4BCHA

Structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
321
structure length
308
Chain Sequence
SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKAGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 9
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 84
structure length 308
sequence length 321
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bchA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bchA01
2XNOA 3SG8A 4CFVA 3GI3A 3WBLA 3QD0A 4IADA 3LCTA 2BAJA 4LL5A 4C0TA 2FA2A 2ITNA 3KF4A 5EG3A 4JNWA 3VF8A 4BC6A 3A7HA 4PDSA 4TL0A 3QQGA 4DT8A 2IZRA 3A60A 3PJ8A 5DN3A 4G6LA 4X2NA 3BBTB 1R39A 2F7XE 3IO7A 4X2JA 4CFXA 2FVDA 3VQHA 5KKRC 5CSHA 5JFSA 5CT7A 3UTOA 2RGPA 2AUHA 5M08A 3DK7A 4DF3A 2BHHA 3LFBA 4KIKB 5E8VA 3AMBA 4YJNA 4IJPA 2RFDA 4HYSA 4UN0C 4GK3A 2XM9A 2FYSA 4FSMA 5EM8A 2E9VA 5A6OA 2QHNA 3GCUA 2CGXA 4FG8A 5H8GA 3KULA 4L00A 4O7SA 3GENA 4D2RA 4FODA 4YJSA 4D28A 1GJOA 3BEAA 4DGMA 4KAOA 4NSTA 3QYZA 4S33A 3LFEA 3IDPA 4FNZA 4V05A 2QOBA 4F7SA 3GXLA 4AP7A 4R78A 4QTBA 3PXQA 4B99A 4CZTA 1CMKE 4PRJA 2HWPA 4G3FA 4EH6A 3VBWA 4IX3A 1M7NA 4J7BA 1YVJA 3SXSA 4D4VA 4ANQA 1YKRA 1KE7A 4AA4A 2IZTA 3F3WA 4MD7E 4DGGA 1MRVA 1P4OA 3BX5A 1VYWA 4G9RA 2PU8A 5HO7A 5E8TA 3ORLA 4O91A 3I0QA 3MH0A 1BL6A 2C6TA 1URWA 2IW6A 2KTYA 3D4QA 4G9CA 4LI5A 4UZDA 4WG5A 3LPBA 3UC4A 2QOHA 4XNEA 3WZJA 2HK5A 4EH7A 4ZSAA 4BN1A 5K5XA 4IC8A 3W2SA 3OY3A 3QRUA 5F9EA 5KMLA 3ORKA 2I40A 3U54A 1JBPE 4AT4A 2FH9A 2I0YA 4KNBA 4N6ZA 1XH9A 2ERZE 4IIRA 4ZSLA 3V5PA 2XS0A 3HV5A 5EW9A 3F5PA 3D9VA 4S32A 4QP8A 4CMOA 1CM8A 3K5UA 3NCZA 4FV8A 3LFCA 4UZHA 5HGIA 4EK6A 3H3CA 4JQ7A 3R8PA 3T8OA 5AAGA 3Q04A 4L42A 1H08A 2X8DA 2WEVA 4EK3A 3HDNA 5CAQA 4MBLA 4IWDA 2PVLA 3MW1A 3BYSA 3U4WA 4AT3A 4YPSA 4B6LA 3IW8A 3KXHA 1UA2A 2W5BA 2BFXA 4XG8A 5HG8A 2QLUA 4X6RA 2FB8A 2FO0A 2LGCA 4M13A 4X0MA 3LQ5A 5HCYA 3F5XA 4RIXB 3W8QA 3R7IA 4DEAA 3EYHA 4AACA 2NRYA 2IW9A 5K4JA 4TY1A 1LUFA 4DFXE 1DM2A 2IVSA 4F70A 4G3EA 5DEWA 3OW3A 3R02A 3PIYA 3DJ6A 3AD6A 3NIEA 4L3LA 5HE3A 2X8IA 5AAEA 5T3QA 3MH3A 4W9XA 3RAIA 4IDVA 2JKMA 3DB8A 4BY9E 4RMZA 4QYYA 3ATSA 5J95A 2CNVA 3FC1X 5BVDA 5B0XA 2WTIA 1T45A 2GQGA 2HY81 4JR3A 4GJ2A 4D4SA 3LCKA 1VYZA 3V01A 3F7ZA 4R1VA 4Z7GA 5IQAA 2BIYA 4FKVA 4I0TA 1GIJA 2YWVA 1H1RA 4FKLA 3IOPA 3O8UA 3FLQA 3Q9YA 5J9YA 3KXXA 4MKCA 3FMLA 4K77A 5M4IA 3RVGA 5CASA 3E8EA 3G9LX 5CZIA 2BRMA 4U5JA 4WT6A 5I9ZA 2WO6A 2R0IA 3D14A 3BIZA 1GIHA 3IW7A 3ZZEA 1ZYSA 3DQXA 4XJ0A 5K4IA 2WD1A 5L4QA 2WKMA 4JLCA 4RQKA 3MH1A 2X2MA 4EK5A 5I5ZA 3KN6A 1LR4A 4O0XA 4QMQA 5CQWA 3SX9A 3V8WA 4TKSA 3C5IA 3NVMB 4NCTC 4A07A 2C3IB 2QNJA 3OOGA 1YHVA 4ANBA 2DUVA 3ZMMA 3ZYAA 3MBLA 3MFRA 4ACHA 2WMTA 1XBBA 4UYAA 4B8MA 1SVGA 1W7HA 3DBFA 3FMNA 1IA8A 1U5QA 1Y57A 4CGAA 1H26A 4IX4A 5DE2A 3W32A 4TWNA 5J79A 2JFMA 2XNPA 4WG4A 3JXWA 2W1FA 3OTVA 1M7QA 4BCOA 4NYEA 2IWIA 4DTKA 4BCQA 2UZLA 2P4IA 4K18A 2XIYA 2BRNA 3P0MA 5FEEA 4IJ9A 4FG7A 4QMNA 3THBA 4MD9E 3R30A 4BCNA 4ZSJA 5LVMA 4ZZMA 1BYGA 3WI6A 4B0GA 1J7UA 4D4YA 3DKCA 5FP5A 4F7JA 4BBFA 3DBEA 5KHWA 2VV9A 5IEVA 2OIBA 2PUNA 5DA3A 3II5A 5AIRA 5E7RA 3VUGA 2X39A 3FKNA 3D7TA 2QD9A 1V0OA 2QOQA 3ZDUA 4BIBA 4BYIA 1WBNA 3NS9A 4ZJVA 4F9CA 3OF0A 4F63A 2CSNA 2WQMA 3MPTA 4X2GA 4XBUA 2CKOA 4FE2A 3UIXA 3EQCA 4DFBA 2J4ZA 4JG7A 3NX8A 3CCNA 2C1AA 5HE2A 1Y91A 3LKMA 2IVVA 2BPMA 3F9NA 2YFXA 3I6UA 2B9HA 3VS5A 2IVTA 4TNDA 4AOIA 3KK8A 5FBOA 3Q4TA 4ARKA 4OW8A 1QPDA 5LMKA 2JAVA 4TYHB 2PMNX 3P7AA 2IVUA 4FNXA 5AV1A 3TNIA 5CF4A 3LCOA 4EH8A 4APCA 3D2IA 2YLEA 1FBNA 4IMYA 3ACKA 5A46A 4UB7A 4LRKA 5JGBA 3ULZA 3DZOA 4CG9A 3B8QA 3F82A 4M7IA 5HBEA 5BYYA 3POOA 3TNPC 4ZY4A 5FQDC 3LJ0A 2YITA 4XG6A 1NT2A 4YJPA 2JKKA 3CJFA 5K3YA 1GZOA 2IO6A 4GYGA 2QHMA 3DS6A 4YU2A 4D2WA 3LHJA 3OY1A 5IH6A 4N6YA 3L9PA 2WQEA 4F99A 3Q6WA 4E7WA 3WF8A 3LIJA 1H01A 3IGOA 4MNEB 4ZTNA 3UIMA 3UNJA 4EH2A 2VWZA 1SNUA 2BRGA 3OD6X 1F3MC 2XKFA 3ORXA 4AZFA 5IQEA 3RPSA 3QKKA 5C8NA 3COIA 1NY3A 2ZDUA 3FUPA 3O2MA 4BIDA 1B39A 4FZAB 3I5ZA 1YXSA 4FZDB 2PE0A 2BRHA 3HL7A 2UZBA 4BICA 4DH5A 4K6ZA 3HP5A 4G6OA 4Y85A 5E8YA 3VBQA 3VS0A 1KOAA 4ORKA 5HLPA 3P7CA 2IJMA 5I9UA 4K1BA 3QF9A 5E90A 4ZP5A 3R1QA 4WKQA 1Y6BA 2R7IA 4YZCA 4WA9A 5FTQA 3ODZX 1Q5KA 4TWOA 4RG0A 5IEYA 4X7QA 2BKKA 4DTBA 4BKYA 4A9UA 2XB7A 2EB2A 3UG1A 4YHFA 3MI9A 1OBGA 5AR8A 5M44A 3ZM4A 3E5AA 3DQWA 3F3VA 4ITHA 4TPTA 5C01A 2QODA 4X2KA 3BZ3A 5IZFA 5FGKA 1LP4A 3AC2A 3BQRA 3ZO4A 4BTJA 4BZDA 3BU3A 5FDPA 5BYZA 3QX2A 3UP2A 3KREA 4BZOA 4ZTLA 4PL4A 2J6MA 1Y6AA 4K11A 3VF9A 2JGZA 3FSKA 3M42A 1ZLTA 3PSCA 4HZSA 2OW3A 4GV1A 4IAYA 2C5NA 4JG8A 4E4NA 4DG3E 1ZYDA 3O8TA 1UU9A 3NW6A 4NEUA 4CEGA 3UZTA 3LXLA 4GUEA 4CG8A 4YZDA 5CU4A 4RIOA 2IZSA 3OWJA 4IM0A 3PP0A 3R83A 2Z7LA 3PJCA 3RNYA 3H10A 3IKAA 5ETFA 5L3AA 2WQBA 3W2CA 4XUFA 3NRMA 2QU5A 4OT6A 2E2BA 4NJ3A 4FKUA 2G2IA 3DJ7A 4NM5A 4JX7A 5DH3A 4GJ3A 2FUMA 1WBWA 2QOLA 3ZS5A 1ZRZA 1YRPA 4P5QA 4O6EA 1STCE 2YIWA 5CZHA 3ZBFA 3VW8A 4LOOA 4MK0A 2PUIA 3OZ6A 2XK4A 4M66A 5CYIA 3GCVA 3E64A 1H07A 2YIRA 3GT8A 3E92A 3BGZA 1OL7A 3FHIA 3HUCA 3LFAA 4EONA 3VRZA 4C4FA 4LM5A 4O0UA 4FKJA 3ZRMA 2GHLA 4ZTHA 