5LCJA

In-gel activity-based protein profiling of a clickable covalent erk 1/2 inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
347
structure length
345
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title In-gel activity-based protein profiling of a clickable covalent ERK1/2 inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 345
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lcjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lcjA01
3LIJA 4FR4A 3O96A 2R9SA 4L3PA 5HE3A 4FV7A 1J1CA 4N6ZA 2UW0A 2XK4A 1XJDA 5IQIA 3HV4A 4FKWA 4U40A 4ZTMA 3ZRLA 4FSNA 3RP9A 4YZNA 4ZTQA 5IQGA 3DBEA 3GVUA 3F2AA 4G3FA 3D2KA 3QRJA 3FSFA 1XO2B 3F7WA 2UZLA 1YHSA 3WARA 2YDKA 3BGZA 3U54A 4QP3A 3U9CA 4FE2A 3RNYA 4F9AA 5M07A 2C3KA 2X8EA 3Q2MA 4GFOA 3I0QA 3DKCA 3UPXA 5CNNA 5H8EA 2OI4X 1Z9XA 5KMOA 2PK9A 4GS6A 4MXXA 4Y5QA 3MYGA 1FMKA 4ANQA 4QTEA 2FA2A 4H3QA 2BRNA 2V7AA 3EIDA 5AUVA 5HCXA 3R9NA 5IMXA 2ZV2A 2UZTA 3FI8A 1YXVA 1A9UA 3ORZA 4RQVA 4CZYB 4ZK5A 3SX9A 4QPAA 2VWWA 3FMKA 4ASXA 3C9WA 4APCA 3FZRA 4FNWA 1U54B 4EH4A 4DH7A 1H4LA 4GT4A 4FIHA 3IGGA 4Q5EA 4BDKA 1OKZA 4HYHA 1ZARA 4FTKA 5CF6A 5M57A 2PMOX 2UZOA 4FV4A 4KIPA 1E1XA 4L43A 2Z7LA 5HLNA 4K33A 4DFXE 4X2KA 2W1ZA 2B52A 3HMIA 5L8LA 4BIBA 4EK5A 4IADA 4ZJIA 3BWFA 3TM0A 4ASEA 1MRUA 4I6FA 2C6OA 2YDJA 4FODA 5CT7A 5HESA 1DM2A 2PMNX 2QO7A 5ETFA 4CRLA 4IAYA 3K2LA 4XNEA 3VUHA 1PJKA 4FYOA 4RX7A 4JXFA 3MH0A 4DG3E 4DFLA 2OIBA 2DS1A 2PY3A 4DEIA 2XRWA 3OWLA 2PUUA 5CT0A 1Q97A 3F3ZA 3TI1A 3W32A 4DE4A 3KXNA 4NWMA 4YBJA 3W2RA 4QMVA 3TKIA 4AN3A 3QCSA 4Q5HA 5EDQA 4BGQA 3BHVA 3OWPA 5M53A 3MJ1A 3FKNA 3I6WA 4IH8A 1SYKA 2FSMX 3FAAA 1UU9A 2P2HA 4J8MA 4UMPA 2ITVA 2XCHA 3E8CA 5AUXA 3EYHA 3OCSA 4D1XA 2SRCA 3LFFA 4MD7E 4FK6A 3ZM4A 2BHHA 2G2FA 4GG7A 4H1JA 3KU2A 4RFZA 4GMYA 3SRVA 3FMLA 3EQIA 2UW5A 2QU5A 3IK3A 4PUZA 4PDYA 4YJUA 3HUBA 3QL8A 2X7FA 1VJYA 2OSCA 5IF1A 4TYJA 3VW8A 1WBPA 4IC7A 4GVAA 1PKDA 3D5XA 4YU2A 5KHWA 4RWJA 2QG7A 4F1OA 2OF2A 3H10A 4XLVA 2XA4A 1JAMA 4ORKA 2QC6A 2RG5A 3G51A 4G5JA 2IZSA 1O6YA 4JDHA 4G3GA 4NEUA 1YDTE 1OZ1A 2C5VA 5CZHA 2R3MA 5EYDA 1JKLA 4D9TA 2F2UA 2CPKE 1OL6A 2UZEA 5CI7A 3LXKA 5K3YA 4YMJA 4AW1A 5LWNA 5HO7A 4BCIA 3DBQA 3DB6A 4FOBA 3VBWA 4CG9A 1ZLTA 1YOLA 1RDQE 2J90A 3ZDUA 3AC5A 2JDVA 1OUKA 3QQUA 3MPMA 4ANBA 2WTDA 3MH2A 5DN3A 1KV2A 4RQKA 4EORA 1P14A 2WMQA 3COKA 3PTGA 5C03A 5ACBC 1WVWA 5E8TA 4PPAA 2O65A 3HEGA 4M84A 2VTTA 5K0XA 4FZ7A 3WF5A 5HTBA 3QRKA 1REKA 3DFAA 4AG8A 3QC4A 4QMWA 3PSBA 3MVLA 5CZIA 5GZAA 4IZ5A 2NO3A 3QAME 3R71A 1R39A 3GNIB 5EM5A 3ZHPC 4EHVA 3DPKA 4JBOA 3NAXA 3COMA 1E1VA 3QWKA 5AP3A 3E8NA 5HHWA 5FXQA 2YM8A 1OITA 5JFWA 4O0YA 4YHFA 1YDRE 3RINA 5CU2A 5L6OA 4L7FA 4EH2A 3DAKA 3Q3BA 3RPRA 3QUEA 5AP4A 5HVKA 3DK7A 3SXSA 2BDWA 2HCKA 2YAKA 4HPTE 2VWIA 3GFEA 2QCSA 5DHJA 3I79A 2FUMA 1K2PA 3LCDA 4DGGA 3MN3A 2YM5A 5HE0A 2B9FA 4B0GA 3BI6A 2BAJA 2R3FA 1PXOA 2P55A 2A27A 3BEGA 2WQOA 3SW7A 1MQ4A 3FZTA 3QWJA 4IVBA 2VWZA 4QMTA 1PMNA 2ZB0A 5A54A 2GQRA 4ZS4A 5FXRA 3E3BX 3OXTA 2CGWA 4BBEA 3C5IA 3QYWA 3C4ZA 5CEIA 4HVDA 2QLQA 1SNUA 2W99B 1LR4A 2CJMA 3C51A 3ORMA 4XEYA 3RPVA 3ZFYA 4D55A 1G8SA 2F2CB 1XBBA 3R1SA 1IRKA 2G1TA 3I60A 4MF0A 1H08A 2QG5A 3TZ7A 1BUHA 3D5UA 4LYNA 3NZ0A 3JVSA 1YHVA 4FTRA 3ZSHA 2QQ7A 4RJ3A 5IA4A 3FQEA 3OD6X 4A4LA 4E26A 2XIKA 1F5QA 4RMZA 1GZKA 4RIWA 4J97A 3VS1A 2R3OA 4U81A 4OR5A 3VF8A 4S34A 5J7BA 4UX9A 4WNPA 5M56A 2OBJA 4FMQA 1ZZ2A 2ZMCA 4O22A 2VRXA 2VTHA 1BI8A 4O7TA 2JBOA 4AZSA 1VR2A 3ROCA 5CAQA 5LWMA 3GCPA 3SW4A 4FV0A 5KX8A 3FSKA 4BB4A 2HXQA 5JZNA 1FPUA 3UNKA 4JJRA 3VN9A 1ZWSA 2PZ5A 4EQCA 4I93A 5ITAA 5HU9A 4YPDA 4EK4A 4L9IA 1PF8A 4IHPA 4MWIA 4AACA 3QA0A 4KSPA 2CCIA 2I0YA 1R0PA 3C1XA 3BYSA 4HZSA 4AGCA 2J0JA 4DGMA 1F3MC 3BV3A 3W16A 4HPUE 4U45A 5IQHA 3GEQA 3UC4A 4D2RA 4ZY5A 2XKDA 3NW7A 4O0TA 4QQTA 3L8SA 4F6SA 3BCEA 5TR6A 1QPEA 3QQGA 4TWNA 3RPOA 3RAIA 3IPHA 1JLUE 4FIEA 4FKTA 4V01A 3TV7A 4F7JA 5IA0A 3W2CA 5JFSA 4JQ7A 4WG5A 2GU8A 3UO5A 2OXYA 3U6JA 4JT3A 3AC4A 2OZAB 2ITZA 3QTIA 5CEKA 2CGUA 3A7HA 4PNIA 5FM2A 4C58A 3V5LA 2EB2A 3DXPA 2C3IB 4RIXB 3RWPA 2BRBA 3PA3A 3WE4A 5EW8A 3E7VA 4C3FA 4K9YA 1IA8A 2XBAA 2YIXA 3VBYA 4USEA 4U8ZA 2FSOX 3R7UA 5C27A 4FICA 2GNHA 3UIXA 5IMEA 1LPUA 3HA8A 3HDNA 5E8UA 4ZTNA 5I9XA 3NIZA 4J95A 3T8OA 4I4FA 3CJFA 2VU3A 5HX8A 3V8WA 3S0OA 4GYGA 4C4JA 1UNGA 5DE2A 5AFVA 4DLIA 3Q4TA 3N4UA 5GJDA 4C34A 5LVOA 2XIZA 4O2ZA 3CQWA 5HE2A 5IKWA 5CU3A 4BZOA 1J7LA 2A0CX 3MIYA 4DEEA 1XH7A 2IZUA 3KRLA 4F7NA 1L8TA 3TDVA 1OIRA 3NNVA 4WT6A 4O7YA 3HRCA 3QTRA 1HCLA 4UZHA 2B9IA 2XJ1A 5KMMA 3QLFA 4KB8A 4O0VA 2XUUA 4NCTA 3UG1A 5K4IA 2VO3A 3PE1A 1CSNA 4O21A 4KS8A 3DFCB 3QYZA 5CASA 3SG8A 2EXMA 4BCGA 4C35A 1MUOA 4IEBA 4D0XA 5KBRA 5FRIA 2C6KA 4DT9A 3JYAA 3OROA 3UC3A 4AZTA 4BKZA 5HLPA 4FIJA 2CGXA 4LRMA 2ACXA 3EB0A 5F1ZA 3RPYA 4HJOA 3VW6A 4XJ0A 3UMXA 4D2WA 4E6DA 5H8GA 4D4VA 5I9VA 4ASZA 1UU7A 4FVRA 5E1EA 1ZYCA 3RM6A 3QTSA 4GU9A 5M44A 3Q9WA 1Q8YA 5HG8A 3KQ7A 4FV5A 4YJSA 3NGAA 4BBMA 1Q3DA 3R7EA 5JGBA 3FI2A 3MVJA 3PPKA 4JVGA 4YGAA 3PY0A 2H6DA 2VTRA 5L2IA 3LLTA 3O7LB 1DI9A 1ZY5A 3A2CA 4YUQA 2PVNA 