4BCHA

Structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
321
structure length
308
Chain Sequence
SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKAGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 9
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 308
sequence length 321
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bchA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bchA01
3C4WA 3FWQA 4FOBA 3P08A 5JSMA 1QPDA 3CTQA 4X3JA 3OW4A 5TOZA 3TUCA 4FV3A 3GCPA 1Y8YA 3QGWA 4X2NA 2ZV9A 5HOAA 4IC8A 1OIQA 1TKIA 5JZNA 2VWUA 4FV2A 3VJNA 5CSPA 4CLJA 4QQCA 2OXYA 3LXLA 1P14A 3JVRA 1I44A 3LFEA 3PJ8A 4ZTRA 5HBEA 3H9FA 2Z7LA 3KN6A 1JQHA 5J9ZA 4BTMA 3MPTA 5HKMA 5HESA 4OTFA 4C4GA 5BUEA 3JS2A 2UW9A 3ZLXA 4ZTNA 5CEKA 4AWIA 2GNLA 2PVNA 3H10A 5HVJA 4M13A 1DAWA 3A60A 3LFDA 5CASA 1H25A 2R3FA 4AZTA 3FMLA 5DYJA 3TL8A 3BYVA 2JDVA 4FNWA 4XHKB 2EB2A 3DTCA 3OOMA 4FV6A 3QFVA 4ID7A 4QP9A 3TJDA 3A7GA 4OTDA 3UQGA 2BDJA 4WG3A 4FKVA 5L6PA 3BPRA 3DJ7A 4RT7A 1VZOA 2XIKA 2PVHA 3HMMA 3CR0A 3W1FA 3E8DA 2PPQA 2C5XA 4P4CA 3KY2A 1M7QA 3POOA 4F63A 3ENHA 4D0XA 4DGLC 3I60A 2ZM4A 4EHEA 4U80A 4FG8A 3NGAA 4YC6A 4MXYA 2VWYA 4GMYA 5I9UA 3FQSA 4IB1A 4P5QA 4W4XA 1KV2A 4U6RA 3JUHA 4NM0A 3KGAA 4ZIMA 2E9OA 4AOIA 4CRSA 4L67A 3HYHA 5HI2A 5JGAA 1F3MC 5JKGA 3KCKA 4OBPA 4M67A 2ESMA 3FMJA 3ZLWA 3ELJA 2I6LA 4M69A 3RPRA 3UNJA 2ITOA 2R64A 4TYIA 4PY1A 2YZAA 3C13A 2CLXA 4D2VA 4EQCA 1FVVA 2BRGA 4ZY5A 4LGHA 3BYUA 5JGBA 3C7QA 2R3LA 2QOCA 3FC2A 5I3OA 3IW4A 2PUNA 4ITIA 5IH4A 2CKOA 4IAFA 3BRBA 3ZM4A 4YJSA 4FTTA 4ALVA 5IA4A 4C38A 3FBVA 4E26A 5L8KA 4TTHB 3KVXA 2RG5A 3PIYA 3AC5A 3OWJA 4ZAUA 4FVRA 3V5JA 3WZDA 5CZHA 5BVFA 1G5SA 3MGYA 4FKSA 5AV3A 2CCIA 1OGUA 4JDJA 5HE2A 3R1QA 4DH5A 4O0VA 1ZOHA 3ZZWA 4O7RA 3A7FA 3GNIB 3HDMA 3KMMA 1OECA 2OICA 4IX5A 4ASEA 3ZFMA 2I1MA 1V0PA 3ZHPC 4O2PA 3VS3A 4GVJA 2B9JA 3LOKA 2OSCA 3NNVA 4ACHA 4R1VA 2YLEA 3IK3A 2GFSA 1YDSE 4UWYA 5FP5A 4QRCA 5EKOA 4BCJA 3OUNB 4IAAA 4FL2A 2OZAA 1JSUA 4KRDA 3R7VA 4EZ3A 4J96A 4PTGA 3EN4A 3AMYA 4LMUA 3UIBA 2I0YA 2GHMA 2XIXA 4IWQA 5CF8A 3L8SA 4A4OA 5J1VA 4DFZE 4F0GA 1ZXEA 3N9XA 3NUUA 3MFTA 3QTRA 5HE0A 2QURA 2YIRA 4J7BA 2YACA 3KVWA 4U81A 4YZDA 4RRVA 4DN5A 3BBTB 3EFLA 5FXQA 2XK9A 4JT3A 5HX8A 2B9IA 2BTRA 1L3RE 2ONLA 4XOZA 2F49A 2P33A 3DT1A 4I22A 1FGKA 1WVWA 4PMTA 3UIMA 4YUQA 3EQGA 1HOWA 4BL1A 5FTOA 1XWSA 4RZWA 3UOJA 2PUIA 2PZPA 3DZOA 3SGCA 4M97A 3KULB 4JI9A 2B0QA 4U7ZA 4ANNA 2Q0BA 5FRIA 5KMIA 5CAUA 5I0BA 3L9LA 2YIQA 2C6DA 2QU6A 3ALOA 3Q2MA 4FGBA 5C03A 2GNFA 3VF8A 4D2SA 4ENYA 4AXAA 3JPVA 4AT5A 4PP7A 3LLAA 4EJ7A 3D5VA 1O9UA 4GUEA 4AN3A 1H24A 4JNWA 2VWXA 5J5SA 4QTBA 3ZEWA 3BHVA 3EFWA 4Y46A 1DM2A 4XG2A 1H28A 5LXMA 4UEUA 3BE2A 3ODYX 4JDKA 2VNWA 4JQ8A 3LCSA 3R2BA 1V0OA 3A8XA 3BGPA 3DB6A 3IS5A 3VUDA 4GYIA 5JGDA 2XJ2A 3D7TB 3NW5A 3OY1A 2R4BA 4PDSA 4F6WA 1OIYA 3PE2A 1U4DA 2Y4IC 4C34A 4Z7HA 