3W2OA 4DEHA 4MHAA 5BNJA 1VEBA 5JZNA 4W8EA 2W06A 3QCYA 2GNLA 5B2MA 4RRVA 2YDJA 3FDNA 3LFQA 2PZ5A 4KB8A 3LFDA 3NVKI 4X3FA 5IQHA 4FEXA 1DI9A 1PXJA 2HZ4A 3MS9A 4M84A 5CSVA 5ICPA 3G0EA 4O83A 3NNUA 1OIQA 4R77A 2E9NA 2ZM4A 4FIJA 5TKDA 3DOGA 3ZU7A 3CQUA 3DV3A 5CSWA 5EQEA 5KMJA 3UQFA 5IG1A 4YZBA 4QO9A 3KRXA 4GIHA 4HGSA 4RJ6A 4M3QA 4TRLA 2VX0A 1HOWA 1PW2A 4YBJA 2B9JA 3GOPA 4IHPA 4NIFA 1WFCA 2XYUA 3D5VA 3QALE 4Q2AA 4C02A 3OP5A 5LARA 2QG5A 5J5TA 3RWQA 4LRMA 4YBKA 4L68A 5CAVA 2R3HA 3SG9A 5CU0A 3SXFA 2C3JA 4PPCA 3PPKA 2X4FA 4XLVA 3RPVA 5JRQA 3NAYA 3QRTA 2W1GA 4EOSA 2Y7JA 3SAYA 2CN8A 4ALVA 5GZAA 2F49A 4FNWA 4FNYA 4U44A 2QI8A 4KS8A 4C33A 4ZLOA 4AUAA 4IM2A 1JWHA 3WF5A 4HVGA 4D1SA 5CEQA 3FYKX 1KE6A 4FV4A 5L2TA 3QC9A 5DLSA 4ZSEA 5F20A 2J0MB 3TKUA 2ITVA 5LVPA 3I5NA 2AC3A 1U54A 2ZM1A 2J7TA 5L6PA 3W18A 4K0YA 2UUEA 3PPZA 4G3DA 4KKEA 3NUAA 1FINA 2V62A 2CKQA 1JPAA 2WIHA 2WMAA 2GNFA 2VTHA 3PJ1A 4MXCA 3WZEA 4F1MA 1J7IA 2X9FA 3SQQA 4AZVA 4MF1A 4RX5A 2BUJA 2J51A 2EUFB 4AZWA 5BVKA 2WZJA 2YIXA 3ZHPC 3E7OA 4PL3A 1BKXA 1M2PA 2ITUA 4TYEA 3V51A 4O0WA 3R21A 4CV9A 4RC3A 5AP1A 3UVPA 4JG6A 4PQNA 4DC2A 4ACDA 3RMFA 4JBVA 3MJ2A 3SGCA 3M11A 5CEMA 3I7BA 3FZOA 3R28A 4HGEA 3AC4A 3AT4A 2X7FA 5A4TA 2XBAA 3MVJA 5EK7A 2XIRA 3ZUVA 1SZMA 3PDTA 2XKEA 4XYFA 2XCKA 4FKSA 2C5YA 3KGAA 4HYIA 2BTRA 3OUKA 3IDCA 5GIPE 2GS6A 1WBPA 3DKFA 3E63A 3F88A 2OGVA 2YCSA 2EWAA 4F9WA 3H0YA 1FPUA 1MQBA 4QYGA 4B8LA 4J1RA 3JVSA 4TT7A 3WZKA 3MA6A 4BWXA 3WZUA 3FMDA 4DCAA 1ND4A 1R1WA 3HGKA 4EOQA 3KQ7A 4F65A 3PP1A 2OFVA 4OTFA 4PMTA 4EWQA 2WMRA 5JMSA 4E4MA 4JOAA 3NUPA 4GCJA 5KX8A 3ORIA 4ALWA 3LM5A 2JBPA 4HPTE 4WG3A 4X21A 5HHWA 4A9RA 4CMTA 4YHTA 4F1TA 2QG7A 3BLQA 4PDOA 2J0IA 4I20A 4WIHA 2R9SA 3KC3A 4RQVA 4DH8A 4F7LA 3GFEA 2C6DA 3MFSA 4A9TA 2FSLX 4BGHA 3BLRA 1OIUA 2Y4PA 4GW8A 3CSVA 3H0ZA 1YDTE 3G0FA 4DYMA 4EOOA 3GCQA 3KA0A 4IVDA 2WQNA 4R3PA 5EDPA 4EOJA 3R9NA 4L52A 5HD4A 3PG3A 3MSSA 5CTPA 4OUCA 3RALA 3GP0A 3G6GA 4BDKA 2PHKA 4CNHA 4CZUA 4WRGA 5B7VA 4M68A 3NMUF 3NDMA 4QPAA 5ANEA 4OTQA 4XH6A 4GVJA 4M69B 3MB7A 3OBJA 1P5EA 3GC7A 3RI1A 3OEFX 2YACA 2QO2A 2ZB0A 2ZV2A 3COKA 3RAKA 4BVUA 2XK7A 3FV8A 4G34A 2YIYA 4KS7A 1I09A 4UY9A 3O96A 4B4LA 4EOPA 3NIZA 3HMOA 1YI6A 3OHTA 4MTAA 1XHAA 2WNTA 3UGCA 3ZEPA 5IQIA 3KK9A 5BQ0A 5HZNA 4MWIA 2PZYA 3W2RA 4FSRA 4WRSA 3EYGA 3CBLA 4AW1A 2JIIA 3OWPA 1Q4LA 3RGFA 4DGOA 3EHAA 3H9FA 4KRCA 1Z5MA 3LXKA 4D2VA 2NPQA 1HCLA 4NFNA 1ZXEA 2O65A 1JKSA 4JL9A 4IM3A 1XKKA 4FZ6A 3F69A 2PVJA 3CKXA 3WYYA 3SVVA 4FSZA 2Q83A 3SRVA 4FV0A 3TEIA 3MA3A 5FWKK 5IA4A 2PUUA 2YIQA 4EKKA 4O7TA 5CQUA 2CKEA 3QRJA 4M0ZA 3IECA 4P4CA 4XG2A 3V5QA 2F2UA 4PX6A 2YM6A 4RVTA 3NZ0A 3EFJA 3HRBA 4EQUA 3GU8A 1J3HA 3Q9ZA 4A06A 4LFIA 3MJ1A 5K9IA 4O7YA 5DNRA 4FIEA 3HX4A 4USFA 4Y46A 3RP9A 4CXAA 3BYVA 4LV8A 4XOYA 2C4GA 3FXWA 3R1SA 1ZWSA 4PDPA 3VULA 5CAPA 5IA0A 4FV5A 5FTGA 4N70A 3FPQA 2UW7A 4G16A 4D1ZA 3QAME 2ZVAA 1XQZA 5IA5A 3FJQE 3MY5A 3ZEWA 5IQDA 4FTKA 1R78A 2RFSA 1PMVA 2BMCA 3PLAE 4OTIA 3VNTA 4A9YA 4BCHA 3UQCA 1YWVA 4IEBA 3UO6A 5CF8A 2GHMA 4OTHA 2F4JA 3SV0A 4DGNA 2WU7A 5AUZA 2PMOX 2PVMA 3Q2JA 2YLFA 2E9PA 4KBKA 1ZOHA 4FL2A 4AG8A 4EH5A 3I4BA 2W9ZB 4FT3A 4UMQA 4PMMA 4AAAA 4TZRA 4NL0A 1PXOA 4E5BA 5I4NA 1XH5A 4ITJA 4Z9LA 1CTPE 2JDRA 5FM3A 1ERKA 4LGDA 1RE8A 4I5CA 3NR9A 2C69A 4FSQA 3N4UA 5DIAA 3U4UA 4BI1A 3OUNB 2UZWE 4O27B 3DAEA 5EOLA 3S4QA 2WOTA 2C6MA 3RPRA 4C37A 5I3OA 5TOZA 3AQVA 4DFUA 4AWIA 3C4FA 2VWVA 3T9TA 2I7QA 3PRFA 4OT5A 1W83A 4PUZA 4Y5QA 2UW6A 4C34A 2C30A 4NM0A 5LCJA 5CSXA 3FI2A 1U5RA 4FKRA 2YWPA 1SVEA 2OWBA 3OFMA 5AM6A 3GFWA 1YWNA 4AOJA 4C8BA 2G9XA 4PWNA 4C7TA 4DG2E 2Q0NA 5M06A 2J90A 1IAHA 5D41A 5M57A 4IC7A 5KMOA 2EXMA 4AFJA 4J8NA 5CVGA 4ONAA 5HLNA 3RHXA 2PZRA 4MXAA 2WXVA 4QQTA 5CANA 5GNKA 2FSTX 4AN9A 3TWJA 2VTNA 1M17A 3ANQA 4QYFA 2R0UA 4OBPA 5A54A 4FV1A 4U3ZA 4BDBA 4I6BA 2BRBA 2GTNA 3TM0A 4JI9A 5L6OA 1YHSA 5B2LA 2J5FA 1R0EA 3TNHA 3U9NA 5IQGA 4DFYA 3ALOA 2DQ7X 3LMGA 2F7EE 3LJ1A 3NSZA 4FBXA 2GNHA 4H36A 3QFVA 4HNFA 5CU6A 4TXCA 5ANDA 2W1DA 5HBHA 3UVRA 3O17A 4BFMA 5AADA 4S30A 3ACJA 3E3BX 5E9EA 4ZMFA 3BELA 1U46A 4J95A 1WBTA 2RG5A 3L9LA 4C57A 4M0YA 2ZB1A 3GBZA 2P3GX 3AXWA 3KULB 4GKHA 4QNAA 3JR1A 2CNUA 5HO6A 4GFGA 4C2WA 1FMKA 2QOFA 3FI4A 3CTQA 4EOLA 4UMUA 3NYOA 1TKIA 4R7IA 2H8HA 3C0GA 2YHVA 3E88A 3IDBA 2OJIA 3Q9WA 3ORTA 2Y8OA 4G3CA 4IACA 3RHKA 1Q3DA 4IE9A 4FTOA 4XEYA 4KIPA 2Y0AA 4O2PA 1RQQA 4QP7A 2ITXA 4NTTA 2OJFE 4TYJA 4RVKA 5IMXA 5D11A 4YTHA 3ORPA 4HOKA 5DMZA 1TVOA 2BROA 2YDIA 3C4ZA 5E92A 3L8SA 4NH1A 4DH7A 4QMTA 3F5UA 3MB6A 4L3PA 3LOKA 2XZSA 4FTLA 5ANJA 3TDVA 5JGAA 3NGAA 3DLSA 3LE6A 2XIXA 3RBWA 2GTMA 3HMIA 3C4EA 5AR5A 2H6DA 3PUPA 4R3RA 2FGIA 2PVKA 4QMPA 4QQJA 1P14A 4UXLA 4YJVA 4YC8A 3TUDA 1PXPA 1IAJA 5A4LA 2H96A 2JC6A 2VNWA 3OWKA 1LPUA 2XNMA 4G6NA 3FZRA 4KIKA 4M67A 5HG9A 2V0DA 4B9DA 4MQ1A 3LCSA 4IWQA 3FQSA 5IH5A 2EU9A 5HG5A 2B53A 4PY1A 2A4LA 5A14A 3O7LB 1TQPA 1OPKA 3ROCA 4HVDA 2WB8A 3LQ3A 2BZJA 3E8CA 3DNEA 3VUIA 3UOJA 4UMPA 3VS2A 3QHRA 4L6QA 3L8VA 4XHKB 1L3RE 2WMUA 3RTPA 3ITZA 2OXDA 4RWKA 4E73A 5DEYA 4IANA 1OITA 4NM3A 3H4JA 