2BZJA 2BRHA 5AM7A 4GKHA 3QTXA 3P79A 2OJGA 3MY0A 5HO6A 4ZY4A 3PPJA 4EWQA 5B2LA 3R73A 4M0YA 1KUTA 4KBCA 4U80A 3L1SA 1XH8A 5DWRA 4ZSLA 1JQHA 4AU8A 5AR8A 3HZTA 4HOKA 4PL4A 3TWJA 2X8IA 1Y6AA 4LUEA 4ZSAA 2J50A 4AF3A 5DRBA 2WOUA 4JQ8A 2EU9A 4D4RA 3TN8A 2WQEA 3VS3A 5B2MA 3WZDA 3SOAA 2YAAA 1JSTA 1Y6BA 3RVGA 5CSVA 3QKLA 4K1BA 5CQWA 5E8ZA 3IDCA 3M2WA 4UWYA 5EH0A 4FF8A 5BUEA 3QZGA 2YWVA 4FZFB 5F4NA 2YJRA 2ZM1A 4CKRA 2J51A 2W0JA 4FTMA 4OGRA 3U8WA 2X0GA 1S9IA 1U59A 4JR3A 1DI8A 3UZPA 5C8NA 1PKGA 4L00A 3K5UA 3ATSA 4ITJA 4J7BA 4FV2A 1ZOGA 2R3GA 2OK1A 2X39A 4FYNA 4I0TA 5IDPA 4G17A 5E8XA 4DBXA 3EFJA 4XX9A 5FQDC 3FMDA 3U9NA 2OH4A 3F6XA 2QO9A 5CENA 2E9OA 3WE8A 3A7IA 2BHEA 3QQFA 4RVKA 1FBNA 3QTUA 3GOPA 2C1AA 4NM3A 5M55A 3AGMA 1P4FA 3A8WA 2ZV7A 3QZIA 2XCKA 3EQFA 3ERKA 3R30A 4GUBA 5C26A 1OUYA 4K0YA 3SKCA 3O8PA 2PZIA 3LCKA 5GNKA 3R8UA 3ZLYA 4YO4A 5CANA 5A9UA 4JX3A 4HGTA 4BWKA 2W5BA 2OGVA 3BBTB 3EQPA 2GHMA 3RM7A 3R8LA 2GNFA 5A46A 3F88A 3OFMA 4QPSA 2HZ0A 4O7RA 4J98A 5J7HA 5IISA 3QZHA 4RSSA 3ZFXA 3SV0A 1BL6A 1RE8A 2W1IA 4HCTA 5AM6A 3EQBA 4QYGA 1UKHA 2QD9A 2CKEA 2VNWA 4ACGA 4X3FA 4F64A 3HRFA 4AGDA 1OPJA 2CGVA 2R3QA 2X9EA 2VTMA 5I9UA 2ITXA 4B8LA 3I7BA 4X2NA 1STCE 2BZHB 4MD9E 2C5OA 3V5JA 3KRRA 4O83A 4KIKB 2O5KA 3LJ0A 3LXLA 1I09A 5CSHA 4F1TA 1CKPA 1LEWA 3O0GA 2GNIA 4E1ZA 1PYEA 4U3YA 3PWYA 4FGRA 5HBJA 3PDTA 1Q4LA 1WBWA 2QR8A 2YLFA 4QMXA 5ANEA 3Q4ZA 4N57A 3W18A 1DAWA 5IA3A 5ETAA 4WG4A 3E88A 3LQ3A 4L44A 3ALNA 3DAJA 2JIVA 1OI9A 4EHZA 3UP2A 4Z9LA 1APME 3ZLWA 3EN9A 4I6HA 4FG7A 4GK2A 5J5SA 4FSWA 4DTKA 2WTKB 2XF0A 2QKWB 1BYGA 2PVJA 2R3JA 4C3RA 4QNAA 4H36A 3DNEA 4QTBA 3ALOA 4R8QA 3EZRA 4P4CA 4BCNA 3TACA 3LMIA 5DR6A 4AE6A 3OUKA 1H07A 4M97A 2VO6A 5HTCA 4CG8A 5ACKA 3NUSA 4I5PA 3CCNA 2HZIA 3VHEA 3W2PA 3G9LX 2CNUA 3MFSA 4PP9A 5DPVA 4IM2A 5FWKK 4DH1A 4RRVA 3MB7A 2RIOA 5DH3A 2W4OA 4HCUA 5FD2A 3GT8A 5FGKA 4FSZA 3Q52A 3QHWA 4EJ7A 3POOA 4UWBA 5IUIA 4WIHA 3GC0A 3E64A 3CP9A 1S9JA 2C30A 1J1BA 3NAYA 4FSTA 4FSQA 3LLAA 3NW5A 2FSLX 1LP4A 3VS6A 1W82A 1WZYA 3SAYA 4CQEA 5HGIA 4O7ZA 2IN6A 2OKRA 3OTUA 3T9IA 4C57A 4ACMA 4IVDA 5DG5A 4U97A 4DH8A 4IDVA 3KKVA 5AP0A 2ZOQA 3VS5A 5JSMA 3REPA 2WEVA 2BRGA 5EM7A 3TV4A 4AZVA 4G3EA 3ACKA 5KMLA 3COIA 3QLGA 4P90A 5DR9A 5D1JA 3FZOA 4AW0A 1U5RA 3G6HA 2XS0A 4WOVA 4E6AA 5LMBA 3LE6A 3DKGA 4QMNA 4ZTLA 3CEKA 2ZAZA 3S3IA 5KMNA 2UZNA 2O3PA 3A99A 3B8QA 3CTHA 5LARA 1XWSA 3VUDA 4DN5A 3Q9ZA 5HVJA 3O23A 4RWLA 2BCJA 1Q8UA 3DJ7A 5FM3A 3ZC6A 4F7SA 3NNXA 4ANLA 4D4SA 2G2HA 3CD3A 3OXZA 3BX5A 3QXOA 2H34A 3QCYA 4YC8A 4ZTHA 5C8MA 3V01A 1GJOA 3HMNA 5DGZA 2P3GX 2BZIB 4IBMA 3OTVA 5AR5A 5M51A 3ZOSA 2HW7A 4C7TA 3F61A 3FZSA 4E6CA 4CNHA 2IW9A 2WKMA 3FE3A 3AXWA 4P7EA 4ZZNA 2BFXA 4PL5A 4XP3A 4USFA 2PTKA 4G9RA 5F95A 3NW6A 2PZYA 3AC2A 2OU7A 1Q24A 2RFDA 3F5GA 4BDIA 1H26A 1OECA 2YA9A 4FG9A 4FTTA 2W06A 5EDRA 4ZSEA 3RKBA 3NYOA 5EYKA 3D7TA 4X6QC 4IAKA 5EI8A 4BICA 2WQMA 5FBNC 1CKIA 2GHLA 2ZDTA 3B2WA 3QBNA 4LFIA 4O7LA 1KOBA 1QPJA 3PWDA 4AXAA 1YHWA 1KE7A 4JL9A 1UU3A 4AX8A 3BPRA 2JDTA 4MBLA 3R9DA 3PYYA 3R7VA 4CFFA 3PLSA 4AW5A 2OIQA 4BDAA 2BIYA 3DKOA 3JS2A 4HNFA 4BHNA 2B7AA 1ZXEA 3R83A 2V22A 2BALA 4RC2A 5EHOA 4CCUA 3UIUA 3ZYAA 1JVPP 4BGGA 5BPYA 1WBVA 1YWVA 2UW7A 2W96B 3LVPA 4KNBA 2HW6A 1P5EA 2OF4A 2R3HA 3O71A 4NYEA 3V5WA 4LOQA 4ASDA 3UQCA 1KE6A 4AT5A 2Z02A 3DA6A 4E4LA 3TUDA 3TNPC 3BHTA 5LOHA 4GVJA 1IG1A 5GJFA 2WIHA 1ZAOA 5HIDA 4FV1A 1QPCA 2VWBA 4X3JA 4MAOA 3FPQA 5HNGA 3BGQA 3UIMA 2J0KA 3P1AA 3VUGA 2C4GA 4XV9A 5DIAA 4YZCA 4I1ZA 4UZDA 5CSWA 3RBWA 3W2SA 1J3HA 4PRJA 5LMAA 3AT2A 3E7OA 3Q4CA 4DITA 4X21A 3R7OA 4BVUA 1OKYA 5TKDA 4QQ5A 5BVWA 3TV6A 5LVMA 3AD6A 2X4ZA 4XHKB 3I7CA 4DGNA 2Z2WA 2A19B 3DBFA 4D0WA 4WUAA 1OKWA 3UJGA 3FKOA 3C4WA 3ANQA 4FTNA 4IDTA 1OB3A 5M08A 2HWPA 5AAGA 4M66A 5A3XA 5BVDA 4O81A 3RALA 4F65A 3MVMA 5L2TA 3N4VA 4RLKA 4O0WA 5EQYA 4ARKA 4XV1A 4F0GA 3RAWA 2JIUA 3VBVA 1UNLA 5DEWA 1VYWA 3KXXA 4FTJA 5TOZA 4ZLZA 4ZLYA 3VQUA 3MIAA 2XNOA 3DT1A 5AP1A 3BEAA 2Y8OA 3FHIA 3PY1A 3MH1A 5AV0A 3ZU7A 4I24A 3QF9A 5A4TA 3FXZA 3OCGA 2KTYA 1ZRZA 4CEGA 3PRFA 5CEMA 4BDEA 5M4IA 4IZ7A 1BLXA 4QP2A 2RG6A 1BMKA 1IASA 3O7LD 1ZOEA 3D0EA 4NUSA 4UEUA 2XNEA 5J1VA 2WEIA 3EMGA 4EH6A 3OOMA 4CV8A 4E5WA 3UGCA 3W2QA 3VJNA 4D2VA 3EKNA 3QZFA 2GMXA 2PMIA 2BTSA 3HP5A 3QA8A 2HYYA 4FOCA 4FL3A 4I6BA 4JG6A 4RG0A 5EFQA 3FPMA 2LAVA 3R1YA 5AV3A 4NIFB 4ONAA 3VJOA 4ANOA 5HOAA 5BUIA 3PJ8A 2HENA 4ERWA 2W1EA 5KE0A 5K0KA 3OW3A 4QMSA 2ZB1A 4IMYA 3FV8A 5FDXA 3C0GA 3EN7A 4FV9A 3Q6UA 1K9AA 2R0IA 3R02A 3LCTA 2C6MA 1YW2A 4QQJA 4TZRA 4OAUC 3VRYA 5D7VA 3FMJA 5GIOE 3QALE 4IX6A 3UZRA 4FKRA 4RIOA 5AUZA 4C61A 3ULIA 4EJNA 4CD0A 2IVVA 3KFAA 1PXKA 3H9OA 4QPMA 3ANRA 3FLNC 3IOKA 4E20A 4BTFA 4YO6A 4YTCA 3NNUA 3V8TA 4N0SA 1B6CB 1KSWA 4U79A 2WMWA 4KWPA 5IUHA 1KE9A 3PFQA 5ANJA 2GNLA 5CWZA 4O86A 3FI3A 3A60A 2OXXA 4IFGA 4LMUA 2IVSA 2XNNA 1FVTA 5C8KA 1QCFA 1YDSE 3BBWA 2XNPA 3W55A 4TYHB 5HIEA 4K11A 4EOPA 4KABA 4QO9A 4I3ZA 3SQQA 4TW9A 3RAKA 5A6OA 3IW6A 2YCFA 3OWJA 3I81A 1PRYA 5BVOA 1H25A 3ZFMA 3CQUA 3MB6A 3U51A 1ZZLA 4QOXA 4R77A 5E9EA 3VS7A 3HECA 3PY3A 2J0IA 