QU6A 5L3AA 4ACGA 1UA2A 5CEOA 3FMEA 2VO6A 3DBDA 3FZPA 3NCGA 2X1NA 5M07A 3MBLA 4WUNA 4Y46A 5HBHA 5H8BA 2B1PA 3VC4A 4FIIA 4EK6A 5BVKA 3KXXA 5I3OA 3O71A 4I21A 2QURA 4LMNA 3CEKA 4CLIA 3MFTA 4YJQA 3HMIA 3M42A 3B8QA 3ALNA 4XP3A 4J1RA 5KBQA 4AW1A 3GCPA 4F7LA 4FK6A 2WB8A 4G16A 5AUVA 2GTNA 3CTHA 3ORZA 4QPSA 4IQ6A 4I4EA 2HCKA 3W33A 3E8CA 3A62A
chains in the Genus database with same CATH superfamily
2I0YA 1WFCA 2OO8X 4FOBA 3L9LA 3QYWA 2OIDA 3FHRA 5CSPA 2WQBA 3NVKI 3IKAA 3QYZA 2V7OA 1GZ8A 5E91A 2JKKA 3GOPA 1U5QA 4AN3A 1L3RE 3PP1A 4O2ZA 4QTBA 4DG2E 5M4IA 1YXUA 3CKWA 3KEXA 4HYHA 4GFGA 4QP8A 4NFMA 4PP9A 2FGIA 4C34A 3OFMA 1PKGA 2FSOX 2PVJA 2Z7QA 4R1VA 4O86A 2QOBA 3KF4A 3MVLA 1E9HA 5CSXA 4A7CA 4OT5A 3VBVA 1P14A 2CGXA 3HECA 3LXPA 2PYWA 4R7BA 4EOSA 3ZZWA 2A2AA 4XOZA 2J0IA 2XEZA 3NUUA 4IFGA 4EOOA 1OL6A 3MH3A 2BIYA 3WARA 4X21A 3R7OA 3WIKA 4CT1A 3ULIA 3IOKA 1KUTA 4NKAA 3NS9A 2X6EA 4DEGA 4I24A 3MYGA 5EDPA 4I5CA 4F99A 4KKEA 3F7ZA 4PDYA 3DAKA 2ITQA 1ZRZA 4EUUA 2XKFA 2JFLA 3QALE 3VVHA 4EQUA 4EZ5A 1PHKA 4DGOA 1QPCA 2VD5A 2I1MA 4DGLC 3SG8A 5K5NA 4CCUA 3Q4CA 3W18A 4BC6A 3DDPA 4XRLA 3VJOA 1BMKA 2C0TA 2PSQA 4D2PA 4O0RA 5BQ0A 5CF5A 3OUNB 1Y8YA 2G2IA 3O8TA 4I0SA 2O0UA 3KCFA 5EM6A 3SOCA 5LWMA 4KRCA 3UMWA 2X7OA 1VLRA 3QZHA 4X3FA 5C4LA 2G2HA 3FXWA 1T45A 4CYJA 3L9NA 2R3JA 4O4CA 3UC3A 3ZFYA 2HYYA 2YDIA 3E8EA 4FVQA 1W82A 4LRMA 2R3LA 2HZNA 4ANLA 4TKSA 2RF9A 3MY1A 1UNLA 5HCZA 5E7RA 4EZ7A 4WNMA 3ROCA 3PJ2A 4BDDA 4D4RA 3EKKA 3O23A 3DKGA 3E7VA 2SRCA 4KINA 5AP1A 4AQKA 1XQZA 1IASA 3LIJA 3SQQA 2YABA 2ESMA 3GC8A 3Q4TA 5CYIA 4MAOA 3WZUA 5IG1A 5ETCA 1I44A 5TT7A 2W4JA 3ENHA 4AXFA 4IJ9A 2VTLA 1WBNA 3Q9YA 4UZDA 4O83A 2QO7A 2ZV8A 3KREA 4IEBA 1OVEA 3R83A 4RZVA 3FV8A 2A98A 4FRFA 5BUJA 4YZBA 1OL5A 4USFA 2GCDA 