3QRKA 4NFMA 4NW5A 1H24A 2VTAA 3K3IA 3SD0A 2EXCX 3EN9A 3O0GA 3R04A 5AP5A 3QUEA 3UNKA 1YOMA 2JKQA 4FV2A 2JKOA 1OZ1A 3V5JA 3TACA 5CSPA 3RAHA 2PL0A 2YCRA 4CRLA 1M2QA 3DK3A 3DXPA 5M4FA 3T3UA 5AUXA 3S95A 2R3KA 4HCTA 1XBCA 4YNEA 2BDWA 3OVVA 5FDXA 1YDSE 4DEGA 2BIKB 1VZOA 3VBTA 4CZYB 2QCSA 3VIDA 4L53A 3A7IA 5L2QA 4YC3A 4WSQA 3O23A 2VTPA 1F5QA 4MD8E 2IG7A 1NXKA 3OCGA 4GS6A 4HCVA 1G5SA 3OS3A 4QMXA 2WTKB 4YJTA 3ZLWA 4U79A 3BYUA 4RX8A 4I5HA 5CXZA 2VGOA 4ZAUA 5FRIA 4ACGA 4KKGA 5E1SA 3MVHA 3PA5A 2HW6A 1YWRA 2JDOA 3V5TA 5IA1A 3AC1A 5C8MA 5CT0A 5DR9A 2R5TA 4I5MA 4MEDA 5AR2A 4DA5A 1FQ1B 4HNIA 3HP2A 3PJ2A 2DYLA 2OU7A 3MV5A 4M97A 2VO7A 4EYJA 1ZMWA 5J87A 3FI3A 2QO9A 1GIIA 2HZ0A 3U87A 2VWUA 2EVAA 4UALA 5AP2A 4ZTSA 3R8UA 5AFVA 4DFZE 4NW6A 4HJOA 3B8RA 4FKTA 4O0SA 5HVKA 2QC6A 1B6CB 2XKDA 4C4GA 3OXTA 1GAGA 4PTEA 2Q0BA 4J52A 5J1WA 4NCTA 3NUXA 3QLGA 1K9AA 3JS2A 1F0QA 2UVXA 4QMSA 5BVNA 2BZHB 5ANIA 1BL7A 3DKGA 1O6KA 3JPVA 2FSOX 3RJCA 3A8XA 4BTKA 4QP1A 4ASDA 2CGWA 2W1ZA 3BEGA 5L2WA 2BALA 2WTKC 1PXNA 4GK4A 4LUEA 4EOKA 1IASA 4CLJA 4J98A 4YTCA 2YM4A 4L3JA 3WE8A 2PE1A 3OG7A 1UU8A 3QXOA 3ZFXA 4MH7A 5EM7A 3SKCA 5FLFA 2HWOA 3DY7A 4BIEA 4O2ZA 4XRJA 4AZSA 1K2PA 4AFEA 2PULA 3Q9XA 2UZUE 3A4OX 5DWRA 4FSUA 4FK6A 4BR3A 3QA8A 5BVEA 3D15A 1O6LA 4AF3A 1H1QA 5IA2A 4OBQA 5AJQA 4MVFA 4EJNA 1QPEA 2ITZA 3A8WA 2A27A 1V0BA 4CSVA 3I60A 4E6CA 5CY3A 3FSFA 2JDVA 5C1QB 3D7TB 5F94A 1NVQA 2OZAB 3OEZA 3TZ9A 4S2ZA 2C6LA 5AEPA 1WZYA 4AZTA 3ZSHA 3LFNA 2CGVA 1XBAA 5DHJA 2YERA 3HYHA 4XV1A 4ANNA 2BDJA 5HD7A 4JBOA 4AE6A 1REKA 3QGWA 3FXZA 5HCZA 3EFKA 2VTRA 3FL4A 3FLNC 5D12A 3A4PA 3MTFA 5AA8A 3QTQA 3GUBA 5FG8A 4F0IA 3CGFA 2UVZA 1E1XA 4ZY5A 2Z8CA 4IDTA 3EFLA 2ONLC 5EI2A 3UOLA 3UP7A 4FGRA 4FA2A 2ITPA 3DBCA 2W4KA 3P7BA 4R6VA 4IVAA 4XG3A 3SC1A 4APPA 4JAIA 2B9FA 1OM1A 3EN5A 3OOMA 4F09A 4FV7A 2WIPA 2VUWA 2V55A 2O3PA 3CR0A 3KN5A 3QD3A 2RFEA 4Z55A 4C36A 3UYTA 4KRDA 1SM2A 1SVHA 5FEQA 3FKLA 4ZJJA 3VRYA 2VWIA 4NM7A 2ZMDA 2GPHA 5EI6A 2XNEA 3JY9A 3VUMA 4MQ2A 4RX7A 4D2TA 1PXMA 2PK9A 4Y5HA 5CWZA 5EI8A 4DH3A 3QTRA 4U7ZA 1OIRA 1UNHA 2V5QA 3DGKA 3F66A 4BDJA 4FKQA 4BWPA 4FTMA 5IDNA 3WF7A 3IW5A 4GUBA 5BUEA 3ORMA 1FVTA 2C6EA 4AQCA 1PRYA 4DHFA 2W05A 4GFOA 4UV0A 2QR8A 3A7GA 4FTAA 1O6YA 5J1VA 2VNYA 3NUSA 4GMYA 4I5PA 4ZXTA 5GZ9A 4QMZA 3G15A 2XMYA 4E6QA 4EHZA 3ZUUA 3EJ1A 4FSNA 4I92A 4CT1A 3SA0A 3CPBA 2B4SB 4BRXA 4YSJA 2WTCA 4FVPA 4IB1A 3DAKA 4KUJA 2X4ZA 4I22A 2Y6OA 1H4LA 5AV2A 3VS4A 3R22A 5T6KA 2YABA 2VO6A 2BDFA 4RZVA 3C50A 4C3FA 2JD5A 3I0OA 1WCCA 5A6NA 5A4QA 5A9UA 2ZV8A 3PYYA 3BE2A 4D5HA 3GCPA 4FV6A 3PPJA 2PPQA 4NUSA 3OBGA 3SW7A 4R7HA 4NU1A 3FPMA 2I1MA 3PIXA 4BTFA 2YM5A 5M09A 4BZNA 3FMKA 3F2AA 4BCKA 3JYAA 3IQ7A 2C5XA 3VS3A 4IWOA 5CF6A 5AP3A 2PMLX 4YZNA 4RVLA 3DXQA 4EKLA 4ZLYA 5KHXA 4O84A 1REJA 3JY0A 5ETCA 4FOBA 1NVSA 5FTOA 2EXEA 3BU5A 4U41A 5F4NA 4RLLA 2O8YA 2R3GA 1V0PA 3DXNA 3ALNA 5IUHA 2G15A 2GS7A 5ANGA 3GU6A 4OLIA 5IQFA 2HIWA 4FKGA 5HTIA 5HI2A 3G33A 2QVSE 1MUOA 3PZEA 4HW7A 1JQHA 4ZEGA 5M55A 2J2IB 2QO7A 4XOZA 2X2LA 4Y95A 5E4HA 3K5VA 3FQHA 3QD4A 2ZV7A 4FSTA 4I93A 4PMSA 5HU9A 1OL6A 3MVMA 4GSBA 3U6IA 5HESA 3VBXA 4D9TA 5FD2A 4EZ7A 3QCQA 3FQEA 3M2WA 3QD2B 4GIIA 4DFNA 5EM5A 4FIHA 3L9NA 4ZOGA 3TNQB 3UO5A 5HOAA 2X9EA 2VO3A 1OECA 5DR6A 4P7EA 4AS0A 4I6HA 5AM7A 2YM7A 3P4KA 4XG7A 4U81A 1WBVA 3MYGA 2OICA 2VX3A 5DVRA 4UWYA 5ANKA 2UW5A 5AX3A 3FZPA 1PXIA 3AOXA 3W2QA 4AGUA 3Q3BA 3FC2A 3PWDA 3F7WA 4AN2A 4OTWA 4QPMA 3D5UA 5IH4A 2O2UA 3MFUA 3E8DA 3EOCA 3VN9A 2JEDA 4EK8A 2Z02A 2VD5A 2HENA 4RA5A 2JDSA 5DT4A 4DH1A 4EYMA 4OGRA 1KWPA 2A0CX 5M07A 4MYGA 4EH3A 4O1PA 2P2IA 1IRKA 3O50A 4GT5A 3GC8A 4QRCA 4YHJA 2WHBA 5CI7A 2B9IA 3HAMA 3QKMA 3QQJA 1CSNA 3MGYA 3Q4UA 3TL8A 4C4HA 5IU2A 1O9UA 5BPYA 1KOBA 2C6OA 4LV5A 4CLIA 2R3PA 2VTTA 5IA3A 3Q4ZA 5LMAA 3C9WA 4BCIA 3Q4CA 2C3KA 3R7VA 3REPA 3QA0A 4J96A 2VRXA 1SNXA 4GL9A 4FGBA 4KWPA 4MXOA 5DRDA 1L8TA 5LWNA 4AX8A 1RDQE 5HIBA 4CKIA 2WFYA 4L45A 3UPXA 1ZYJA 2ERKA 3QQFA 5JFVA 1UKIA 2J0LA 1H25A 3CTJA 4ENYA 2XJ0A 2B55A 2F7ZE 3UJGA 4MCVA 4EHEA 3CY2A 3QWJA 4QMOA 2X6EA 4BCJA 4V0GA 5AIKA 2GU8A 3OROA 2RFNA 4D9UA 4ZTRA 2C1BA 3LVPA 1JOWB 1XWSA 3QTZA 1U59A 2OG8A 2WAJA 4C62A 1M14A 3AD5A 5HNIX 4OTDA 5I3RA 3CS9A 3LLTA 2XK9A 1OBDA 1W84A 1G3NA 2XEZA 4AW2A 3HZTA 3FLYA 5IISA 4HCUA 2XJ1A 4EI4A 4BWKA 3DFAA 5KNJA 1M2RA 4FK3A 4EK4A 3QTUA 3ZLSA 5JQ5A 3RK5A 4CT2A 4BDFA 4ASEA 1T46A 4DEDA 4TN6A 5EW8A 4YJRA 3V3VA 2WOUA 2YEXA 3CXWA 5DT3A 4JX3A 5FUTA 2FSMX 3MIAA 3AGLA 4L9IA 3S1HA 3N9XA 3G90X 3OCSA 2W96B 4ZMEA 4GFMA 4RJ3A 4O86A 4DFLA 2WTJA 5BVOA 3C7QA 4JS8A 5L2SA 1LEZA 4FMQA 1PHKA 5HKMA 2ZM3A 4YO4A 1DI8A 3GB2A 3KCKA 4QMWA 5IEXA 4J97A 3BQCA 3P9JA 4GU9A 4NT4A 2C6IA 1YXXA 3UDBA 1JSTA 4YJOA 1FOTA 5CU2A 3PVUA 3CD3A 4WD5A 4RIYA 4BHZA 4YLLA 5C27A 4ZTQA 4ZIMA 2E9UA 1ZYCA 5G1XA 1MQ4A 2BTSA 1H00A 5ACBC 3W8LA 2JIVA 3BLHA 3OT3A 2OH0E 3BWFA 4DBNA 3KY2A 3UVQA 2OI4X 2ETMA 3PZHA 4O21A 1IG1A 1U4DA 3IK3A 4IBMA 3E7VA 5LCKA 3T3VA 3UQGA 3ZUTA 4CV8A 4DN5A 4NKSA 5K0XA 3D5WA 1UNGA 4RLKA 3MPMA 3C13A 4ZTMA 2HELA 4JVGA 4R1YA 3TCPA 3I79A 1HCKA 4HVIA 3HKOA 