3E92A 4Y95A 5M09A 4F9WA 2RKUA 5J9LA 3Q32A 2X2LA 2X6DA 2XEYA 3W2OA 3ZC5A 4DBNA 4ID7A 1YRPA 1XH5A 4NFNA 2R7BA 5KCVA 4EQMA 3DCVA 4QP4A 3DXNA 3DK6A 1NVSA 5AV1A 3T9TA 1FQ1B 1JWHA 1OPLA 2BAKA 4FL1A 4I94A 4JAIA 3WZUA 4EYMA 3L9MA 3FXWA 4PTCA 1GZNA 4N4SA 4FSMA 5IZFA 1GY3A 3C4FA 3C4CA 1EH4A 4NM5A 5HORA 4GV1A 3VBTA 1G8AA 3QD3A 3WZJA 4EUUA 3ET7A 3F3UA 5DI1A 4G6LA 4NTTA 4RJ5A 4BWXA 2OIDA 3LM0A 3DJ6A 3GQIA 3QTQA 2R0UA 5CF4A 2E9NA 2VNYA 4F9CA 5A4CA 5I3OA 4BCPA 3WZKA 3BE2A 1PHKA 4O27B 4YBKA 5AEPA 4O7VA 3EOCA 4L01A 3CLYA 2HK5A 2RF9A 1WBSA 3IO7A 4GFGA 3PJ1A 4BBFA 4EOLA 2HAKA 3OBJA 3RWQA 5I9ZA 5CNOA 3GFWA 4YJTA 5T6KA 2BZKB 1Q8ZA 5DOSA 4W8DA 3FL4A 1ZMWA 4IX5A 3LFSA 4MNEA 3MPAA 4Y72A 3ZCLA 1SMHA 2GPHA 3ULZA 3FZPA 3RHXA 3CTJA 4FKIA 3PXKA 1MP8A 1W0XC 2OLCA 2CN5A 4R3PA 4ENXA 5KKRB 4G31A 4PTGA 2JITA 2YJSA 3ZO3A 3QD0A 4GL9A 4AUAA 3KXHA 4FBXA 4TNBA 4PMTA 3QXPA 2WFYA 4ZAUA 2YHVA 3C0HA 3PG3A 4KRCA 1M2PA 5AR4A 4DCEA 5CAOA 4C0TA 2C47A 2PVHA 3N4TA 4Q9ZA 3KULB 4KS7A 4MYGA 4FEWA 4WNOA 4FZDB 3PJ3A 2VZ6A 1NY3A 2CNQA 1KOAA 1PXJA 5HNIX 4F7LA 4UYAA 3CY3A 3PJCA 5BMMA 4OTDA 2XM8A 3LXNA 4C02A 1JNKA 3DS6A 3GBZA 5GZ8A 3R00A 5EHYA 4FKVA 3II5A 4A7CA 4PF4A 1YXXA 5IQDA 4CKIA 5J9ZA 4NH1A 4EQUA 4BIDA 2I0EA 4R5YA 2WU7A 5JZJA 3FLWA 1SNXA 2JKOA 2VTQA 4FSYA 4BDGA 3FMHA 2PVFA 3UQFA 3CS9A 3A7JA 3HL7A 3BHYA 3CSVA 4AA4A 4DFBA 3ZDIA 5IH5A 1M2RA 2A1AB 5CU4A 5AR2A 4EZ7A 4M69A 5CVFA 3SDJA 5CEPA 2B55A 3MY1A 4X6RA 5LCJA 2BRMA 4QYHA 1JOWB 5BX0A 4KD1A 2VTLA 3AGLA 5E8WA 4BTKA 3FL5A 3PVUA 4QP6A 2O64A 3WIKA 4FTAA 4B8MA 5BVFA 4RWIA 4DHFA 4D1ZA 4ALVA 3NR9A 1BX6A 3PXYA 4M3QA 4V04A 5CVGA 4DFZE 5IPJA 3UO4A 1YVJA 1OBDA 3PP0A 3NVMB 4WG3A 3GCSA 2OJJA 5EI2A 4TWOA 4FG8A 2YITA 2XJ0A 4YJNA 3ZMMA 2HIWA 3HLLA 3EYGA 4DYMA 3H0YA 3PRIA 4MXOA 5TF9A 4ALUA 4EK8A 4BI1A 4AW2A 1AD5A 2V55A 4FTLA 3C4EA 3G0FA 3GXLA 5DT4A 2WMAA 3FLQA 4KSQA 2J0LA 3WF8A 3WIGA 3KY2A 1Q62A 2XH5A 2ETKA 4E93A 1KE8A 4P2KA 1GAGA 3A4OX 1IA9A 4I23A 2GFSA 2JDSA 2OO8X 4LV8A 2IPXA 4PY1A 3POZA 3A7GA 3EQGA 3F69A 4E4NA 2QOCA 4HCVA 4R7HA 1W8CA 5AX3A 3HV6A 2PULA 5HG9A 4BI2A 4OAVB 3BLHA 4G6NA 3VS4A 2C6DA 4A07A 4PPCA 2OICA 4CV9A 5BVNA 2XYNA 4BY9E 1ZYSA 5E90A 1M7NA 3GC7A 2UVZA 3JY0A 4GCJA 2QHMA 4LRKA 3QGYA 4R7IA 4BZNA 2QOOA 1NVRA 3GUBA 4MBIA 5E91A 3VRZA 1XBCA 3WBLA 1XH9A 4C4HA 1WVYA 4MTAA 5A4EA 5CQUA 4YTFA 2XJ2A 4W9XA 2W4KA 2ITNA 5DMZA 1UWJA 1Z57A 1P4OA 1PY5A 1JKTA 1YI6A 4WRSA 3UYTA 2OJIA 3UTOA 3LAUA 1V1KA 5FBOA 1VYZA 4I4EA 3TIYA 2BIKB 3Q96A 5L2QA 1JPAA 5K5NA 4UBAA 2OWBA 4M7IA 5KMKA 3R01A 3ATTA 3ENHA 3QRUA 1M52A 3R8PA 4O7WA 3ORXA 2WAJA 3MGYA 2ERZE 4L3LA 4PMMA 5GZ9A 3U87A 4CT2A 5FG8A 2WU6A 1YXTA 5EW9A 1B38A 4F9YA 3PVWA 4RJ7A 2J9MA 5B7VA 4ZY6A 1M2QA 4TTHB 3UYSA 2G9XA 4JOAA 3EFLA 1H28A 2IZRA 2JEDA 3DAEA 2GS2A 4IE9A 3CPCA 3SHEA 3G5DA 3TZ9A 3RK5A 1RQQA 1HCKA 3VUTA 4NM0A 4QYFA 4CRSA 3WYXA 4IAFA 4BYIA 2PUPA 4B99A 4BDJA 4BCHA 3G33A 5K5XA 4CFUA 5JRSA 5JEBA 1NT2A 3DXQA 3P9JA 4GEOA 4XBRA 4AT3A 5AV2A 3LFCA 3FQHA 2E9VA 2XYUA 3FMNA 3BHHA 3CGOA 4U41A 4BI0A 4RIYA 2C0IA 2C6TA 3CPBA 4IX4A 3CE3A 2IZTA 1T45A 3MBLA 2VGPA 4FKSA 5EHLA 1Y8GA 2X1NA 4JG8A 3OY3A 3JR1A 4V0GA 4YHTA 4Y73A 3GI3A 3OEFX 5ANIA 3CR0A 1AQ1A 4IANA 1JKKA 5E7RA 5E8VA 3GU6A 4W4XA 4KAOA 2ZJWA 3S4QA 3QGWA 5H3QA 1OPKA 3PLAE 3FLSA 3UZTA 1R0EA 2VGOA 4BYJA 1WVXA 2YM7A 2P2IA 1ND4A 4AT4A 3L9LA 2OJ9A 4G6OA 4QMZA 3CD8A 3CTQA 4MXCA 4LGDA 4JBVA 5EDPA 4J52A 2F9GA 2YFXA 5CI6A 3UVQA 4ANSA 4UN0C 4EZ3A 2QR7A 3EQRA 4WSQA 2X7GA 1J91A 2HZNA 2W1CA 3ZBXA 5J9YA 4NT4A 2BKKA 3NMUF 5F20A 2PE0A 5LVNA 2PZPA 4QMMA 4CMOA 4L46A 2GQGA 3TZMA 1O6KA 3D7ZA 1J7UA 5IA2A 3ROYA 3AOXA 4PP7A 3VUIA 5D7AA 2IWIA 2ZM4A 2ERKA 1ZYLA 2HOGA 3CKXA 4ZJVA 5EQPA 4C2VA 1Y8YA 3H3CA 2R4BA 4YSMA 3PZEA 5EG3A 3TJDA 4KINA 2HY0A 5AIRA 3ZXZA 4EH7A 3CIKA 4H58A 4K77A 1URWA 1E9HA 3ITZA 2IW6A 3B2TA 1BKXA 4HYIA 4NTSA 4D58A 1NW1A 3EHAA 3I0OA 5KKRC 2AC5A 4FV8A 4TT7A 5IG1A 3QQHA 4FV3A 4J8NA 1CKJA 4CZTA 4HVHA 1UKIA 2Y4IB 5HCZA 4BZDA 3O2MA 5I0BA 3NYVA 1CM8A 1H01A 2I0VA 3T3VA 4FEVA 4U42A 5J87A 4E7WA 3P5KA 2ZV8A 4WRGA 4JR7A 5EKNA 4RLLA 1SVHA 2GTNA 1UWHA 4CMUA 1YOMA 3G90X 4U0IA 5BYZA 4AWIA 3LOKA 3ZZEA 4Q9SA 2UW8A 1YXSA 2WQNA 3OUNB 3TNHA 4F4PA 4DEHA 5LMKC 5C1QB 3FYJX 4ZS0A 2C6IA 5FDPA 3AC1A 1RJBA 3P4KA 4IX3A 4ACCA 1OVEA 5M06A 4XG7A 5BUJA 4BF2A 3R9RA 4TNDA 4R78A 4FKQA 3V04A 3EFWA 4ZZMA 5M4CA 3F2RA 5GIPE 3A8XA 3FMEA 5AUWA 4ZOGA 3SRVB 1QL6A 4M67A 5CXHA 4UMQA 3R7GA 4I5MA 5EOBA 3W10A 2PUIA 2VWVA 2ETRA 4YZBA 4GYIA 3FMMA 4IC8A 2B54A 5DA3A 4C4IA 4FNYA 4K18A 4AS0A 5IEXA 3V5QA 4R6VA 3LKMA 3UBDA 5KMJA 3WF6A 3PXFA 2UZDA 4CCBA 2CHLA 4Z55A 2GS6A 3C13A 3GCQA 4H3BA 4IW0A 1PXNA 3W8LA 4EEVA 4PMPA 4ITHA 2G2IA 4AAAA 3VO3A 5CALA 1H0WA 2RFSA 3DU8A 4FNZA 2VX3A 5HE1A 1H1QA 4BCFA 2YIRA 3HMOA 5LVLA 3T3UA 4EUTA 3LCSA 3R1NA 2HY81 2YCSA 5AWMA 4ZXTA 4FT3A 2CN8A 3FZ1A 5C9CA 5LCKA 1SZMA 2ITQA 5K4JA 4QTDA 4G16A 4M14A 3JVRA 3QCQA 2O2UA 2J5FA 4J53A 5EW3A 4IACA 2QU6A 4GJ2A 3JXWA 5DFPA 4GSBA 5KBQA 4QD6A 2QO2A 4I20A 5AP6A 3Q2JA 4MKCA 3RZFA 3DTCA 3FC2A 4YTIA 4OUCA 4OTGA 2B4SB 3RTPA 4LOOA 4C2WA 2Q0NA 3EN5A 2BVAA 3OY1A 