4ZOGA 2E9VA 4PX6A 2WTKB 5AR8A 3FLWA 2HY0A 4I20A 1ZOGA 4UXQA 2FUMA 1JSUA 5E8VA 2XRUA 4NCTA 3TZMA 4NK9A 3GU4A 4KBCA 1UV5A 1CDKA 3EFJA 4JIAA 2QR8A 4HPTE 4Q5HA 4K18A 1NT2A 1Q99A 3R21A 1GIIA 3UG2A 4F6WA 5CEQA 2W5AA 2XF0A 2BR1A 3Q2MA 4HJOA 4G5PA 3FQSA 1KE9A 1DAWA 3MFRA 4IACA 5JZJA 1MUOA 4GT3A 4Y5QA 2VAGA 2VTHA 2CGVA 3IW5A 4Y83A 2PZ5A 2VX0A 3V6SA 3QL8A 3IGOA 1KSWA 1W2FA 4DH1A 4X2JA 5AX3A 4QQJA 4FKRA 4MD7E 1F0QA 2YAKA 3CIKA 3GU6A 3NYVA 4O6LA 5C01A 2ZOQA 4AOJA 2XM8A 2UW7A 2IWIA 3TNIA 5IA3A 5ANJA 4CZUA 2OF2A 2G1TA 3ORTA 4K8AA 2C47A 3DXNA 4DGNA 1DI9A 1PXPA 3DFAA 1M2PA 2QKWB 3BYVA 3R9HA 5HQ0A 4GJ3A 3HAMA 4FV7A 1XBAA 4WBBB 2XP2A 4EOLA 1Q41A 2JD5A 4JG7A 4O21A 4ZZNA 4CMTA 3ZC5A 1JKLA 3UDZA 3I0QA 4GU6A 4FG7A 4QMZA 3CJFA 4MD9E 4UXLA 3SKCA 2QLUA 4N4SA 3P5KA 2G01A 2GDOA 3L8XA 3RHKA 3ZM4A 4O84A 5AFVA 2X0GA 3E92A 3EQGA 4BYIA 5KKRB 1H1PA 4FEQA 4MWIA 3JY9A 4IJPA 4U9AA 5FTOA 1OL7A 4J97A 5BMSA 3R71A 1OKYA 2F57A 1IAHA 3S1HA 5ANKA 5AP3A 3VUHA 3I6UA 5DRDA 3DJ6A 1SVHA 3F82A 4TYHA 2YLEA 3N51A 5DBXA 5AP0A 5EH0A 2HY81 3QHRA 2ZV9A 4WD5A 1OKWA 3NR9A 2PTKA 4H36A 2J0MB 2B9HA 1AD5A 3I79A 4IHPA 5FM3A 2XNEA 1XJDA 5EQYA 5LXMA 3L9MA 1DS5A 4V0GA 3DQWA 5LMKC 3LFBA 1JKKA 4O7TA 5AV2A 3KK9A 5TF9A 5TR6A 1MQ4A 4ITJA 4L9IA 4JLCA 3NW7A 3ZUVA 5IH4A 1AQ1A 1Q4LA 4GV1A 5KMJA 4IWOA 3RK7A 5C27A 2NO3A 3BYUA 3UIMA 2V22A 4A9YA 2IW9A 4BCOA 4FIGA 3LCDA 5HE1A 5IQGA 3FMDA 5I5ZA 4NEUA 3LCKA 4YGAA 2DQ7X 2C5XA 1O9UA 1TVOA 2QI8A 4EK4A 3PE2A 2XCKA 3HEGA 3P86A 3UZRA 5M53A 3OTUA 1Q97A 4AXEA 3T9IA 3T8OA 3BX5A 3KGAA 1W2CA 4UV0A 3PXYA 1WBTA 4MQ2A 2B55A 3DZOA 4PUZA 2ITOA 4PTEA 2Y4PA 2F2CB 4WSQA 4FTMA 1XBBA 2Q83A 2I0VA 2XNOA 4BKYA 4EWQA 3T9TA 4Q5EA 3IK3A 1IA8A 4EHVA 3PRIA 4YLKA 1XH4A 5A9UA 4O7VA 4KNBA 3VUGA 4LOQA 2AEGA 