3ZLXA 4S31A 1BI7A 3QZIA 1S9JA 2Y6MA 4RJ8A 4F6SA 4DT9A 4MXYA 3R01A 5DBXA 2WMQA 2XIKA 5AWMA 5CF5A 2XK3A 3KKVA 3O7LD 2HZNA 1JKLA 3ZSIA 3W55A 3DJ5A 1Q99A 3HVCA 3HECA 1H1WA 4G17A 5JRSA 1FGKA 4YSMA 2V7OA 5HEZA 4ACMA 5KO1A 4HGLA 4UWBA 3NEWA 4V04A 3N51A 2PSQA 1WBSA 1GZNA 2WELA 1S9IA 5E8UA 1J1BA 2F9GA 4MX9A 3EL7A 1ZY4A 3TIYA 5JGDA 4TYGA 2C3LA 5JSMA 1OKWA 2YM8A 4W4VA 3ZC5A 5CU3A 2ETKA 4PTCA 4ANMA 2XH5A 4FC0A 5J7HA 2B1PA 3R00A 4WNMA 4DCEA 2VWXA 3BHVA 1XH4A 2YDKA 4QTAA 4KSPA 2C0TA 4C3PA 3TT0A 3AC8A 2OO8X 4BTMA 3U51A 3LFSA 1KV1A 5I0BA 3VWAA 2WU6A 3P78A 2QKWB 5J7BA 4MBIA 4E5WA 1GZKA 3K54A 1UWHA 2XIZA 5FXSA 4QD6A 2UZVA 4J8MA 3FY0A 3IS5A 3BGPA 4BB4A 5I9WA 3KRJA 4RPVA 5LMBA 4O0TA 4ENXA 5G6VA 3D94A 2GNIA 4FF8A 5BYLA 3KXMA 2XRUA 4KBAA 5EQYA 4H05A 3P08A 4GH2A 3VBYA 1UU3A 3JUHA 3QQHA 4QYHA 1RW8A 3AT3A 4LMNA 2CPKE 2PZIA 2HXQA 4FIGA 5EQPA 1PF8A 3HV3A 2UZDA 2WQOA 4LOPA 2P55A 3DNDA 2VWBA 2Z7SA 4LRJA 3SRVB 4EWHA 4JJRA 2PYWA 3FAAA 4JDJA 1FVRA 1OL2A 1PXLA 4CCBA 1A06A 2W99B 2ZV9A 3Q53A 5KUPA 3COHA 2CCIA 3QKLA 4FTUA 4OAUC 3GU7A 1ZYLA 4C3RA 2R3MA 5DGZA 1BUHA 3BCEA 1PMUA 4MAOA 3LMIA 4EJ7A 2XK6A 3LFFA 3ZFMA 2O0UA 4M69A 4EORA 4BKJA 3NPCA 3E3PA 2OF2A 4RVMA 3EN7A 2JDTA 4N0SA 4RIWA 2YAKA 4XP0A 3R73A 5GIOE 1TQIA 4QP6A 4AA5A 1YQJA 3ET7A 3TIZA 3ZO3A 2OK1A 4J99A 4LOQA 3EMGA 5HE1A 5JH6A 3ZONA 2JBOA 2R3IA 3W2PA 4CD0A 3VVHA 4MWHA 1I44A 3C4CA 2R3LA 5J8IA 2C47A 4CMUA 5HIEA 4JBPA 1Q24A 4E1ZA 5EW3A 4M12A 1MRYA 3COMA 2HZIA 2XF0A 3NYNA 2X7OA 3MFTA 2WTVA 5D7VA 3SOAA 1Q97A 3A2CA 5DT0A 5CLPA 3SW4A 4BL1A 2H9VA 4QTCA 4AGCA 3UODA 2UVYA 4O7RA 3UOHA 4DG0E 3QTXA 1Y8GA 3BHHA 4G5JA 4E4LA 5TO8A 3R8ZA 3DAJA 3NYVA 3CY3A 4BDAA 2YZAA 5ITAA 5EHLA 4ZS4A 1V1KA 4O0VA 2JAMA 3DBDA 2GQSA 4FL1A 3PSBA 4H3PA 3EQIA 1QL6A 1Q3WA 4ANOA 5LVOA 2VX1A 4EBWA 3N4VA 4FEUA 3AMAA 3C51A 5DPVA 2OXYA 4L01A 4RJ4A 3HAVA 3FY2A 2Z7RA 2R3OA 4DINA 1DS5A 3CQWA 3EKNA 2Y9QA 4IZ5A 4FZ7A 2J50A 4BF2A 3TXOA 5JQ8A 5AUTA 2W9FB 3VUDA 3QHWA 3FL5A 2QOOA 1OKYA 1SMHA 2I0HA 3ZTXA 4H3QA 4GKIA 4D0WA 1M52A 3UIUA 1K3AA 3HV4A 5F1ZA 5TR6A 4BCMA 3OMVA 5ETIA 5J9ZA 3F2RA 3H9OA 2HCKA 1UU7A 4S34A 4CQEA 3R7OA 4O7ZA 2UZNA 4DAWA 3ZZWA 4FR4A 3BHYA 4FV9A 3DTWA 5C26A 3BYOA 2W17A 3DB6A 3F3ZA 2R3FA 3ORZA 4XRLA 4TWPA 5D9HA 1FVVA 3PRIA 3HNGA 4BDEA 1JLUE 2CN5A 2GCDA 1VJYA 2C5OA 2HW7A 3HEGA 4R5SA 3E8NA 2WMSA 4Q9ZA 5HIDA 3PJ3A 3Q6UA 3I81A 1H8FA 3LZBA 4FSWA 3EWHA 4X6QC 2W7XA 3DT1A 3EQDA 3WIKA 2WEIA 2PE2A 2RL5A 5DG5A 4K8AA 5CX9A 2UW8A 3HRCA 4K9YA 1H0WA 3R6XA 3C0IA 2JFLA 1AQ1A 3POZA 4E6DA 4GK2A 2X2KA 3BV2A 4FL3A 3R1NA 4XG9A 2WTWA 2Z2WA 4YJUA 5HX6A 1IA9A 5CEKA 3FXXA 3ULIA 5GJDA 2YISA 4FT5A 4WUAA 4ASXA 4BGQA 4E6AA 1G8AA 5D7AA 4MXXA 2JIUA 3IG7A 3DDQA 1RJBA 5H8EA 3NCGA 2BZKB 4QT1A 4JQ8A 2YN8A 3L1SA 3KMMA 3R7EA 3PG1A 3TZ8A 5KBQA 5IDPA 4DLIA 3EQHA 4I1ZA 3EB0A 2OIDA 4BCGA 5FM2A 2OH4A 4IAAA 2QQ7A 4FTJA 4KSQA 4EEVA 2PVRA 5EH0A 5JFXA 3E93A 3PSDA 4MBJA 2XRWA 4HYHA 4W8DA 2OJJA 1YXVA 3HV7A 5A3XA 3CKWA 4BI0A 1PKDA 3U55A 3RINA 5KE0A 4AOTA 1Y8YA 3KVWA 3FZTA 3SXRA 3ZO1A 4OTGA 5AV0A 3ZOSA 2V7AA 3DCVA 4FIIA 5HTBA 4PTGA 3DLZA 4N4SA 5ETAA 4C35A 3NNWA 3HMPA 3PXRA 4FUYA 4O38A 3RPYA 2IW8A 2EB3A 4TWCA 5KCVA 5AUVA 1BI8A 3NNVA 1OL1A 3R8VA 3ZLYA 2Z7QA 3CTHA 4FKIA 4I4FA 4CFUA 5KMMA 3U6JA 5C9CA 4YLKA 3TG1A 3UIBA 2PUPA 3TN8A 2R3RA 2WMWA 3MPAA 4QP9A 3FI8A 4F9YA 3VHEA 4FZFB 3VUKA 5E91A 3RPOA 3MESA 5CAOA 3EZVA 4YO6A 4PNKA 1OKVA 1ZOEA 3G51A 1CKPA 4NTSA 1NW1A 1PY5A 4CKRA 2IN6A 2ITTA 4M15A 2OSCA 3QTWA 3A7FA 1PMEA 4EOMA 3FZ1A 3ZXTA 5HX8A 1ZZLA 3OWLA 2GFCA 4I24A 3U6HA 2OKRA 3PIZA 4O81A 1KE9A 5E8XA 2ETRA 4AZEA 4QMYA 4IW0A 4AT5A 2PVFA 4C2VA 1OMWA 3CEKA 3AD4A 4HVSA 3ZO2A 5C4KA 3KMUA 4KIOA 5H3QA 3VO3A 2X6DA 3AGMA 4F9AA 5AP0A 4AW5A 4O1OA 5I9XA 4U80A 3Q2MA 4FT7A 3IPHA 1OL5A 2QURA 2VTMA 3GOKA 3F3TA 3VC4A 5BX0A 5HU3A 4RFMA 3D7ZA 2BR1A 2ZOQA 4CKJA 1IR3A 3S0OA 4XS2A 4UBAA 4IAZA 2NO3A 1WAKA 3LM0A 3QWKA 4LYNA 3RWPA 1H28A 3R9HA 1JAMA 2SRCA 3NAXA 4IVBA 3ZCLA 4A4OA 2VTSA 5AA9A 4C4IA 1FMOE 2PVHA 3G5DA 3PVBA 4PP9A 4QTEA 3MIYA 2HXLA 3KMWA 4BBEA 4F08A 5ANOA 4RGJA 5K5NA 2DS1A 1YI4A 2CKPA 2QR7A 4AW0A 1JVPP 2XP2A 4R7BA 4PNIA 5FXRA 1Q61A 2V22A 4I0SA 3OXIA 3PE2A 2XNNA 4A4XA 3R2YA 2BHEA 2R3JA 2NRUA 3DZQA 4USDA 4Y73A 4DE4A 3W10A 4KKHA 1R3CA 4ZJIA 4CFMA 4XCUA 4NKAA 4QP3A 5LXMA 2J5EA 4DITA 3BWJA 4XP2A 3ETAA 3I1AA 3C4WA 3W1FA 3ELJA 3RK7A 4BCFA 4LMUA 3CD8A 3A7JA 5EYKA 3U8WA 4A9SA 5M56A 3LCDA 3PLSA 3CP9A 3LJ2A 4RIXA 1IEPA 4F1OA 2ITOA 3UBDA 2CNQA 4RFZA 4H39A 5J9LA 5GJGA 3QZFA 3HA8A 4RWLA 4XV9A 5C03A 2I0VA 3NW7A 3TI1A 3TTIA 4FEWA 3FBVA 3KEXA 3ZFYA 3F6XA 3FLZA 4TTHB 1QMZA 3C4XA 3EH9A 3C1XA 3ERKA 5HQ0A 3VUTA 4E4XA 1YW2A 5D1JA 4GRBA 1OKZA 2Y4IB 3VW6A 1ZY5A 3WZDA 3OT8A 2HAKA 2J0KA 4K33A 4QMUA 2R4BA 3RKBA 5EYCA 5HVYA 4B7TA 2CJMA 5IUGA 3BPRA 3FEGA 5CVHA 5E8ZA 5FXQA 4O22A 5H8BA 3KCFA 4GYIA 4IX5A 4U45A 3QRIA 4CRSA 3FLWA 3TV4A 3O8PA 4UYNA 4AE9A 5DI1A 3VQUA 5HTCA 3GGFA 3ODYX 3DKOA 5BMMA 4YMJA 2GMXA 1XJDA 3QC4A 3QGYA 4NJDA 4KA3A 2XNGA 3NW5A 5M53A 5IUIA 2RF9A 3PVGA 4F4PA 3RCJA 2IPXA 3VHKA 2XCHA 3KXZA 4PF4A 4IB3A 4YNOA 4AN3A 4ASZA 