4UB7A 1WAKA 1W83A 2QOBA 4GG5A 3CJGA 4OT5A 5AR7A 4HW7A 4K8AA 3DQXA 4CYJA 1QPDA 4R1VA 4DEBA 1U54A 3BZ3A 5AADA 3GU4A 2B9JA 4QT1A 1U4DA 3V3VA 4CZUA 5G6VA 4DA5A 1G3NA 1MRVA 4PDSA 3WI6A 2WTCA 4BCMA 5BQ0A 3PVBA 3UOKA 2UV2A 4S30A 4D5HA 2PZRA 4IWPA 4AA5A 5AUYA 3ZO1A 4DG0E 5AAFA 4FSRA 4NFMA 4WD5A 5FLFA 4CTBA 3HGKA 3IDPA 3OW4A 1OGUA 3NUYA 3C4XA 4Y5HA 4FKOA 3ZONA 1XR1A 3RI1A 3MESA 3FKLA 4QYEA 3KMUA 3PA5A 4FGBA 4KKEA 3DK3A 4LG4A 4YJOA 2XVDA 4MD8E 4AGUA 2DWBA 3KVWA 2YACA 4PV0A 4D2PA 4YSJA 2YDIA 1TQPA 3R63A 4NJ3A 4U9AA 2LGCA 3KXZA 4O0SA 2WOTA 4MCVA 2QI8A 4XMOA 4O82A 2HWOA 5TO8A 2X8DA 4NJDA 4BGHA 3HV7A 4FKGA 3NSZA 4PX6A 1W7HA 5DYJA 3G2FA 1A06A 4QMQA 3B8RA 5AP5A 4TN6A 5D11A 3EL8A 5HICA 3I4BA 2WZJA 3Q5ZA 4N6YA 3E8DA 4HVGA 3IQ7A 2R3LA 2XB7A 4ACHA 3FLYA 5D12A 4DEGA 2BKZA 4A4OA 4HYUA 2EUFB 3RNIA 4XP0A 1DAYA 5CXZA 3UOLA 3A62A 3PXZA 1PMEA 3MA3A 4DH3A 4R5SA 3ZUVA 4RIWB 1TKIA 1UNHA 2V5QA 5KUPA 5IA5A 5HBEA 4UMUA 4HVIA 3I1AA 2CMWA 3PXQA 1JSUA 4Z3VA 5CF5A 4DAWA 4IZYA 2WMVA 3PG1A 3CY2A 1FMOE 4IJPA 5HLWA 1ZMVA 1UA2A 3TJCA 5GINE 3NNWA 3IG7A 5AP7A 2ESMA 1Q99A 2Y9QA 4EKLA 5JQ8A 1YQJA 5JH6A 4JNWA 4F0IA 3NUAA 2QODA 4BTJA 4CQGA 2ZM3A 3IONA 3OT8A 3FLZA 4FTQA 4XV2A 3QRIA 3PIXA 2QNJA 3K54A 4IWOA 4MF1A 4MXYA 4NW5A 3WZEA 2B1PA 4XUFA 3SOCA 4GK4A 3BU5A 3GC8A 4MH7A 4J99A 4U6RA 3RHKA 2WO6A 2NRYA 3HMMA 2CDZA 3R22A 3ZLSA 4G9CA 4ANMA 2QOHA 4HVSA 4USDA 5AIKA 4WA9A 3KN5A 2PMLX 2VTIA 2VWXA 3DGKA 2YZAA 4FIIA 4JBPA 4XG8A 4U3ZA 1V0PA 3N9XA 4FT9A 3BU3A 2FVDA 4S33A 4BKYA 4D4YA 2C1BA 3TCPA 2JKKA 1MRYA 3O50A 4L67A 5CEOA 4JRVA 4YLLA 4ZSJA 4FKJA 3U6IA 3R6XA 3MTLA 4O0UA 3IGOA 4W4VA 5BNJA 3ZEWA 4TYGA 4C36A 2VN9A 4O7SA 4U43A 1OL1A 5L6PA 4KRDA 4F09A 2WMRA 2V62A 3OXIA 1LUFA 2IJMA 3LFEA 2DUVA 4IIRA 5IQBA 2R5TA 3R2BA 4CSVA 4ZJJA 1M7QA 3FY0A 4V05A 5EQEA 2P33A 3DY7A 3M11A 1OIQA 2WIPA 4L45A 4MHAA 4A06A 4I92A 2Y4IC 4G3DA 2C69A 2OW3A 4AFEA 3NPCA 2H8HA 1YI4A 3R1QA 3P7CA 5JRQA 2BPMA 4LRJA 5JMSA 2GTMA 5HO8A 1XH6A 4NW6A 1OKVA 2BROA 3PPZA 4QTCA 4RX9A 4O96A 5L6WL 5CX9A 2HZ4A 3C5UA 4C62A 5EM8A 4ZMEA 4GFMA 3QRTA 4YC3A 1UVRA 5TE0A 5L8KA 2E2BA 2JIIA 4LQMA 3QHRA 3VHKA 1A48A 2VX1A 3WF9A 4RC4A 3ZEPA 2OFUA 3PZHA 2BUJA 4CFVA 3OP5A 4Z7HA 3UVPA 2ITWA 3KC3A 3AC3A 4ZTRA 3C0IA 5KZIA 2IVUA 1O9UA 4AGWA 2WTVA 3G0EA 2CKOA 3PP1A 1JSVA 4XS2A 3NUPA 1PW2A 5CLPA 2PUNA 5EYMA 3TDWA 4FUYA 3HUCA 3QKMA 4M0ZA 3TTIA 3SC1A 4CYIA 3LCOA 4J96A 4RC3A 1Q3WA 3F66A 4NM7A 4E73A 3P08A 2J5EA 5A4QA 2GCDA 4RPVA 3EQCA 4LOPA 4DFYA 2F57A 5CSXA 3HV5A 3AMYA 2W1FA 3KXMA 1VZOA 3NEWA 4WBOA 4ANNA 4P5QA 4HGSA 1MQBA 4J1RA 4FSUA 4C4GA 1O6LA 4M15A 2XIXA 1BL7A 2XK8A 5AUUA 4AE9A 3E5AA 4I22A 4FKLA 4WNMA 4AOTA 3TL8A 4EC9A 1U46A 4GW8A 4XRLA 3K3JA 4OTFA 3NUNA 2GNJA 3VAPA 4AP7A 2WELA 2Z8CA 3F3VA 1ZMUA 3MFTA 1WMKA 4GIIA 2JAVA 4LV5A 4NK9A 3NLBA 4WNKA 4MK0A 3VS0A 4EH5A 1V0OA 2BFYA 5IEYA 4L42A 3AD4A 4L68A 4ACDA 5HCYA 4DT8A 2WXVA 2J0MB 3QKKA 4KBKA 4UWCA 2PHKA 3IW8A 5HD7A 3HDMA 3FXXA 3TNQB 2W4JA 2QOQA 4GT5A 3FI4A 5J8IA 4C4EA 3GENA 3Q4UA 3DLZA 5F94A 4ZTSA 3NCGA 3G15A 4DTBA 4XG9A 2CLXA 4APPA 3OWKA 5AMNA 3H0ZA 2WMXA 4NU1A 2XBJA 2VTSA 2QHNA 3CC6A 3UDBA 4A9TA 4UYNA 5M4FA 3D83A 3KA0A 4RVLA 1Q5KA 3F7ZA 3DLSA 4EH8A 2XKCA 3ODZX 1TVOA 2FO0A 2H96A 2OZAA 4IXPA 4LUDA 2W7XA 3N51A 3SA0A 1UU8A 3ZBFA 5CF8A 2XK6A 4RIXA 5AR3A 5ANOA 3P23A 2C68A 2UZUE 4CFNA 2J6MA 5LQFA 4RT7A 5KNJA 4FI1A 4GH2A 4ZMFA 2WTJA 4QP7A 4JDIA 1LEZA 3EQDA 2F7EE 2WTKC 3KRXA 3BIZA 3JPVA 4E3CA 4E5AX 2YN8A 3PE2A 2R7IA 4HZRA 3F2NA 4TY1A 3R9OA 2W5HA 3GCUA 4XG6A 2WD1A 4O84A 4C37A 3KN6A 2RFNA 4JBQA 4X3FB 3D15A 3ORIA 4NKAA 3E63A 4FK3A 3IW4A 1W98A 3KCFA 3AMBA 4B7TA 3MW1A 3IDBA 4OBOA 3VBQA 3VWAA 4EOKA 5HX6A 1XKKA 5BVEA 5D10A 3KL8A 3S00A 4YC6A 4FIFA 3HMPA 4FTIA 4PL3A 4BDFA 2R3IA 2XM9A 3OCBA 4YNOA 5JKGA 2BILB 2JAMA 3PIYA 3LMGA 4IWDA 3AT4A 4F6UA 5E92A 4C4FA 1ZYDA 3NX8A 4D28A 3HV3A 3EQHA 2FGIA 5ANDA 3DNDA 3SD0A 5JQ5A 4FZ6A 2ZDUA 4GUEA 3OVVA 2I1MA 1R3CA 3LW0A 3MFUA 2RL5A 4I6QA 4TWCA 4DF3A 4E5BA 3BV2A 4KUJA 2QURA 4QMUA 3ZO4A 1JKSA 3D5WA 3ZZWA 3CGFA 4LMNA 5H2UA 4RJ6A 4FT0A 4WSYA 4EOJA 4M12A 2X9FA 2VV9A 3SXFA 2WMUA 5KHXA 5HKMA 1IR3A 3RCDA 3ORKA 3KK9A 4XP2A 4LM5A 2RSVA 4CFWA 1GOLA 5I4NA 4OTIA 2Z7SA 3V5TA 4AOJA 4F70A 3QX2A 4M13A 2P4IA 3KREA 2BDJA 4JDJA 4Y46A 3WOWA 5IH6A 3GQLA 3KF4A 1YOJA 3TT0A 4W9WA 3MTFA 3TZ8A 4GIHA 1H0VA 3HA6A 1OL2A 2UZWE 2Y6OA 2ZVAA 5J79A 2VTOA 4PTEA 3ZUUA 2Y7JA 3VBXA 2W9FB 4YLKA 5LVPA 2PPQA 4YLJA 3U4UA 3MDYA 3LJ1A 3LXPA 5T68A 4O6LA 4RBLA 3R28A 3DDPA 2QOKA 5CVHA 3QD4A 2JBPA 3AT3A 4MNFA 2NRUA 4OTWA 4ALWA 4FZAB 4C3PA 3IW7A 4PDOA 2FSTX 3R21A 3O51A 3MJ2A 5ANKA 1Q41A 2HELA 4TKSA 2CLQA 1OL5A 2Z60A 2PYWA 3GU7A 4JQEA 4OBPA 3DTWA 4JRNA 3AG9A 4UALA 3W33A 4DTAA 2XKEA 2BTRA 4AOIA 4RZVA 2VO7A 3NDMA 5IU2A 4FX3A 3WYYA 2QOLA 2JDOA 2C5YA 4QNYA 3E62A 3BQCA 4S31A 5FXSA 4QMYA 4NSTA 5FUTA 2YISA 5EYCA 4X7QA 2Y0AA 4O38A 2XNGA 3VF9A 5A6NA 4ENYA 1GIIA 2CKQA 1SM2A 4E4XA 2QONA 4DH5A 4QP8A 3MPTA 3PVGA 2C5XA 4AFJA 4F9BA 3C50A 4XYFA 4IWQA 4UY9A 1DS5A 1XQZA 3BYOA 4E4MA 1YWNA 5CY3A 2X2MA 5HD4A 3OT3A 3F3WA 4ZEGA 1KE5A 5K9IA 4PNKA 2IO6A 2Z7RA 