2VTSA 5AV1A 2JDOA 1ERKA 3E87A 4I92A 5E8SA 1YOJA 3AC4A 1G8AA 3UZRA 4EH8A 2Z8CA 4UMPA 1XHAA 2QCSA 5GIOE 4EC9A 1FVTA 2QOFA 1GIHA 4H1JA 4N6ZA 2IO6A 4RVMA 3PFQA 4YHJA 4MF1A 3SW7A 4AA0A 2WMVA 3PSDA 3UOKA 4L3PA 3VS2A 3ZO3A 2BZIB 2BFYA 3O8TA 5LCJA 5LVNA 4N6YA 4ONAA 4TT7A 4R3RA 4BGQA 1Q3WA 4HGSA 2GQGA 3IG7A 4O0UA 3MFUA 3DA6A 5DNRA 5EM6A 2ZDUA 3W10A 5BVDA 2VO7A 1L8TA 4CGAA 4L3LA 3A2CA 3BEAA 2XKEA 4BTKA 3DJ6A 4HYSA 3CSVA 2FYSA 5KE0A 4PNKA 5C01A 4UMTA 3BWFA 3ITZA 4FTLA 2UV2A 3KXHA 4QNYA 4DEEA 4IZYA 2WQOA 4AN9A 1R0PA 4U5JA 3R6XA 3HMIA 5EG3A 4AZWA 4F7NA 1ZYDA 1Q41A 4BHZA 4QYYA 3FE3A 3ZSHA 5JFXA 1PYEA 4W9XA 5A9UA 1P4FA 4Y5HA 2PE0A 3D2KA 3UO4A 5CSWA 4MTAA 3RM7A 3P78A 5M08A 1OIRA 4MXXA 3NIEA 4S30A 4OUCA 5GINE 4FSQA 3TKIA 3I7BA 3FLZA 4OW8A 3E62A 3HLLA 4G1WA 4QPAA 4CTCA 4BDAA 3FMDA 2ETRA 3IW6A 3QUEA 4JVGA 4ANBA 3R8ZA 3NYVA 3GOPA 4DG3E 4L7FA 1WCCA 3UPXA 5CAQA 2OF4A 1JAMA 2R3QA 4ASZA 3HECA 3LXNA 3KU2A 1UU8A 2IVSA 3DFCB 4JBPA 5GZAA 2JFLA 2XNOA 4M12A 3ZFYA 4BI0A 3R7GA 4QMZA 2Y7JA 2WTJA 3L8PA 2X1NA 3GP0A 4TNBA 3SD0A 3ZUTA 4GKHA 3BQCA 3LVPA 5DWRA 1R39A 4S32A 4RIXB 3RCDA 1Q62A 4R1YA 4Z55A 5JH6A 4AGUA 1WVYA 3IOPA 4EUTA 2ZB1A 3QXOA 3PA3A 1NVQA 5F94A 4GT5A 2ITWA 2VGPA 2VTHA 3FMEA 4O22A 4MQ1A 4XBUA 4GRBA 3DKOA 3GCVA 5IQAA 2RF9A 4GL9A 4U43A 3QD0A 2WGJA 3BYSA 3GB2A 3ODZX 4O1PA 5AR5A 1OBDA 3BV3A 5L2WA 2WTDA 3KULA 4U0IA 3A7JA 5E8XA 1O6YA 4EK4A 4CG8A 1M17A 4AW1A 4XP3A 1XH5A 3BU5A 2BDWA 3QKMA 5AP7A 3A7HA 3PJ3A 3NEWA 5BVOA 4RFZA 4YZ9A 4NJ3A 4BRXA 2IVTA 3NWWA 3V01A 3BV2A 5IQHA 4RC4A 3FV8A 3H3CA 3IW5A 4FV8A 2RSVA 4EOPA 2ZVAA 5C8MA 1B6CB 3ZSIA 4G34A 5H2UA 4F6UA 3RP9A 3C4EA 5AUVA 2ERZE 3AT2A 5CVFA 4CV8A 5J8IA 3AC3A 4BBMA 3D7TA 3GC0A 4FGRA 3F2RA 3NUNA 2V22A 3EHAA 4QMMA 4YNEA 3F7WA 4H05A 3GOKA 4O0TA 5E8TA 5IUGA 3G51A 4KB8A 3I79A 5M4CA 3U6IA 1NW1A 3CEKA 3QCSA 4UN0C 2ZV2A 2ACXA 3VHEA 3LQ3A 3K3IA 3CTJA 2W4JA 2E9UA 1REJA 3NW6A 3R2YA 4JLCA 3WI6A 4V0GB 4H39A 2X9FA 3BQRA 1CM8A 1YHWA 2C0OA 3TXOA 1H26A 4KSQA 4EOKA 4ACMA 5EW8A 2Y0AA 5HO7A 3PYYA 1ZZ2A 4AW0A 3FKNA 5F95A 4YTHA 5LARA 5CEIA 1XBBA 2B7AA 4I5HA 5IH6A 5IG1A 3EWHA 5FBOA 2W05A 3TIYA 5AP0A 4BVUA 5I9ZA 1ZZLA 1O6KA 4DTKA 5M56A 3HEGA 5AAGA 3EQCA 1OKZA 2GDOA 1NXKA 3HUBA 4MH7A 1FGIA 4EJNA 4NM3A 4DTAA 3CD8A 3KMUA 3S3IA 4AW5A 4DEGA 5JRQA 2FO0A 4ZTQA 3UG1A 4YPSA 4Q9ZA 1Z5MA 3Q32A 4FTCA 5LWNA 2BKKA 3QX2A 4NUSA 3TIZA 2X0GA 5K9IA 3IO7A 4YJTA 4C61A 2P55A 3BI6A 5AA8A 3FZOA 3U55A 5F1ZA 4EORA 3QQKA 2Z02A 4FODA 2HELA 5IUIA 2F7XE 5CAPA 3T9TA 3FY0A 4BDFA 4BKJA 4F7LA 3HV7A 1PW2A 3NLBA 3PSCA 2EWAA 4FNZA 5F9EA 2PVFA 4WUNA 3KMWA 5EFQA 4FIJA 2GNGA 4GK3A 1H27A 2OJ9A 4ERKA 2UZOA 4RFYA 2JDSA 3QRUA 1YDRE 1ZAOA 4ANQA 4OBQA 2GTNA 3GCSA 3QRTA 3QTUA 2X9EA 2PZYA 4H1MA 3GUBA 2A2AA 1MQ4A 5H8BA 5AAEA 4ZK5A 5IA0A 4P7EA 1UNGA 3QRJA 3QLFA 1OZ1A 1WBPA 2C6LA 2R7IA 5HD7A 4E3CA 3ZDUA 2FA2A 1T45A 1OMWA 3CXWA 3C0IA 5DHJA 4QTCA 3OP5A 