5LCJA

In-gel activity-based protein profiling of a clickable covalent erk 1/2 inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
347
structure length
345
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title In-gel activity-based protein profiling of a clickable covalent ERK1/2 inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 345
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lcjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lcjA01
2XEZA 5CSHA 3CBLA 5AIKA 4AZFA 3RAIA 4AA0A 1GIJA 4AFJA 3HRFA 3MB6A 3NW7A 2ZJWA 3F69A 3UO5A 3BCEA 4XG7A 4LM5A 5JT2A 3ULIA 4TWCA 5HOAA 4YZNA 3HDMA 3ZLWA 2YAKA 3R0TA 3RM7A 5BVFA 3TNQB 3I5NA 3Q60A 4UALA 5E92A 3RZBA 2PPQA 4BYJA 1W98A 3VBVA 3QQUA 4RIYB 3UNZA 4QYHA 3AT3A 3D7ZA 3VQHA 4XHKB 3VUIA 4O7VA 5E8WA 4IQ6A 5K3YA 2F49A 5CI7A 4B8MA 4LI5A 4BC6A 3UC3A 4E6CA 2R9SA 3LFAA 4AZSA 4FV2A 4OTFA 4C3FA 1UNLA 2WO6A 3EB0A 2JDTA 4AZWA 4HNFA 2UZBA 2DQ7X 1PY5A 4K11A 4ASEA 3R28A 2YHVA 3HMMA 2ETMA 5L8KA 4YJNA 3OXIA 2ZOQA 5CS6A 2AUHA 2X8EA 3NYXA 3OC1A 3U87A 3RPOA 2H8HA 1PKDA 4FL2A 4AN3A 5IF1A 1G3NA 1H28A 4AP7A 2GNFA 3LXKA 5HE2A 4KSPA 2YM8A 4X21A 4AN9A 2PVFA 3BLQA 2Y9QA 5DT4A 4HVIA 4FV8A 1YOLA 2YFXA 4QYFA 1QCFA 3K3IA 5AP3A 4U40A 1JSTA 2XKCA 3OXZA 4KB8A 2XA4A 3VW8A 4FVRA 3R8UA 3V5QA 5I4NA 5CSWA 5H9BA 3G9NA 4L52A 5AEPA 2JAVA 4BTKA 4C4GA 4WOVA 2UZEA 4FG7A 3BI6A 4MNEA 3AT4A 3CR0A 4AF3A 4F99A 2UZUE 3TACA 5E9EA 2WMUA 1XR1A 4HCVA 5LVOA 1DS5A 2BRMA 1NY3A 3DU8A 5FRIA 3E8DA 2CGXA 4OTHA 3MY5A 4ENXA 3SA0A 1Q5KA 4ONAA 5F20A 3KRLA 5EK7A 1P4OA 3FLZA 2H9VA 3ATTA 2HOGA 1NVRA 3NUNA 4KABA 4D0WA 1OIYA 3DJ6A 4O0UA 1GJOA 3SKCA 2IVUA 4I5PA 4DGMA 4EH7A 2W7XA 4I6FA 2HK5A 3C7QA 4BBEA 3JPVA 2G2HA 4FL3A 3WF5A 1OBDA 1YI4A 5F1ZA 1NXKA 1UU7A 4ZTQA 4TNBA 3K2LA 3NR9A 4JL9A 5C8NA 2JKOA 2XB7A 3LAUA 4OR5A 4JG8A 4E4MA 4YTFA 5LOHA 3O7LD 4APCA 2X39A 4AT5A 3TZ7A 4U7ZA 5BVEA 4ID7A 1YVJA 3FI2A 3AMAA 4I23A 4IWQA 1V0OA 1WBOA 4G2FA 1R78A 2WMTA 2UV2A 3G0FA 4YC8A 2X8DA 3PXQA 2F7ZE 4DCEA 4K33A 3DV3A 5C8KA 5FEEA 3TUBA 2C0OA 5HLPA 4FT0A 4CRSA 1S9JA 2F4JA 5M44A 1Y6BA 3I1AA 3Q6WA 3QQKA 4HYUA 5D10A 3FMDA 4PMSA 4NWMA 2Y7JA 1E1XA 3ORIA 4FYOA 2VNWA 4DG2E 2V0DA 4LUEA 3FLQA 4YGAA 3C9WA 5IQGA 1YOMA 2R2PA 4KIKB 2E9VA 3R9OA 3CIKA 2GNHA 4FL1A 4EYJA 1JNKA 3KQ7A 2C3LA 4UZHA 1OMWA 3U8WA 3VC4A 3ZDIA 3LE6A 4FI1A 4PL5A 4E1ZA 3PLSA 2X2MA 4YBKA 4JXFA 4UV0A 4ZJIA 1J1BA 3OT3A 1K9AA 2WOTA 2NO3A 3MPTA 4RWIA 3GU7A 3LCSA 5T6KA 4EOSA 2PMNX 5KHWA 2WMWA 4KIQA 5CNOA 4FT5A 3HDNA 3LW0A 5JMSA 3RTPA 3RJCA 2JKQA 3VUTA 3WE4A 4G6OA 5BYLA 5LXMA 1ZMWA 4UWBA 3ZRLA 4CZTA 4GEOA 4NK9A 2FSOX 1R0EA 2C5OA 3UG1A 4PMPA 5B2LA 2HY81 3PJ8A 4FV5A 4E4XA 4XLVA 4EH9A 5EQYA 1Z5MA 4HGTA 5AUVA 2XUUA 3JY0A 2QLUA 4KWPA 3VS5A 4A4OA 4IFGA 5L2WA 1DM2A 2FGIA 2WXVA 4N6YA 5CEQA 1LR4A 3VBXA 1H26A 1SNUA 2C6OA 4CYJA 3RAHA 5L8LA 4QMSA 3GP0A 1PRYA 4S31A 1Q41A 2C1AA 3A99A 4KS8A 5HBHA 5M51A 2JKKA 5IA0A 3BU6A 4HGLA 4F9WA 1KV2A 2ONLC 3NNWA 4RPVA 4WA9A 1Q62A 3THBA 4YJOA 3R04A 3MH2A 4TXCA 3ZUVA 4MVFA 1JWHA 3PLAE 2PE2A 4RX9A 3VS6A 3PRFA 2FH9A 5AUZA 2YIWA 2IPXA 3E87A 4XG3A 5IMEA 3UMXA 5A46A 4FTTA 5IEYA 1X8BA 4CXAA 2VTOA 4IX6A 1CSNA 3DKOA 3NYVA 4CLIA 3BPRA 1TVOA 4D0XA 3VUKA 3DOGA 3SHEA 4NW6A 2UW5A 4U97A 3NNXA 3IDPA 4QD6A 3JVRA 3T9IA 2BTSA 3QBNA 3WOWA 3FQSA 2XP2A 3TNWA 1PMNA 5CU4A 3I6UA 4KNBA 2C5YA 2PVMA 4R6VA 3RI1A 3HL7A 5C9CA 2R3HA 3W16A 3WF7A 3R1NA 4X6RA 4O86A 4NM3A 4YTCA 2ZM3A 2QKWB 4RIWA 4BZNA 3S1HA 4R5YA 4YP8A 3LFCA 2PVJA 4IZ5A 4O27B 2LGCA 4F6UA 1BMKA 4MAOA 2WFYA 4U41A 5M09A 1JLUE 2IN6A 2ZM4A 3BE2A 4RZWA 5DWRA 5EM5A 2QOFA 3FQEA 1YQJA 2B7AA 5DGZA 4YMJA 4QP2A 3OF0A 4IX4A 3GEQA 5F4NA 4BDFA 2WQMA 4J96A 5LVLA 3KN6A 4BTFA 4IWOA 5TF9A 3BKBA 3C4WA 3EZRA 3OG7A 4L44A 2R4BA 1A06A 4G6LA 4LRJA 1ERKA 3DFCB 4PUZA 1R39A 4S32A 2PUPA 3MFRA 2WQOA 1U4DA 2BVAA 4RGJA 3LKMA 4JNWA 2E9NA 3Q5IA 4FTAA 3CSVA 1RQQA 5IA1A 2V62A 1IEPA 4RZVA 2GNJA 3UQFA 2GS6A 3VQUA 4U3YA 4JX3A 3U9CA 4PL4A 4FK3A 4ANNA 3LM5A 3E3BX 4IE9A 4IVCA 3G15A 4DBXA 5DEYA 2FB8A 3MH3A 5IUIA 4P5QA 2LAVA 4IWDA 3ORNA 4C57A 2XM8A 3DKFA 3I60A 3QTXA 4DT8A 3AD4A 3CJFA 2CKPA 4IB5A 4WBBB 4NZWB 4BDCA 1V0PA 3SXFA 4D58A 5F9EA 3DXPA 3BX5A 3H30A 5AX9A 4ASXA 4B7TA 4BWKA 3PVUA 4OTWA 1FGKA 3FMEA 1XKKA 3PPKA 4IX3A 4MXCA 2BZKB 3ZH8A 3VS7A 4ANSA 4UBAA 4Y73A 4C35A 3ZOSA 3LHJA 4IAZA 4R7IA 3WYYA 4II5A 4G34A 2R3IA 5JZNA 3MWUA 4OAUC 3LFFA 4BDKA 5LMAA 4QTBA 5C4KA 3OT8A 4XYFA 3R7UA 5IA2A 4NL0A 2RSVA 2JFLA 2ONLA 3K5VA 5C01A 5I9VA 4G9RA 3U51A 4YTHA 3HAVA 4QMMA 3TV7A 4D1XA 1OL2A 4C4EA 4F7JA 4GK3A 1PHKA 3S3IA 3FMMA 3VN9A 1M7NA 1MRVA 2WD1A 2P2HA 2HAKA 2VTMA 4FZFB 1SVHA 2REIA 2HY0A 4PF4A 2RFDA 3AD5A 3PVBA 5E1SA 1YW2A 5AR2A 3QA0A 2X4ZA 4C58A 2QOKA 2WELA 1YHSA 5DE2A 1KOBA 4RFMA 5KMMA 3JUHA 3EQPA 5I9WA 4W9XA 2VTAA 2RG6A 3P78A 3MI9A 3F7WA 4IM2A 5CASA 4QNYA 4YHJA 1MUOA 2XNOA 4OTQA 5CAVA 2B9IA 4ZTRA 4C61A 3OD6X 3ULZA 4IW0A 2F9GA 3A8XA 3OCGA 4XRLA 5DEWA 3O7LB 4HVSA 3S00A 4LYNA 2ZDTA 4GRBA 3P7BA 2O8YA 3QGYA 3ZRKA 1QPJA 2AYPA 5K4JA 3NYOA 2VGPA 5I9XA 3GU5A 4EK5A 3FHRA 5M08A 1JKTA 4OTGA 3D83A 3SW4A 4YPSA 4QQJA 