3ZXTA 5FP6A 4G1WA 5BVKA 5AJQA 4QMPA 4BCQA 4GKIA 4ZP5A 4W8EA 5D41A 4A9RA 3R8VA 4LI5A 2J2IB 4BRXA 3VNTA 3SG9A 4LGGA 5DT3A 4NCTC 3V6SA 3QTZA 5FEQA 2B9HA 3D7TB 4KIKA 3JY9A 5IQAA 3QCXA 2FB8A 3RK7A 4KIOA 2ZV9A 4YJVA 2EXCX 2E9PA 2YM4A 3Q60A 4OTQA 3EL7A 2XK9A 4LL5A 2GDOA 2W05A 3AC8A 1Z5MA 2ITPA 4Y83A 1M17A 3NCZA 2YCQA 3PA4A 3U4WA 3R8MA 1TQMA 4U7ZA 2W17A 3HX4A 1PMVA 3I6UA 2X6EA 5DRDA 4DG2E 2Q83A 2JDRA 3QQLA 3EJ1A 2QLUA 3I5NA 3KXGA 3IOPA 3SVVA 3BLQA 4BDCA 1R1WA 5C4LA 4FTUA 3FHRA 3OZ6A 4W4WA 4F99A 1NVQA 4MQ1A 5A14A 5L3AA 2UW3A 4XG4A 4DFUA 3QFVA 3U6HA 3QTWA 2GHGA 2PVRA 3RMFA 4LGHA 4YHJA 4A4XA 3Q04A 1FVRA 2EXEA 3GB2A 2Q0BA 3LJ2A 4YZ9A 4MEDA 2XKFA 4MXZA 4FUXA 5DEYA 3P0MA 2ZYBA 2GQSA 4H3PA 4RVTA 5CSPA 3IW5A 3L8VA 2CNVA 3DDQA 4XOYA 4CLJA 2XIYA 3AQVA 4CVAA 2W9ZB 4KKGA 4QMLA 1YKRA 2YEXA 3R04A 3VIDA 4EK6A 5J95A 3HAMA 3S1HA 2JKQA 3UE4A 4BC6A 3PSCA 4IVCA 4O2PA 3VULA 4BDDA 4TL0A 5I3RA 3MY5A 1QMZA 3BELA 4JIAA 5ETCA 4KBAA 5CYIA 3ZSGA 5KMIA 3ZTXA 3UPZA 2YM3A 3MFRA 3O8TA 5JGDA 3PUPA 1V0BA 2PE2A 4M8TA 1URCA 3UG2A 5C01A 3PXRA 4XOZA 3DZQA 5IA1A 3Q5IA 3ORTA 4RVMA 5CAVA 3EN6A 3QX4A 4UMTA 3NS9A 4CTCA 1WBTA 1R78A 2H9VA 4HGEA 4IJ9A 4RGJA 1Q8WA 3M1SA 2UW9A 2YIQA 3OG7A 3JUHA 5IDNA 2WMTA 4IM3A 3TUBA 4WKQA 4YR8A 3Q53A 4BWPA 4AZWA 4NL0A 4K6ZA 4ZIMA 2VTNA 3KF7A 1PXIA 2XNMA 2F49A 3RK9A 2BR1A 1FVVA 5E8SA 1CMKE 2UUEA 3ENMA 3KVXA 3VUMA 4II5A 5FP5A 3TEIA 1ZYJA 2BAQA 2ETMA 2P0CA 4PPBA 2DQ7X 2PVKA 3BU6A 3D5VA 4JAJA 4X3FC 4DEDA 3F9NA 4L8MA 5AV4A 4XBUA 5HVYA 1XBAA 3ACJA 5FTOA 3BYUA 4BCKA 4TPTA 1OL7A 4DINA 4D2TA 4X2JA 4UMRA 4EH9A 2Y6MA 2EB3A 4FEXA 2I7QA 4QMOA 4GK3A 4C38A 2BDFA 3S95A 2UZVA 1IAHA 2PVMA 4O0RA 3S2PA 4BCJA 4R3RA 2A4LA 3P78A 1YWRA 4CXAA 3LFAA 2XK7A 4RWKA 5L8JA 3MV5A 2RFEA 4DEAA 4WUNA 3D2IA 1SVEA 5ETIA 3CBLA 4KIQA 2V7OA 1T46A 2GNGA 5CEQA 4G2FA 4AZEA 2UW6A 5DT0A 5BMSA 4JS8A 3D94A 4S2ZA 3HRBA 3GCVA 3NUXA 3TKUA 4EK3A 3DBDA 4CFXA 4O91A 4RA5A 4OLIA 1TQIA 1P2AA 4YNEA 4FT5A 3CXWA 2Z7QA 3UMWA 4C33A 2I0HA 3CKWA 4QQCA 4EI4A 4YURA 5I5ZA 3HP2A 5BYLA 2J4ZA 1PXMA 2ONLC 4GRBA 4MWHA 4EHEA 5AA9A 2JLDA 2IVTA 4EOMA 1UV5A 2JC6A 3BGPA 1ZY4A 4A9UA 4NKSA 3E93A 4QTAA 1XHAA 2HXLA 3F5PA 3PJ2A 4UXQA 4E8AA 3RGFA 1NXKA 2BMCA 5FEDA 3TNIA 2EWAA 4DFNA 5HQ0A 2R3NA 3DV3A 2OZOA 3ZS5A 3L8PA 3BWJA 4AQCA 2R2PA 2NP8A 5M4UA 3WILA 2XZSA 2REIA 2YABA 3DOGA 3VQHA 4E6QA 3Q6WA 3ZUTA 5CAUA 4O0XA 4ERKA 2JGZA 3LFNA 3ZLXA 1RW8A 2XEZA 4HGLA 1SVGA 3LM5A 4QRCA 1PXLA 4QP9A 3ZH8A 3ELJA 4BHZA 3H4JA 3L9NA 4DGOA 4ZLOA 2G15A 4IM0A 2G01A 3RAHA 3UO6A 4CMTA 4I0SA 3KCKA 5JK3A 2AYPA 3R0TA 5DNRA 4BN1A 2X81A 3C7QA 4IVAA 4FIGA 2JFMA 5HIBA 4HYSA 2OFVA 4RX8A 3FJQE 3AD5A 1BI7A 4DCAA 2QOIA 5HBHA 4BTMA 2ITYA 2GFCA 3GC9A 3EWHA 4MNEB 4EYJA 5IQFA 3BRBA 2VTPA 5EM6A 4FVPA 5DBXA 4F6WA 4F1MA 2ZMDA 1M14A 3D9VA 5LXMA 3EZVA 4G3CA 3RPSA 3PSDA 2PVYA 4RJ4A 5BYYA 3R8ZA 3MA6A 2C3JA 2JD5A 3GGFA 2PVLA 4MVFA 1NA7A 3DBCA 3FWQA 3QU0A 2XNBA 2J7TA 3KGAA 2O0UA 4MXAA 4NIFA 2W1DA 4BKJA 4KA3A 5JN2A 1HOWA 3L9PA 4IAZA 4OTPA 4I21A 4MQ2A 1GZOA 3TTJA 3FC1X 3KRJA 4O1PA 2O8YA 3W1FA 2C0TA 4YJPA 5ICPA 4JIKA 3UOJA 2OXDA 4CFMA 2WTIA 1H1RA 2UW4A 5L4QA 3H9RA 5IQCA 3DB8A 4FV6A 5JT2A 3ZM9A 4EC8A 2VTAA 4WO5A 4IAAA 3HVCA 4AN2A 4D1SA 4EZ5A 3E8EA 2B0QA 2YIWA 3VS2A 1IEPA 2XP2A 4MX9A 4O6EA 4EKKA 5KO1A 2YCRA 1CTPE 3DZOA 3ETAA 4I0RA 3FBVA 3VVHA 2IW8A 3F82A 4FTOA 4XG3A 3AMAA 3P86A 4M69B 1B39A 3KK8A 2RGPA 4RFMA 5AP2A 4L6QA 2V0DA 2WTWA 5G1XA 3ODYX 1K3AA 3R2YA 3FUPA 4TYHA 2E9UA 3RCJA 4LL0A 1YI3A 4CGAA 4D2SA 2UVYA 2YM6A 3EFKA 4TYEA 3BYVA 5EK7A 1PYXA 1Y57A 3GP0A 3ID6C 3LMHA 1JBPE 1OMWA 3OBGA 4G5PA 3IS5A 4JI9A 3KRWA 4D5KA 5E4HA 3ORNA 3HAVA 5A4LA 3RZBA 4CLIA 4QYYA 3ZSIA 4Z7GA 1GIJA 3GU5A 3ORPA 1FINA 4EBVA 1Q8TA 1Q61A 3Q9YA 4PDPA 4BDHA 3TUCA 5J1WA 2GSFA 4F08A 3CQEA 1FOTA 4FA2A 2W1HA 3KEXA 3NIEA 4OBQA 4U5JA 3NUUA 1OM1A 1Y91A 3TIZA 2EVAA 5CU0A 1OBGA 1YXUA 5FEEA 5IEVA 2F7ZE 3ORLA 1H00A 5HNBA 4PQNA 4FL2A 4PWNA 4WBBB 1XH4A 4H05A 3THBA 5CTPA 1FGIA 1PMUA 2X4FA 3WF7A 2OG8A 4IZAA 2W1GA 1OIYA 3BLRA 4HNIA 4S32A 4B9DA 2F7XE 3P7BA 3UQGA 4XRJA 2C6EA 4A9YA 4I41A 4OT6A 5EOLA 3V6RA 4RX5A 4C8BA 3FYKX 1GZ8A 1VEBA 3DJ5A 2VWUA 2F4JA 3FQSA 4Y8DA 3NYXA 3BYMA 1FGKA 2DYLA 5AUTA 5LJJA 2VD5A 4FEUA 5GJGA 4CKJA 2ITTA 2ONLA 4TYIA 2VAGA 3UVRA 3ZRKA 1OIUA 4EWHA 4D9UA 2WHBA 5HI2A 5ANGA 3A7FA 4FNXA 4L52A 3E87A 4BR3A 3G9NA 3MI9A 5GHVA 5HG5A 5I9YA 3D4QA 3KMMA 3O8UA 5AAEA 2QKRA 4A9SA 4TRLA 5AA8A 4C59A 4GJ3A 3SLSA 4EONA 1W84A 4GT3A 3KULA 3OC1A 4H1MA 4EOOA 4M68A 4J71A 4B6LA 4EHGA 4JDKA 3UODA 4PMSA 2XK3A 3ZRMA 4XH6A 2YLEA 4EL9A 3LFDA 4FKUA 2WMBA 3DKFA 2ITUA 5HG7A 2XRUA 3OCTA 3LQ5A 4RJ8A 3TXOA 4FTCA 3NWWA 2X2KA 4L53A 2XMYA 5LMKA 5IQEA 2R3PA 5E8YA 4BCOA 4IB5A 4B4LA 2WB8A 4X0MA 3HNGA 3FDNA 3OEZA 4XLIA 3VC4A 3OHTA 3GOKA 5HTIA 4O7NA 2VX0A 1IAJA 3NVKI 4XCUA 3FEGA 1X8BA 3QC9A 4RFYA 4TXCA 5D9HA 3QUPA 4I5HA 4IB1A 4RA4A 1AGWA 3F5UA 1G5SA 2JFLA 4YPSA 2ITOA 3R7IA 3UNZA 2Y4PA 4FEQA 3GU8A 4YJRA 2C5NA 2QOFA 1H1SA 4RIYB 5DR2A 2CKPA 5FTGA 3UIBA 5KZ0A 4XG2A 4R3CA 2YZLA 2VUWA 2C6LA 5B0XA 1WCCA 1H24A 3UOHA 3R7YA 4P5ZA 4V0GB 4EOSA 2X7OA 4I5CA 