2HOGA 4ZZNA 2IZUA 5TE0A 3K3JA 5TT7A 2OBJA 3ZRKA 2I0EA 5F95A 2ONLA 4F0FA 5IF1A 2RSVA 1A9UA 4YR8A 1PMNA 3GEQA 2ZMCA 5AR7A 4GEOA 3VBVA 5JFWA 4CTBA 5KMNA 4LQMA 3QZHA 4XV2A 5AUWA 1E1VA 1OGUA 5BVFA 2W4JA 2XUUA 3MN3A 4HPUE 3LW0A 4FI1A 2C0OA 3R8MA 3WYXA 1TQMA 4JQEA 2R64A 4JDKA 4EUTA 4HVHA 4R5YA 2BAQA 4IH8A 5HNBA 3MH2A 1OB3A 4N57A 2C5VA 2Y4IC 4FKPA 4FTIA 2R3NA 5CVFA 2J9MA 4QNYA 3QL8A 3ID6C 4O7VA 2OZOA 3NUNA 3QUPA 3VS1A 1KUTA 5FP6A 4QQ5A 4RJ7A 3GNIB 3RAWA 1P4FA 5ACKA 2G2HA 5C8KA 4FVQA 3UC3A 3W16A 2OZAA 3NLBA 4OAVB 4D1XA 1W82A 2B52A 1W0XC 1W8CA 2GNGA 5LQFA 3V8SA 3EIDA 5E8WA 2C0IA 4CFWA 4OR5A 5DOSA 1PKGA 2W5HA 4P90A 2OJGA 3NWWA 4FTTA 4U97A 5FEDA 3V5LA 3IGGA 5EM6A 4CQGA 4D5KA 4CCUA 3D83A 4O96A 5JEBA 2X0GA 2YCQA 2CMWA 2ACXA 5EYDA 4QP2A 5AR3A 1QPCA 3GQIA 3PXFA 3V6RA 1Q62A 1UNLA 2YA9A 3F3UA 1APME 3LLAA 1Q41A 2I6LA 2UW0A 4RFYA 1WMKA 2PZPA 4JBQA 4O0RA 3WF9A 4IZ7A 3V04A 4O7NA 3C0HA 3P79A 4GT3A 1UV5A 3R8LA 2VAGA 3BU6A 3QLFA 4D55A 4FTNA 4DEBA 5E8SA 3ZH8A 3V8TA 4RZWA 5CNNA 5LMKC 3O51A 2GS2A 3DBQA 5CALA 1NVRA 4YJQA 5D10A 3QTSA 1JKKA 3PTGA 4TYHA 4DBXA 3RZFA 3FHRA 5JT2A 4EQCA 1H1SA 2O5KA 5DFPA 4W9WA 2W0JA 3SLSA 2VTIA 3DU8A 4YURA 2NNWB 4ANLA 3DPKA 3R71A 1JNKA 2GSFA 3HLLA 1W98A 2DWBA 2P0CA 3LAUA 3TKHA 3FYJX 4WNKA 5EOBA 5EYMA 4Y8DA 3WILA 2AC5A 3P86A 2REIA 4CVAA 2OLCA 1CKJA 3B2TA 2PY3A 4DGLC 4F7NA 3BE9A 4D2SA 4F64A 1XH8A 4EBVA 5LJJA 3EZRA 4G31A 4NK9A 2WGJA 2A1AB 4I0RA 4IB5A 3RCDA 3WOWA 3LQ8A 3ENMA 1GY3A 4F9BA 4MNEA 5AP7A 4FYOA 5HICA 4Z3VA 4W4WA 3QBNA 3FMHA 1OUKA 4FICA 4H58A 4L43A 3HRFA 4UXQA 4U40A 4C61A 5JK3A 4EUUA 4XV3A 4JIKA 4TNBA 4YP8A 5BUJA 1YI3A 4U9AA 5GHVA 4BKZA 3BRBA 3E62A 4FSYA 4JRNA 3SOCA 3RZBA 1BX6A 3VAPA 4BDDA 3CJGA 2JLDA 4E8AA 2OXXA 1E9HA 4TW9A 2X81A 1SYKA 4OBOA 5CS6A 4EQMA 2OIQA 2PTKA 2VZ6A 3GCSA 2GFSA 4E5AX 4XP3A 3UZPA 3TNWA 3ANRA 3HV6A 3PXZA 4E20A 3R9DA 1VR2A 3IOKA 4ZY6A 1BLXA 3AMYA 2RKUA 3KXNA 4ZSGA 1ZAOA 5M4CA 3IONA 5BUIA 4J71A 4U42A 3EN6A 3P23A 5IQBA 3T9IA 3VJNA 4QQCA 1YXTA 1ZOGA 2BILB 3EN4A 4QOXA 4Y72A 3MVLA 2ZAZA 4IFCA 4LG4A 3TKIA 4O7WA 2R3QA 3NUUA 1MRUA 3BKBA 4O0YA 4X3FB 2R7BA 4PDYA 2ZDTA 2XM8A 4JRVA 5A4EA 1MP8A 2C68A 3RM6A 5LOHA 3TZ7A 2W1EA 3BI6A 3UG2A 3QZGA 4ERKA 4DLJA 1Q8UA 4FEQA 1LEWA 4FKWA 3UYSA 5I9YA 4PMPA 4Q5HA 4NWMA 4IAFA 3NYXA 3PWYA 2P2HA 1WVYA 3GU5A 1X8BA 4NIFB 4U8ZA 3LMHA 4QP4A 5I9VA 4F0GA 1URCA 3QUDA 3QXPA 4U0IA 3V6SA 3TUCA 5BMSA 1J1CA 4C58A 2G01A 3QCXA 4QYEA 5C4LA 2OF4A 4K2RA 1BMKA 4AU8A 4V0GB 3R9RA 4H3BA 3ZC6A 2UW4A 3FZSA 2BVAA 4Z16A 4A4LA 4ZZOA 3ZM9A 3ZDIA 3JVRA 5JN2A 5IKWA 3WE4A 5DRBA 4Q9SA 3CPCA 3OC1A 4EZ3A 3S00A 4O7LA 3FWQA 4RSSA 4F6UA 2ITQA 2UW9A 4R3CA 1AD5A 2CGUA 4BDGA 4FIFA 2RIOA 3EQBA 5CEPA 4KIQA 3H30A 4ZS0A 2A19B 3CQEA 5HCXA 5KMKA 2HYYA 4IWPA 4A7CA 2VTQA 4YPDA 4RX9A 4XLIA 1EH4A 4WBOA 4IX6A 4QMLA 1U54B 4X3FC 3WIGA 4BI2A 4I6FA 3NUYA 3R1YA 4FYNA 4QPSA 5L8JA 3IW6A 4OTPA 4GVAA 5GINE 4C59A 3FMMA 1KSWA 4L7FA 4QMVA 4HGTA 4RWJA 1WVXA 1A48A 1Q8TA 2VU3A 1AGWA 2WPAA 3GC0A 4WHZA 4WNPA 2GQRA 2XBJA 3D0EA 3FE3A 4I4EA 3R9OA 4RA4A 2ZJWA 3F5GA 3L8PA 5LWMA 4WUNA 3DDPA 4WO5A 3VS7A 2GNJA 2QOCA 3Q60A 4JDHA 4C4EA 4AXAA 2XJ2A 5HO8A 1ATPE 4P5ZA 4IXPA 4RT7A 4UMRA 3UZRA 4C38A 4DEEA 1UKHA 4DEIA 3ZBXA 3ZXZA 4FUXA 4L8MA 3KL8A 5E1EA 5LVLA 2W5AA 5AUUA 4RIYB 3TZMA 4AGDA 3KRWA 3QQLA 2Z60A 1OIYA 2WMBA 3HUBA 3R63A 2BKZA 2BZIB 5H9BA 3M1SA 1Q8ZA 2XK8A 3Q96A 3UE4A 2YZLA 1KE5A 2QOKA 4PP7A 1YOLA 5CXHA 4V01A 3DTCA 3WARA 2UW3A 4JIAA 4RC2A 3HMMA 5JKGA 3BYMA 5HVJA 3QTIA 3KVXA 3UPZA 4PPBA 4RC4A 5EDRA 3UOKA 1B38A 1Z9XA 2UZEA 1OPLA 3LXPA 4ACCA 3UNZA 3C5UA 4UWCA 2QKRA 3EQPA 4ANSA 4IQ6A 4I94A 3VS6A 2XYNA 3ENHA 4ERWA 3HMNA 4YTFA 5IMEA 1DAYA 3PY3A 4DTAA 2QONA 2ITYA 3FLSA 5EFQA 4ZK5A 3RK9A 1PYXA 2UZOA 3MY0A 4RWIA 4YZ9A 2VN9A 5EDQA 5H2UA 4FT9A 1PJKA 3UMXA 5L8KA 5EKOA 2LAVA 1ZZ2A 3VJOA 2KULA 2BFYA 3IW4A 3DFCB 4H1MA 4BYJA 5HORA 2B0QA 3CC6A 2B54A 4QTDA 1NA7A 3B2WA 4JT3A 4D58A 5AUYA 1CKIA 2XNBA 3KRRA 4FTQA 3QX4A 5KZ0A 5EHOA 4C4JA 3F61A 4J53A 3PXKA 2PVYA 5IQCA 4U6RA 3GU4A 3L8XA 5HLWA 3HA6A 2ESMA 3TUBA 4O6LA 3N4TA 3I6WA 1R0PA 1OUYA 3MTLA 4FVRA 2O64A 4YGAA 5GZ8A 4FT0A 4IB0A 2QOIA 3FMJA 3LXNA 3R7GA 4FV3A 4RBLA 4LL0A 5KZIA 2W4OA 5T68A 4F6WA 3DA6A 1YHWA 4PPAA 3PY1A 3EQGA 3K2LA 4BBMA 4PV0A 1JSVA 2VGPA 3OCTA 4FTCA 5HBJA 3OXZA 4UEUA 1H1PA 5HNGA 2JITA 4RJ5A 3FMEA 3KF7A 5HE0A 1XH6A 3R7UA 2J0JA 2HY0A 1GOLA 4TYIA 2W1CA 3PVWA 2G1TA 3ZSGA 4IVCA 4D0XA 3RNIA 2YCFA 2E9OA 4WSYA 1H27A 2RG6A 1WVWA 4L7SA 4EH4A 1Q8WA 4I6QA 3UMWA 3MDYA 5GJFA 2VTLA 4FG9A 3O71A 3L9MA 4G2FA 5DR2A 1XH7A 3V5WA 2VTOA 4I21A 4L46A 5AV4A 3EQFA 4YC6A 3S2PA 5M4UA 2CLQA 4CYIA 4GG7A 5JZJA 2C6KA 1UVRA 1ZARA 4GT4A 2XKCA 3BV3A 3PE1A 4JR7A 4AA0A 3CE3A 5EKNA 1FGIA 3QYWA 3WF6A 3AT2A 3KRLA 4JAJA 1PYEA 3TTJA 4CYJA 2CHLA 4XX9A 3A62A 2AYPA 2GHGA 3FKOA 4P2KA 5AX9A 3GC9A 4II5A 3AC3A 3Q32A 5LVNA 4FOCA 4RIWB 5BVWA 2PWLA 2NP8A 3H9RA 3ORNA 5CAUA 5DYJA 3G9NA 3RM7A 3BGQA 5CENA 2G2FA 4EH9A 3S3IA 5CI6A 1XO2B 3KFAA 2F57A 5AR4A 4EL9A 5AP4A 3GQLA 3NNXA 4XMOA 5J5SA 3QQUA 1QCFA 2PVNA 4IZAA 2O63A 3G2FA 2BCJA 2OFUA 3HDMA 4I41A 1P2AA 2ZYBA 