2XK6A 2B4SB 4FKJA 2HIWA 4O4DA 4ASDA 3UJGA 2X9FA 3NYNA 4RJ8A 4BCGA 4XEYA 3W16A 4IZAA 4X7QA 4BZOA 3PXQA 2X4ZA 4NH1A 5BVNA 1NXKA 5LCKA 3MA3A 4XH6A 2O3PA 4X3FB 4PNKA 4QYHA 2J2IB 2P0CA 4N70A 4Q2AA 2CHLA 1OI9A 4L53A 4UY9A 5EHYA 3W10A 4IZYA 4DITA 4DLJA 3QTWA 3OXTA 1Z5MA 2FH9A 3EQIA 5LOHA 4HVHA 2WMTA 5IQBA 4GFOA 3OS3A 3NYXA 4PPCA 4F0FA 2PHKA 2FSTX 4IWQA 1NA7A 2HXQA 3VHKA 5HESA 4DF3A 2W1GA 4O91A 4MXAA 5CVFA 4PL3A 4YLJA 4AZEA 3BLHA 3H9RA 2PY3A 3F88A 4R5YA 5JK3A 3S00A 3UTOA 4CFVA 5DWRA 1VYZA 5J5SA 4BWXA 3KFAA 2YISA 4TNDA 3N9XA 2C6KA 5IUGA 3PPKA 5M09A 4F7JA 4EBVA 2V5QA 4MBLA 4YNEA 4BDIA 2XNMA 3P78A 3GQIA 3PP0A 4GVAA 5IH6A 4GUEA 2VTAA 4M7IA 4N0SA 4ZAUA 4DBXA 4YPSA 3IONA 5CEMA 2VX1A 3KXZA 4UN0C 3UDSA 3PG1A 4RA5A 5E92A 3MTFA 2XNPA 5ETIA 4BI0A 4FSWA 1RQQA 4QYGA 4AT5A 3M11A 3FC2A 4NW5A 5DR2A 2JFMA 1XWSA 4GIIA 3BWJA 1ZY4A 2HWOA 3UE4A 4RIOA 1BKXA 5L8LA 3VUIA 2XCHA 3H3CA 3HNGA 5I9XA 3FLZA 3ZXZA 4OTQA 2IVVA 3P7BA 4ZSLA 4QMPA 2VTOA 1JQHA 3OWKA 4O38A 4D4YA 4O7NA 2YM4A 3JUHA 2BDJA 5AAFA 2H6DA 4M12A 4QMVA 4FKOA 1LP4A 4L67A 5CF8A 4F09A 4WO5A 5CT0A 5FTQA 3KIOC 4S31A 4M8TA 3UQGA 2Y8OA 5IA2A 1PW2A 4I0TA 2E9NA 2VU3A 2GNIA 1Q3WA 3C13A 3RAHA 4HVDA 5FTGA 4BHZA 2PVFA 1U4DA 2RKUA 3HRCA 4USEA 5ETFA 3QZFA 5EKOA 2E2BA 4C4JA 1IR3A 5HD4A 1R1WA 1UNGA 4QMMA 1Q5KA 2BRGA 2VWIA 3BEGA 4JDKA 3S4QA 4QMSA 3R8UA 2WU7A 3RVGA 5KX8A 4I41A 3Q9WA 2YCRA 4QP2A 1RW8A 3D5WA 5BYLA 3BLRA 3CQEA 4LMUA 1A9UA 3V6RA 2VGOA 3TIYA 4A07A 5FBOA 4HOKA 3R00A 3KXHA 3QCYA 4C3FA 2P2HA 2XS0A 5JRSA 5IA4A 1J7LA 1APME 5EM8A 3I81A 2H9VA 2GU8A 1SVEA 3DOGA 3P79A 2WEIA 4JX3A 5CSWA 5AR2A 3WF9A 3R8MA 4DEAA 3EB0A 3QD2B 4YU2A 5JH6A 4CKIA 1OM1A 4G34A 1WMKA 3DTCA 1PYEA 2YJRA 4TYHB 2ZYBA 3TN8A 4BTMA 4L8MA 4BTJA 1JOWB 5CEPA 2RG6A 2QG7A 3ZMMA 