5JEBA 5D7VA 3TXOA 4YLLA 2YIRA 3DBCA 3I4BA 2CCIA 3NUSA 4U80A 2J0IA 3KVXA 1T46A 2W05A 4FKVA 4WKQA 2BIKB 3E5AA 4K18A 5CSXA 4GSBA 2UW8A 4U0IA 4Y5HA 4DTBA 2QOCA 4X3JA 3CD3A 3LFDA 4EJ7A 3BV3A 2UVYA 2QG7A 4I93A 5GJFA 2XRUA 1YXSA 3G6GA 2VX0A 3OXTA 3MGYA 4NCTC 4CT2A 2CLXA 4FGRA 4UN0C 4X2GA 5HQ0A 2X8IA 3F3TA 3IW8A 3O51A 3K3JA 3KXHA 3OZ6A 4FV0A 4JLCA 4MXXA 4RIXB 5G1XA 4F08A 3P23A 3VNTA 4YHFA 5HNBA 1NW1A 5ACBC 5IEXA 3MPAA 5AR4A 4GIIA 4YJPA 1OL7A 3I79A 3R63A 3RNYA 4Q9ZA 4M66A 4FIJA 5FTQA 2YZLA 3Q2MA 5E91A 4W8DA 4HGSA 2F57A 2NRUA 4O22A 4CFXA 5CT7A 1XH9A 2HXLA 3BYVA 3UYTA 5IH5A 2QKRA 4YZDA 2YM4A 3CPBA 4AGUA 4O82A 4JG7A 3AC4A 4GH2A 4W9WA 2QO2A 5BYYA 4ZMFA 4V04A 5BPYA 4BN1A 3U4UA 1AQ1A 3KULA 4ASDA 4C2WA 3LFBA 4M13A 4GT4A 2UZOA 5CEIA 5FXSA 2J2IB 3QZFA 4H36A 5IH6A 2GPHA 1A48A 1JSVA 4R5SA 2PK9A 4EEVA 4GYIA 1HCKA 3BYOA 5EM8A 2XIZA 2HENA 1M52A 3KL8A 4R77A 1SZMA 2UZLA 3MTFA 4CT1A 2BZHB 4EOJA 1GZKA 1MP8A 4EK8A 3LLAA 1KV1A 2NRYA 5GZ8A 4CEGA 1FQ1B 5GZAA 5AMNA 2OJ9A 3A4PA 4UEUA 4ZY5A 1BL6A 2J50A 3AG9A 5B0XA 5J9YA 4F9YA 3E7VA 3PJ2A 2CKEA 4TYHB 3TNHA 3TI1A 3V5WA 4FTQA 2XIRA 2Z8CA 5CXHA 4O1PA 3ENHA 2P33A 5BVWA 4N6ZA 5IQDA 1XBAA 5ANJA 4CVAA 1BYGA 2P4IA 2VWXA 5A54A 4CKIA 4IB1A 1CKIA 5H8BA 5AA8A 5KMKA 4QPMA 2X1NA 3VS4A 1YWVA 4JDJA 3MFSA 3NSZA 1LEWA 4A9TA 2ERZE 4F9CA 5GIOE 2XKEA 2WMRA 2JBPA 2RFNA 5IQEA 3T3UA 2YIYA 4YC6A 2JFMA 3SXSA 3IK3A 4J71A 3W10A 4Z55A 4O7TA 3BHTA 3DTCA 2GHGA 2JC6A 5ETIA 3REPA 5E8YA 4CFMA 3O96A 4RWLA 1F3MC 2PWLA 5HU9A 1URCA 4DH3A 5CAUA 5M4CA 3N4TA 5FG8A 4CV9A 4KBAA 4XG9A 3ERKA 3HV4A 5L6PA 3QHRA 1ZAOA 4XLIA 3HEGA 4MX9A 3DB6A 3KMMA 5I9UA 1PMEA 2YCSA 3EN4A 4FOCA 5DRDA 3N51A 4U9AA 4DCAA 4E5WA 2QOHA 5FXQA 4D1SA 2VWVA 4D9UA 1ZOHA 5E90A 3BGZA 3HP5A 1FOTA 4GU6A 5LARA 4NCTA 2Y6OA 2OWBA 3LFEA 3W8LA 2KULA 4BRXA 1U54A 5JZJA 3L8SA 2HCKA 3Q4UA 3O17A 4IXPA 1UVRA 3EL7A 4DGNA 4NYEA 1H4LA 2RKUA 3DQXA 2ITZA 4QMOA 3F3ZA 5J7BA 2BRBA 5AR3A 5AV0A 3LMIA 2PL0A 3F5GA 3QZHA 3WI6A 3DBQA 3PSDA 3ODYX 4XG2A 4ZS4A 4RWJA 4LRKA 4XOYA 2OF2A 4FKIA 4FG9A 3EHAA 2CSNA 2RFEA 4JVGA 4J98A 2R3KA 4O7YA 3VVHA 3AXWA 4F4PA 4USFA 2RFSA 3FMKA 5D1JA 5AP7A 3SOAA 1TKIA 2JD5A 2VWUA 4U42A 2BILB 1KE5A 3M2WA 5IQCA 4X3FB 5IUGA 5HCYA 3PP0A 3R1YA 4EH6A 3NDMA 4O7LA 1O6LA 1YHWA 4ACCA 4FT7A 1VJYA 3PA4A 5A4TA 4FEUA 3UNJA 3BGPA 3E8NA 4AOTA 3RHXA 5LMKC 3FMNA 3KK8A 3LCTA 3QTUA 2CNQA 2X7GA 4QMXA 4DH5A 2PVLA 4PDOA 3BU5A 3OCBA 4I4EA 3BBWA 3C4EA 4M15A 1PXMA 4ZSEA 3Q04A 5BVKA 5KBQA 3LQ5A 3LCKA 4EQCA 3PJ1A 2EUFB 4ANMA 2O5KA 2Z2WA 3GFEA 5HX6A 2XEYA 2V55A 3CE3A 3BYSA 4KINA 2XK3A 3PZEA 3PFQA 4WHZA 3SXRA 4XMOA 4RQVA 4FTOA 1OB3A 3COKA 4Q5HA 3D15A 1M17A 4ACHA 3AMYA 4MBJA 2BUJA 3R7VA 5HVYA 3Q96A 5C27A 4MCVA 4FVPA 1FPUA 3DBFA 2IZTA 4JOAA 4ZTMA 3COMA 4U6RA 4L7SA 2QURA 3EKNA 1JQHA 4UWYA 5HGIA 4BI1A 4E93A 4ZY4A 4GJ3A 4AW2A 3GXLA 4JBPA 4H3BA 4FT9A 4FEQA 4P7EA 5CF8A 2QODA 3RAWA 5HG8A 4JG6A 1ZYDA 3HLLA 5ANGA 3BHUA 2I0YA 3I0QA 3DAKA 3RPYA 4BDJA 3CQWA 5EQPA 2CMWA 2HXQA 1ATPE 4ZZNA 4XS2A 3DAJA 4QYYA 3EQCA 4AE6A 3L8PA 4WT6A 5IISA 1ZYCA 1OZ1A 3Q6UA 5A4QA 3VUMA 4PTEA 4F9BA 1G8AA 4BI2A 3HA8A 3BZ3A 2XNNA 4QPSA 1Y57A 4KS7A 4AX8A 4DFUA 2XIYA 5IEVA 1UU3A 3KRRA 3TCPA 5J9ZA 2A2AA 1OKVA 4BVUA 5CU3A 4A9RA 2G2FA 4Q2AA 4EWHA 1MRUA 3SG9A 2QOOA 2ZM1A 3FBVA 4WRSA 3ZO4A 2OSCA 5IDNA 3GU8A 4YNOA 3PE1A 4FGBA 4CFFA 4GW8A 3OCSA 2X9EA 3QD0A 4K2RA 4DEEA 3R9HA 5A4CA 5L3AA 2X9FA 4YR8A 2J6MA 3EYHA 1W84A 4TPTA 2I40A 3DB8A 5HG7A 4IWPA 1V0BA 4PPAA 5J79A 5J87A 3MDYA 3N9XA 1YXXA 2W9FB 2C3KA 3RHKA 3OEZA 2OICA 3A7IA 3BLRA 3OS3A 1FBNA 3QKKA 4FE2A 3KC3A 2CJMA 2WMAA 4CMTA 2W1ZA 3FXZA 5GJDA 3TKIA 4XV1A 2BALA 1J3HA 2ETRA 1S9IA 4FSZA 3IPHA 4EOOA 2YDJA 4M97A 4RRVA 4IVAA 4U44A 4AG8A 4AGDA 5C4LA 3D9VA 2XRWA 2I0VA 3MA3A 5ICPA 3TIZA 5AR5A 2G1TA 4Z3VA 2C5VA 3OOMA 4TY1A 3DDPA 4NW5A 5KZIA 3RMFA 4YU2A 4QQTA 1J1CA 4RA5A 5EW9A 2XNPA 4UWCA 5E1EA 4D2VA 3P79A 2ZMCA 2Y4PA 4L3LA 4OTPA 3WZEA 5LMKA 4OAVB 1Q8ZA 3SOCA 3CY2A 5J95A 3FXWA 5AX3A 3RPRA 2R3NA 1Y8GA 5CNNA 5JSMA 1YXTA 4RFZA 2BPMA 3VULA 2VWZA 4EK4A 4IMYA 4L68A 2PVKA 4RIYA 4IVDA 4YSJA 3QYZA 3ZCLA 3PWYA 4I1ZA 2WU6A 3QRTA 4JT3A 1FMOE 2I6LA 1JOWB 4E6DA 3CEKA 2E9OA 3UIBA 1HCLA 3L8XA 1PKGA 4FV1A 3QTIA 3KF7A 2VAGA 3UIXA 4FF8A 3ZM4A 2QI8A 2WTDA 1YXVA 3R8MA 2XYNA 3VJOA 2R3PA 3QD2B 2BHEA 2YAAA 1EH4A 3F82A 5D9HA 4ZTLA 3TL8A 3M1SA 4BCFA 1SYKA 3GENA 3HKOA 4L45A 4ZY6A 2PMLX 3UPZA 3RK5A 4DGGA 1Q24A 5DOSA 4LV8A 3Q4CA 4FMQA 2BAKA 4ZSLA 4FODA 5K5NA 4RMZA 1DAWA 4CNHA 1IAJA 2WHBA 4FIFA 4D4RA 2PZIA 2RGPA 3NWWA 4NM7A 3KMWA 4WO5A 4F70A 2YM7A 1ZZLA 5EYDA 5HD7A 4APPA 1ND4A 3C5UA 3EQFA 5FTGA 2QVSE 3ANRA 2CN8A 1H01A 4WNKA 2Z02A 5E8ZA 2OZOA 4BKZA 4O0XA 4IM3A 4MNFA 1PXIA 3V3VA 4UMRA 5A6NA 2R7BA 1OKYA 2F7EE 3FLYA 5HE1A 3HGKA 4YJVA 4ITJA 1A9UA 3Q52A 5EYKA 2X2KA 4NKAA 4I92A 4P4CA 5AV4A 2WTKB 5DA3A 3S0OA 4BDEA 1REJA 3NGAA 1IA9A 1W0XC 3HRCA 3NW6A 4L01A 4AE9A 4EYMA 1ZY4A 3EQIA 2ZVAA 3TT0A 1GIIA 3FZTA 4XP3A 1PYEA 4WD5A 4R3RA 2WMXA 5JGDA 3BWJA 4GK4A 2J4ZA 2X7OA 3FXXA 1MQBA 4EUUA 4O83A 4R78A 3ZBFA 5ANOA 3H9OA 4EOKA 3ZMMA 4PQNA 3PTGA 2FSTX 4S2ZA 1NVQA 4IEBA 