3Q9XA 2PU8A 3U55A 2AUHA 3UNJA 3HYHA 5FTQA 5H8BA 4F0FA 1H1PA 3H9FA 1H8FA 3D14A 5E1SA 2WPAA 2FYSA 1WBOA 4OTRA 3A61A 4F63A 5EKOA 5B2KA 2IG7A 2WNTA 3LFBA 4Q2AA 4JG7A 4QP1A 2I6LA 2NNWB 3A4PA 1H27A 4MBJA 4XV3A 4OW8A 1H1WA 3MS9A 2CSNA 3L8XA 3OS3A 3O17A 1PXPA 4IB3A 2XIRA 4WHZA 5DLSA 4EH3A 3SGCA 4NZWB 4EOIA 4AN9A 5IH4A 5I9WA 3MWUA 4IFCA 2GS7A 2C0OA 4UV0A 4YP8A 3QQKA 4CT1A 4W4YA 4X2GA 4YZMA 3NYNA 2PWLA 3BKBA 1KV1A 2R3RA 4TWPA 4IAIA 5HZNA 3PIZA 3HKOA 2JKMA 3E3PA 4EBWA 4JLCA 4R1YA 4EOQA 1J7IA 4BFMA 2PSQA 2VO0A 4GU6A 4K2RA 4UXLA 3UP7A 4Z16A 3FY2A 4H39A 2B53A 4FKPA 4AZFA 3IECA 4ZSGA 3SXRA 5JFXA 1WFCA 2YERA 5AX9A 4ZZOA 4YZDA 2WGJA 4OTHA 3NRMA 4YJQA 2W5AA 4N70A 5T3QA 5HU3A 3K5VA 3KB7A 3V51A 2WMSA 4BL1A 2OJFE 3H30A 5HEZA 3LFQA 5JGAA 3M42A 5DVRA 4R7BA 3EKKA 3BQRA 1CDKA 3F3TA 2I40A 4X2FA 3COHA 2PE1A 4BIEA 1WBNA 1REJA 3LPBA 3TNWA 2KULA 4IQ6A 2R3KA 4YTHA 3ZO2A 4FT7A 2WQBA 4FC0A 1ERKA 3EN4A 3LZBA 4FVQA 3V5PA 3K3IA 4O1OA 4BDBA 1F0QA 3EH9A 3QD2B 5IUGA 5L2SA 5CAPA 2O63A 3MVHA 3MH3A 4RZWA 5EI6A 5TT7A 5L2WA 3I5ZA 3G6GA 2AC3A 5CU6A 3F5XA 3TG1A 2OH0E 3P7AA 4IB0A 2A2AA 3V8SA 4KKHA 4L3JA 3DQWA 3VUKA 4DGLC 2VWYA 3OF0A 3OMVA 2NPQA 3LHJA 3RJCA 3LQ8A 3TKHA 5JFVA 2PL0A 1KWPA 3W8QA 5C4KA 1ZOHA 5J5TA 2CCHA 5F9EA 2UVXA 2FH9A 4Y85A 2C3LA 3BHUA 3R9HA 3KMWA 3QUDA 3MSSA 4ITIA 4G34A 1GIHA 2QVSE 2VTJA 1L3RE 2YWPA 4U44A 3IKAA 5CS6A 1ATPE 4JX7A 1I44A 1U5QA 4AA0A 3BE9A 1GNGA 2YIYA 3OOGA 4DLJA 3QQJA 4DC2A 5H9BA 2UZBA 2R64A 4L7SA
chains in the Genus database with same CATH superfamily
3LIJA 4FR4A 3O96A 2R9SA 4L3PA 5HE3A 4FV7A 1J1CA 4N6ZA 2UW0A 2XK4A 1XJDA 5IQIA 3HV4A 4FKWA 4U40A 4ZTMA 3ZRLA 4FSNA 3RP9A 4YZNA 4ZTQA 5IQGA 3DBEA 3GVUA 3F2AA 4G3FA 3D2KA 3QRJA 3FSFA 1XO2B 3F7WA 2UZLA 1YHSA 3WARA 2YDKA 3BGZA 3U54A 4QP3A 3U9CA 4FE2A 3RNYA 4F9AA 5M07A 2C3KA 2X8EA 3Q2MA 4GFOA 3I0QA 3DKCA 3UPXA 5CNNA 5H8EA 2OI4X 1Z9XA 5KMOA 2PK9A 4GS6A 4MXXA 4Y5QA 3MYGA 1FMKA 4ANQA 4QTEA 2FA2A 4H3QA 2BRNA 2V7AA 3EIDA 5AUVA 5HCXA 3R9NA 5IMXA 2ZV2A 2UZTA 3FI8A 1YXVA 1A9UA 3ORZA 4RQVA 4CZYB 4ZK5A 3SX9A 4QPAA 2VWWA 3FMKA 4ASXA 3C9WA 4APCA 3FZRA 4FNWA 1U54B 4EH4A 4DH7A 1H4LA 4GT4A 4FIHA 3IGGA 4Q5EA 4BDKA 1OKZA 4HYHA 1ZARA 4FTKA 5CF6A 5M57A 2PMOX 2UZOA 4FV4A 4KIPA 1E1XA 4L43A 2Z7LA 5HLNA 1TFFA 4K33A 4DFXE 4X2KA 2W1ZA 2B52A 3HMIA 5L8LA 4BIBA 4EK5A 4BJJB 4IADA 4ZJIA 3BWFA 3TM0A 4ASEA 1MRUA 4I6FA 2C6OA 2YDJA 4FODA 5CT7A 5HESA 1DM2A 2PMNX 2QO7A 5ETFA 4CRLA 4IAYA 3K2LA 4XNEA 3VUHA 1PJKA 4FYOA 4RX7A 4JXFA 3MH0A 4DG3E 4DFLA 2OIBA 2DS1A 2PY3A 4DEIA 2XRWA 3OWLA 2PUUA 5CT0A 1Q97A 3F3ZA 3TI1A 3W32A 4DE4A 3KXNA 4NWMA 4YBJA 3W2RA 4QMVA 3TKIA 4AN3A 3QCSA 4Q5HA 5EDQA 4BGQA 3BHVA 3OWPA 5M53A 3MJ1A 3FKNA 3I6WA 4IH8A 1SYKA 2FSMX 3FAAA 1UU9A 2P2HA 4J8MA 4UMPA 2ITVA 2XCHA 3E8CA 5AUXA 3EYHA 3OCSA 4D1XA 2SRCA 3LFFA 4MD7E 4FK6A 3ZM4A 2BHHA 2G2FA 4GG7A 4H1JA 3KU2A 4RFZA 4GMYA 3SRVA 3FMLA 3EQIA 2UW5A 2QU5A 3IK3A 4PUZA 4PDYA 4YJUA 3HUBA 3QL8A 2X7FA 1VJYA 2OSCA 5IF1A 4TYJA 3VW8A 1WBPA 4IC7A 4GVAA 1PKDA 3D5XA 4YU2A 5KHWA 4RWJA 2QG7A 4F1OA 2OF2A 3H10A 4XLVA 2XA4A 1JAMA 4ORKA 2QC6A 2RG5A 3G51A 4G5JA 2IZSA 1O6YA 4JDHA 4G3GA 4NEUA 1YDTE 1OZ1A 2C5VA 5CZHA 2R3MA 5EYDA 1JKLA 4D9TA 2F2UA 2CPKE 1OL6A 2UZEA 5CI7A 3LXKA 5K3YA 4YMJA 4AW1A 5LWNA 5HO7A 4BCIA 3DBQA 3DB6A 4FOBA 3VBWA 4CG9A 1ZLTA 1YOLA 1RDQE 2J90A 3ZDUA 3AC5A 2JDVA 1OUKA 3QQUA 3MPMA 4ANBA 2WTDA 3MH2A 5DN3A 1KV2A 4RQKA 2AEGA 4EORA 1P14A 2WMQA 3COKA 3PTGA 5C03A 5ACBC 1WVWA 5E8TA 4PPAA 2O65A 3HEGA 4M84A 2VTTA 5K0XA 4FZ7A 3WF5A 5HTBA 3QRKA 1REKA 3DFAA 4AG8A 3QC4A 4QMWA 3PSBA 3MVLA 5CZIA 5GZAA 4IZ5A 2NO3A 3QAME 3R71A 1R39A 3GNIB 5EM5A 3ZHPC 4EHVA 3DPKA 4JBOA 3NAXA 3COMA 1E1VA 3QWKA 5AP3A 3E8NA 5HHWA 5FXQA 2YM8A 1OITA 5JFWA 4O0YA 4YHFA 1YDRE 3RINA 5CU2A 5L6OA 4L7FA 4EH2A 3DAKA 3Q3BA 3RPRA 3QUEA 5AP4A 5HVKA 3DK7A 3SXSA 2BDWA 2HCKA 2YAKA 4HPTE 2VWIA 3GFEA 2QCSA 5DHJA 3I79A 2FUMA 1K2PA 3LCDA 4DGGA 4QEBA 3MN3A 2YM5A 5HE0A 1VLRA 2B9FA 4B0GA 3BI6A 2BAJA 2R3FA 1PXOA 2P55A 2A27A 3BEGA 2WQOA 3SW7A 1MQ4A 3FZTA 3W0QA 3QWJA 4IVBA 2VWZA 4QMTA 1PMNA 1W2DA 2ZB0A 5A54A 2GQRA 5FXRA 4ZS4A 3E3BX 3OXTA 2CGWA 4BBEA 3C5IA 3QYWA 3C4ZA 5CEIA 4HVDA 2QLQA 1SNUA 2W99B 1LR4A 2CJMA 3C51A 3ORMA 4XEYA 3RPVA 3ZFYA 4D55A 1G8SA 2F2CB 1XBBA 3R1SA 1IRKA 2G1TA 3I60A 4MF0A 1H08A 2QG5A 3TZ7A 1BUHA 3D5UA 4LYNA 3NZ0A 3JVSA 1YHVA 4FTRA 3ZSHA 2QQ7A 4RJ3A 5IA4A 3FQEA 3OD6X 4A4LA 4E26A 2XIKA 1F5QA 4RMZA 1GZKA 4RIWA 4J97A 3VS1A 2R3OA 2XANA 4U81A 4OR5A 3VF8A 4S34A 5J7BA 4UX9A 3AKJA 4WNPA 5M56A 2OBJA 4FMQA 1ZZ2A 2ZMCA 4O22A 2VRXA 2VTHA 1BI8A 4O7TA 2JBOA 4AZSA 1VR2A 3ROCA 5CAQA 5LWMA 3GCPA 3SW4A 4FV0A 5KX8A 3FSKA 4BB4A 2HXQA 5JZNA 1FPUA 3UNKA 4JJRA 3VN9A 1ZWSA 2PZ5A 4EQCA 4I93A 5ITAA 5HU9A 4YPDA 4EK4A 4L9IA 1PF8A 4IHPA 4MWIA 4AACA 3QA0A 4KSPA 2CCIA 2I0YA 1R0PA 3C1XA 3BYSA 4HZSA 4AGCA 2J0JA 3PUFC 4DGMA 1F3MC 3BV3A 3W16A 4HPUE 4U45A 5IQHA 3GEQA 3UC4A 4D2RA 4ZY5A 2XKDA 3NW7A 4O0TA 4QQTA 3L8SA 4F6SA 3BCEA 5TR6A 1QPEA 3QQGA 4TWNA 3RPOA 3RAIA 3IPHA 5BV3A 1JLUE 4FIEA 4FKTA 4V01A 3TV7A 4F7JA 5IA0A 3W2CA 5JFSA 4JQ7A 4WG5A 2GU8A 3UO5A 