3SG9A 3NVKI 4RIXA 1JWHA 4DFUA 1H01A 3F69A 3MVHA 3O51A 2FSLX 1H08A 2GHGA 2X81A 4D4SA 2BRMA 3D5UA 5E8YA 2OG8A 5AUWA 3B8QA 2XK3A 3VF9A 2XH5A 3OEFX 4EH5A 1WMKA 5BYYA 4YJOA 3FLSA 5CSXA 3MS9A 3RCJA 2OO8X 4BWPA 4LGGA 2UZDA 3OCSA 4U42A 4UYNA 4W9WA 3ZC6A 5HCXA 5IQEA 4C3RA 5CF5A 3E88A 1YXSA 1Y6AA 2QQ7A 3KL8A 3PXKA 4O7YA 5J9LA 4LOOA 4EOQA 2QOBA 3OG7A 3K2LA 3Q4ZA 4PMPA 3KA0A 3P7BA 5DT4A 4E73A 3LFAA 3R9HA 4RLLA 3OC1A 2IVVA 2CKEA 3BLRA 3FKOA 3GXLA 2YEXA 3QUDA 4KIOA 3FZRA 3Q4CA 2YM3A 3VS4A 4F0FA 1MRYA 3AGMA 3PJ2A 4GVAA 5DMZA 2OH4A 3BE9A 4FTAA 4RX9A 3OWPA 2QOKA 3GFWA 4IFCA 4FKQA 4OTHA 2HIWA 4BC6A 2Q0NA 5IMEA 5DVRA 2XNMA 5DEYA 3MPAA 3LKMA 5DA3A 5AP5A 2Q83A 2J51A 2WD1A 4FZDB 3FXWA 5HBJA 4G6LA 4ENXA 2ONLC 2AC3A 1UWJA 2XK6A 4C4EA 2WTWA 4GU6A 4EH3A 2WMXA 4C62A 4C8BA 4CFNA 4BHNA 4JBOA 2HZ0A 3OCBA 3TV7A 3NS9A 4V0GA 4DG0E 1JVPP 4S33A 3U6HA 3IDBA 4LI5A 3ORMA 1T46A 3KRXA 4BN1A 4PNIA 3ZS5A 3VWAA 3WF9A 3VJOA 4FZ6A 2VO6A 2CCHA 3OFMA 3AMAA 1IG1A 3EQFA 3C4ZA 4O6EA 3MY1A 2KULA 2PUUA 3RK5A 4BIEA 4YZCA 4LUEA 5ETAA 3SXSA 3F9NA 5BMMA 3W2PA 2XKFA 4W4YA 5AUZA 5IEVA 5KMLA 3LJ0A 4BCIA 2Z7SA 1R0EA 2FSMX 1HCKA 4N0SA 3EKNA 5HTIA 2ITQA 4HNFA 4LM5A 1RJBA 5FEQA 2NPQA 4F9AA 1JKSA 5LVLA 4WO5A 2XIYA 3DNEA 2XS0A 5DRDA 3KRLA 4IDVA 5JZJA 2XEYA 3OCGA 3FPQA 5DGZA 3Q3BA 5C4LA 4FF8A 2YJRA 1XO2B 3D83A 1KOAA 3FUPA 5HU3A 2C1BA 2YWPA 3FSKA 4Y5QA 3UOLA 1E9HA 3KK9A 4WBOA 5CEOA 5KMKA 2PZ5A 3NAYA 2JC6A 4GG7A 1OPKA 1SNXA 4PV0A 5ETFA 4JR7A 2JIUA 4OAUC 3MVLA 3S2PA 3SAYA 1KE9A 3F5GA 4NT4A 3VIDA 4BCHA 3OHTA 4O83A 3U51A 1M52A 4IWOA 1J1CA 3UZPA 5LVPA 3CKWA 4FOCA 4ANSA 3M11A 4OTWA 4IIRA 5ANOA 5H8GA 3NSZA 3V5PA 4FNYA 3ZFXA 2JBPA 4P90A 1XH6A 4R5SA 1KWPA 3QWKA 3KRRA 4DG2E 2QONA 3DTWA 4O0XA 3PVUA 1TQPA 4ZS0A 1Q8TA 1CDKA 3P4KA 3QUPA 3GGFA 1GOLA 4NCTC 3SQQA 3U4UA 4CVAA 2XRUA 5L2IA 4UX9A 3DPKA 5CZIA 3R9OA 4ZMFA 4HGLA 2XCHA 4IZ5A 3COHA 2GNIA 4JG7A 4I94A 5B2LA 1TQMA 4PF4A 5CQWA 1J7LA 4G3CA 3VS0A 3QQGA 4AGWA 2R3HA 3A4PA 2X39A 4L9IA 4K2RA 5A46A 2J4ZA 3K3JA 4YLKA 3U9CA 4U79A 4X0MA 4JQEA 1M2PA 3KK8A 2XIZA 5I9WA 5BMSA 1WZYA 4NW6A 2PHKA 1P2AA 4H3BA 2GMXA 1H0WA 4F08A 5I9XA 4C2VA 4KA3A 2XJ0A 4LG4A 5HO8A 4J98A 1FBNA 3S4QA 3FMKA 3FYKX 4M0ZA 2WTKB 3OY3A 3R71A 3M2WA 4FSUA 4FV5A 4EH4A 2YIXA 1H1WA 1YKRA 5CEQA 4F99A 2WPAA 1KE8A 4M3QA 4WHZA 2VTLA 4M66A 4AS0A 5FTGA 2BIYA 5IA2A 3LZBA 3MTLA 3PTGA 3EYGA 2QR7A 3G6GA 4U97A 2HZIA 3D94A 4BBFA 2YFXA 4RPVA 3Q4TA 4AZFA 4AA4A 4DC2A 2W0JA 3ENMA 4HPTE 2WTIA 3RTPA 5HX6A 3PY3A 2YA9A 5D41A 3UO6A 2OLCA 1W98A 1GJOA 3R04A 3OT3A 4RWIA 1RW8A 2UW4A 3BHTA 3H30A 3HGKA 3PRIA 4B8MA 2PZIA 4AP7A 1A06A 3UYSA 5HNGA 4MD9E 4EKLA 2PWLA 4EYJA 1KSWA 3Q6UA 2W17A 4FKRA 4IAZA 4KRCA 3DXNA 4ZTSA 3MI9A 5HG8A 4KKGA 2GQRA 3QA8A 5IMXA 2REIA 4RQVA 1ATPE 3NCZA 3OTUA 3HA8A 3PWDA 4DYMA 4UB7A 3S00A 2VZ6A 5IQDA 4YO4A 3VUGA 2CPKE 5CS6A 2DS1A 3QQLA 5C9CA 3SW4A 3ZRLA 4FYOA 5AX3A 4FUYA 