4IZ5A 1M7NA 1OECA 5EYKA 4RSSA 2EUFB 2QLQA 4D2WA 5IU2A 4HGTA 3PYYA 4V0GB 4RIYA 3FDNA 4ZS4A 4ZTSA 3R0TA 2B52A 3MH2A 4ARKA 4ZZMA 4YO6A 4JR7A 1GZNA 4C62A 4V04A 3B2TA 2WTKC 3ODYX 4OTPA 2QG5A 1XH6A 4FV1A 2C3IB 4MXOA 4IB0A 4L6QA 2CKOA 2W1CA 3KQ7A 3BELA 3Q32A 4TWOA 1XH5A 3O7LB 3R1QA 4GUBA 3THBA 3JPVA 5J79A 1DM2A 1SZMA 4UMUA 2CGWA 4OAUC 5HU3A 1Q8WA 5EQEA 3PA3A 2VV9A 3R22A 4O22A 3UP2A 4J98A 5TOZA 3A4PA 5K0XA 1OUYA 2Z8CA 3OT8A 5IEVA 3FKLA 4BR3A 5DNRA 2WELA 3BE9A 5BPYA 2ITYA 2IJMA 4GK4A 2R3OA 4JQEA 5AAEA 4DEDA 4BCFA 1H1WA 5AADA 3TYKA 3C5UA 4FIFA 1FGKA 3IPHA 3R1SA 1V0BA 4XG6A 4XOYA 2XIRA 3UBDA 5CT7A 3DKCA 2BTRA 4DTBA 5AP2A 3IECA 2X4FA 3CQUA 4W8DA 3C4ZA 5C03A 4IAZA 4WSYA 5C4KA 5JGBA 4DN5A 2C3JA 5CVHA 4LDTA 2W4OA 4XP2A 2R4BA 3AKKA 2WQOA 4FEUA 1Q61A 4C4FA 4PMPA 3BEAA 3O51A 1G8JA 2UVXA 3FZ1A 4CRSA 2W06A 3TJCA 5IDPA 4R3PA 5E8YA 4YC8A 4FTLA 1O6YA 2Y9QA 3GU8A 4KSQA 3ZSGA 4IVBA 3Q04A 3NSZA 1YDSE 3FL5A 5FM2A 2EWAA 3WI6A 4CMUA 3OP5A 4FNXA 3RWQA 1XMMA 2B7AA 3QWKA 3SHEA 3RAWA 2B0QA 4EH9A 3OF0A 4NM3A 4E1ZA 4MX9A 3DCVA 1M2QA 1R3CA 2HELA 5HICA 4E7WA 5BYYA 5KKRC 3BLAA 1URCA 5IQHA 4JVGA 5AM6A 3OZ6A 5I9VA 1YXVA 4QTEA 3RAKA 5CAVA 3GI3A 4QDVA 1OPKA 1M52A 3K3JA 4BDEA 3TI1A 4CZTA 5IA0A 4LV7A 4IANA 2XAMA 3OT3A 1PXJA 4RT7A 3ZCLA 2PZPA 5KMIA 4QEBA 1IRKA 3PA4A 4DYMA 5CU6A 1ZLTA 4W4WA 5HD7A 4CEGA 3ORLA 4FSTA 4AOIA 4C4GA 3LCTA 3I5ZA 4U5JA 2C5YA 3AT4A 3W2CA 4JRNA 3F7WA 3DJ5A 5AWMA 5L8JA 5LCJA 3SXSA 3PDTA 3I7BA 1B39A 4KKGA 4O7LA 4LG4A 3V5TA 2QOLA 4QD6A 2WXVA 2X2LA 4JT3A 3PJ3A 4FE2A 1R0PA 4IM3A 4QP9A 5HVJA 3OROA 4EJNA 3PSCA 3TV4A 1OGUA 1QPEA 2R5TA 4F0IA 1PY5A 4OLIA 2GNHA 2JEDA 3IO7A 5CY3A 3I0OA 4PMSA 4O0YA 2I0EA 4JRVA 4XG8A 2UZUE 4RJ3A 4V01A 2WU6A 3DA6A 4W9WA 4XS2A 3R7YA 2WGJA 3FZRA 1CM8A 3QXOA 