4QQCA 4YJUA 4DTKA 5DIAA 4MBLA 2I1MA 2AC5A 4HZSA 2IW9A 3DLSA 1ZRZA 2YLFA 2VTSA 4YJQA 3EJ1A 2YACA 3TV4A 4C0TA 1GZOA 4RVMA 5I5ZA 1KSWA 2XIXA 2DUVA 4AOIA 4EOMA 2GS7A 4U81A 1Y6AA 4XG4A 5AP5A 5EI6A 3AC2A 3ET7A 3FE3A 3NRMA 3EN5A 3UOHA 5I9YA 3BYMA 1H1RA 4HZRA 2A27A 2YLEA 3E3PA 3G2FA 3Q9XA 4C34A 3TUDA 2XIKA 1GNGA 5AUXA 4DG0E 2QO9A 4CV8A 5L8JA 4D5HA 2DS1A 4ZLOA 4D9TA 4KIKA 3UOKA 1Y91A 4EH8A 3HUBA 4Y85A 3HP2A 3SLSA 1JKSA 4JJRA 5FXRA 3KF4A 4FKTA 4BY9E 2QR8A 2OZAB 3NIZA 1ZLTA 2VRXA 4X6QC 4AW5A 3CD8A 3NLBA 4EJNA 5CSPA 3SVVA 4L3JA 3MB7A 5JRSA 3FZOA 2OGVA 4BDBA 1XHAA 2I0EA 2J0KA 4TW9A 4Z7GA 3QKMA 4K8AA 4YJTA 4DTAA 1L8TA 2VTQA 4CCUA 4IZAA 4FBXA 4XV3A 3R7OA 2XKFA 3I6WA 4DYMA 4FTIA 3EKKA 1ZARA 3OP5A 4EOIA 4L42A 2GQGA 5L6OA 3IW7A 4C4JA 3F2AA 2JDRA 4ITHA 3B2WA 3F5UA 3F7ZA 3FC2A 4KKEA 2ITPA 1WVXA 4QP9A 5JFSA 3ORLA 4ALVA 4EONA 5BVOA 4H05A 2A0CX 4XNEA 3SAYA 3O71A 1WVWA 1YDTE 2OJJA 2R7IA 2XF0A 3QQGA 1U5QA 1V1KA 5TOZA 3OFMA 4PDPA 4BHZA 2QOBA 3FL4A 2C6MA 3PA3A 2GHLA 2WQNA 2G15A 5HCXA 5CU2A 5IPJA 5FLFA 4TNDA 5FP5A 2VTNA 4MK0A 4O84A 2Q0NA 2EXMA 3MY0A 3ZFYA 4D2RA 2WEIA 5KE0A 2XH5A 3PVWA 2UW6A 4KSQA 1KE6A 2XZSA 4CZUA 4E5AX 3SW7A 3SV0A 4HJOA 1OI9A 3S4QA 5CX9A 2J0JA 4MXYA 2XK8A 2XNMA 3TG1A 2IZRA 4EKKA 4RVTA 2VWBA 1PF8A 5HO6A 3T9TA 3G6HA 3COIA 4TWPA 5AM6A 2WMVA 3AQVA 4C38A 5LJJA 3UTOA 4CTCA 4PPBA 3RVGA 3ZEWA 3WE8A 5H3QA 3NNVA 2HZNA 3QHWA 2RG5A 2C30A 4G16A 2HELA 4YUQA 4FSMA 2JITA 4AS0A 3PIXA 5LVMA 4RVKA 2C1BA 3AC1A 3PVGA 3PDTA 4EZ5A 4AACA 2QLQA 3G51A 2WKMA 3DY7A 4NH1A 3NPCA 2R3MA 4ERWA 1W8CA 4IAIA 3DT1A 3A60A 5AR7A 2R0IA 4BF2A 3PY1A 3C0GA 3F3UA 4NIFB 2WEVA 5CEPA 5HI2A 1FMKA 5DR2A 4YZCA 4OW8A 3EFKA 4W4YA 4AZEA 3FI8A 5I3RA 5ANEA 3KY2A 4OBPA 2BRNA 2IG7A 4WNOA 4I6BA 3TZ9A 1CDKA 4ANLA 2YCRA 1U46A 1L3RE 4LV5A 5TO8A 4QTCA 3UIUA 5AADA 5EQEA 4LOPA 4B0GA 4BCIA 5HBJA 3TDWA 2XYUA 3EN6A 5CSVA 1PXLA 4R1VA 3GC9A 4X2FA 3Q53A 4NSTA 3KXGA 5AAEA 2PVYA 3C0HA 3MH0A 3WZDA 4WIHA 2PVRA 3G90X 3ROYA 5CAOA 2YABA 1VYWA 2GCDA 3WZJA 3UZRA 3GCSA 2B52A 3DS6A 3UDBA 3DK3A 1E1VA 5IKWA 3NZ0A 5CEMA 5L2QA 5IA4A 3FJQE 2YCQA 4U5JA 5D11A 5DHJA 3D94A 4BHNA 3H10A 3DJ5A 3Q3BA 2OIQA 2WZJA 4LOQA 3HMNA 4YLJA 3VIDA 1OL6A 4G9CA 4UMUA 5A14A 4EC9A 3V8TA 4O1OA 3A2CA 3D14A 4PDYA 3GU4A 4H3QA 3R8VA 3C1XA 3PUPA 1RE8A 3FLNC 3W1FA 2GQRA 4FKSA 3UODA 4BGHA 2BRGA 4BWXA 5CENA 5ETAA 2GQSA 2OIBA 4ZSGA 1XH4A 2J7TA 5CLPA 4EHEA 3PIZA 3SD0A 3ETAA 5A6OA 2WTVA 4O81A 4EKLA 5DT3A 5L2SA 1IG1A 3GQLA 4H39A 1ZMVA 4J52A 3ALOA 4TYJA 3P0MA 2XVDA 3IOKA 4P2KA 4HNIA 5IZFA 2C0IA 4WG4A 3G0EA 1UV5A 4JBVA 4V01A 4DFBA 5FGKA 3F5XA 3MIAA 3PJCA 4M7IA 2R3RA 2CDZA 1ZYLA 4AT4A 4GCJA 4AOJA 4XP0A 3PE2A 2R3JA 4OT6A 3AGLA 3VS3A 5C8MA 4BKYA 2WU7A 3DGKA 4U79A 3CY3A 4C3RA 4D2TA 2ZDUA 4BI0A 5KMIA 4JQEA 2OXDA 1R3CA 3QC9A 4FSQA 5IQHA 1KWPA 2W1DA 4MD7E 3CTHA 2V5QA 3CS9A 4LGDA 1WZYA 2VX3A 4AA5A 5IA3A 4CSVA 2VN9A 2OO8X 2W06A 3FDNA 1H8FA 5A9UA 3WARA 3NVMB 4N4SA 3SRVB 3WF9A 2H6DA 2YWPA 2GFSA 3Q32A 4QP4A 5DR9A 4CMOA 4DH8A 2VTTA 5HKMA 4EZ7A 2QOQA 5KKRB 3FAAA 2ZMDA 4XBRA 1W82A 4G3GA 3GI3A 4ZEGA 5M06A 3LJ0A 4DA5A 3ZUUA 4F0IA 3ZFXA 4E4NA 4C2VA 4L6QA 3O23A 4HCUA 2ZV2A 3VUHA 4LMNA 3ZZEA 4DBNA 2OJFE 5HG5A 4TWOA 1CKPA 2IWIA 2VWIA 5K4IA 1J7UA 4TL0A 5JKGA 2IW8A 3NMUF 3E8EA 3PXZA 3Q9YA 4W8EA 5E8UA 2XNGA 2JLDA 3EQDA 3R9NA 3BELA 1Q99A 4MF1A 4ZSAA 1J91A 4CFWA 1OIUA 3C5IA 1LPUA 1B38A 3A7GA 5EI2A 4JS8A 2EXEA 4D2PA 4FYNA 3TN8A 1B6CB 3ZO3A 4GFGA 4RIXA 4AXAA 4GYGA 2PE0A 3I5ZA 4AZTA 5BQ0A 3O0GA 4IH8A 4QMUA 3D4QA 5AM7A 4B8LA 5L2IA 4I94A 2W1IA 5JGAA 1GAGA 4MQ2A 3SDJA 3FC1X 4FNYA 4DT9A 4DE4A 3T8OA 3P7CA 4G6NA 2YITA 2F7XE 1BLXA 4J8NA 4CFVA 2EVAA 5ACKA 1H1WA 3BE9A 3G9LX 2XCHA 4B9DA 3HAMA 4G3FA 4CYIA 4F9AA 2VTJA 3QRJA 4LGGA 4RJ7A 4D2SA 4EQMA 3DDQA 4Y5QA 1PJKA 4X3FC 1UNHA 4FKWA 3ZFMA 3TDVA 4JDKA 3VS2A 3WILA 3E92A 2F2CB 4FKOA 2J5EA 4U43A 2BRHA 4KKGA 2VO3A 5HCZA 4C4IA 1Z57A 3RCJA 3FWQA 4R1YA 3Q4TA 2CPKE 5K0XA 5HO8A 5KX8A 3UP7A 2CCHA 2JAMA 4RQKA 4B4LA 1MQ4A 4OBQA 2B54A 2VTRA 3T3VA 3UJGA 2W4KA 1OPJA 4C33A 5FDPA 2XKDA 2CNVA 3QALE 3VS0A 3D7TB 4I0RA 3LQ3A 3S95A 4BCGA 3BYUA 4V0GB 4PMTA 3OOGA 2BKZA 2VNYA 4V05A 4X2JA 4BDGA 4NM5A 3SQQA 4EQUA 3FQHA 4IAKA 2YM3A 2W9ZB 3BLHA 3F88A 2BZIB 1OIQA 5CF4A 4PV0A 3ZEPA 2XBAA 3DAEA 4IAAA 3CKXA 4Q5EA 3IW4A 4AUAA 3POOA 1JKKA 3R02A 4BCOA 3GCUA 1XQZA 4TYHA 2O63A 3QX4A 4P5ZA 2X4FA 1Z9XA 4XG6A 2JEDA 3IDBA 5HORA 5J5TA 4NM0A 4K77A 5B7VA 2C6IA 3UC4A 2IZSA 4KKHA 4LFIA 5K9IA 2JDOA 3MSSA 4W4XA 3WIKA 3Q9ZA 3LCDA 3CJGA 3O50A 1LP4A 1W7HA 4M3QA 4E4LA 3CQUA 4CFUA 3VW6A 1QPEA 3TIYA 3AD6A 3GC0A 5J8IA 5DH3A 4FKQA 3IOPA 3JS2A 5EHOA 3HMIA 4ALUA 2E2BA 2UVXA 3FSKA 4EBWA 3U54A 3NCGA 4FKGA 4C36A 3F9NA 1ZXEA 2VU3A 2VX1A 2Y0AA 3C4ZA 3M42A 4M12A 4D1ZA 4R8QA 4H1MA 2UZTA 5CY3A 4QMNA 4F65A 4ITIA 5CVGA 1RJBA 2OK1A 4JIAA 5FEQA 1CTPE 4JQ7A 4Z9LA 2W1HA 3L9LA 4L00A 3UGCA 3R7GA 3KULB 4D4VA 2Q83A 4F7SA 1GIHA 3LLTA 5EHLA 5KZ0A 3W2CA 2OJGA 3TNIA 3O8TA 4O7ZA 3QC4A 5M53A 4BCJA 3ZLSA 4DGLC 4ZTNA 3QCYA 3P86A 4MWHA 5IU2A 2CN5A 2JIUA 4ZJJA 3GC8A 4E6AA 4TYIA 4JAIA 5AAGA 3DBEA 3HNGA 4H58A 2JKMA 1ZOEA 2HIWA 