4USEA 3Q52A 3P5KA 4ALUA 4YLJA 4L44A 2UZTA 4EZ5A 2W1IA 4H1JA 3ATTA 3F2NA 4FTRA 2QU6A 1YXUA 3OTUA 4GU6A 4BDCA 2WMXA 5AAFA 3EL8A 3TJCA 4CFNA 4EOIA 3EKKA 5L2IA 3VUHA 4IAKA 5B2KA 3TDWA 4D4RA 3G6HA 3R2BA 4FX3A 1KV2A 1Z57A 4L67A 2ITWA 1J91A 1ZMUA 3BHUA 3D5XA 1CDKA 4JDIA 3CIKA 2YAAA 3BHTA 3DK6A 4IAIA 1YDRE 2GDOA 2UV2A 5CEOA 3MWUA 2VWWA 4ITIA 1GNGA 5AP6A 5CNOA 4YZMA 1JKTA 1XR1A 3EFWA 4XG4A 5L6WL 3U9CA 2B7AA 4R8QA 2H34A 4Y83A 2XEYA 4PL5A 5EHYA 1UWJA 1YOJA 4D2PA 4W4YA 2W1HA 4EC9A 2X1NA 4EHGA 4YUQA 3KB7A 1JSUA 4W4XA 4KBCA 4BDIA 3A99A 2OJ9A 5KMIA 5L8LA 3OW4A 4AGWA 4CTCA 1Q8YA 3P1AA 1J7LA 4WBBB 4MXZA 1ZMVA 3PA4A 4WNOA 4Q5EA 3PA3A 4FKOA 4LUDA 4CFFA 3TV6A 2YJSA 3GVUA 4HZRA 4ZLZA 4MF0A 5KBRA 2P33A 3QU0A 2R2PA 5TF9A 2QLQA 4E93A 5M51A 4FEVA 2YJRA 1GZ8A 4BHNA 3QCSA 3R0TA 4E3CA 3PY0A 4M14A 1PXKA 1WBOA 4G1WA 4QMMA 3AC5A 3KXGA 3Q5ZA 4UMTA 5A4CA 2CLXA 2XVDA 3OCBA 4JXFA 1QPJA 4U3YA 4M8TA 5AV3A 3R7YA 4BDHA 5HG7A 3TJDA 4NZWB 4KABA 2WTDA 4G5PA 4GG5A 3Q5IA 2VO0A 2BAKA 3CGOA 1DAWA 3CLYA 5K0KA 5KKRB 3ROYA 2XA4A 4Z7HA 4G3GA 1G8SA 4X3JA 4BCPA 5CEIA 2PMIA 4XBRA 5AMNA 3PFQA 4ID7A 4U43A 5FBNC 3D2KA 4OTRA 3SDJA 1OPJA 4HYUA 4BGGA 3MY1A 2A2AA 4IFGA 4E26A 1KE8A 4UX9A 2VWYA 4O82A 4IZYA 4I23A 2X8EA 2YM3A 3A61A 3W33A 1OI9A 4LGGA 4EHVA 3BBWA 4X2FA 4YTIA 3ZRLA 2F2CB 4WOVA 1H0VA 2X7GA 3QQKA 2CDZA 3SHEA 2CCHA 2VTJA 3PXYA 5IPJA 3AG9A 4EC8A 3TV7A 3KU2A 1OVEA 4KD1A 2WMVA 3EQRA 3E87A 4I3ZA 3I7CA 4KINA 4MNFA 3UO4A 4LGHA
chains in the Genus database with same CATH superfamily
2XNOA 3SG8A 4CFVA 3GI3A 3WBLA 3QD0A 4IADA 3LCTA 2BAJA 4LL5A 4C0TA 2FA2A 2ITNA 3KF4A 5EG3A 4JNWA 3VF8A 4BC6A 3A7HA 4PDSA 4TL0A 3QQGA 4DT8A 2IZRA 3A60A 3PJ8A 5DN3A 4G6LA 4X2NA 3BBTB 1R39A 2F7XE 3IO7A 4X2JA 4CFXA 2FVDA 3VQHA 5KKRC 5CSHA 5JFSA 5CT7A 3UTOA 2RGPA 2AUHA 5M08A 3DK7A 4DF3A 2BHHA 3LFBA 4KIKB 5E8VA 3AMBA 4YJNA 4IJPA 2RFDA 4HYSA 4UN0C 4GK3A 2XM9A 2FYSA 4FSMA 5EM8A 2E9VA 5A6OA 2QHNA 3GCUA 2CGXA 4FG8A 5H8GA 3KULA 4L00A 4O7SA 3GENA 4D2RA 4FODA 4YJSA 4D28A 1GJOA 3BEAA 4DGMA 4KAOA 4NSTA 3QYZA 4S33A 3LFEA 3IDPA 4FNZA 4V05A 2QOBA 4F7SA 3GXLA 4AP7A 4R78A 4QTBA 3PXQA 4B99A 4CZTA 1CMKE 4PRJA 2HWPA 4G3FA 4EH6A 3VBWA 4IX3A 1M7NA 4J7BA 1YVJA 2X0OA 3SXSA 4D4VA 4ANQA 1YKRA 1KE7A 4AA4A 2IZTA 3F3WA 4MD7E 4DGGA 1MRVA 1P4OA 3BX5A 1VYWA 4G9RA 2PU8A 5HO7A 5E8TA 3ORLA 4O91A 3I0QA 3MH0A 1BL6A 2C6TA 1URWA 2IW6A 2KTYA 3D4QA 4G9CA 4LI5A 4UZDA 4WG5A 3LPBA 3UC4A 2QOHA 4XNEA 3WZJA 2HK5A 4EH7A 4ZSAA 4BN1A 5K5XA 4IC8A 3W2SA 3OY3A 3QRUA 5F9EA 5KMLA 3ORKA 2I40A 3U54A 1JBPE 4AT4A 2FH9A 2I0YA 4KNBA 4N6ZA 1XH9A 2ERZE 4IIRA 4ZSLA 3V5PA 2XS0A 3HV5A 5EW9A 3F5PA 3D9VA 4S32A 4QP8A 4CMOA 1CM8A 3K5UA 3NCZA 4FV8A 3LFCA 4UZHA 5HGIA 4EK6A 3H3CA 4JQ7A 3R8PA 3T8OA 5AAGA 3Q04A 4L42A 1H08A 2X8DA 2WEVA 4EK3A 3HDNA 5CAQA 4MBLA 4IWDA 2PVLA 3MW1A 3BYSA 3U4WA 4AT3A 4YPSA 4B6LA 3IW8A 3KXHA 1UA2A 2W5BA 2BFXA 4XG8A 5HG8A 2QLUA 4X6RA 2FB8A 2FO0A 2LGCA 4M13A 4X0MA 3LQ5A 5HCYA 3F5XA 4RIXB 3W8QA 3R7IA 4DEAA 3EYHA 4AACA 2NRYA 2IW9A 5K4JA 4TY1A 1LUFA 4DFXE 1DM2A 2IVSA 4F70A 4G3EA 1OGYA 5DEWA 3OW3A 3R02A 3PIYA 3DJ6A 3AD6A 3NIEA 4L3LA 5HE3A 2X8IA 5AAEA 5T3QA 3MH3A 4W9XA 3RAIA 4IDVA 2JKMA 3DB8A 4BY9E 4RMZA 4QYYA 3ATSA 5J95A 2CNVA 3FC1X 5BVDA 5B0XA 2WTIA 1T45A 2GQGA 2HY81 4JR3A 4GJ2A 4D4SA 3LCKA 1VYZA 3V01A 1W2DA 3F7ZA 4R1VA 4Z7GA 2BIYA 5IQAA 4FKVA 4I0TA 1GIJA 2YWVA 1H1RA 4FKLA 3IOPA 3O8UA 3FLQA 3Q9YA 5J9YA 3KXXA 4MKCA 3FMLA 4K77A 5M4IA 3RVGA 5CASA 3E8EA 3G9LX 3BL7A 5CZIA 2BRMA 4U5JA 4WT6A 5I9ZA 2WO6A 2R0IA 3D14A 3BIZA 1GIHA 3IW7A 3ZZEA 1ZYSA 3W0PA 3DQXA 4XJ0A 5K4IA 2WD1A 5L4QA 2WKMA 4JLCA 4RQKA 3MH1A 2X2MA 4EK5A 5I5ZA 3KN6A 1LR4A 4O0XA 4QMQA 5CQWA 3SX9A 3V8WA 4TKSA 3C5IA 3NVMB 4NCTC 4A07A 2C3IB 2QNJA 3OOGA 1YHVA 4ANBA 2DUVA 3ZMMA 3ZYAA 3MBLA 3MFRA 4ACHA 2WMTA 1XBBA 4UYAA 4B8MA 1SVGA 1W7HA 3DBFA 3FMNA 1IA8A 1U5QA 1Y57A 4CGAA 1H26A 4IX4A 5DE2A 3W32A 4TWNA 5J79A 2JFMA 2XNPA 4WG4A 3JXWA 2W1FA 3OTVA 1M7QA 4BCOA 4NYEA 2IWIA 4DTKA 4BCQA 2UZLA 2P4IA 4K18A 2XIYA 2BRNA 3P0MA 5FEEA 4IJ9A 3TYKA 3VONA 4FG7A 4QMNA 3THBA 4MD9E 3R30A 4BCNA 2XAMA 4ZSJA 5LVMA 4ZZMA 1BYGA 3WI6A 4B0GA 1J7UA 4D4YA 3DKCA 5FP5A 4F7JA 4BBFA 3DBEA 5KHWA 2VV9A 5IEVA 2OIBA 2PUNA 5DA3A 3II5A 5AIRA 5E7RA 4QEBA 3VUGA 2X39A 3FKNA 3D7TA 2QD9A 1V0OA 2QOQA 3ZDUA 4BIBA 4BYIA 1WBNA 3NS9A 4ZJVA 4DDGA 4F9CA 3OF0A 4F63A 2CSNA 2WQMA 3MPTA 4X2GA 4XBUA 2CKOA 4FE2A 3UIXA 3EQCA 4DFBA 2J4ZA 4JG7A 3NX8A 3CCNA 2C1AA 5HE2A 1Y91A 3LKMA 1TZDA 2BPMA 2IVVA 2YFXA 3F9NA 2B9HA 3I6UA 3VS5A 2IVTA 4TNDA 4AOIA 3KK8A 5FBOA 3Q4TA 4ARKA 4OW8A 1QPDA 5LMKA 2JAVA 4TYHB 2PMNX 3P7AA 2IVUA 4FNXA 5AV1A 3TNIA 5CF4A 3LCOA 4EH8A 4APCA 3D2IA 2YLEA 1FBNA 4IMYA 3ACKA 5A46A 4UB7A 4LRKA 5JGBA 3ULZA 3DZOA 4CG9A 3B8QA 3F82A 4M7IA 5HBEA 5BYYA 3POOA 3TNPC 4ZY4A 5FQDC 3LJ0A 2YITA 4XG6A 1NT2A 4YJPA 2JKKA 3CJFA 5K3YA 1GZOA 2IO6A 4GYGA 2QHMA 3DS6A 4YU2A 4D2WA 3LHJA 3OY1A 5IH6A 4N6YA 3L9PA 2WQEA 4F99A 3Q6WA 4E7WA 3WF8A 3LIJA 1H01A 3IGOA 4MNEB 4ZTNA 3UIMA 3UNJA 4EH2A 2VWZA 1SNUA 2BRGA 3OD6X 1F3MC 2XKFA 3ORXA 4AZFA 5IQEA 3ML1A 3RPSA 3QKKA 5C8NA 3COIA 