2YCFA 3EJ1A 5BMMA 2OJJA 2VN9A 1Y6AA 3DZQA 3E7OA 2XIZA 3PUPA 4XV2A 4EK5A 1MRUA 2J4ZA 2W5HA 2F49A 3CBLA 3UVRA 1YWRA 4AZTA 1Q62A 3RNYA 4NM0A 5CSVA 3WZJA 5ACBC 4L7FA 2ETKA 2NRUA 3AD4A 4W4VA 2BHHA 3LFSA 4P5QA 3AD5A 4C02A 5LARA 5KZ0A 5AUWA 4AQCA 2XNGA 4F1OA 1TQPA 3H9OA 3ZEPA 1FVVA 3PFQA 4MBIA 4R8QA 1KE6A 4E4LA 4L52A 4D2TA 2BROA 2JAVA 1BYGA 4M84A 2GPHA 4GG7A 4RJ4A 3FLNC 1KOBA 4X3FC 4ITHA 1ZMUA 3FPMA 3FZTA 3RK9A 3I5NA 5GJGA 3V5PA 1G8SA 3BQCA 3BGZA 3VULA 2W9FB 4WNOA 5DR9A 3MY0A 4FSNA 3GGFA 3LXKA 5AV3A 4BDJA 5AR7A 3G15A 1GIJA 5CAPA 3R8LA 2PK9A 3AT2A 1XR1A 3LMGA 2UVYA 4QP6A 3EFWA 2HK5A 2XALA 4U7ZA 2V0DA 2XUUA 4TTHB 3SOAA 1UU3A 2C0IA 3E8NA 3OY1A 4EOMA 3WOWA 1W84A 2W1IA 4PDOA 4DH5A 2C6OA 2Y0AA 4QMXA 3ULZA 3VF9A 2QONA 4PDPA 5ANGA 3FMJA 5EHOA 5AUXA 5CLPA 4RIYB 3W2PA 3GCUA 5FG8A 1K2PA 5FP6A 4IIRA 2X8EA 3OEFX 4JQ7A 5E1EA 4DEHA 4II5A 4AAYA 4NWMA 3AC5A 4BI2A 4IX3A 4QQCA 3WBLA 5E8WA 4CVAA 1J91A 3DBQA 4XLVA 3BGQA 2J5FA 5AMNA 2HZIA 4I5PA 1G8KA 4GT5A 4XMOA 2OK1A 4L01A 4W8EA 1PXLA 2RSVA 2WHBA 2WOUA 3D0EA 2NPQA 2XM9A 4AFEA 4ZEGA 3LE6A 3Q6UA 3LMIA 3HYHA 4FV9A 3QRJA 4Z9LA 3SRVA 2JKMA 1YOLA 3MVMA 4QO9A 3RKBA 3RPOA 2OBJA 3FYJX 3OCSA 3U6HA 4MD8E 4E6AA 3U9CA 4IX4A 4YC3A 3VS4A 3PSDA 3TNQB 1TQMA 3R7IA 3BHTA 3BCEA 1P4FA 4IBMA 4QMYA 1MP8A 5B7VA 4CV9A 3QF9A 4YZMA 3CPCA 4F7NA 2VTQA 5CU4A 2XARA 3BYMA 3O7LD 4X6QC 4IAAA 4M14A 4AOTA 4IVCA 2V55A 4FEWA 2Y6MA 4QYFA 4S32A 3UQFA 3IDPA 1PYXA 2OJ9A 3L8VA 3GC0A 4DGGA 4QP1A 2QHMA 5FRIA 2UZVA 3EQPA 2WQNA 1YI6A 2F2UA 3BRBA 1YOJA 4FUYA 2C0OA 4IX6A 4A4OA 3QRTA 5HG7A 1Q8ZA 2Z60A 3KXNA 3MGYA 5HI2A 5AX9A 2PUPA 3ROYA 3QFVA 2GFSA 3UNJA 5C1QB 2OWBA 4CYIA 1U46A 3A8XA 4RX7A 4Z55A 5BVEA 1TKIA 1I09A 4YJTA 3TKIA 3GC7A 4XRJA 3ZEWA 4LRJA 2GQGA 2CMWA 4RWKA 2VWVA 5CAUA 