2PVLA 3D7ZA 4ALUA 4ZLOA 2QLQA 4DH3A 2BUJA 4I5CA 2ZAZA 1OB3A 4YSJA 1V0BA 5DIAA 5EDRA 4TKSA 3L9PA 3ZRKA 4CFVA 4PQNA 3BHYA 3UMWA 3SG8A 2IVUA 3TTJA 1UVRA 5E7RA 4FSYA 2BTSA 5LMKC 5AV0A 4AF3A 4L45A 2QODA 4XG8A 5CQUA 2HY0A 5AWMA 1PMNA 2WU7A 3MN3A 3QQFA 4J8MA 1PXMA 2W4KA 3O17A 4UYAA 4GS6A 4KSPA 5B2KA 4F09A 5CVGA 3ZTXA 3WE4A 2ITNA 4EBVA 2QOQA 4DGMA 3VBTA 4E7WA 2CGXA 3PWYA 2XUUA 5CSVA 2E9NA 4K9YA 4IH8A 4J97A 4R6VA 4FBXA 5HO6A 4CG9A 4XUFA 4R3CA 3R8VA 3G33A 4O27B 4ZSEA 4ZLZA 5IA3A 3DCVA 3LCKA 2XM9A 2X8EA 4DGGA 3FQHA 3R9NA 4UXQA 4AACA 3F3WA 3Q5ZA 2JDRA 2F4JA 3LLTA 4OLIA 4K11A 4QTAA 5ETCA 4DF3A 4X2FA 3BCEA 3CP9A 3P5KA 4NL0A 4U45A 4ZZNA 3VNTA 4LOPA 3LM0A 4G31A 3MBLA 5D7AA 4D28A 4EH2A 4UMQA 4LUDA 3DAJA 3RZBA 4EWHA 4XBRA 5IEYA 1K9AA 2VX1A 1Q99A 3AD6A 3BHUA 4WNKA 3TKHA 2CGWA 3OMVA 3QU0A 3OBGA 3SOAA 3TTIA 2CSNA 3O0GA 2FSTX 1IA8A 5AP1A 5EDQA 5HE3A 3D2IA 4PL5A 3NX8A 5HEZA 1PMUA 4KUJA 4C3FA 4QPSA 1WBVA 3MVJA 3PG3A 4C0TA 4LYNA 3HVCA 5E91A 3O23A 1Y8GA 1Q8ZA 2Y9QA 5LVOA 4IB0A 4G17A 4FK6A 4K77A 4X3FB 3K5UA 3EMGA 3ZEPA 2XZSA 3TNWA 3GI3A 1J7UA 3MB7A 3PPKA 4AFJA 3P7CA 5HIBA 5AUTA 2X2MA 2EXMA 4RWKA 1GZ8A 5E9EA 3JY0A 4Y72A 4KS7A 5CX9A 3TACA 4L00A 3A7IA 5FM2A 5HG7A 3SLSA 4CFFA 1M7NA 2ZB0A 1OITA 5AM6A 3SDJA 3LMHA 4B4LA 4FSZA 3ZYAA 4BTJA 3LW0A 3EL7A 1XH4A 2J6MA 5BYZA 1BUHA 1S9IA 1RQQA 4NU1A 4RQKA 4CV9A 1YXVA 4XV2A 1XH7A 5BX0A 5DT0A 3GEQA 3UMXA 3EQDA 4D1ZA 4KBAA 3DXQA 2XNEA 3QD4A 2ITPA 4FIFA 4EK5A 3DBQA 3HV4A 3RPOA 2A27A 5TKDA 3LFCA 4E4XA 1NT2A 2I7QA 4FIIA 3PDTA 4UWCA 1PYXA 4LRKA 3LFFA 3GVUA 4XMOA 3V6RA 4CCUA 4OAVB 2YCRA 4K33A 3P7AA 3QQJA 4IBMA 4MXCA 4ZY4A 5IF1A 2DWBA 3TCPA 1GAGA 2G01A 4ZXTA 2BHEA 4TYHB 5B0XA 3DK7A 2FVDA 2UVXA 4J99A 2BROA 4X7QA 4CCBA 3DB8A 4YJUA 4OTPA 4AE9A 3WILA 4XG4A 3RHXA 3WYXA 3M1SA 4DAWA 3H9OA 3CTHA 3MTFA 4I41A 4IM2A 4APPA 2C3IB 2IZTA 1VR2A 3EQRA 3WF7A 3QX4A 4R78A 2BPMA 4O21A 5DG5A 4TWNA 3VBYA 3R63A 2B54A 1ZYLA 2YAAA 4BBEA 5A54A 3OUKA 3NAXA 4ANMA 2C6IA 2A19B 2R3PA 2XK4A 3HX4A 5C1QB 1VYWA 4FSRA 4JRVA 4BDCA 3SC1A 3OTVA 4AT3A 4CLIA 5KHWA 2YWVA 2GNJA 1JKLA 2WEVA 3C1XA 2RFEA 3VAPA 4DITA 4F7SA 5K4IA 1R1WA 2GFCA 2Z7QA 4LRJA 2ZV7A 3Q9YA 2ITTA 4RA4A 2B53A 3G9NA 4JG8A 1PXIA 3HMPA 2FB8A 1ZYCA 4MNEB 3PZHA 1PXKA 3Q04A 4GJ2A 2QO2A 2PE2A 4XJ0A 4EH6A 4S31A 4JIKA 3VS1A 4BDKA 4FEQA 3FLWA 2OW3A 3MVMA 4GUBA 4WD5A 3UC4A 4IDTA 2UZUE 4AOJA 3UPZA 4YPDA 1YQJA 4RIOA 4R5YA 4WA9A 4C4IA 4O7LA 1U5QA 5A6OA 3MYGA 5EQPA 5M4UA 4QMXA 4RVKA 3R00A 4QD6A 4D2PA 5IZFA 4YU2A 2C6OA 2IZSA 4GK2A 2FSOX 3PXZA 3AGLA 2VWZA 2IW6A 2OJIA 4GG5A 1U46A 2OF2A 3IW8A 3DBFA 2R0UA 4FT7A 1OKWA 4J71A 5EQEA 4PDYA 2G2IA 2XK7A 2WQNA 4KWPA 4XYFA 1Q4LA 4RJ8A 4DFNA 4XEYA 5AM7A 2EXCX 2VTJA 4F1MA 5KMMA 3CQEA 4TRLA 2WQBA 2UVZA 3PVWA 5JK3A 1XH9A 4I6QA 3V51A 3WZJA 5CU4A 4FKTA 5BVNA 3DAEA 4NH1A 3ORKA 1SMHA 4YO6A 3V6SA 2CN8A 4I4EA 4IANA 4WUAA 4FSNA 3VUIA 3ACKA 2IG7A 2PSQA 4I3ZA 