4O0TA 4TT7A 1CMKE 3PIYA 4AFEA 4DH1A 4YZMA 4K9YA 3FMLA 4PP9A 1Y8YA 2YIXA 4IDTA 4F0GA 4E73A 1ZWSA 2ZB0A 2H34A 4RJ5A 4O91A 2ITOA 4KIOA 3OHTA 4L3PA 1H27A 2UZWE 5ETCA 4ZSJA 4A4LA 4XCUA 4F09A 4RA4A 4DEHA 1UU9A 3ZS5A 4F6WA 2VTIA 3LJ2A 4X3FA 4YNEA 2WTJA 3R71A 4OT5A 3D2KA 4ZZOA 4IANA 2A19B 2R5TA 4FSNA 3ZO2A 4B6LA 4GJ2A 2C4GA 4RC3A 3SGCA 4MHAA 4FK6A 1WBPA 4FIHA 3VS1A 3WF6A 4IZYA 4EC8A 5LWMA 3EL8A 3DNEA 3W32A 3R8PA 3EH9A 3NUUA 4FSUA 3VBYA 5GIPE 4PP7A 4NTSA 3RCDA 4IM0A 3CPCA 5IDPA 5AIRA 4PPCA 4GL9A 4DLIA 3LM0A 5CQUA 2VGOA 4FUYA 1OGUA 3WZUA 4M0ZA 2ITTA 3HUCA 2YDKA 3VBWA 3UQGA 5KUPA 3WF8A 4FNZA 3ZO1A 3KRXA 4CMUA 4C37A 3KA0A 3IGOA 5KMOA 3EQBA 3QZGA 4USDA 1UWJA 1VZOA 3P9JA 4NEUA 1U5RA 2Y4IB 3HMPA 4WNPA 5AV2A 4UMTA 4QMQA 2IVVA 3U9NA 4UX9A 1YRPA 3RPSA 3TZ8A 2WMBA 3BHHA 4BDIA 2QU6A 1U54B 3P08A 3PRIA 2EWAA 2UW9A 3O2MA 2UUEA 4PNIA 5HE3A 3VUGA 3DFAA 5JFVA 2PYWA 2FUMA 1SMHA 1PW2A 1GZNA 5HNGA 3FY0A 3LFNA 4MXOA 3ZLYA 5I3OA 3UVRA 4FEVA 5GINE 1Q97A 2PZYA 1TQIA 2WQEA 4Y46A 5CZHA 3A62A 3CGFA 3KXZA 3GGFA 3ENMA 3BQCA 3DZQA 3LOKA 4CKRA 1KE9A 3O8PA 4QT1A 3MJ1A 5B2KA 2RF9A 3E93A 4E7WA 3ALNA 3Q9WA 2E9UA 4EH4A 3OW3A 2OI4X 3DXNA 2YA9A 5HHWA 3QUPA 1OPKA 1E9HA 4FNXA 2YM5A 1MRYA 4O7SA 4IC7A 2YJRA 2JDSA 4G5PA 5HVJA 3RKBA 3IQ7A 2W1GA 1O6YA 4TZRA 4I5CA 2R64A 3A7HA 5CT0A 3V6SA 2XNBA 3P1AA 3PSCA 4QO9A 4GMYA 4ZXTA 2WTKC 4BCQA 2YIQA 1Q8WA 4FICA 4L9IA 5K0KA 2CKOA 4ZK5A 5LWNA 5EM7A 2ZB1A 2QO7A 4IVBA 3WIGA 1OM1A 3OCTA 4ACDA 5KMNA 2HZ4A 4M69B 4EZ3A 2PHKA 3FY2A 4PRJA 4FC0A 1F0QA 3PP1A 4DG3E 3LXLA 3MY1A 2V7AA 4HGEA 1M7QA 3MV5A 3W2RA 3PWDA 2OG8A 4DH7A 3N4UA 3DXQA 2W1CA 3H9RA 3PY0A 2P3GX 4IX5A 3GNIB 4F7LA 3EFWA 2ITYA 4FIGA 3LFSA 5J5SA 4XP2A 3RPVA 3TJDA 4AT3A 3HRBA 2BCJA 5FQDC 4O0RA 3KB7A 4EK3A 3FHIA 3H4JA 4W4WA 3LZBA 2HW6A 4BL1A 4LOOA 3UZTA 3ORZA 3CQEA 4CRLA 4Q9SA 2BTRA 5D7AA 5JK3A 1Q4LA 1WBSA 1NVSA 2UVZA 4WBOA 5EDPA 4RC2A 4WUNA 1GY3A 2RIOA 4J7BA 3MVLA 5J1VA 2BDFA 1KUTA 2W17A 3NCZA 4YTIA 3VRZA 5CU6A 1XBCA 4BZOA 4KBKA 4CLJA 3LXPA 3VO3A 3GU6A 4MXZA 4C4FA 2ITXA 4JR7A 2AC3A 4CFNA 4U8ZA 1XH7A 5EFQA 3OBJA 3ZDUA 3KN5A 3FKLA 5CALA 4O0WA 3II5A 4USEA 1P2AA 2OU7A 4O21A 3RALA 4JQ8A 3OBGA 3UOLA 4QOXA 2EB2A 1NA7A 1OKZA 5KBRA 4HOKA 1J7LA 3R8ZA 3A7JA 5E8SA 2W99B 2VWWA 2V22A 1XH5A 3I7BA 4XUFA 2JBOA 5EDRA 3UYSA 4N57A 1H24A 3BEAA 1H00A 3KRWA 4HVDA 2VO7A 5TE0A 4RLLA 2PZPA 4QPAA 2UZVA 3TEIA 4RC4A 5ANDA 4HVGA 2QOIA 4QMLA 4C62A 1YDRE 1QMZA 3QTRA 4AWIA 3MESA 4OUCA 4RIOA 3OWPA 3GT8A 3OUKA 2GTNA 4K6ZA 1H0VA 1XO2B 3TNPC 2HYYA 3NUXA 4PDSA 4S33A 1JAMA 4O0YA 5AUWA 4AGWA 5HTCA 1M2QA 4ZZMA 3RK7A 3HMOA 2C6EA 2HZ0A 1YHVA 3NEWA 4FZ6A 4FG8A 1CM8A 3MVJA 5BUIA 3PXKA 2A4LA 2ACXA 4J95A 3F3VA 4WSQA 3OVVA 2UZNA 1IRKA 5FDXA 5G6VA 4A9SA 3KMUA 1PYXA 4QNAA 5FWKK 2XNEA 4NJ3A 2QHMA 1OECA 4A4XA 5CQWA 5DPVA 4CG8A 3ORKA 4NJDA 4AN2A 4OTRA 4R3CA 3FPMA 3QWKA 5JFWA 3L9NA 2HWPA 3QD4A 4LL0A 3TUCA 2G01A 2B53A 4UXLA 2WB8A 3G5DA 5AUYA 4IC8A 3O8UA 4ZAUA 5HLWA 3FUPA 5BUJA 4CG9A 4FKRA 2XCKA 3QF9A 5C1QB 4KIPA 3TZMA 3NIEA 1TQPA 3DA6A 3UMWA 5IA5A 4R3PA 5A4LA 3L1SA 5E8VA 1WMKA 4O38A 2W5BA 3C13A 3GCPA 4FTKA 4FT3A 4KD1A 4O2PA 1FVVA 3ANQA 4ERKA 4EUTA 3HV6A 3QLGA 4DN5A 2PULA 4O7RA 5EH0A 3ZLXA 3KKVA 3KU2A 2GTMA 1URWA 2UW3A 2OLCA 3MBLA 2ITVA 2J51A 5CI6A 3BHVA 3AOXA 3QU0A 4TRLA 5CZIA 3RWQA 3QCSA 4C59A 3W18A 2UW0A 2X6EA 3E8CA 4QMZA 4RT7A 4RWKA 5AA9A 5AV1A 5LVPA 4FEWA 4LL5A 3L9PA 4PNKA 3KXMA 4UMQA 5HICA 3QUEA 3DJ7A 3ZSHA 1UU8A 3U6JA 3SC1A 4J8MA 4BDAA 4CKJA 3DLZA 4GFMA 4L53A 4MXAA 4QP3A 2W4JA 4OTDA 1CKJA 3QQFA 4KUJA 4OGRA 4XJ0A 4AW1A 4M8TA 3R7YA 2EU9A 5IQAA 5ETFA 3KFAA 5LMBA 3QXPA 4WG3A 3UPXA 5IH4A 2ZYBA 3UQCA 4YJSA 1BUHA 3PXYA 4X2NA 3SX9A 4ZLZA 1OBGA 2VV9A 4NFNA 3C4CA 2ITWA 4O6LA 5K5XA 2WIPA 4QTAA 3F2NA 4IBMA 5HO7A 3SG8A 2OZAA 3FYJX 4MWIA 2ZV9A 1M2RA 3L8VA 4FSRA 3FZ1A 5JGBA 3D5VA 2OKRA 4LMUA 5H8EA 4K1BA 1ZOGA 2C68A 1UA2A 4HCTA 4F6SA 4UMPA 5J7HA 2HW7A 2GNIA 3HECA 3LMHA 3VHEA 3W33A 5DR6A 3FLSA 4MNEB 4I0TA 4XEYA 1OUYA 3FZRA 3DQWA 5HLNA 3KREA 3R7IA 4QP1A 3HYHA 1SVGA 2QC6A 5EYCA 1OUKA 3GCVA 3HZTA 2R3LA 2ZAZA 4NU1A 5AAFA 4GKIA 2BFYA 4L7FA 3IKAA 1SVEA 4FSWA 5AP4A 4FZ7A 5HBEA 4FSTA 4PTCA 3U6HA 4YHTA 4RSSA 5FM2A 3ORXA 5HD4A 2VTHA 4GVJA 3QWJA 3PXFA 3FSFA 3UO6A 4F7NA 2OF4A 4FKPA 1M2PA 1ZMUA 3CXWA 3R1SA 3RWPA 3ACKA 5T3QA 3ZONA 4BIEA 4BCPA 4O7NA 2J5FA 3ZM9A 2YWVA 3IDCA 5EHYA 4L43A 5ANIA 4G31A 3ZSIA 4QMVA 5ANKA 5DLSA 4I22A 4TKSA 5EG3A 1YI3A 3KK9A 3V8SA 2WPAA 1VR2A 2QNJA 4Z7HA 3P4KA 3U4WA 3VF8A 5CTPA 3ZU7A 5GNKA 1WFCA 4IB3A 4KA3A 4IAYA 4MD9E 4MF0A 4XV2A 4ZJVA 2PU8A 3D5WA 3GFWA 3F66A 4JDHA 2O64A 3OMVA 4YO4A 3LMGA 5DBXA 4A7CA 2C6TA 4IHPA 4GT5A 4TYGA 1IASA 3EZVA 4G3DA 2WNTA 4F1MA 5IG1A 4G3EA 4ORKA 3QKLA 3QRIA 4IIRA 5DN3A 2IVSA 4ZIMA 3PA5A 3G33A 4L46A 5EDQA 5KKRC 2PUNA 5CAQA 3OUNB 2C3JA 3H9FA 4UZDA 5IMXA 1Q61A 4J53A 3AMBA 2R3QA 3GB2A 3KRJA 3V01A 4C02A 3QRUA 2CKQA 4I0SA 4JBQA 5CEKA 3IS5A 4EHZA 5BVDA 4NUSA 3FLWA 3QLFA 4HYSA 4NIFA 3QTWA 2O3PA 2NPQA 4FOBA 3KCKA 4XRJA 3WZKA 4ALWA 2OJIA 4NT4A 4P90A 5CYIA 2QG5A 4TN6A 3V6RA 2WAJA 3VWAA 3C0IA 4ZMEA 4DF3A 4S30A 3ZC6A 4E8AA 