1NY3A 2ZDUA 3FUPA 3O2MA 4BIDA 1B39A 4FZAB 3I5ZA 1YXSA 4FZDB 4O4BB 2PE0A 2BRHA 3HL7A 2UZBA 4BICA 4DH5A 4K6ZA 3HP5A 4G6OA 4Y85A 5E8YA 3VBQA 3VS0A 1KOAA 4ORKA 5HLPA 3P7CA 2IJMA 5I9UA 4K1BA 3QF9A 5E90A 4ZP5A 3R1QA 4WKQA 1Y6BA 2R7IA 4YZCA 4WA9A 5FTQA 3ODZX 1Q5KA 4TWOA 4RG0A 5IEYA 4X7QA 2BKKA 4DTBA 4BKYA 4A9UA 2XB7A 2EB2A 4FJVA 3UG1A 4YHFA 3MI9A 1OBGA 5AR8A 5M44A 3ZM4A 3E5AA 3DQWA 3F3VA 4ITHA 4TPTA 5C01A 2QODA 4X2KA 3BZ3A 5IZFA 5FGKA 1LP4A 3AC2A 3BQRA 3ZO4A 4BTJA 4BZDA 3BU3A 5FDPA 5BYZA 3QX2A 3UP2A 3KREA 4BZOA 4ZTLA 4PL4A 2J6MA 1Y6AA 4K11A 3VF9A 2JGZA 3FSKA 3M42A 1ZLTA 3PSCA 4HZSA 2OW3A 4GV1A 4IAYA 2C5NA 4JG8A 4E4NA 4DG3E 1ZYDA 3O8TA 1UU9A 3NW6A 4NEUA 4CEGA 3UZTA 3LXLA 4GUEA 4CG8A 4YZDA 5CU4A 4RIOA 2IZSA 3OWJA 4IM0A 3PP0A 3R83A 2Z7LA 3PJCA 3RNYA 3H10A 3IKAA 5ETFA 5L3AA 2WQBA 3W2CA 4XUFA 3NRMA 2QU5A 4OT6A 2E2BA 4NJ3A 4FKUA 2G2IA 3DJ7A 4NM5A 4JX7A 5DH3A 4GJ3A 2FUMA 1WBWA 2QOLA 3ZS5A 1ZRZA 1YRPA 4P5QA 4O6EA 1STCE 2YIWA 5CZHA 3ZBFA 3VW8A 4LOOA 4MK0A 2PUIA 3OZ6A 2XK4A 4M66A 5CYIA 3GCVA 3E64A 1H07A 2YIRA 3GT8A 3E92A 3TMOA 3BGZA 1OL7A 3FHIA 3HUCA 3LFAA 4EONA 3VRZA 4C4FA 4LM5A 4O0UA 4FKJA 3ZRMA 2GHLA 4ZTHA 3W2OA 4DEHA 4MHAA 5BNJA 1VEBA 5JZNA 4W8EA 2W06A 3QCYA 2GNLA 5B2MA 4RRVA 2YDJA 3FDNA 3LFQA 2PZ5A 4KB8A 3LFDA 3NVKI 4X3FA 1ST4A 5IQHA 4FEXA 1DI9A 1PXJA 2HZ4A 3MS9A 4M84A 5CSVA 5ICPA 3G0EA 4O83A 3NNUA 1OIQA 4R77A 2E9NA 2ZM4A 4FIJA 5TKDA 3DOGA 3ZU7A 3CQUA 3DV3A 5CSWA 5EQEA 5KMJA 3UQFA 5IG1A 4YZBA 4QO9A 3KRXA 4GIHA 4HGSA 4RJ6A 4M3QA 4TRLA 2VX0A 1HOWA 1PW2A 4YBJA 2B9JA 3GOPA 4IHPA 4NIFA 1WFCA 2XYUA 3D5VA 3QALE 4Q2AA 4C02A 3OP5A 5LARA 2QG5A 5J5TA 3RWQA 4LRMA 4YBKA 4L68A 5CAVA 2R3HA 3SG9A 5CU0A 3SXFA 2C3JA 4PPCA 3PPKA 2X4FA 4XLVA 3RPVA 5JRQA 3NAYA 3QRTA 2W1GA 4EOSA 2Y7JA 3SAYA 2CN8A 4ALVA 5GZAA 2F49A 4FNWA 4FNYA 4U44A 2QI8A 4KS8A 4C33A 4ZLOA 4AUAA 4IM2A 1JWHA 3WF5A 4HVGA 4D1SA 5CEQA 3FYKX 1KE6A 4FV4A 5L2TA 3QC9A 3PUFC 5DLSA 4ZSEA 5F20A 2J0MB 3TKUA 2ITVA 5LVPA 3I5NA 2AC3A 1U54A 2ZM1A 2J7TA 5L6PA 3W18A 4K0YA 3UDTA 2UUEA 4DHJA 3PPZA 4G3DA 4KKEA 3NUAA 1FINA 2V62A 2CKQA 1JPAA 2WIHA 2WMAA 2GNFA 2VTHA 3PJ1A 4MXCA 3WZEA 4F1MA 1J7IA 2X9FA 3SQQA 4AZVA 4MF1A 4RX5A 2BUJA 2J51A 2EUFB 4AZWA 5BVKA 2WZJA 2YIXA 3ZHPC 3E7OA 4PL3A 1BKXA 1M2PA 4AQKA 2ITUA 4TYEA 3V51A 4O0WA 3R21A 4CV9A 4RC3A 5AP1A 3UVPA 4JG6A 4PQNA 4DC2A 4ACDA 3RMFA 4JBVA 3MJ2A 3SGCA 3M11A 5CEMA 3I7BA 3FZOA 3R28A 4HGEA 2X0QA 3AC4A 4LV7A 3AT4A 2X7FA 5A4TA 2XBAA 3MVJA 5EK7A 2XIRA 3ZUVA 1SZMA 3PDTA 2XKEA 4XYFA 3NFFB 4I6LA 2XCKA 4FKSA 2C5YA 3KGAA 4HYIA 2BTRA 3OUKA 3IDCA 5GIPE 2GS6A 1WBPA 3DKFA 3E63A 3F88A 2OGVA 2YCSA 2EWAA 4F9WA 3H0YA 1FPUA 1MQBA 4QYGA 4B8LA 4J1RA 3JVSA 4TT7A 3WZKA 1TFFA 3MA6A 4BWXA 3WZUA 3FMDA 4DCAA 1ND4A 1R1WA 3HGKA 4EOQA 3KQ7A 4F65A 3PP1A 2XAOA 2OFVA 4OTFA 4PMTA 4EWQA 2WMRA 5JMSA 4E4MA 4JOAA 3NUPA 4GCJA 5KX8A 3ORIA 4ALWA 3LM5A 2JBPA 4HPTE 4WG3A 4X21A 5HHWA 4A9RA 4CMTA 4YHTA 4F1TA 2QG7A 3BLQA 4PDOA 2J0IA 4I20A 4WIHA 2R9SA 3KC3A 4RQVA 4DH8A 4F7LA 3GFEA 4BJJB 2C6DA 3MFSA 4A9TA 2FSLX 4BGHA 3BLRA 1OIUA 2Y4PA 4GW8A 3CSVA 3H0ZA 1YDTE 3G0FA 4DYMA 4EOOA 3GCQA 3KA0A 4IVDA 2WQNA 4R3PA 5EDPA 4EOJA 3R9NA 4L52A 5HD4A 3PG3A 3MSSA 5CTPA 4OUCA 3RALA 3GP0A 3G6GA 4BDKA 2PHKA 4CNHA 4CZUA 4WRGA 5B7VA 4M68A 3NMUF 3NDMA 4QPAA 5ANEA 4OTQA 4XH6A 4GVJA 4M69B 3MB7A 3OBJA 1P5EA 3GC7A 3RI1A 3OEFX 2YACA 2QO2A 2XANA 2ZB0A 2ZV2A 3COKA 3RAKA 4BVUA 2XK7A 3FV8A 4G34A 2YIYA 4KS7A 1I09A 4UY9A 3O96A 4B4LA 4EOPA 3NIZA 3HMOA 1YI6A 3OHTA 4MTAA 1XHAA 2WNTA 3UGCA 3ZEPA 5IQIA 3KK9A 5BQ0A 5HZNA 4MWIA 2PZYA 3W2RA 4FSRA 4WRSA 3EYGA 3CBLA 4AW1A 2JIIA 3OWPA 1Q4LA 3RGFA 4DGOA 3EHAA 3H9FA 4KRCA 1Z5MA 3LXKA 4D2VA 2NPQA 1HCLA 4NFNA 1ZXEA 2O65A 1JKSA 4JL9A 4IM3A 1XKKA 4FZ6A 3F69A 2PVJA 3CKXA 3WYYA 3SVVA 2ZFYA 4FSZA 2Q83A 3SRVA 4FV0A 3TEIA 3MA3A 5FWKK 5IA4A 2PUUA 2YIQA 4EKKA 4O7TA 5CQUA 2CKEA 3QRJA 4M0ZA 3IECA 4P4CA 4XG2A 3V5QA 2F2UA 4PX6A 2YM6A 4RVTA 3NZ0A 3EFJA 3HRBA 4EQUA 3GU8A 1J3HA 3Q9ZA 4A06A 4LFIA 3MJ1A 5K9IA 4O7YA 5DNRA 4FIEA 3HX4A 4USFA 4Y46A 3RP9A 4CXAA 3BYVA 4LV8A 4XOYA 2C4GA 3FXWA 3R1SA 1ZWSA 4PDPA 3VULA 5CAPA 5IA0A 4FV5A 5FTGA 4N70A 3FPQA 2UW7A 4G16A 4D1ZA 3QAME 2ZVAA 1XQZA 5IA5A 3FJQE 3MY5A 3ZEWA 5IQDA 4FTKA 1R78A 2RFSA 1PMVA 2BMCA 3PLAE 4OTIA 3VNTA 4A9YA 4BCHA 3UQCA 1YWVA 4IEBA 3UO6A 5CF8A 2GHMA 4OTHA 2F4JA 3SV0A 4DGNA 2WU7A 5AUZA 2PMOX 2PVMA 3Q2JA 2YLFA 2E9PA 4KBKA 1ZOHA 4FL2A 4AG8A 4EH5A 3I4BA 2W9ZB 4FT3A 4UMQA 4PMMA 4AAAA 4TZRA 4NL0A 1PXOA 2IEWA 4E5BA 1XH5A 4ITJA 4Z9LA 5I4NA 1CTPE 2JDRA 5FM3A 1ERKA 4LGDA 1RE8A 4I5CA 3NR9A 2C69A 4FSQA 3N4UA 5DIAA 3U4UA 4BI1A 3OUNB 2UZWE 4O27B 3DAEA 5EOLA 3S4QA 2WOTA 2C6MA 3RPRA 4C37A 5I3OA 5TOZA 3AQVA 4DFUA 4AWIA 3C4FA 2VWVA 3T9TA 2I7QA 3PRFA 4OT5A 1W83A 4PUZA 4Y5QA 2UW6A 4C34A 2C30A 4NM0A 5LCJA 5CSXA 2AEGA 3FI2A 1U5RA 4FKRA 2YWPA 1SVEA 2OWBA 3OFMA 5AM6A 3GFWA 1YWNA 4AOJA 4C8BA 2G9XA 4PWNA 4C7TA 4DG2E 2Q0NA 5M06A 2J90A 1IAHA 5D41A 5M57A 4IC7A 5KMOA 2EXMA 4AFJA 4J8NA 5CVGA 4ONAA 5HLNA 3RHXA 2PZRA 4MXAA 2WXVA 4QQTA 5CANA 5GNKA 2FSTX 4AN9A 3TWJA 2VTNA 1M17A 3ANQA 4QYFA 2R0UA 4OBPA 