5HVYA 2RIOA 3ZS5A 3G0EA 3H30A 4PTCA 4BBMA 5A4TA 3MB7A 2JITA 2OW3A 2HZ4A 2ZV2A 3KRLA 4RBLA 5HE2A 4AT3A 3D15A 2IF8A 3DY7A 3PFYA 4FTQA 3PLAE 4WNPA 1GJOA 3TUCA 5C8NA 2PMNX 4R77A 3S0OA 4ERWA 2R3RA 3V51A 3PSBA 3PIZA 5EHLA 4QMNA 3OOGA 4EH5A 3DNDA 5AP6A 3LFNA 4IB1A 5DHJA 4A4LA 3CLYA 2AQXA 3POOA 4FKPA 1YW2A 4PRJA 4I94A 4OTFA 4TWNA 2ITTA 5HBEA 5CQUA 4ZLYA 1VEBA 5CALA 2OFVA 3CD8A 4FMQA 4C4HA 4FF8A 1FQ1B 5J8IA 4YHJA 5ICPA 3BHVA 4O4FA 3UOHA 3DBEA 2EXMA 2YIWA 3RPRA 3EN7A 2WEVA 1HOWA 1JSVA 4G3GA 4JDJA 1SM2A 3COIA 3U8WA 3R28A 2E9OA 3Q9ZA 4EKLA 1PMVA 2A4LA 3CE3A 2IZUA 4I93A 4CT2A 4GCJA 5CXHA 3FQEA 4RIWA 3RZBA 1ND4A 2BRNA 2OU7A 3W1FA 4ENYA 2BAQA 3R7VA 5D7AA 4CFMA 4DCEA 3ZBFA 2Y4IB 2XK8A 4I1ZA 3A7JA 1Z57A 3HVCA 4R5SA 4FT0A 4RX5A 3DBFA 3W0PA 3OVVA 3FC1X 3O50A 4UWYA 5G6VA 3CGFA 3ORPA 3QTRA 2WFYA 3A7HA 2A0CX 4JS8A 2XKCA 3GT8A 1J3HA 1BL7A 2JBPA 3FLSA 3VBTA 4U40A 5J95A 3DLSA 5EYMA 2GQSA 4D55A 4O0SA 4AW2A 2X0QA 3FYKX 2WOTA 5G1XA 2I0HA 4BCMA 5CAQA 1IA9A 2ZMDA 4DEIA 4DFUA 1JKSA 3P1AA 3C4XA 5BNJA 2OF4A 2P33A 4NIFA 4E20A 2RL5A 4U45A 2XBJA 4IX5A 3TIZA 1H00A 4ZSAA 4O81A 2ONLA 3BU3A 3U51A 3CPBA 1Y91A 4FZ7A 3ML1A 3W0SA 4O0XA 3GP0A 5D12A 4C0TA 2OJGA 3DAJA 1W2DA 2Z7LA 3ACJA 2YERA 3CD3A 5AV1A 3LQ3A 2H96A 2RFNA 4J96A 4OGRA 4XG2A 4RVKA 1QL6A 2OZAA 2C6IA 2G9XA 2QU5A 3F3ZA 1Q8UA 1SNXA 3CS9A 3IG7A 4FKTA 1JAMA 4O6EA 3QCSA 3OW4A 4E6DA 2F4JA 4TPTA 1KV1A 1YXXA 2GTMA 3ELJA 3ALOA 4C57A 5HTBA 5E8UA 3ZBXA 2O63A 1YHVA 3P7AA 4FZAB 5AJQA 2DYLA 4IAKA 2R3NA 5TO8A 3G33A 5M56A 4EL9A 4N6ZA 4L3PA 4AN2A 4BN1A 4EH2A 1BX6A 4JAIA 4I6LA 3QGYA 3QX2A 2QOKA 2JDRA 2VTPA 3FKNA 3IS5A 5EFQA 3UOKA 4CLJA 3OW3A 4BIDA 2R9SA 5BX0A 4CQGA 2C6TA 4GH2A 3VW8A 4CTCA 3VW6A 4O7SA 4YHFA 4GU9A 5L8KA 3K54A 5EM7A 2YJSA 1YQJA 3DK7A 