2OXYA 3U6JA 4JT3A 3AC4A 2OZAB 2ITZA 3QTIA 5CEKA 2CGUA 3A7HA 4PNIA 5FM2A 4C58A 3V5LA 2EB2A 3DXPA 2C3IB 4RIXB 3RWPA 2BRBA 3PA3A 3WE4A 5EW8A 3E7VA 4C3FA 4K9YA 1IA8A 2XBAA 2YIXA 3VBYA 4USEA 4U8ZA 2FSOX 3R7UA 5C27A 4FICA 2GNHA 3UIXA 5IMEA 1LPUA 3HA8A 3HDNA 5E8UA 4ZTNA 5I9XA 3NIZA 4J95A 3T8OA 4I4FA 3CJFA 2VU3A 5HX8A 3V8WA 3S0OA 4GYGA 4C4JA 1UNGA 5DE2A 5AFVA 4DLIA 3Q4TA 3N4UA 5GJDA 4C34A 5LVOA 2XIZA 4O2ZA 3CQWA 5HE2A 5IKWA 5CU3A 4BZOA 1J7LA 2A0CX 3MIYA 4DEEA 1XH7A 2IZUA 3KRLA 4F7NA 1L8TA 3TDVA 1OIRA 3NNVA 4WT6A 4O7YA 3HRCA 3QTRA 1HCLA 4UZHA 2B9IA 2XJ1A 5KMMA 3QLFA 4KB8A 3TYKA 4O0VA 2XUUA 4NCTA 3UG1A 5K4IA 2VO3A 3PE1A 1CSNA 4O21A 4KS8A 3DFCB 3QYZA 5CASA 3SG8A 2EXMA 4BCGA 4C35A 1MUOA 4IEBA 4D0XA 3P5JC 5KBRA 5FRIA 2C6KA 4DT9A 3JYAA 3OROA 3UC3A 4AZTA 4BKZA 5HLPA 4FIJA 2CGXA 4LRMA 2ACXA 3EB0A 5F1ZA 3RPYA 4HJOA 3VW6A 4XJ0A 3UMXA 4D2WA 4E6DA 5H8GA 4D4VA 5I9VA 4ASZA 1UU7A 4FVRA 5E1EA 1ZYCA 3RM6A 3QTSA 4GU9A 5M44A 3Q9WA 1Q8YA 5HG8A 3KQ7A 4FV5A 4YJSA 3NGAA 4BBMA 1Q3DA 3R7EA 5JGBA 3FI2A 3MVJA 3PPKA 4JVGA 4YGAA 3PY0A 2H6DA 2VTRA 5L2IA 3LLTA 3O7LB 1DI9A 1ZY5A 3A2CA 4YUQA 2PVNA 2BZJA 2BRHA 5AM7A 4GKHA 3QTXA 3P79A 2OJGA 3MY0A 5HO6A 4ZY4A 3PPJA 4EWQA 5B2LA 3R73A 4M0YA 1KUTA 4KBCA 4U80A 3L1SA 1XH8A 5DWRA 4ZSLA 1JQHA 4AU8A 5AR8A 3HZTA 4HOKA 4PL4A 3TWJA 2X8IA 1Y6AA 4LUEA 4ZSAA 2J50A 4AF3A 5DRBA 2WOUA 4JQ8A 2EU9A 4D4RA 3TN8A 2WQEA 3VS3A 5B2MA 3WZDA 3SOAA 2YAAA 1JSTA 1Y6BA 3RVGA 3NFFB 5CSVA 3QKLA 4K1BA 5CQWA 5E8ZA 3IDCA 3M2WA 4UWYA 5EH0A 4FF8A 5BUEA 3QZGA 2YWVA 4FZFB 5F4NA 2YJRA 2ZM1A 4CKRA 2J51A 2W0JA 4FTMA 4OGRA 3U8WA 3BL7A 2X0GA 1S9IA 1U59A 4JR3A 1DI8A 3UZPA 5C8NA 1PKGA 4L00A 3K5UA 3ATSA 4ITJA 4J7BA 4FV2A 1ZOGA 2R3GA 2OK1A 2X39A 4FYNA 4I0TA 5IDPA 4G17A 5E8XA 4DBXA 3EFJA 4XX9A 5FQDC 3FMDA 3U9NA 2OH4A 3F6XA 2QO9A 5CENA 2E9OA 3WE8A 3A7IA 2BHEA 3QQFA 4RVKA 1FBNA 3QTUA 3GOPA 2C1AA 4NM3A 5M55A 3AGMA 1P4FA 3A8WA 2ZV7A 3QZIA 2XCKA 3EQFA 3ERKA 3R30A 4GUBA 5C26A 1OUYA 4K0YA 3SKCA 3O8PA 2PZIA 3LCKA 5GNKA 3R8UA 3ZLYA 4YO4A 5CANA 5A9UA 4DHIB 4JX3A 4HGTA 4BWKA 2W5BA 2OGVA 3BBTB 3EQPA 2GHMA 3RM7A 3R8LA 2GNFA 5A46A 3F88A 3OFMA 4QPSA 2HZ0A 4O7RA 4J98A 5J7HA 5IISA 3QZHA 4RSSA 3ZFXA 3SV0A 1BL6A 1RE8A 2W1IA 4HCTA 5AM6A 3EQBA 4QYGA 1UKHA 2QD9A 2CKEA 2VNWA 4ACGA 4X3FA 4F64A 3HRFA 4AGDA 1OPJA 2CGVA 2R3QA 2X9EA 2VTMA 5I9UA 2ITXA 4B8LA 3I7BA 4X2NA 1STCE 2BZHB 4MD9E 2C5OA 3V5JA 3KRRA 4O83A 4KIKB 2ZFYA 2O5KA 3LJ0A 3LXLA 1I09A 5CSHA 4F1TA 1CKPA 1LEWA 3O0GA 2GNIA 4E1ZA 1PYEA 4U3YA 3PWYA 4FGRA 5HBJA 3PDTA 1Q4LA 1WBWA 2QR8A 2YLFA 4QMXA 5ANEA 3Q4ZA 4N57A 3W18A 4I6LA 1DAWA 5IA3A 5ETAA 4WG4A 3E88A 3LQ3A 4L44A 3ALNA 3DAJA 2JIVA 1OI9A 4EHZA 3UP2A 4Z9LA 1APME 3ZLWA 3EN9A 4I6HA 4FG7A 4GK2A 5J5SA 4FSWA 4DTKA 2WTKB 2XF0A 2QKWB 1BYGA 2PVJA 2R3JA 4C3RA 4QNAA 4H36A 3DNEA 4QTBA 3ALOA 4R8QA 3EZRA 4P4CA 4BCNA 3TACA 3LMIA 5DR6A 4AE6A 3OUKA 1H07A 4M97A 2VO6A 5HTCA 4CG8A 5ACKA 3NUSA 4I5PA 3CCNA 2HZIA 3VHEA 3W2PA 3G9LX 2CNUA 3MFSA 4PP9A 5DPVA 4IM2A 5FWKK 4DH1A 4RRVA 3MB7A 2RIOA 5DH3A 3O5AA 2W4OA 4HCUA 5FD2A 3GT8A 5FGKA 4FSZA 3Q52A 3QHWA 4EJ7A 3POOA 4UWBA 5IUIA 4WIHA 3GC0A 3E64A 3CP9A 1S9JA 2C30A 1J1BA 3NAYA 4FSTA 4FSQA 3LLAA 3NW5A 2FSLX 1LP4A 3VS6A 1W82A 1WZYA 3SAYA 4CQEA 5HGIA 4O7ZA 2IN6A 2OKRA 3OTUA 3T9IA 4C57A 4ACMA 4IVDA 5DG5A 4U97A 4DH8A 4IDVA 3KKVA 5AP0A 2ZOQA 3VS5A 5JSMA 3REPA 2WEVA 2BRGA 5EM7A 3TV4A 4AZVA 4G3EA 3ACKA 5KMLA 3COIA 3QLGA 4P90A 5DR9A 5D1JA 3FZOA 4AW0A 1U5RA 3G6HA 2XS0A 4WOVA 4E6AA 5LMBA 3LE6A 3DKGA 4QMNA 4ZTLA 3CEKA 2ZAZA 3S3IA 5KMNA 2UZNA 2O3PA 3A99A 3B8QA 3CTHA 5LARA 1XWSA 3VUDA 4DN5A 3Q9ZA 5HVJA 3O23A 4RWLA 2BCJA 1Q8UA 3DJ7A 5FM3A 3ZC6A 4F7SA 3NNXA 4ANLA 4D4SA 2G2HA 3CD3A 3OXZA 3BX5A 3QXOA 2H34A 3QCYA 4YC8A 4ZTHA 5C8MA 3V01A 1ST0A 1GJOA 2A98A 3HMNA 5DGZA 2P3GX 3UDTA 2BZIB 4IBMA 3OTVA 5AR5A 5M51A 3ZOSA 2HW7A 4C7TA 3F61A 3FZSA 4E6CA 4CNHA 2IW9A 2WKMA 3FE3A 3AXWA 4P7EA 4ZZNA 2BFXA 4PL5A 4XP3A 4USFA 2PTKA 4G9RA 5F95A 3NW6A 2PZYA 3AC2A 2OU7A 1Q24A 4FRFA 2RFDA 3F5GA 4BDIA 1H26A 1OECA 2YA9A 4FG9A 4FTTA 2W06A 5EDRA 4ZSEA 3RKBA 3NYOA 5EYKA 3D7TA 4X6QC 4IAKA 5EI8A 4BICA 2WQMA 5FBNC 1CKIA 2GHLA 2ZDTA 3B2WA 3QBNA 4LFIA 4O7LA 1KOBA 1QPJA 3PWDA 4AXAA 1YHWA 1KE7A 4JL9A 1UU3A 4AX8A 3BPRA 2JDTA 4MBLA 3R9DA 4AXDA 3PYYA 3R7VA 4CFFA 3PLSA 4AW5A 2OIQA 4BDAA 2BIYA 3DKOA 3JS2A 4HNFA 4BHNA 2B7AA 1ZXEA 3R83A 2V22A 2BALA 4RC2A 5EHOA 4CCUA 3UIUA 3ZYAA 1JVPP 4BGGA 5BPYA 1WBVA 1YWVA 2UW7A 2W96B 3LVPA 4KNBA 2HW6A 1P5EA 2OF4A 2R3HA 3O71A 4NYEA 3V5WA 4LOQA 4ASDA 3UQCA 1KE6A 4AT5A 2Z02A 4DHZA 4DHJA 3DA6A 4E4LA 3TUDA 3TNPC 3BHTA 5LOHA 4GVJA 1IG1A 5GJFA 2WIHA 1ZAOA 5HIDA 4FV1A 1QPCA 2VWBA 4X3JA 4MAOA 3FPQA 5HNGA 3BGQA 3UIMA 2J0KA 3P1AA 3VUGA 2C4GA 4XV9A 5DIAA 3W0PA 4YZCA 4I1ZA 4UZDA 2AQXA 5CSWA 3RBWA 3W2SA 1J3HA 4PRJA 5LMAA 3AT2A 3E7OA 3Q4CA 4DITA 4X21A 3R7OA 4BVUA 1OKYA 3AKLA 5TKDA 4QQ5A 5BVWA 3TV6A 1W2FA 3AD6A 5LVMA 2X4ZA 4XHKB 3I7CA 4DGNA 2Z2WA 2A19B 3DBFA 4D0WA 4WUAA 1OKWA 3UJGA 3FKOA 3C4WA 3ANQA 4FTNA 4IDTA 1OB3A 5M08A 2HWPA 5AAGA 4M66A 5A3XA 5BVDA 4O81A 3RALA 4F65A 3MVMA 5L2TA 3N4VA 4RLKA 4O0WA 