2R3OA 2Z7RA 4WG5A 2QD9A 3UVQA 4QTDA 1JVPP 3I0OA 2FYSA 4EWQA 3QQHA 3NVKI 3FPQA 4F0FA 3ID6C 4IFCA 3AGMA 4O7WA 3PXRA 2P2IA 3H0ZA 3QFVA 4O96A 3V5JA 4AA4A 2PMIA 4FVQA 2GNGA 4LQMA 5AP0A 4CZYB 5GHVA 2VTPA 3EN9A 2BR1A 2A1AB 3OY1A 3A61A 3LPBA 1PMVA 1Q3WA 4I41A 4RX5A 3ORPA 4YSMA 1I44A 3ZTXA 5HESA 5J9LA 2BFXA 4MKCA 4OLIA 1DAYA 3MFTA 3K5UA 3Q5ZA 4D28A 3OEFX 2PZ5A 2C6LA 2C6KA 3IG7A 5EW3A 5FTOA 4BDDA 4G17A 5BMMA 2H96A 4BZDA 2BKKA 2XJ2A 4RX7A 5E7RA 5CVFA 4MQ1A 3LCOA 1PXJA 5AJQA 4NFMA 3V04A 4BTMA 3JXWA 3A4OX 3QL8A 4YC3A 4BWPA 3I81A 3CLYA 4JR3A 5HE0A 3OWJA 3ZYAA 3DCVA 4F64A 1M14A 2OFVA 2X2LA 3TV6A 5CAPA 4BBFA 2DWBA 1J7IA 4FTNA 5DI1A 4O0VA 3RGFA 1PXOA 3LJ1A 5HX8A 4EH2A 3VAPA 4S34A 2OFUA 2XK7A 2FSMX 3DKCA 5DRBA 3C4XA 4PX6A 1QL6A 3P7AA 4OBOA 5CXZA 5JRQA 2JIIA 3CTJA 3S2PA 1WVYA 4D55A 4GFOA 1NT2A 2JIVA 4I3ZA 2BMCA 3W2SA 1BKXA 3FI4A 4MD8E 3PSBA 3DBDA 3EWHA 4WUAA 4QYEA 2I0HA 4F1OA 3HVCA 4NKSA 1OIRA 4RBLA 3DK6A 1SNXA 4A9UA 3MJ2A 5HTIA 4CGAA 3D0EA 3RK9A 3M11A 5TR6A 3RZFA 5KMJA 4G1WA 4IADA 2R3FA 2V7OA 3LQ8A 3VBTA 5EW8A 3F6XA 3KXNA 4ASZA 4BKJA 5IQIA 2IZUA 4ACGA 4RIWB 4JRNA 3R7EA 4DGOA 2ZV8A 4BCNA 3IECA 3VF9A 2R3GA 5CF6A 3W8QA 3V5TA 5C03A 3SRVA 2YM6A 2KTYA 4XV9A 2Z7QA 4FX3A 4RJ3A 5AP2A 1K3AA 4WSYA 1G8SA 1ZZ2A 3BRBA 3CKWA 3MFUA 4X0MA 4PMMA 3MPMA 2OBJA 4N0SA 5D41A 3D2IA 3GCQA 4QP6A 4CQGA 1XBBA 1H1QA 4YO6A 4BCMA 3PG1A 5C26A 2PVHA 3ACJA 4C3PA 5FBNC 4ZTHA 4EH3A 3R83A 3MVHA 5E8TA 4KAOA 5B2MA 3BQRA 4MH7A 2PY3A 4IB0A 3HV7A 4FZDB 4UYAA 2VUWA 5HVKA 4AZVA 1WBWA 3FKNA 2OXXA 3WYXA 2J90A 3ZRMA 3QZIA 2C5XA 2B4SB 3K54A 1XJDA 4JI9A 1IAHA 4JBOA 2PUUA 1LEZA 2B9FA 4QMWA 4BCKA 5KHXA 3R9RA 3LXNA 4E3CA 4C7TA 4AGCA 4GIHA 3MIYA 4GUBA 5TT7A 4EL9A 3QRKA 3MW1A 4EHVA 1Q8TA 1RW8A 3CTQA 3GQIA 5CF5A 4RFYA 2GSFA 3EFJA 4YBJA 4A07A 4I6QA 4E5BA 4QP7A 4XX9A 2B9JA 3R1QA 2J0LA 3ZSGA 1H08A 3C50A 3C4FA 4YLKA 5TKDA 4BB4A 4YURA 1OITA 4F63A 1FINA 2C5NA 2F2UA 3RM6A 1KE8A 1UKIA 1WBTA 4FTMA 3ZBXA 2XBJA 1K2PA 2CGWA 2XS0A 4X7QA 4XH6A 4C4HA 4DFLA 3F3WA 3QCQA 4FKJA 3NW5A 4UY9A 2BROA 2J0MB 2WTWA 2C0TA 4QMPA 3R21A 5EKOA 4DLJA 4XG8A 3UOJA 3ZXZA 1JKLA 4AQCA 2PUIA 4ZOGA 2UZDA 3PY3A 3VBQA 3V5PA 5M57A 4FEXA 5HIBA 3IW6A 2Z7SA 2QU5A 4FTLA 4HPTE 2HZIA 4EBVA 3C51A 3D7TA 4FV7A 3UO4A 4E6QA 4V0GA 5CANA 3R2BA 2O65A 3FI3A 3LFQA 3VJNA 5EOLA 1I09A 2G9XA 4AU8A 1WCCA 3F2RA 3LIJA 4MBIA 5E4HA 3TJCA 4FV4A 5E8XA 4MTAA 1AD5A 1YXUA 4UXQA 2QONA 4GS6A 2Y4IC 5DNRA 3QTZA 4M67A 4QYGA 4BIDA 3PJ3A 1OVEA 2GFCA 2ZV7A 3HV5A 5HZNA 5DYJA 3IW5A 3GUBA 2O0UA 2IW6A 3BBTB 2G2IA 3KVWA 4I4FA 3FZSA 3EN7A 5AP1A 4ARKA 4EOPA 3ZC5A 1H1SA 4UYNA 2C6DA 3MA6A 2ITNA 3AC3A 3FMHA 3QQLA 3OWLA 3DKGA 4DEIA 3GBZA 4FTJA 3BEGA 2PSQA 2R0UA 3E88A 2FA2A 4E26A 3FV8A 4EHGA 2C3IB 4CCBA 4EK6A 2PMOX 5KNJA 1APME 3AC5A 2OXYA 3QD3A 3P5KA 4HYIA 4D5KA 3UBDA 1BI7A 4DEBA 3MH1A 4ZS0A 3R00A 4HYHA 3GVUA 3WBLA 2ITQA 4LUDA 4GKHA 2QHNA 3CP9A 3PYYA 3QX2A 5F95A 4EH5A 4JRVA 3NS9A 4EI4A 3FKOA 3A7FA 5A3XA 2FSLX 3MTLA 4YJRA 2UW4A 1UKHA 2B9HA 3ZHPC 4DHFA 3DTWA 5BNJA 1YWNA 3TWJA 5IQFA 3ODZX 5EKNA 2B0QA 4J1RA 5ITAA 4Y95A 4OTIA 5JFXA 4JIKA 5JN2A 5KMLA 4QRCA 2FO0A 3R30A 3FMJA 2YERA 2CLQA 5BX0A 3QQJA 4BGQA 2BAQA 4L8MA 3MN3A 3NX8A 4JX7A 3Q4ZA 1FVTA 5M4UA 1WBVA 4ANQA 3PPJA 1G5SA 5HEZA 2QR7A 3H3CA 5CVHA 1OL5A 2YEXA 1P5EA 4BFMA 4BICA 2P55A 2C69A 3F61A 4I21A 2VTLA 3POZA 1FGIA 4A9YA 1PXPA 4EOLA 2PTKA 3ATSA 2SRCA 3D5XA 4XOZA 3VUDA 4FKUA 3B8RA 5J1WA 2BDWA 4B99A 4CTBA 3N4VA 3NNUA 4GUEA 3DK7A 3BHYA 2XMYA 4PWNA 5H2UA 4EORA 3DPKA 3CC6A 4IJ9A 5FM3A 4Z16A 2Y6MA 4I20A 1GOLA 4GT3A 4I5MA 1Q8UA 1VEBA 2NNWB 2WGJA 3E64A 3F5PA 4D4SA 1PMUA 1YWRA 3CGOA 5H8GA 4Y8DA 4GG7A 3ZZWA 2ETKA 2GU8A 3NAYA 4ANOA 3BWFA 3GOPA 5DT0A 1OKWA 3B2TA 1YOJA 2QQ7A 3EQRA 3EQHA 3H0YA 4KRCA 5LQFA 5LCJA 4G5JA 5HIDA 5T68A 1TQMA 3OROA 4BCHA 4RJ8A 3PZHA 5DG5A 3BU3A 3VRYA 5GZ9A 5HG9A 2XJ1A 3R01A 1UWHA 3QXOA 3TTJA 2XK9A 4F1TA 3B8QA 5AR8A 2W1EA 4E20A 3R73A 2GMXA 5M4IA 4FTRA 5GJGA 2GHMA 2Z60A 2IO6A 5AWMA 4GVAA 3E62A 1XH8A 3TM0A 2CGVA 4GG5A 4N70A 1DI8A 2FVDA 2UW7A 3E63A 3NUYA 3UNKA 2O2UA 2X7FA 3EOCA 3CCNA 2NP8A 3UE4A 3W2QA 2Z7LA 1O9UA 5D12A 4FIIA 5L2TA 2Q0BA 3FZPA 4FKLA 1T45A 4J97A 4MEDA 5LCKA 4BGGA 2YCFA 4FUXA 3Q2JA 2X6DA 3QA8A 4I24A 3BV2A 3RNIA 2C47A 3IGGA 2B1PA 4FV3A 3NYNA 4FZAB 4QQ5A 5IQBA 4YZBA 4BYIA 3UP2A 5IUHA 4CD0A 2CGUA 3V8WA 2P0CA 4FA2A 1H0WA 5L6WL 3QCXA 3UIMA 1H25A 3VHKA 1R0PA 4U3ZA 5EOBA 3R9DA 4IAFA 1QPCA 1UNGA 3ZUTA 4PL3A 3QTQA 3UG2A 2WQBA 2YZAA 3BGQA 3RAKA 2IJMA 3ROCA 3R2YA 4IJPA 4RJ6A 4QP8A 4XBUA 3V51A 4FTUA 2YDIA 4HVHA 2OIDA 4G3CA 2X0GA 1BI8A 3ITZA 4R7HA 4U45A 2BIYA 2WMSA 3HA6A 2OH4A 5AFVA 4H3PA 3DNDA 2VZ6A 2BZJA 4X2KA 3JR1A 4PY1A 2RL5A 4FV9A 3EIDA 5M55A 4CQEA 4FR4A 1SM2A 3QYWA 2JGZA 2ITUA 5AV3A 4C8BA 4FIEA 2OH0E 4I5HA 1JPAA 3W55A 5LVNA 3FEGA 1H1PA 3UVPA 1KOAA 4Y72A 3ELJA 2I7QA 4KRDA 4IZ7A 3EQGA 3RP9A 2VWYA 1Q8YA 2PVNA 5L4QA 4ENYA 4K0YA 2XK4A 4RLKA 3AC8A 3R8LA 4M69A 5I9ZA 3JVSA 3R22A 3KXXA 1REKA 3FYKX 4GV1A 1YKRA 3QGWA 4TWNA 3FL5A 2OW3A 2EB3A 2W5AA 1DI9A 1H07A 1JSUA 4YZ9A 3MS9A 2W4OA 2YN8A 3QTSA 1PXNA 3HV3A 3NUPA 5AUUA 3ORMA 3A8WA 