5A54A 4FV1A 4U3ZA 4BDBA 4I6BA 3W0MA 2BRBA 2GTNA 3TM0A 4JI9A 5L6OA 1YHSA 5B2LA 2J5FA 1R0EA 3TNHA 3U9NA 5IQGA 4DFYA 3ALOA 2DQ7X 3LMGA 2F7EE 3LJ1A 3NSZA 4FBXA 2GNHA 4H36A 3QFVA 4HNFA 5CU6A 4TXCA 5ANDA 2W1DA 5HBHA 3UVRA 3O17A 4BFMA 5AADA 3W0NA 4S30A 3ACJA 3E3BX 5E9EA 4ZMFA 3BELA 1U46A 4J95A 1WBTA 2RG5A 3L9LA 4C57A 3AKLA 4M0YA 2ZB1A 3GBZA 2P3GX 3AXWA 3KULB 4GKHA 4QNAA 3JR1A 2CNUA 5HO6A 4GFGA 4C2WA 1FMKA 2QOFA 3FI4A 3CTQA 4EOLA 4UMUA 3NYOA 1TKIA 4R7IA 2H8HA 3C0GA 2YHVA 3E88A 3IDBA 2OJIA 3Q9WA 3ORTA 2Y8OA 4G3CA 4IACA 3RHKA 1Q3DA 4IE9A 4FTOA 4XEYA 4KIPA 2Y0AA 4O2PA 1RQQA 4QP7A 2ITXA 4NTTA 2OJFE 4TYJA 4RVKA 5IMXA 5D11A 4YTHA 3ORPA 4HOKA 5DMZA 1TVOA 2BROA 2YDIA 3C4ZA 5E92A 3L8SA 4NH1A 4DH7A 4QMTA 3F5UA 3MB6A 4L3PA 3LOKA 2XZSA 4FTLA 5ANJA 3TDVA 5JGAA 3NGAA 3DLSA 3LE6A 2XIXA 3RBWA 2GTMA 3HMIA 3C4EA 5AR5A 2H6DA 3PUPA 4R3RA 2FGIA 2PVKA 4QMPA 4QQJA 1P14A 4UXLA 4YJVA 4YC8A 3TUDA 1PXPA 1IAJA 2NYAA 5A4LA 2H96A 2JC6A 2VNWA 3OWKA 1LPUA 2XNMA 4G6NA 3FZRA 4KIKA 4M67A 5HG9A 2V0DA 4B9DA 4MQ1A 3LCSA 4IWQA 3FQSA 5IH5A 2EU9A 5HG5A 2B53A 4PY1A 2A4LA 5A14A 3O7LB 1TQPA 1OPKA 3ROCA 4HVDA 2WB8A 3LQ3A 2BZJA 3E8CA 3DNEA 3VUIA 3UOJA 3AKJA 4UMPA 3VS2A 3QHRA 4L6QA 3L8VA 4XHKB 1L3RE 2WMUA 3RTPA 3ITZA 2OXDA 4RWKA 4E73A 5DEYA 4IANA 1OITA 4NM3A 3H4JA 3QRKA 4NFMA 4NW5A 1H24A 2VTAA 3K3IA 3SD0A 2EXCX 3EN9A 3O0GA 3R04A 5AP5A 3QUEA 3UNKA 1YOMA 2JKQA 4FV2A 2JKOA 1OZ1A 3V5JA 4MUQA 3TACA 5CSPA 3RAHA 2PL0A 2YCRA 4CRLA 1M2QA 3DK3A 3DXPA 5M4FA 3T3UA 5AUXA 3S95A 2R3KA 4HCTA 1XBCA 4YNEA 2BDWA 3OVVA 5FDXA 1YDSE 4DEGA 2BIKB 1VZOA 3VBTA 4CZYB 2QCSA 3VIDA 4L53A 3A7IA 5L2QA 4YC3A 4WSQA 3O23A 2VTPA 1F5QA 4MD8E 2IG7A 1NXKA 3OCGA 4GS6A 4HCVA 1G5SA 3OS3A 4QMXA 2WTKB 4YJTA 3ZLWA 4U79A 3BYUA 4RX8A 4I5HA 5CXZA 2VGOA 4ZAUA 5FRIA 4ACGA 4KKGA 5E1SA 3MVHA 3PA5A 2HW6A 1YWRA 2JDOA 3V5TA 5IA1A 3AC1A 5C8MA 5CT0A 5DR9A 2R5TA 4I5MA 4MEDA 5AR2A 4DA5A 1FQ1B 4HNIA 3HP2A 3PJ2A 2DYLA 2OU7A 3MV5A 4M97A 2VO7A 4EYJA 1ZMWA 5J87A 3FI3A 2QO9A 1GIIA 2HZ0A 3U87A 2VWUA 2EVAA 4UALA 5AP2A 4ZTSA 3R8UA 5AFVA 4DFZE 4NW6A 4HJOA 3B8RA 4FKTA 4O0SA 5HVKA 2QC6A 1B6CB 2XKDA 4C4GA 3OXTA 1GAGA 4PTEA 2Q0BA 4J52A 5J1WA 4NCTA 3NUXA 3QLGA 1K9AA 3JS2A 1F0QA 2UVXA 4QMSA 5BVNA 2BZHB 5ANIA 1BL7A 3DKGA 3W0SA 1O6KA 3JPVA 2FSOX 3RJCA 3A8XA 4BTKA 4QP1A 4ASDA 2CGWA 2W1ZA 3BEGA 5L2WA 2BALA 2WTKC 1PXNA 4GK4A 4LUEA 4EOKA 1IASA 4CLJA 4J98A 4YTCA 2YM4A 4L3JA 3WE8A 2PE1A 3OG7A 1UU8A 3QXOA 3ZFXA 4MH7A 5EM7A 3SKCA 5FLFA 2HWOA 3DY7A 4BIEA 4O2ZA 4XRJA 4AZSA 1K2PA 4AFEA 2PULA 3Q9XA 2UZUE 3A4OX 5DWRA 4FSUA 4FK6A 4BR3A 3QA8A 5BVEA 3D15A 1O6LA 4AF3A 1H1QA 5IA2A 4OBQA 5AJQA 4MVFA 4EJNA 1QPEA 2ITZA 3A8WA 2A27A 1V0BA 4CSVA 3I60A 4E6CA 5CY3A 3FSFA 2JDVA 5C1QB 3D7TB 5F94A 1NVQA 2OZAB 3OEZA 3TZ9A 4S2ZA 2C6LA 5AEPA 1WZYA 4AZTA 3ZSHA 3LFNA 2CGVA 1XBAA 5DHJA 2YERA 3HYHA 4XV1A 4ANNA 2BDJA 5HD7A 4JBOA 4AE6A 1REKA 3QGWA 3FXZA 5HCZA 3EFKA 2VTRA 3FL4A 3FLNC 5D12A 3A4PA 3MTFA 5AA8A 3QTQA 3GUBA 5FG8A 4F0IA 3CGFA 2UVZA 1E1XA 4ZY5A 2Z8CA 4FRFA 3EFLA 4IDTA 2ONLC 5EI2A 3UOLA 3UP7A 4FGRA 4FA2A 2ITPA 3DBCA 2W4KA 3P7BA 4R6VA 4IVAA 4XG3A 3SC1A 4APPA 4JAIA 2B9FA 1OM1A 3EN5A 3OOMA 4F09A 4FV7A 2WIPA 2VUWA 2V55A 2O3PA 3CR0A 3KN5A 3QD3A 2RFEA 4Z55A 4C36A 1XMLA 3UYTA 4KRDA 1SM2A 1SVHA 5FEQA 3FKLA 4ZJJA 3VRYA 2VWIA 4NM7A 2ZMDA 2GPHA 5EI6A 2XNEA 3JY9A 3VUMA 4MQ2A 4RX7A 1W2FA 1PXMA 2PK9A 4Y5HA 5CWZA 5EI8A 4D2TA 4DH3A 3QTRA 4U7ZA 1OIRA 1UNHA 2V5QA 3DGKA 3F66A 4BDJA 4FKQA 4BWPA 4FTMA 5IDNA 3WF7A 3IW5A 4GUBA 5BUEA 3ORMA 1FVTA 2C6EA 4AQCA 1PRYA 4DHFA 2W05A 4GFOA 4UV0A 2QR8A 3A7GA 4FTAA 1O6YA 5J1VA 2VNYA 3NUSA 3O5AA 4GMYA 4I5PA 4ZXTA 5GZ9A 4QMZA 3G15A 2XMYA 4E6QA 4EHZA 3ZUUA 3EJ1A 4FSNA 4I92A 4CT1A 3SA0A 3CPBA 2B4SB 4BRXA 4YSJA 2WTCA 4FVPA 4IB1A 3DAKA 4KUJA 2X4ZA 4I22A 2Y6OA 1H4LA 5AV2A 3VS4A 3R22A 5T6KA 2YABA 2VO6A 2BDFA 4RZVA 3C50A 4C3FA 2JD5A 3I0OA 1WCCA 5A6NA 5A4QA 5A9UA 2ZV8A 4AXFA 3PYYA 3BE2A 4D5HA 3GCPA 4FV6A 3PPJA 2PPQA 4NUSA 3OBGA 3SW7A 4R7HA 4NU1A 3FPMA 4O4FA 2I1MA 3PIXA 4BTFA 2YM5A 5M09A 4BZNA 3FMKA 3F2AA 4BCKA 3JYAA 3IQ7A 2C5XA 3VS3A 4IWOA 5CF6A 5AP3A 2PMLX 4YZNA 4RVLA 3DXQA 4EKLA 4ZLYA 5KHXA 4O84A 1REJA 3JY0A 5ETCA 2IF8A 4FOBA 1NVSA 5FTOA 2EXEA 3BU5A 4U41A 5F4NA 4RLLA 2O8YA 2R3GA 1V0PA 3DXNA 3ALNA 5IUHA 2G15A 2GS7A 5ANGA 3GU6A 4OLIA 5IQFA 2HIWA 4FKGA 5HTIA 5HI2A 1VLRA 3G33A 2QVSE 1MUOA 3PZEA 4HW7A 1JQHA 4ZEGA 5M55A 2J2IB 2QO7A 4XOZA 2X2LA 4Y95A 5E4HA 3K5VA 3FQHA 3QD4A 2ZV7A 4FSTA 4I93A 4PMSA 5HU9A 1OL6A 3MVMA 4GSBA 3U6IA 5HESA 3VBXA 4D9TA 5FD2A 4EZ7A 3QCQA 3FQEA 3M2WA 3QD2B 4GIIA 4DFNA 5EM5A 4FIHA 3L9NA 4ZOGA 3TNQB 3UO5A 5HOAA 2X9EA 2VO3A 1OECA 4O4DA 4P7EA 5DR6A 4AS0A 4I6HA 5AM7A 2YM7A 3P4KA 4XG7A 4U81A 1WBVA 3MYGA 2OICA 2VX3A 5DVRA 4UWYA 5ANKA 2UW5A 5AX3A 3FZPA 1PXIA 3AOXA 3W2QA 4AGUA 3Q3BA 3FC2A 3PWDA 3F7WA 4AN2A 4OTWA 4QPMA 3D5UA 5IH4A 2O2UA 3MFUA 3E8DA 3EOCA 3VN9A 2JEDA 4EK8A 2Z02A 2VD5A 2HENA 4RA5A 2JDSA 5DT4A 4DH1A 4EYMA 1G8JA 4OGRA 1KWPA 2A0CX 5M07A 4MYGA 4EH3A 4O1PA 2P2IA 1IRKA 3O50A 4GT5A 3GC8A 4QRCA 4YHJA 2WHBA 5CI7A 2B9IA 3HAMA 3QKMA 3QQJA 1CSNA 3MGYA