1BL6A 3E63A 1CTPE 3CPCA 1P4OA 2ZM1A 5A14A 2HAKA 4CKIA 1CKPA 1AQ1A 1OL1A 2OZOA 3QCXA 4GJ3A 3O8PA 4W8EA 4YJPA 3QWJA 4X3FA 2DYLA 3QTXA 4ALWA 1OL5A 1OIUA 3RK7A 3CKXA 5G6VA 4I0RA 4PRJA 3BEGA 3DKCA 2XNBA 4JAJA 3Q96A 3AD4A 4RA5A 4ZSGA 4C2WA 4GEOA 2JFMA 3ZLYA 3KXNA 3G5DA 1QL6A 3MIYA 4FIGA 3FMNA 3I0QA 3W16A 2F9GA 4PMSA 5IQIA 3KN5A 4JL9A 3UOHA 4FTNA 5KCVA 4AW2A 2WMTA 3PVBA 1Z9XA 3R7UA 4APCA 4KIQA 4YGAA 3UZTA 3ZH8A 4MXZA 4RC3A 4YJVA 5EH0A 2ZDTA 4NCTA 1WBWA 4YLLA 5FDXA 3NVMB 1SVGA 3V5WA 4L68A 3N51A 5EW9A 3ZRMA 3P9JA 4E6QA 5AP2A 3NMUF 4FA2A 1ND4A 3PA4A 2ETMA 4V01A 4Q5HA 5E1EA 1ZYSA 4FZAB 5FWKK 4FTJA 5CXHA 4MXAA 1WAKA 5EYDA 2A0CX 2PE1A 3G15A 1STCE 5L6WL 4QMTA 3D0EA 4TYHA 5FUTA 2C0TA 1JPAA 4FR4A 3UODA 2J90A 4EC8A 5JEBA 3LFSA 2JD5A 3DAKA 4FKJA 1BI7A 1QCFA 2C5VA 4R7HA 4Q5EA 1AD5A 4IAIA 4BDIA 2YABA 5JQ5A 4O7NA 3QTZA 4IM3A 4EL9A 2YHVA 4EUUA 3NYOA 3SV0A 4HPUE 5LCKA 3WZEA 5D12A 4X2JA 3MFRA 3I6WA 2V0DA 2XBAA 4ASXA 2YCFA 1OPLA 4OBOA 1YOLA 3GU7A 3F61A 3LCDA 4IB5A 4KAOA 4X2GA 2IW8A 4EK3A 3MH1A 5DFPA 5B7VA 1Y57A 4Y8DA 5IEXA 5A6NA 2P3GX 5AV2A 5J79A 2C6MA 3BHHA 3MW1A 1PRYA 4IWDA 3UNZA 2IPXA 1M14A 2RKUA 2VNYA 2XVDA 3FZ1A 3IONA 3D5WA 3LAUA 3MPMA 4ZJVA 2XIRA 3G9LX 3IQ7A 4ZY6A 3DLSA 1G3NA 4MNEA 4WT6A 2PYWA 3Q5IA 4BCOA 4A4XA 3KXXA 5AV4A 2YCSA 2QU5A 5K5NA 4FK3A 3E7VA 4NM7A 2X2KA 5D9HA 4DLJA 3OW3A 2J9MA 4CT1A 2QVSE 4FG7A 2QO7A 2GSFA 3L1SA 3WZKA 3E3PA 4EZ5A 2WQMA 4C37A 1H07A 3PSBA 1NA7A 2W1IA 1IASA 4J52A 4IM0A 4MXOA 4PPCA 5CI7A 5E8VA 3VS5A 4BI2A 3ZO1A 5KX8A 4XG9A 2W1HA 2XB7A 4QYFA 4GFGA 3RM6A 4WNOA 4KIKB 4DHFA 3Q9ZA 3DDQA 5M55A 4A9UA 5HQ0A 2C68A 2OWBA 1YRPA 5EYKA 2GS7A 4U9AA 2BIKB 3I4BA 4UZDA 3R9RA 3HP2A 1WFCA 3SA0A 2XMYA 3EN9A 1CSNA 1Q3DA 2R5TA 4AU8A 4Y95A 4F7JA 3DQXA 2C6EA 5HLPA 4DH1A 5KBRA 3O7LD 5EOLA 2ZMCA 1OUKA 3QYWA 5LQFA 3ZXTA 3PLSA 3ZUUA 3F2NA 5HBHA 3RAKA 4C36A 1JKKA 2PVRA 4FYNA 2EUFB 5LMKA 4DTBA 2R0IA 1PHKA 1YI4A 5J7HA 3MA6A 3C4FA 3IOKA 5HE1A 3W2QA 5HCYA 2O65A 4BIDA 3C4XA 5HLWA 5C27A 2X8DA 3UP2A 1UKIA 2Z60A 4L8MA 1GY3A 3EL8A 2PMNX 4WNPA 2J2IB 2RFSA 1XKKA 4TXCA 4C58A 2XBJA 4DEIA 2BVAA 4QYGA 1SZMA 3FL4A 2OH0E 1H4LA 2XKCA 3B8RA 4LFIA 5KZIA 3UE4A 3W55A 1IR3A 3II5A 4CTBA 1Q61A 2VX0A 1W83A 2VO3A 4IX3A 4L42A 5K0KA 5BUJA 3P86A 2E9PA 3HRFA 4J1RA 5EI8A 4BKZA 3VO3A 2WOTA 4F9BA 3RPSA 4YTIA 5BVEA 5EDPA 4L6QA 2BAKA 2JAVA 3QALE 1KV1A 3R9DA 4E6AA 2PUPA 1GIIA 2PMOX 2QC6A 3F5PA 3RKBA 4FC0A 3NUXA 3Q6WA 3CY3A 4QPMA 3QKLA 3WIGA 2CLQA 5BQ0A 4FEWA 3ZO4A 1P5EA 3CQWA 2OBJA 1FPUA 5F4NA 1QPEA 5J5TA 5IA5A 3RINA 5HZNA 3R22A 4DFBA 4IZAA 4HCVA 5IQBA 4FNXA 4MBJA 4H3QA 3P23A 3AQVA 3QTIA 1U5RA 2OJGA 4CQEA 4EKKA 3PIXA 4QMOA 3OWKA 2BRHA 4FKPA 4FKWA 2CNVA 4Y83A 1UWHA 4D2WA 3MY5A 3FC1X 4P2KA 2V7AA 4NJDA 3BGZA 4HYIA 2WTKC 2XP2A 3OEZA 4I6HA 1BI8A 4YJNA 3KXMA 3R83A 3C51A 3ROYA 4IHPA 4JR3A 3S95A 3GU6A 2VTTA 3QHWA 3TI1A 4CRLA 1URWA 3R7IA 4WSYA 4FT5A 2B52A 