4HPUE 4M0YA 3NAXA 3V5LA 4I6HA 5FUTA 5FP6A 1Q3DA 2HWOA 3MVMA 4DC2A 3TKUA 2WOUA 3OY3A 5CWZA 4J99A 4ZTSA 2W5HA 2GNLA 3RINA 4BR3A 4JAJA 3KGAA 2J9MA 5EI8A 4O6EA 2JDVA 3NUAA 2BHHA 4IACA 5FD2A 5M07A 3MYGA 1OL1A 1XH6A 4TYEA 3W2OA 4ACMA 4DFNA 4BBMA 4BTJA 3KEXA 3W2PA 4DEAA 4D4YA 4DFZE 5HU3A 4PTGA 4WNMA 5DMZA 5JQ5A 3OW4A 1O6KA 4DAWA 4M68A 4BIBA 4ZP5A 4DEGA 4LGHA 3GC7A 4L67A 4H1JA 1ZYSA 2CHLA 4LG4A 2YISA 2YJSA 5FEDA 4DFYA 3AT2A 3PG3A 3U6IA 2GS2A 3OTUA 5M56A 1HOWA 1U59A 4DITA 4O0SA 3EMGA 1STCE 1KE7A 4FSYA 3U55A 2E9PA 1BL7A 1FVRA 1PXKA 5EM6A 4QTEA 1GZ8A 4D2WA 3I7CA 5JH6A 5CEOA 5F94A 5BVNA 2VO6A 4JDIA 3ZXTA 1VYZA 2PZRA 2WTCA 4BDHA 3DZOA 3TKHA 3D5UA 1AGWA 3R6XA 5HNIX 1XWSA 3HX4A 5DVRA 2VO0A 1P14A 1JBPE 3EFLA 4DINA 4YPDA 2CNUA 2DYLA 3JY9A 3KCFA 2PE1A 2WIHA 2IVTA 2XJ0A 3OWKA 2BDJA 5DFPA 5KCVA 2QCSA 1RDQE 4W4VA 4DEDA 3PPZA 2EXCX 5BUEA 5BMSA 4RX8A 3EYGA 4M84A 4QMTA 3LVPA 4NTTA 3COHA 4KBCA 5FBOA 4ANBA 4WRGA 3UZPA 3BIZA 4RJ4A 5EYMA 2XK6A 3E7OA 1OPLA 2Y8OA 3GOKA 4GK2A 1IA8A 5AP6A 4RG0A 1WBNA 1ZY5A 1IR3A 3JYAA 4QMYA 1LUFA 5KO1A 5I0BA 3RBWA 5AUTA 4Y83A 1B39A 2W0JA 4DFXE 4A06A 4HW7A 5BYZA 2ESMA 1BX6A 2X81A 4TTHB 4M14A 5M4FA 4FNWA 1ZYJA 4FTCA 2XM9A 4RVLA 4IDVA 2WTIA 4UB7A 4O2ZA 5HTBA 2B55A 3TTIA 5CU0A 3OTVA 4FV6A 5JQ8A 4MYGA 4AAAA 1P4FA 2ERKA 5A4EA 2W1FA 2QOLA 1WAKA 5HIEA 4LRMA 3L9MA 4ZLYA 4EOQA 1YI6A 3QUDA 2VD5A 1W83A 2WMQA 1QPDA 4GU9A 4R7BA 3QAME 2GDOA 2W96B 3ORTA 4AW0A 3IO7A 2BAJA 3IONA 1YDSE 1R1WA 1F5QA
chains in the Genus database with same CATH superfamily
2XEZA 5CSHA 3CBLA 5AIKA 4AZFA 3RAIA 4AA0A 1GIJA 4AFJA 3HRFA 3MB6A 3NW7A 2ZJWA 3F69A 3UO5A 3BCEA 4XG7A 4LM5A 5JT2A 3ULIA 4TWCA 5HOAA 4YZNA 3HDMA 3ZLWA 2YAKA 3R0TA 3RM7A 5BVFA 3TNQB 3I5NA 3Q60A 4UALA 5E92A 3RZBA 2PPQA 4BYJA 1W98A 3VBVA 3QQUA 4RIYB 3UNZA 4QYHA 3AT3A 3D7ZA 3VQHA 4XHKB 3VUIA 4O7VA 5E8WA 4IQ6A 5K3YA 2F49A 5CI7A 4B8MA 4LI5A 4BC6A 3UC3A 4E6CA 2R9SA 3LFAA 4AZSA 4FV2A 4OTFA 4C3FA 1UNLA 2WO6A 3EB0A 2JDTA 4AZWA 4HNFA 2UZBA 2DQ7X 3W0QA 1PY5A 4K11A 4ASEA 3R28A 2YHVA 3TYKA 3HMMA 2ETMA 5L8KA 4YJNA 3OXIA 2ZOQA 5CS6A 2AUHA 2X8EA 3NYXA 3OC1A 3U87A 3RPOA 2H8HA 1PKDA 4FL2A 4AN3A 5IF1A 1G3NA 1H28A 4AP7A 2GNFA 3LXKA 5HE2A 4KSPA 2YM8A 4X21A 4AN9A 2PVFA 3BLQA 2Y9QA 5DT4A 4HVIA 4FV8A 1YOLA 2YFXA 4QYFA 1QCFA 3K3IA 5AP3A 4U40A 1JSTA 2XKCA 3OXZA 4KB8A 2XA4A 3VW8A 4FVRA 3R8UA 3V5QA 5I4NA 5CSWA 5H9BA 3G9NA 4L52A 5AEPA 2JAVA 4BTKA 4C4GA 4WOVA 2UZEA 4FG7A 3BI6A 4MNEA 3AT4A 3CR0A 4AF3A 4F99A 2UZUE 3TACA 5E9EA 2WMUA 1XR1A 4HCVA 5LVOA 1DS5A 2BRMA 1NY3A 3DU8A 5FRIA 3E8DA 2CGXA 4OTHA 3MY5A 4ENXA 3SA0A 1Q5KA 4ONAA 5F20A 3KRLA 5EK7A 1P4OA 3FLZA 2H9VA 3ATTA 2HOGA 1NVRA 3NUNA 4KABA 4D0WA 1OIYA 3DJ6A 4O0UA 1GJOA 3SKCA 2IVUA 4I5PA 4DGMA 4EH7A 2W7XA 4I6FA 2HK5A 3C7QA 4BBEA 3JPVA 2G2HA 4FL3A 3WF5A 1OBDA 1YI4A 5F1ZA 1NXKA 1UU7A 4ZTQA 4TNBA 3K2LA 3NR9A 4JL9A 5C8NA 2JKOA 2XB7A 3LAUA 4OR5A 4JG8A 4E4MA 4YTFA 5LOHA 3O7LD 4APCA 2X39A 4AT5A 3TZ7A 4U7ZA 5BVEA 4ID7A 1YVJA 3FI2A 3AMAA 4I23A 4IWQA 1V0OA 1WBOA 4G2FA 1R78A 2WMTA 2UV2A 3G0FA 4YC8A 2X8DA 3PXQA 2F7ZE 4DCEA 4K33A 3DV3A 5C8KA 5FEEA 3TUBA 2C0OA 5HLPA 4FT0A 4CRSA 1S9JA 2F4JA 5M44A 1Y6BA 3I1AA 3Q6WA 3QQKA 4HYUA 5D10A 3FMDA 4PMSA 4NWMA 2Y7JA 1E1XA 3ORIA 4FYOA 2VNWA 4DG2E 2V0DA 4LUEA 3FLQA 4YGAA 3C9WA 5IQGA 1YOMA 2R2PA 4KIKB 2E9VA 3R9OA 3CIKA 2GNHA 4FL1A 4EYJA 1JNKA 3KQ7A 2C3LA 4UZHA 1OMWA 3U8WA 3VC4A 3ZDIA 3LE6A 4FI1A 4PL5A 4E1ZA 3PLSA 2X2MA 4YBKA 4JXFA 4UV0A 4ZJIA 1J1BA 3OT3A 1K9AA 2WOTA 2NO3A 3MPTA 4RWIA 3GU7A 3LCSA 5T6KA 4EOSA 2PMNX 5KHWA 2IF8A 2WMWA 4KIQA 5CNOA 4FT5A 3HDNA 3LW0A 5JMSA 3RTPA 3RJCA 2JKQA 3VUTA 3WE4A 4G6OA 5BYLA 5LXMA 1ZMWA 4UWBA 3ZRLA 4CZTA 4GEOA 4NK9A 2FSOX 1R0EA 2C5OA 3UG1A 4PMPA 5B2LA 2HY81 3PJ8A 4FV5A 4E4XA 4XLVA 4EH9A 5EQYA 1Z5MA 4HGTA 5AUVA 2XUUA 3JY0A 2QLUA 4KWPA 3VS5A 4A4OA 4IFGA 5L2WA 1DM2A 2FGIA 2WXVA 4N6YA 5CEQA 1LR4A 3VBXA 1H26A 1SNUA 2C6OA 4CYJA 3RAHA 5L8LA 4QMSA 3GP0A 1PRYA 5BV3A 4S31A 1Q41A 2C1AA 3A99A 4KS8A 5HBHA 5M51A 1W2DA 2JKKA 5IA0A 3BU6A 4HGLA 4F9WA 1KV2A 2ONLC 3NNWA 4RPVA 4WA9A 1Q62A 3THBA 4YJOA 3R04A 3MH2A 4TXCA 3ZUVA 4MVFA 1TFFA 1JWHA 3PLAE 2PE2A 4RX9A 3VS6A 3PRFA 2FH9A 5AUZA 2YIWA 2IPXA 3E87A 4XG3A 5IMEA 3UMXA 5A46A 4FTTA 2XANA 5IEYA 1X8BA 4CXAA 2VTOA 4IX6A 1CSNA 3DKOA 3NYVA 4CLIA 3BPRA 1TVOA 4D0XA 3VUKA 3DOGA 3SHEA 4NW6A 2UW5A 4U97A 2A98A 3IDPA 3NNXA 3JVRA 4QD6A 3T9IA 2BTSA 3QBNA 3WOWA 3FQSA 2XP2A 3TNWA 1PMNA 5CU4A 3I6UA 4KNBA 2C5YA 2PVMA 4R6VA 3RI1A 3HL7A 5C9CA 2R3HA 3W16A 3WF7A 3R1NA 4X6RA 4O86A 4NM3A 4YTCA 2ZM3A 2QKWB 4RIWA 4BZNA 3S1HA 4R5YA 4YP8A 3LFCA 2PVJA 4IZ5A 4O27B 2LGCA 4F6UA 1BMKA 4MAOA 2WFYA 4U41A 5M09A 1JLUE 2IN6A 2ZM4A 3BE2A 4RZWA 5DWRA 5EM5A 3VONA 2QOFA 3FQEA 1YQJA 2B7AA 5DGZA 4YMJA 4QP2A 3OF0A 4IX4A 3GEQA 5F4NA 4BDFA 2WQMA 4J96A 5LVLA 3KN6A 4BTFA 4IWOA 5TF9A 3BKBA 3C4WA 3EZRA 3OG7A 4L44A 2R4BA 1A06A 4G6LA 4LRJA 1ERKA 3DFCB 4PUZA 1R39A 4S32A 2PUPA 3MFRA 2WQOA 1U4DA 2BVAA 4RGJA 3LKMA 4JNWA 2E9NA 3Q5IA 4FTAA 3CSVA 1RQQA 5IA1A 2V62A 1IEPA 4RZVA 2GNJA 3UQFA 2GS6A 3VQUA 4U3YA 4JX3A 3U9CA 4PL4A 4FK3A 4ANNA 3LM5A 