5EQYA 4ARKA 4XV1A 4F0GA 3RAWA 2JIUA 3VBVA 1UNLA 5DEWA 1VYWA 3KXXA 4FTJA 5TOZA 4ZLZA 4ZLYA 3VQUA 3MIAA 2XNOA 3DT1A 5AP1A 3BEAA 2Y8OA 3FHIA 3PY1A 3MH1A 5AV0A 3ZU7A 1OGYA 4I24A 3QF9A 5A4TA 3FXZA 1G8JA 3OCGA 2KTYA 1ZRZA 4CEGA 3PRFA 5CEMA 4BDEA 5M4IA 4IZ7A 1BLXA 4QP2A 2RG6A 1BMKA 1IASA 3O7LD 1ZOEA 3D0EA 4NUSA 4UEUA 2XNEA 5J1VA 2WEIA 3EMGA 4EH6A 3OOMA 4CV8A 4E5WA 3UGCA 3W2QA 3VJNA 4D2VA 3EKNA 4FJVA 3QZFA 2GMXA 2PMIA 2BTSA 3HP5A 3QA8A 2HYYA 4FOCA 4FL3A 4I6BA 4JG6A 4RG0A 5EFQA 3FPMA 2LAVA 3R1YA 5AV3A 4NIFB 4ONAA 3VJOA 4ANOA 5HOAA 5BUIA 3PJ8A 2HENA 4ERWA 2W1EA 5KE0A 5K0KA 3OW3A 4QMSA 2ZB1A 4IMYA 3FV8A 5FDXA 3C0GA 3EN7A 4FV9A 3Q6UA 1K9AA 2R0IA 3R02A 3LCTA 2C6MA 1YW2A 4QQJA 4TZRA 4OAUC 3VRYA 5D7VA 3FMJA 5GIOE 3QALE 4IX6A 3UZRA 4FKRA 4RIOA 5AUZA 4C61A 3ULIA 4EJNA 4F78A 4CD0A 2IVVA 3KFAA 1PXKA 3H9OA 4QPMA 3ANRA 3FLNC 3IOKA 4E20A 4BTFA 4YO6A 4YTCA 3NNUA 3V8TA 4N0SA 1B6CB 1KSWA 4U79A 2WMWA 4KWPA 5IUHA 1KE9A 3PFQA 5ANJA 2GNLA 5CWZA 4O86A 3FI3A 3A60A 2OXXA 4IFGA 4LMUA 2IVSA 2XNNA 1FVTA 5C8KA 1QCFA 1YDSE 3BBWA 2XNPA 3W55A 4TYHB 5HIEA 4K11A 4EOPA 4KABA 4QO9A 4I3ZA 3SQQA 4TW9A 3RAKA 5A6OA 3IW6A 2YCFA 3OWJA 3I81A 1PRYA 5BVOA 1H25A 3ZFMA 3CQUA 3MB6A 3U51A 1ZZLA 4QOXA 4R77A 5E9EA 3VS7A 3HECA 3PY3A 2J0IA 3E92A 4Y95A 5M09A 4F9WA 2RKUA 5J9LA 3Q32A 2X2LA 2X6DA 2XEYA 3W2OA 3ZC5A 4DBNA 4ID7A 1YRPA 1XH5A 4NFNA 2R7BA 5KCVA 4EQMA 3DCVA 4QP4A 3DXNA 3DK6A 1NVSA 1W2CA 5AV1A 3T9TA 1FQ1B 1JWHA 1OPLA 2BAKA 4FL1A 4I94A 4JAIA 3WZUA 4EYMA 3L9MA 4O4CA 3FXWA 4PTCA 1GZNA 4N4SA 4FSMA 5IZFA 1GY3A 3C4FA 3C4CA 1EH4A 4NM5A 5HORA 2XARA 4GV1A 3VBTA 1G8AA 3QD3A 3WZJA 4EUUA 3ET7A 3F3UA 5DI1A 4G6LA 4NTTA 4RJ5A 4BWXA 2OIDA 3LM0A 3DJ6A 3GQIA 3QTQA 2R0UA 5CF4A 2E9NA 2VNYA 4AXCA 4F9CA 5A4CA 5I3OA 4BCPA 3WZKA 3BE2A 1PHKA 4O27B 4YBKA 5AEPA 4O7VA 3EOCA 4L01A 3CLYA 2HK5A 2RF9A 1WBSA 3IO7A 4GFGA 3PJ1A 4BBFA 4EOLA 2HAKA 3OBJA 3RWQA 5I9ZA 5CNOA 3GFWA 4YJTA 5T6KA 2BZKB 1Q8ZA 2X0OA 5DOSA 4W8DA 3FL4A 1ZMWA 4IX5A 3LFSA 4MNEA 3MPAA 4Y72A 3ZCLA 1SMHA 2GPHA 3ULZA 3FZPA 3RHXA 3CTJA 4FKIA 3PXKA 1MP8A 1W0XC 2OLCA 2CN5A 4R3PA 4ENXA 5KKRB 4G31A 4PTGA 2JITA 2YJSA 3ZO3A 3QD0A 4GL9A 4AUAA 3KXHA 4FBXA 4TNBA 4PMTA 3QXPA 2WFYA 4ZAUA 2YHVA 3C0HA 3PG3A 4KRCA 1M2PA 5AR4A 4DCEA 5CAOA 4C0TA 2C47A 2PVHA 3N4TA 4Q9ZA 3KULB 4KS7A 4MYGA 4FEWA 4WNOA 4FZDB 3PJ3A 2VZ6A 1NY3A 2CNQA 1KOAA 1PXJA 5HNIX 4F7LA 4UYAA 3CY3A 3PJCA 5BMMA 4OTDA 2XM8A 3LXNA 4C02A 1JNKA 3DS6A 3GBZA 5GZ8A 3R00A 5EHYA 4FKVA 3II5A 4A7CA 4PF4A 1YXXA 5IQDA 4CKIA 5J9ZA 4NH1A 4EQUA 4BIDA 2I0EA 4R5YA 2WU7A 5JZJA 3FLWA 1SNXA 2JKOA 2VTQA 4FSYA 4BDGA 3FMHA 2PVFA 3UQFA 3CS9A 3A7JA 3HL7A 3BHYA 3CSVA 4AA4A 4DFBA 3ZDIA 5IH5A 1M2RA 2A1AB 5CU4A 5AR2A 4EZ7A 4M69A 5CVFA 3SDJA 5CEPA 2B55A 3MY1A 4X6RA 3W0RA 5LCJA 2BRMA 4QYHA 1JOWB 5BX0A 4KD1A 2VTLA 2XAOA 3AGLA 5E8WA 4BTKA 3FL5A 3PVUA 4QP6A 2O64A 3WIKA 4FTAA 4B8MA 5BVFA 4RWIA 4DHFA 4D1ZA 4ALVA 3NR9A 1BX6A 3PXYA 4M3QA 4V04A 5CVGA 4DFZE 5IPJA 3UO4A 1YVJA 1OBDA 3PP0A 3NVMB 4WG3A 3GCSA 2OJJA 5EI2A 4TWOA 4FG8A 2YITA 2XJ0A 4YJNA 3ZMMA 2HIWA 3HLLA 3EYGA 4DYMA 3H0YA 3PRIA 3UDZA 4MXOA 5TF9A 4ALUA 4EK8A 4BI1A 4AW2A 1AD5A 2V55A 4FTLA 3C4EA 3G0FA 3GXLA 5DT4A 2WMAA 3FLQA 4KSQA 2J0LA 3WF8A 3WIGA 3KY2A 1Q62A 2XH5A 3W0OA 3UDSA 2ETKA 4E93A 1KE8A 4P2KA 1GAGA 3A4OX 1IA9A 4I23A 2GFSA 2JDSA 2OO8X 4LV8A 2IPXA 4PY1A 3POZA 3A7GA 3EQGA 3F69A 4E4NA 2QOCA 4HCVA 4R7HA 1W8CA 5AX3A 3HV6A 2PULA 5HG9A 4BI2A 4OAVB 3BLHA 4G6NA 3VS4A 2C6DA 4A07A 4PPCA 2OICA 4CV9A 5BVNA 2XYNA 4BY9E 1ZYSA 5E90A 1M7NA 3GC7A 2UVZA 3JY0A 4GCJA 2QHMA 4LRKA 3QGYA 4R7IA 4BZNA 2QOOA 1NVRA 3GUBA 4MBIA 5E91A 3VRZA 1XBCA 3WBLA 1XH9A 4C4HA 1WVYA 4MTAA 5A4EA 5CQUA 4YTFA 2XJ2A 4W9XA 2W4KA 2ITNA 5DMZA 1UWJA 1Z57A 1P4OA 1PY5A 1JKTA 1YI6A 4WRSA 3UYTA 2OJIA 3UTOA 3LAUA 1V1KA 5FBOA 1VYZA 4I4EA 3TIYA 2BIKB 3Q96A 5L2QA 1JPAA 5K5NA 4UBAA 2OWBA 4M7IA 5KMKA 3R01A 3ATTA 3ENHA 3QRUA 1M52A 3R8PA 4O7WA 3W0MA 3ORXA 2WAJA 3MGYA 2ERZE 4L3LA 4PMMA 5GZ9A 3U87A 4CT2A 5FG8A 2WU6A 1YXTA 5EW9A 1B38A 4F9YA 3PVWA 4RJ7A 2J9MA 5B7VA 4ZY6A 1M2QA 4TTHB 3UYSA 2G9XA 4JOAA 3EFLA 1H28A 2IZRA 2JEDA 3DAEA 2GS2A 4IE9A 3CPCA 3SHEA 3G5DA 3TZ9A 3ML1A 3RK5A 1RQQA 1HCKA 3VUTA 4NM0A 4QYFA 4CRSA 3WYXA 4IAFA 4BYIA 2PUPA 4B99A 4BDJA 4BCHA 3G33A 5K5XA 4CFUA 5JRSA 5JEBA 1NT2A 3DXQA 3P9JA 4GEOA 4XBRA 4AT3A 5AV2A 3TMOA 3LFCA 3FQHA 2E9VA 2XYUA 3FMNA 3BHHA 3CGOA 4U41A 4BI0A 4RIYA 2C0IA 2C6TA 3CPBA 4IX4A 3CE3A 2IZTA 1T45A 3MBLA 2VGPA 4FKSA 5EHLA 4DDIA 1Y8GA 2X1NA 4JG8A 3OY3A 3JR1A 4V0GA 4YHTA 4Y73A 3GI3A 3OEFX 5ANIA 3CR0A 1AQ1A 4IANA 1JKKA 5E7RA 5E8VA 3GU6A 4W4XA 4KAOA 2ZJWA 3S4QA 3QGWA 4DDGA 5H3QA 1OPKA 3PLAE 3FLSA 3UZTA 1R0EA 2VGOA 4BYJA 1WVXA 2YM7A 2P2IA 1ND4A 4AT4A 3L9LA 2OJ9A 4G6OA 4QMZA 3CD8A 3CTQA 4MXCA 4LGDA 4JBVA 5EDPA 4J52A 2F9GA 2YFXA 5CI6A 3UVQA 4ANSA 4UN0C 4EZ3A 2QR7A 3EQRA 4WSQA 2X7GA 1J91A 2HZNA 2W1CA 3ZBXA 5J9YA 4NT4A 2BKKA 3NMUF 5F20A 2PE0A 5LVNA 2PZPA 4QMMA 4CMOA 4L46A 2GQGA 3TZMA 1O6KA 3D7ZA 1J7UA 5IA2A 3ROYA 3AOXA 4PP7A 3VUIA 5D7AA 4O4FA 2IWIA 2ZM4A 2ERKA 1ZYLA 2HOGA 3CKXA 4ZJVA 5EQPA 4C2VA 1Y8YA 3H3CA 2R4BA