4B0GA 4DFYA 4I1ZA 4IAKA 4DT8A 4A9RA 3FI2A 4QO9A 1PXPA 4FMQA 3SRVB 3MFSA 3N4VA 2AUHA 4L46A 4ZP5A 1GZKA 3D5XA 3BZ3A 4JRNA 4AZSA 4EHZA 5AUXA 5FXSA 4DFLA 3CQUA 5EYMA 3TUBA 5M06A 5FEEA 2X8IA 3P0MA 3TJCA 3PJCA 3BBWA 3TZ8A 3ZXZA 1UA2A 4XV3A 4FKIA 3F3ZA 3D14A 4ZSLA 4O96A 2QOOA 2XNPA 5H8EA 5HCZA 3TV6A 4H36A 2HW6A 4QMSA 3LM5A 4UV0A 3FZPA 3G90X 3FY2A 5FP6A 4FV4A 2J0IA 3BGQA 3FLNC 4BB4A 1BLXA 4MEDA 3IGOA 4DH7A 1MP8A 3LMGA 2XJ1A 4IMYA 4HW7A 2JLDA 2W4OA 3HV3A 4BR3A 1YXTA 3Q53A 2YDJA 3ETAA 3I6UA 4FTIA 4XRLA 3COIA 5DEWA 2B1PA 1UNHA 4WRGA 5A4EA 3RWQA 3I81A 2CKPA 4Z9LA 4QP2A 5ACKA 3EZRA 3V8WA 4JXFA 4XOYA 3V5TA 4BDJA 4KIKA 3F3VA 1SNUA 3CPBA 2BZJA 2F2CB 4PTEA 4LGDA 1U54B 2C4GA 3ANRA 3GU8A 3OWLA 5IKWA 3HV5A 5CALA 3DXPA 4WG5A 4QP6A 3VS6A 4QMNA 3DFAA 5C8KA 5HNBA 2C47A 4BYJA 2WKMA 5FTQA 3PPZA 4DFXE 3U9NA 4OTGA 3ZBFA 4IFGA 4GIHA 4TYEA 4ARKA 3FSFA 3HZTA 4Z3VA 5KBQA 4O7TA 4FVQA 3LFNA 3LQ8A 2ITYA 4BCKA 5IU2A 4W8DA 5CF6A 5GNKA 2R3GA 4I93A 1NVSA 2W5HA 4YURA 3FZTA 4XV9A 5LVMA 5M4FA 3MESA 2WZJA 4OT6A 2G2FA 2R3IA 4RJ3A 5DPVA 3VBXA 4S2ZA 4ZZOA 4E93A 3RI1A 5JFWA 5IA1A 4YZBA 4DEBA 3BELA 4BCMA 4J95A 1UU7A 3C4CA 3CE3A 2R3KA 5J95A 2PY3A 5K5XA 3HL7A 3U87A 3OZ6A 5TE0A 2UUEA 4AE6A 3R7EA 4FIEA 3BU3A 4B7TA 4Z16A 4O91A 5BPYA 4HYUA 1OUYA 3REPA 4WRSA 3TKUA 4ANOA 1FINA 4I6BA 3FXXA 3TN8A 3GU4A 4GT3A 4HCUA 3QZFA 3TDWA 3TDVA 1QPCA 4QP1A 3H0ZA 3HNGA 5E4HA 4DA5A 2OU7A 3U4WA 2XCKA 4JX7A 5M57A 2ZJWA 2PULA 3EFJA 3NYXA 4IE9A 3VBQA 4IJ9A 3W2SA 3PIZA 3RNYA 4CFUA 3PY1A 4IC7A 3R7OA 4NK9A 2W99B 4UZHA 1Q8YA 5EI2A 5AR4A 3EZVA 4ZTLA 3ZUVA 2W9FB 5CF4A 2OIDA 3RAWA 4D4YA 3NPCA 5EM5A 3P1AA 4D9TA 2GS2A 2W9ZB 4X3FC 4FV7A 4QP4A 4BZDA 2A4LA 5KMNA 4BTFA 2F57A 4H3PA 2JDTA 1H1QA 2UW0A 5AADA 4NWMA 4FEUA 4K6ZA 4YBJA 3AD5A 3BU6A 5FBNC 2HY81 1JOWB 4BF2A 1YWRA 4G5PA 4PP9A 5EHLA 4C7TA 4EOIA 4F70A 1OVEA 3GT8A 1BMKA 5JT2A 2WAJA 4WOVA 3FI4A 2B9HA 4QNAA 3BLHA 4RC2A 3SRVA 5CXZA 3FQEA 1IEPA 5ANIA 4E4LA 5I5ZA 1PKGA 2W1ZA 5ANJA 3W2OA 4QQTA 4EOOA 1OKYA 4FSWA 2YM5A 4O6LA 4G6OA 3BYOA 3QBNA 4G9RA 1H1PA 2NRUA 4JIAA 4G9CA 4I21A 4HVIA 1CKIA 4XV1A 4YMJA 4EI4A 1REKA 2VWIA 4TPTA 2QHNA 5F20A 2EU9A 4PL3A 4FL3A 3VULA 1KUTA 4FT0A 3TZMA 3ZLSA 3AOXA 3IDCA 4LRMA 3KQ7A 5HG9A 3W2RA 3C50A 3ZBXA 3MV5A 1R78A 5HVYA 4CMUA 3NZ0A 4O7VA 4QTEA 4CFMA 4D9UA 4M68A 5EM7A 2V5QA 1LPUA 5LJJA 3UDBA 3O8UA 4YZNA 1O6LA 1OM1A 2BALA 5BYLA 3L9NA 3VBVA 3LQ5A 4U40A 2X7OA 3FHRA 5CU2A 4RVTA 4RGJA 3MB6A 5DR6A 5A4TA 4QP3A 4QMUA 5DR9A 2BRBA 4KKEA 1JNKA 4FKUA 5AP4A 2RFNA 3FKLA 1W7HA 1DS5A 5AEPA 4ZSJA 4BCGA 2OJJA 3D4QA 3W18A 3ZC5A 3UIUA 3O2MA 1PXNA 3AC2A 4USEA 3QQHA 5A4QA 4YJQA 4RJ6A 2ZMDA 3WIKA 1Q8UA 2HCKA 2WFYA 3E8NA 5AX9A 5CSHA 3O7LB 5L8JA 3VHKA 3VVHA 3PLAE 3R01A 2X2LA 1Q8WA 1DI8A 4DEHA 3PXYA 4CMTA 5DOSA 4Z7GA 1IAJA 2FUMA 4IVDA 4A07A 2OIQA 3VQHA 4CQGA 2H9VA 3V3VA 3A61A 5L2SA 3Q4UA 2PMIA 3CGFA 3KREA 2VWBA 3CGOA 4KD1A 3SXFA 