3KL8A 3TACA 2WAJA 4U42A 4BFMA 4BCKA 4GKIA 2BKKA 4YJUA 4YP8A 2W99B 4IVAA 5EDRA 5L2SA 5LVPA 4HPUE 3R7EA 4ZTQA 3SAYA 3SRVB 1FINA 3BV3A 1R39A 4FTAA 3G5DA 4RLKA 3UYSA 3W55A 2V7AA 3V5QA 5K4IA 3AC2A 3LLAA 3W2SA 3TTJA 4FT9A 3R1YA 4AZFA 3ZOSA 5IPJA 4MCVA 4XNEA 1WBSA 1Q24A 4AZVA 5HU9A 2NNWB 1R78A 3EQBA 4BCPA 4A9RA 1WAKA 3BLQA 4XG9A 2X8IA 4C38A 3I1AA 1ZMVA 4B0GA 1BUHA 3V5LA 1PF8A 4YTFA 4WNKA 3PVBA 3EZVA 2JBOA 3CTQA 3NDMA 2VTRA 5HBJA 2ZJWA 4EH3A 3I60A 4EONA 3F2AA 3Q4ZA 3DK6A 3R04A 4RFZA 3HZTA 3NNWA 3AD6A 3MPMA 3ODZX 3W2RA 5J7HA 3I6WA 3N4TA 3ZXTA 4I92A 1ZYJA 4YJPA 4FV2A 4A4XA 5IF1A 3M2WA 3EQHA 1JPAA 4PY1A 1JSTA 4XUFA 4YBJA 2P4IA 3UVPA 4F9CA 3GENA 5DYJA 4MKCA 2NYAA 2YCQA 3QA8A 5DLSA 1RJBA 3RCJA 4WRGA 4J8NA 3SXFA 5E8ZA 3F3WA 4UMQA 1XHAA 3RNIA 3KK8A 2WTIA 4HCVA 5HOAA 3LZBA 4FNZA 5CENA 4F65A 2OG8A 5EI6A 3MDYA 5B0XA 4RVTA 3ZLXA 3UG1A 4Z16A 5FP5A 3ZRMA 1H1QA 3FL4A 4CFNA 4YUQA 4ZZOA 5BVDA 4BY9E 5B2KA 5DT0A 5I9UA 1WVYA 2J6MA 4FYOA 4G2FA 2B53A 5ANOA 3PWYA 4RFMA 4U97A 4F7SA 1OB3A 3QQFA 3VBWA 3QU0A 5DEWA 3RM6A 2XIKA 5HEZA 4AXAA 4EH4A 3UOLA 1WVXA 4HGLA 1CKJA 2ERKA 4C2VA 4ZMEA 5AP7A 3AKJA 3LXNA 3L9PA 4DFYA 4E93A 3POZA 4FSQA 4B9DA 4D4SA 3FUPA 2CNQA 4R3CA 1B6CB 4DFNA 1P5EA 4FSYA 2J50A 3MIAA 4YHTA 4ALUA 2QOFA 3NNUA 4RX9A 3GCSA 4R78A 1QMZA 3RJCA 5HE0A 4G3FA 4RIWB 3LFCA 3PPZA 3FI8A 2R0UA 3OCBA 4YJNA 3LFAA 4A9TA 5FQDC 4YR8A 2VRXA 2W1HA 2XK9A 2VWUA 3VWAA 4DT8A 2UZWE 3NUAA 4W9XA 3P4KA 5FDXA 1OMWA 3A99A 5JFXA 4QMUA 4RJ5A 4PP7A 2YM8A 3GCQA 4MH7A 4M97A 5J7BA 3P08A 5ITAA 3KB7A 1FMOE 3CR0A 3ORMA 3P5JC 5CZIA 4IW0A 3RPVA 4QPAA 2Z2WA 3RAIA 2J5EA 4ANBA 3UO5A 4UWCA 3H4JA 1PMUA 2YWVA 1YHSA 1WBVA 3QUEA 2JC6A 3FE3A 4RQVA 1Q8YA 3AG9A 5DG5A 4BVUA 4DINA 5A4LA 3NVMB 2PWLA 1FPUA 4GT4A 4NIFB 4W4XA 4I6FA 