3E3BX 4IE9A 1XMMA 4IVCA 3G15A 4DBXA 5DEYA 2FB8A 3MH3A 5IUIA 4P5QA 2LAVA 4IWDA 3ORNA 4C57A 2XM8A 3DKFA 3I60A 3QTXA 4DT8A 3AD4A 3CJFA 2CKPA 4IB5A 4WBBB 4NZWB 4BDCA 1V0PA 3SXFA 4D58A 5F9EA 3DXPA 3BX5A 3H30A 5AX9A 4ASXA 4B7TA 4BWKA 3PVUA 4OTWA 3UDTA 1FGKA 3FMEA 1XKKA 3PPKA 4IX3A 4MXCA 2BZKB 3ZH8A 3VS7A 4ANSA 4UBAA 4Y73A 4C35A 3ZOSA 3LHJA 4IAZA 4R7IA 3WYYA 4II5A 4G34A 2R3IA 5JZNA 3MWUA 4OAUC 3LFFA 4BDKA 5LMAA 4QTBA 5C4KA 3OT8A 4XYFA 3R7UA 5IA2A 4NL0A 2RSVA 2JFLA 4I6LA 2ONLA 3K5VA 5C01A 5I9VA 4G9RA 3U51A 4YTHA 3HAVA 4QMMA 3TV7A 4D1XA 1OL2A 4C4EA 4F7JA 4GK3A 1PHKA 3S3IA 3FMMA 3VN9A 1M7NA 1MRVA 2WD1A 2P2HA 2HAKA 2VTMA 4FZFB 1SVHA 2REIA 2HY0A 4PF4A 2RFDA 3AD5A 3PVBA 5E1SA 1YW2A 5AR2A 3QA0A 2X4ZA 4C58A 5FTGA 2QOKA 2WELA 1YHSA 5DE2A 1KOBA 4RFMA 5KMMA 3JUHA 3EQPA 5I9WA 4W9XA 2VTAA 1G8KA 2RG6A 3P78A 3MI9A 3F7WA 4IM2A 5CASA 4QNYA 4YHJA 1MUOA 2XNOA 4OTQA 5CAVA 2B9IA 4ZTRA 4C61A 3OD6X 3ULZA 4IW0A 2F9GA 3A8XA 3OCGA 4XRLA 5DEWA 3O7LB 4HVSA 3S00A 4LYNA 2ZDTA 4GRBA 3P7BA 2O8YA 3QGYA 3ZRKA 1QPJA 2AYPA 5K4JA 3NYOA 2VGPA 5I9XA 3GU5A 4EK5A 3FHRA 5M08A 1JKTA 4OTGA 3D83A 3SW4A 4YPSA 4QQJA 5JEBA 5D7VA 3TXOA 4YLLA 2YIRA 3DBCA 3I4BA 2CCIA 3NUSA 4U80A 2J0IA 3KVXA 1T46A 2W05A 4FKVA 4WKQA 2BIKB 3E5AA 4K18A 5CSXA 4GSBA 2UW8A 4U0IA 4Y5HA 4DTBA 1W2CA 2QOCA 4X3JA 3CD3A 3LFDA 4EJ7A 3BV3A 2UVYA 2QG7A 4I93A 5GJFA 2XRUA 1YXSA 3G6GA 2VX0A 3OXTA 3MGYA 4NCTC 4CT2A 2CLXA 4FGRA 4UN0C 4X2GA 5HQ0A 2X8IA 3F3TA 3IW8A 3O51A 3K3JA 3KXHA 3OZ6A 4FV0A 4JLCA 4MXXA 4RIXB 5G1XA 4F08A 3P23A 3VNTA 4YHFA 5HNBA 1NW1A 5ACBC 5IEXA 3MPAA 5AR4A 4GIIA 4YJPA 3W0NA 1OL7A 3I79A 3R63A 3RNYA 4Q9ZA 4M66A 4FIJA 5FTQA 2YZLA 3Q2MA 5E91A 4W8DA 4HGSA 2F57A 2NRUA 4O22A 4CFXA 5CT7A 1XH9A 2HXLA 3BYVA 3UYTA 5IH5A 2QKRA 4YZDA 2YM4A 3CPBA 4AGUA 4O82A 4JG7A 3AC4A 4GH2A 4W9WA 2QO2A 5BYYA 4ZMFA 4V04A 5BPYA 4BN1A 3U4UA 1AQ1A 3KULA 4ASDA 4C2WA 3LFBA 4F78A 4M13A 4GT4A 2UZOA 5CEIA 5FXSA 2J2IB 3QZFA 4H36A 5IH6A 2GPHA 1A48A 1JSVA 4R5SA 2PK9A 4EEVA 4GYIA 1HCKA 3BYOA 5EM8A 2XIZA 2HENA 1M52A 3KL8A 4R77A 1SZMA 2UZLA 3MTFA 4CT1A 2BZHB 4EOJA 1GZKA 1MP8A 4EK8A 3LLAA 1KV1A 2NRYA 5GZ8A 3W0MA 4CEGA 1FQ1B 5GZAA 5AMNA 2OJ9A 3A4PA 4UEUA 4ZY5A 1BL6A 2J50A 3AG9A 5B0XA 5J9YA 4F9YA 3E7VA 3PJ2A 2CKEA 4TYHB 3NFFB 3TNHA 3TI1A 3V5WA 4FTQA 2XIRA 2Z8CA 5CXHA 4O1PA 3ENHA 2P33A 5BVWA 4N6ZA 5IQDA 1XBAA 5ANJA 4CVAA 3P5JC 1BYGA 2P4IA 2VWXA 5A54A 4CKIA 4IB1A 1CKIA 5H8BA 5AA8A 5KMKA 4QPMA 2X1NA 3VS4A 1YWVA 4JDJA 3MFSA 3NSZA 1LEWA 4A9TA 2ERZE 4F9CA 5GIOE 2XKEA 2WMRA 2JBPA 2RFNA 5IQEA 3T3UA 2YIYA 4AXEA 4YC6A 2JFMA 3SXSA 3IK3A 4J71A 3W10A 4Z55A 4O7TA 3BHTA 3DTCA 2GHGA 2JC6A 5ETIA 3REPA 5E8YA 4CFMA 3O96A 4RWLA 1F3MC 2PWLA 5HU9A 1URCA 4DH3A 5CAUA 5M4CA 3N4TA 5FG8A 4CV9A 4KBAA 4XG9A 3ERKA 3HV4A 5L6PA 3QHRA 1ZAOA 4XLIA 3HEGA 4MX9A 3DB6A 3KMMA 5I9UA 1PMEA 2YCSA 3EN4A 4FOCA 5DRDA 3N51A 4U9AA 4DCAA 4E5WA 2QOHA 5FXQA 4D1SA 2VWVA 4D9UA 1ZOHA 5E90A 3BGZA 3HP5A 1FOTA 4GU6A 5LARA 4NCTA 2Y6OA 2OWBA 3LFEA 3W8LA 2KULA 4BRXA 1U54A 5JZJA 3L8SA 2HCKA 3Q4UA 3O17A 4IXPA 1UVRA 3EL7A 4DGNA 4NYEA 1H4LA 2RKUA 3DQXA 2ITZA 4QMOA 3F3ZA 5J7BA 2BRBA 5AR3A 5AV0A 3LMIA 2PL0A 3F5GA 3QZHA 3WI6A 3DBQA 3PSDA 3ODYX 4XG2A 4ZS4A 4RWJA 4LRKA 4XOYA 2OF2A 4FKIA 4FG9A 3EHAA 2CSNA 2RFEA 2X0QA 4JVGA 4J98A 2R3KA 4O7YA 3VVHA 3AXWA 4F4PA 4USFA 2RFSA 3FMKA 5D1JA 5AP7A 3SOAA 1TKIA 2JD5A 2VWUA 4U42A 2BILB 1KE5A 3M2WA 5IQCA 4AAYA 4X3FB 5IUGA 5HCYA 3PP0A 3R1YA 4EH6A 3NDMA 4O7LA 1O6LA 1YHWA 4ACCA 4FT7A 1VJYA 3PA4A 5A4TA 4FEUA 3UNJA 3BGPA 3E8NA 4AOTA 3RHXA 5LMKC 3FMNA 3KK8A 3LCTA 3QTUA 2CNQA 2X7GA 4QMXA 4DH5A 2PVLA 4PDOA 3BU5A 3OCBA 4I4EA 3BBWA 3C4EA 4M15A 1PXMA 4ZSEA 3Q04A 5BVKA 5KBQA 3LQ5A 3LCKA 4EQCA 3PJ1A 2EUFB 4ANMA 2O5KA 2Z2WA 3GFEA 5HX6A 2XEYA 4AQKA 2V55A 3CE3A 3BYSA 4KINA 2XK3A 3PZEA 3PFQA 4WHZA 3SXRA 4XMOA 4RQVA 4FTOA 1OB3A 3COKA 4Q5HA 3D15A 1M17A 4ACHA 3AMYA 4MBJA 2BUJA 3R7VA 5HVYA 3Q96A 5C27A 4MCVA 4FVPA 1FPUA 3DBFA 2IZTA 4JOAA 4ZTMA 3COMA 4U6RA 4L7SA 4DDGA 2QURA 3EKNA 1JQHA 4UWYA 5HGIA 4BI1A 4E93A 4ZY4A 4GJ3A 4AW2A 3GXLA 4JBPA 4H3BA 4FT9A 4FEQA 4P7EA 5CF8A 2QODA 3RAWA 5HG8A 4JG6A 1ZYDA 3HLLA 5ANGA 3BHUA 2I0YA 3I0QA 3DAKA 3RPYA 4BDJA 3CQWA 5EQPA 2CMWA 2HXQA 1ATPE 4ZZNA 4XS2A 3DAJA 4QYYA 3EQCA 4AE6A 3L8PA 4WT6A 5IISA 1ZYCA 1OZ1A 3Q6UA 5A4QA 3VUMA 4PTEA 4F9BA 1G8AA 1VLRA 4BI2A 3HA8A 3BZ3A 2XNNA 4QPSA 1Y57A 4KS7A 4AX8A 4DFUA 2XIYA 5IEVA 4LDTA 1UU3A 3KRRA 3TCPA 5J9ZA 2A2AA 1OKVA 4BVUA 5CU3A 4A9RA 2G2FA 4Q2AA 4EWHA 1MRUA 3SG9A 2QOOA 2ZM1A 3FBVA 4WRSA 3ZO4A 2OSCA 5IDNA 3GU8A 4YNOA 3PE1A 4FGBA 4CFFA 4GW8A 3OCSA 2X9EA 3QD0A 4K2RA 4DEEA 3R9HA 5A4CA 5L3AA 2X9FA 4YR8A 2J6MA 3EYHA 1W84A 4TPTA 2I40A 3DB8A 5HG7A 4IWPA 1V0BA 4PPAA 5J79A 5J87A 3MDYA 3N9XA 1YXXA 2W9FB 2C3KA 3RHKA 3OEZA 2OICA 3A7IA 3BLRA 3OS3A 1FBNA 3QKKA 4FE2A 3KC3A 2CJMA 2WMAA 4CMTA 2W1ZA 3FXZA 5GJDA 3TKIA 4XV1A 2BALA 1J3HA 2ETRA 1S9IA 4FSZA 3IPHA 4EOOA 2YDJA 4M97A 4RRVA 4IVAA 4U44A 4AG8A 4AGDA 5C4LA 3D9VA 2XRWA 2I0VA 3MA3A 5ICPA 3TIZA 5AR5A 2G1TA 4Z3VA 2C5VA 3OOMA 4TY1A 3DDPA 4NW5A 5KZIA 3RMFA 4YU2A 4QQTA 1J1CA 4RA5A 5EW9A 2XNPA 