2PZRA 2YN8A 3FI3A 3E3BX 4G16A 1SVEA 2GU8A 2CNUA 4NFNA 4USFA 3TT0A 3LHJA 2O8YA 3PRFA 2G1TA 4DBNA 3VN9A 4W4WA 3AC8A 3Q9XA 2J0MB 3ZM9A 1UV5A 4UWBA 4RMZA 3EQPA 4WNMA 3E5AA 3ULIA 4EQMA 4F64A 4FKOA 2X7GA 4WSQA 4UALA 3RNIA 3HAMA 2HWPA 2WIPA 3P79A 3TM0A 3RJCA 1BL7A 3OS3A 4CZUA 2JBOA 2CGVA 2G15A 2VU3A 4FTRA 3KCFA 4FZFB 4FV9A 4C02A 4RZVA 2WOUA 2GNHA 4CKJA 2WB8A 4D4RA 4A9YA 3ORPA 4EONA 2OZAB 4PL4A 4AZVA 2ETKA 4HCTA 2V55A 3NRMA 4RIWB 3PUPA 4L7SA 1CMKE 3ACJA 3PXQA 3C0GA 3QC4A 5IISA 2BCJA 1H0VA 1ZOEA 4U44A 3QXPA 2QO9A 3BLQA 1GZOA 4FI1A 3FLQA 4EZ7A 5EI6A 1JSVA 4BCPA 2H34A 4FICA 2CGUA 2BMCA 4MD7E 4YJRA 2YZLA 4FTQA 4NSTA 1QMZA 4AAAA 3RWPA 1ZOGA 4ZSAA 1YDTE 2WEIA 3UBDA 1F5QA 3EQIA 4AGDA 1FOTA 2IZUA 4U3YA 3QQUA 3COKA 4F0IA 4FT3A 5E1SA 4OTIA 5ANGA 4MD8E 4HVSA 5JMSA 4BGGA 4G3EA 2R3JA 2XEZA 2O5KA 1VEBA 3KFAA 1FMOE 4O1OA 2PU8A 2EXEA 3B2WA 3QZIA 3VUMA 4EYMA 3SVVA 3ATTA 2J0LA 5J1WA 2E9VA 5B2MA 2WMBA 4D2TA 5EQYA 3ZCLA 4FSMA 3MWUA 2C0IA 2OI4X 4PDPA 4RFMA 5L2QA 4C4HA 3QCQA 5CNOA 3TZ9A 1BX6A 5L4QA 2WMQA 5C8NA 3GCQA 3EH9A 3F3UA 4BCFA 3F6XA 4E1ZA 5CT0A 3NNXA 4G3DA 3FAAA 1YOMA 3CD3A 1H1SA 4EK6A 2VTQA 3QYZA 2B55A 2H6DA 2OK1A 4YLJA 2YDIA 4ANLA 3RBWA 3R73A 2UW5A 4JDHA 5FM3A 3PG1A 1ZRZA 4MCVA 5AFVA 2QNJA 4FL1A 3EJ1A 2W1FA 3DJ5A 3CCNA 2GS6A 4QYEA 3VW6A 5KKRB 5CU6A 4MK0A 3ET7A 4U3ZA 5DE2A 3C5UA 4YNOA 3G0EA 4KBCA 3NCGA 4O38A 4ZJIA 4ZEGA 3QD3A 2YAKA 4U41A 3U54A 2YM7A 5I4NA 2VRXA 4BY9E 2QKWB 3O71A 4ACGA 4FKGA 2GTMA 5HG5A 4I24A 3N4UA 5LWMA 1UU3A 4G3FA 4YSMA 2G9XA 5D11A 4C3PA 3N4TA 3PXFA 3FJQE 4GFOA 4G3GA 3OBJA 5HLNA 4L53A 2JEDA 5JRSA 4O81A 2RIOA 2XYNA 5ANKA 4UXLA 4QMQA 5IDPA 2WTVA 1OBGA 2RFDA 3MH3A 3B2TA 5L6OA 3ORIA 4NTSA 3Q9WA 3MJ2A 1ZY4A 4HOKA 5FD2A 4CT2A 3EIDA 4TY1A 2P2HA 3H4JA 3UNKA 3W2CA 4FE2A 3FMMA 4FZ7A 5GIPE 3L8VA 2YM8A 4FT9A 4X21A 4DE4A 3DBEA 4E6CA 2VGOA 3S1HA 5GJDA 4X6QC 3UVQA 3WF5A 4Y73A 1K2PA 2JGZA 3VC4A 5GZ9A 2YJSA 2QOHA 4NM5A 4EEVA 3WE8A 2CMWA 4CYJA 3PJ1A 4TW9A 3HMNA 4PMMA 4C33A 3ORZA 1IRKA 5ANEA 2NP8A 3DBCA 4OT5A 4HGEA 3NDMA 3LXPA 3DDPA 4IW0A 1SM2A 3K54A 4O0YA 3R8MA 2F2UA 2CJMA 4EH9A 4L3JA 5CNNA 5EHOA 1A48A 3FMHA 3PPJA 3TG1A 4D2RA 2R7BA 4ACDA 1DAYA 5BVWA 3F82A 5E92A 3U6JA 2YDKA 4CYIA 3ORLA 4O7ZA 3QZGA 3T3UA 4C59A 3I5ZA 4RIWA 4IQ6A 2O0UA 3R1YA 2IWIA 4JOAA 3GU5A 3UQFA 5IQFA 1PXLA 3GENA 5BNJA 4IVAA 3Q60A 2XK8A 4NKAA 3RPYA 4O0RA 4MF0A 3TNHA 4NYEA 4NEUA 3QL8A 1A9UA 3FZSA 5AR7A 5FLFA 2QKRA 2OFUA 3EN6A 4YTFA 5M51A 2AYPA 3FLYA 1J7IA 1AGWA 4D58A 5EK7A 3RVGA 1NY3A 4I0TA 4LMNA 4GT4A 4Q2AA 5EHYA 3DY7A 4JG6A 4XP2A 3VUKA 4EOLA 5A4CA 4HVGA 4NW5A 2UZEA 4PWNA 4DINA 3JYAA 3DNDA 3AT4A 5IPJA 2R3RA 3QRIA 3PZEA 3R30A 5HD4A 3UVRA 4RJ7A 3KRJA 5KNJA 2C1AA 2XNNA 2VAGA 1IA9A 4BZOA 3DU8A 4AFEA 2YIYA 3PP0A 4H58A 4QMLA 3MJ1A 4I0SA 1ZMUA 3RK9A 2HOGA 3JY9A 4MWHA 4PDOA 4O2ZA 3V8TA 1XH8A 2W5AA 2VV9A 2SRCA 4PPBA 4E5AX 3ZONA 2OIBA 3HUCA 2GPHA 4YR8A 4BCQA 