5LMAA 5JFWA 1W7HA 4Y85A 4ALWA 3SLSA 3EN6A 3QD3A 4B8MA 3F9NA 4HGEA 4FSRA 4HNFA 4A9SA 2DS1A 3OD6X 1LEWA 4D58A 2BZHB 3QRKA 4YPDA 4AXCA 4R7HA 2YIXA 3A7GA 2OICA 3PXKA 4GL9A 4IAYA 5JSMA 4F78A 5M44A 5GZ9A 4BL1A 1PMNA 2OZAB 1JWHA 2C5OA 1DAYA 1OL2A 4WKQA 4Y95A 1Z9XA 5HCYA 1H8FA 2AC5A 4DHFA 4IC8A 1ZARA 5J1VA 2C6MA 3C9WA 3G90X 2ITWA 4U3YA 4JAJA 2CKEA 2R7IA 5BYZA 4IAIA 3EQDA 4AW5A 3WYXA 3V5JA 3MS9A 4ZY5A 2HZ0A 2BDFA 4RVLA 4YBKA 4GYIA 2XJ1A 3DV3A 3ZSHA 4KIPA 4RG0A 3TUBA 2PVKA 4BCJA 3QTZA 3NMUF 2CGUA 2WTVA 1GY3A 4LQMA 4GFMA 4J71A 4FJVA 2C6LA 3KRXA 3KVXA 5EDQA 3GFEA 4FT5A 5L6PA 3LKMA 4D9UA 2Z7SA 2QHNA 3AXWA 4M0YA 3BL7A 2W05A 5CS6A 4C59A 4DG3E 5D41A 2YDKA 4NTSA 3LMHA 3TG1A 2IVSA 3BI6A 3QLGA 1OIQA 1VR2A 2ITVA 3NNXA 4XV3A 4HCTA 4E6QA 3TV7A 5EG3A 3PJ1A 3ZDUA 2F7EE 2YIRA 3L8PA 5D10A 4D2SA 5DOSA 4QNAA 4ZJJA 3OEZA 4C3RA 2Y4IC 4EOIA 3ZZEA 4H3PA 2WMXA 3DTWA 4FSUA 4ZXTA 3WZDA 4CG9A 3V04A 5HLWA 2BUJA 2I6LA 4ANMA 4F0GA 5A54A 5CU2A 3C50A 3KN6A 4CMOA 4JBOA 4F1TA 4G1WA 3D2IA 3C4CA 3WF7A 5FXQA 4EH8A 4DAWA 4U8ZA 1RDQE 3DPKA 3R01A 5KZIA 4GKHA 3DKFA 4YSMA 3RALA 4ANNA 5AUTA 3UYTA 3UZTA 3OCTA 4O1OA 2KTYA 3TM0A 4JQ8A 1YI4A 2WMQA 3COKA 4I6HA 4E4MA 5IQFA 2EXEA 2PVLA 4O2PA 4EHZA 4ZLOA 4OTIA 2UZDA 3BKBA 4IM0A 3MB6A 3RPYA 4ANSA 5FEEA 1CKIA 3DK3A 3LLTA 5FUTA 3EQRA 3D14A 4B8LA 5E9EA 5GZAA 2HW7A 4F9AA 5IEXA 4GG5A 3JY0A 2W9ZB 2DUVA 5F1ZA 3F3TA 3OBGA 2FVDA 2AUHA 4OTHA 2R3HA 4ZIMA 3CQWA 4I5MA 4P2KA 2CCHA 4M3QA 2PMOX 3DS6A 4IZ7A 2GNFA 3VBYA 2IZSA 3MESA 4YJOA 3PZEA 4RJ6A 3W0NA 4RC2A 2ETRA 2A27A 4R1YA 5AIRA 4F9BA 1GNGA 3EYGA 2O2UA 4YZ9A 4IFCA 2F9GA 2XZSA 3C1XA 3VS1A 3U55A 2VWBA 1OIYA 3T3UA 4U0IA 4PPBA 4D28A 5A4EA 4KBAA 3JYAA 4NZWB 2R3KA 4BCIA 4ZTRA 4HVSA 3PVUA 4OBPA 3E3BX 4XG4A 2YWPA 3PG3A 3F5GA 4DC2A