4UWCA 5E1EA 4D2VA 3P79A 2ZMCA 2Y4PA 4L3LA 4OTPA 3WZEA 5LMKA 4OAVB 1Q8ZA 3SOCA 3CY2A 5J95A 3FXWA 5AX3A 3RPRA 2R3NA 1Y8GA 5CNNA 5JSMA 1YXTA 4RFZA 2BPMA 3VULA 2VWZA 4EK4A 4IMYA 4L68A 2PVKA 4DDIA 4RIYA 4IVDA 4YSJA 3QYZA 3ZCLA 3PWYA 4I1ZA 2WU6A 3QRTA 4JT3A 1FMOE 2XAMA 2I6LA 1JOWB 4E6DA 3CEKA 2E9OA 3UIBA 1HCLA 3L8XA 1PKGA 4FV1A 3QTIA 3KF7A 2VAGA 3UIXA 4FF8A 3ZM4A 2QI8A 2WTDA 1YXVA 3R8MA 2XYNA 3VJOA 2R3PA 3QD2B 2BHEA 2YAAA 1EH4A 3F82A 5D9HA 4ZTLA 3TL8A 3M1SA 4BCFA 1SYKA 3GENA 3HKOA 4L45A 4ZY6A 2PMLX 3UPZA 3RK5A 4DGGA 1Q24A 5DOSA 4LV8A 3Q4CA 4FMQA 2BAKA 4ZSLA 4FODA 5K5NA 4RMZA 1DAWA 4CNHA 1IAJA 2WHBA 4FIFA 4D4RA 2PZIA 2RGPA 3NWWA 4NM7A 3KMWA 4WO5A 4F70A 2YM7A 1ZZLA 5EYDA 5HD7A 4APPA 1ND4A 3C5UA 3EQFA 4QDVA 2QVSE 3ANRA 2CN8A 1H01A 4WNKA 2Z02A 5E8ZA 2OZOA 4BKZA 4O0XA 4IM3A 4MNFA 1PXIA 3V3VA 4UMRA 5A6NA 2R7BA 1OKYA 2F7EE 3FLYA 5HE1A 3HGKA 4YJVA 4ITJA 1A9UA 3Q52A 5EYKA 2X2KA 4NKAA 4I92A 4P4CA 5AV4A 2WTKB 5DA3A 3S0OA 4BDEA 1REJA 3NGAA 1IA9A 1W0XC 3HRCA 3NW6A 4L01A 4AE9A 4EYMA 1ZY4A 3EQIA 2ZVAA 3TT0A 1GIIA 3FZTA 4XP3A 1PYEA 4WD5A 4R3RA 2WMXA 5JGDA 3BWJA 4GK4A 2J4ZA 2X7OA 3FXXA 1MQBA 4EUUA 4O83A 4R78A 3ZBFA 5ANOA 3H9OA 4EOKA 3W0SA 3ZMMA 4PQNA 3PTGA 2FSTX 4S2ZA 1NVQA 4IEBA 4QQCA 4YJUA 4DTKA 5DIAA 4MBLA 2I1MA 2AC5A 4HZSA 2IW9A 3DLSA 1ZRZA 2YLFA 2VTSA 4YJQA 3EJ1A 2YACA 3TV4A 4C0TA 3W0OA 1GZOA 4RVMA 5I5ZA 1KSWA 2XIXA 2DUVA 4AOIA 4EOMA 4DHZA 2GS7A 4U81A 1Y6AA 4XG4A 5AP5A 5EI6A 3AC2A 3ET7A 3FE3A 3NRMA 3EN5A 3UOHA 5I9YA 3BYMA 1H1RA 4HZRA 3ML1A 2A27A 2YLEA 3E3PA 3G2FA 3Q9XA 4C34A 3TUDA 2XIKA 1GNGA 5AUXA 4DG0E 2QO9A 4CV8A 5L8JA 4D5HA 2DS1A 4ZLOA 4D9TA 4KIKA 3UOKA 1Y91A 4EH8A 3HUBA 4Y85A 3HP2A 3SLSA 1JKSA 4JJRA 5FXRA 3KF4A 4FKTA 4BY9E 2QR8A 2OZAB 3NIZA 1ZLTA 2VRXA 4X6QC 4AW5A 3CD8A 3NLBA 4EJNA 5CSPA 3SVVA 1TZDA 4L3JA 3MB7A 5JRSA 3FZOA 2OGVA 4AXDA 4BDBA 1XHAA 2I0EA 2J0KA 4TW9A 4Z7GA 3QKMA 4K8AA 4YJTA 4DTAA 1L8TA 2VTQA 4CCUA 4IZAA 4FBXA 4XV3A 3R7OA 2XKFA 4BJJB 3I6WA 4DYMA 4FTIA 3EKKA 1ZARA 3OP5A 4EOIA 4L42A 2GQGA 5L6OA 3IW7A 4C4JA 3F2AA 2JDRA 4ITHA 3B2WA 3F5UA 3F7ZA 3FC2A 4KKEA 2ITPA 1WVXA 4QP9A 5JFSA 3ORLA 4ALVA 4EONA 5BVOA 4H05A 2A0CX 4XNEA 2IEWA 3SAYA 3O71A 1WVWA 1YDTE 2OJJA 2R7IA 2XF0A 3QQGA 1U5QA 1V1KA 5TOZA 3OFMA 4PDPA 4BHZA 2QOBA 3FL4A 2C6MA 3PA3A 2GHLA 2WQNA 2G15A 5HCXA 5CU2A 5IPJA 5FLFA 4TNDA 5FP5A 2VTNA 4MK0A 1G8JA 4O84A 2Q0NA 2EXMA 3MY0A 3ZFYA 4D2RA 2WEIA 5KE0A 2XH5A 3PVWA 2UW6A 4KSQA 1KE6A 2XZSA 4CZUA 4E5AX 3SW7A 3SV0A 4HJOA 1OI9A 3S4QA 5CX9A 2J0JA 4MXYA 2XK8A 2XNMA 3TG1A 2IZRA 4EKKA 4RVTA 2VWBA 1PF8A 5HO6A 3T9TA 3G6HA 4DHJA 3COIA 4TWPA 5AM6A 2WMVA 3AQVA 4C38A 5LJJA 3UTOA 4CTCA 4PPBA 3RVGA 3ZEWA 3WE8A 5H3QA 3NNVA 2HZNA 3QHWA 2RG5A 2C30A 4G16A 2HELA 4YUQA 4FSMA 2JITA 4AS0A 3PIXA 5LVMA 4RVKA 2C1BA 3AC1A 3PVGA 3PDTA 4EZ5A 4AACA 2QLQA 3G51A 2WKMA 3DY7A 4NH1A 3NPCA 2R3MA 4ERWA 1W8CA 4IAIA 3DT1A 3A60A 5AR7A 2R0IA 4BF2A 3PY1A 3C0GA 3F3UA 4NIFB 2WEVA 5CEPA 5HI2A 1FMKA 5DR2A 4YZCA 4OW8A 3EFKA 4W4YA 4AZEA 3FI8A 3W0PA 5I3RA 5ANEA 3KY2A 4OBPA 2BRNA 2IG7A 4WNOA 4I6BA 3TZ9A 1CDKA 4ANLA 2YCRA 1U46A 1L3RE 4LV5A 5TO8A 4QTCA 3UIUA 5AADA 5EQEA 4LOPA 4B0GA 4BCIA 5HBJA 3TDWA 2XYUA 3EN6A 5CSVA 1PXLA 4R1VA 3GC9A 4X2FA 3Q53A 4NSTA 3KXGA 5AAEA 2PVYA 3C0HA 3MH0A 3WZDA 2AEGA 4WIHA 2PVRA 3G90X 3ROYA 5CAOA 2YABA 1VYWA 2GCDA 3WZJA 3UZRA 3GCSA 2B52A 3DS6A 3UDBA 3DK3A 1E1VA 5IKWA 3NZ0A 5CEMA 5L2QA 5IA4A 3FJQE 2YCQA 4U5JA 5D11A 5DHJA 3D94A 4BHNA 3H10A 3DJ5A 3Q3BA 2OIQA 2WZJA 4LOQA 3HMNA 4YLJA 3VIDA 1OL6A 4G9CA 4UMUA 5A14A 4EC9A 4AXCA 3V8TA 4O1OA 3A2CA 3D14A 4PDYA 3GU4A 4H3QA 3R8VA 3C1XA 3PUPA 1RE8A 3FLNC 3W1FA 2GQRA 4FKSA 3UODA 4BGHA 2BRGA 4BWXA 5CENA 5ETAA 2GQSA 2OIBA 4ZSGA 1XH4A 2J7TA 5CLPA 4EHEA 3PIZA 3SD0A 3ETAA 5A6OA 3BL7A 2WTVA 4O81A 4EKLA 5DT3A 5L2SA 1IG1A 3GQLA 4H39A 1ZMVA 4J52A 3ALOA 4TYJA 3P0MA 2XVDA 3IOKA 4P2KA 4HNIA 5IZFA 2C0IA 4WG4A 3G0EA 1UV5A 4JBVA 4V01A 4DFBA 5FGKA 3F5XA 3MIAA 3PJCA 4M7IA 2R3RA 2CDZA 1ZYLA 4JMQA 4AT4A 4GCJA 4AOJA 4XP0A 3PE2A 2R3JA 4OT6A 3AGLA 3VS3A 5C8MA 4BKYA 2WU7A 3DGKA 4U79A 3CY3A 4C3RA 4D2TA 2ZDUA 4BI0A 5KMIA 4JQEA 2OXDA 1R3CA 3QC9A 4FSQA 5IQHA 1KWPA 2W1DA 4MD7E 3CTHA 2V5QA 3CS9A 4LGDA 1WZYA 2VX3A 4AA5A 5IA3A 4CSVA 2VN9A 2OO8X 2W06A 3FDNA 1H8FA 5A9UA 3WARA 3NVMB 4N4SA 3SRVB 3WF9A 2H6DA 2YWPA 2GFSA 3Q32A 4QP4A 5DR9A 4CMOA 4DH8A 2VTTA 5HKMA 4EZ7A 2QOQA 5KKRB 3FAAA 2ZMDA 4XBRA 4AXFA 1W82A 4G3GA 3GI3A 4ZEGA 5M06A 3LJ0A 4DA5A 3ZUUA 4F0IA 3ZFXA 4E4NA 4C2VA 4L6QA 3O23A 4HCUA 2ZV2A 3VUHA 4LMNA 3ZZEA 4DBNA 2OJFE 5HG5A 4TWOA 1CKPA 2IWIA 2VWIA 5K4IA 1J7UA 4TL0A 5JKGA 2IW8A 3NMUF 3E8EA 3PXZA 3Q9YA 4W8EA 5E8UA 2XNGA 2JLDA 3EQDA 3R9NA 3BELA 1Q99A 4MF1A 4ZSAA 1J91A 4CFWA 1OIUA 3C5IA 1LPUA 1B38A 3A7GA 5EI2A 4JS8A 2EXEA 4D2PA 4FYNA 3TN8A 3TMOA 1B6CB 3ZO3A 4GFGA 4RIXA 4AXAA 4GYGA 2PE0A 3I5ZA 4AZTA 5BQ0A 3O0GA 4IH8A 4QMUA 3D4QA 5AM7A 4B8LA 5L2IA 4I94A 2W1IA 5JGAA 1GAGA 4MQ2A 3SDJA 3FC1X 4FNYA 3NFGB 4DT9A 4DE4A 3T8OA 3P7CA 4G6NA 2YITA 2F7XE 1BLXA 4J8NA 4CFVA 2EVAA 5ACKA 1H1WA 3BE9A 3G9LX 2XCHA 4B9DA 3HAMA 4G3FA 4CYIA 4F9AA 2VTJA 3QRJA 4LGGA 4RJ7A