5E8WA 4A9TA 3EYHA 4QTDA 3UG2A 4WIHA 2JKKA 4K8AA 4EK8A 5D10A 3K5VA 2VTRA 3KRWA 1WBNA 1KE6A 3JXWA 4RVLA 5FEDA 5HHWA 3T3VA 2F7ZE 3VRZA 2O64A 5M09A 5H9BA 5AP6A 2VWWA 3MSSA 4ZLYA 4O0WA 4IWPA 2HWOA 4M7IA 1E1VA 2WMUA 3OF0A 4IJPA 2J5EA 4QQJA 4E6DA 3RHKA 4HVHA 2Z2WA 3WARA 4HGTA 5CY3A 4A7CA 4ZS4A 5HTBA 3OOGA 3DBDA 3HV6A 3FHIA 2W5BA 5TR6A 2CNQA 2B9FA 5CU3A 4F1TA 3QLGA 2HXLA 2QHMA 3WBLA 4JAIA 4FEXA 1LUFA 2IJMA 4ZTHA 2W7XA 5AMNA 1GNGA 4RWLA 4F6SA 2F7EE 3R02A 4KS8A 1MRUA 2C5OA 2NO3A 4N70A 4TWPA 4BDEA 3R21A 1TVOA 1YW2A 4O0SA 4XS2A 3GBZA 1G8SA 2JIVA 2NRYA 2OGVA 5AR2A 3V5LA 4NFMA 3RAIA 2PMLX 4JBQA 4ZJJA 1UKHA 3IDPA 2P0CA 3MH2A 4HJOA 3LCOA 2V62A 4IXPA 4YZMA 4R8QA 4ITJA 2IZRA 3NIZA 2UZNA 3RMFA 3GFEA 2HK5A 4HVDA 4NZWB 3L9MA 4PTCA 3ZSGA 4KNBA 1LEZA 3IECA 4GCJA 2V7OA 3OCTA 1R3CA 2OJFE 1Y91A 1WVXA 2HW7A 2PTKA 2RG6A 3AXWA 4FV1A 5AR8A 2IW9A 2Z7RA 5HORA 4G5JA 1GZNA 4YP8A 3BIZA 4W4VA 5CEMA 1V1KA 3DV3A 3ALNA 4OTRA 1PMEA 4LV5A 3V5QA 1Q24A 3C9WA 2A1AB 4AUAA 4D1SA 5A4LA 3R1SA 2QD9A 4JX3A 5AUYA 4B8LA 4ZZMA 1XBCA 2JKQA 4QMYA 2O3PA 4FKLA 4XLVA 4GKIA 3ANQA 3VUHA 4HZSA 1B38A 1MUOA 2C3JA 4K1BA 5CT7A 2WTCA 1M2QA 5DRBA 3WF6A 1YXUA 4CZYB 2UZTA 2ITXA 2BKZA 4LV8A 4IX4A 4AQCA 3E8EA 3KXGA 2X6DA 3DKGA 1S9JA 4BIBA 2ITVA 2BDFA 3E92A 5IUHA 5CVHA 4D5KA 3GCUA 3GC9A 3TUDA 4S34A 3VUTA 3TNPC 2UZVA 5J9YA 3Q2JA 4E5WA 4GH2A 2HZ4A 5J87A 3FDNA 4CZTA 5LOHA 1OL7A 4II5A 2JIIA 3CBLA 4IVCA 3WOWA 4QMPA 4CXAA 1FQ1B 4LL0A 4G2FA 4PUZA 3UC3A 3DK6A 5D7VA 3VW8A 5AR3A 4K18A 1XR1A 1H8FA 4L43A 4CKRA 1UNLA 5J7BA 2VO0A 2OKRA 2BZKB 3LIJA 5KUPA 3RAHA 1ZMVA 1YI6A 3G2FA 3EOCA 3THBA 3DLZA 3WYYA 4AX8A 4D5HA 2C3KA 4EH7A 4NTTA 3ZMMA 5IQGA 1XQZA 4RJ5A 4EOMA 2BAQA 3LE6A 4X6RA 2W96B 2CN5A 3KKVA 4OGRA 3DK3A 3SOCA 5KMOA 4K0YA 2C3LA 1ZYJA 5CANA 3QD2B 4V05A 1KE7A 5JFVA 3ROCA 2OFVA 5FG8A 3H9RA 2J7TA 2ZYBA 4TNDA 4R7IA 5AAFA 2LGCA 4CD0A 4O7SA 3HMOA 5E8ZA 4DH8A 3EQHA 3SX9A 4D4VA 4GYGA 3VQUA 2C69A 2H8HA 3CC6A 4B6LA 4BDBA 5AIRA 1Q5KA 4BICA 2PL0A 5I9VA 2W1EA 4CNHA 4RX5A 3LJ2A 4YC8A 2CHLA 4KBKA 4I20A 1OPJA 1YI3A 3T8OA 2VX3A 3EB0A 3QTWA 3RZFA 4BI1A 3SHEA 4C4FA 2GHLA 2P4IA 3O50A 3PXRA 5IDNA 1RE8A 2OXXA 3UO5A 2QLUA 5CU0A 4A06A 4O86A 4USDA 4AOTA 3GQIA 2Y6MA 2WIHA 4M0YA 3CLYA 5KO1A 4C35A 3JVSA 2LAVA 4C57A 2C6TA 4EQUA 3F5XA 2Y4PA 1Z57A 3OXIA 4F1OA 4ORKA 5TT7A 2YISA 3F66A 1W82A 2WNTA 2ITZA 3ULZA 4XNEA 5IQCA 1YWVA 4B9DA 4YTCA 1LP4A 1ZY5A 1APME 2XF0A 2WQEA 5CWZA 5M4IA 3TNIA 5CTPA 3KF7A 3QTSA 4CFWA 2BR1A 2PVYA 2XM8A 2R2PA 4GU9A 4ACCA 4BDHA 2QG7A 1FVRA 2FH9A 3QKKA 5DR2A 3ZOSA 5G1XA 4O7WA 1VYZA 1OI9A 4JBVA 4QYHA 4RJ4A 4GFMA 4GIIA 4L44A 1J91A 3I1AA 2WMSA 2WMRA 2DQ7X 4GV1A 1JBPE 3A62A 1YXXA 1WBSA 3DQWA 5FQDC 4ZTMA 5T3QA 5K4JA 4JS8A 4DT9A 4XLIA 4XG6A 4E5BA 4ZOGA 4QP7A 3NR9A 4ASDA 3KF4A 3NNWA 4Y85A 1W0XC 4DGNA 5DBXA 3UP7A 1OL6A 3R7YA 3DKFA 3PP1A 2KTYA 4BDDA 4BWXA 2CDZA 2Y4IB 2WMAA 2I0EA 3E8CA 4M14A 2XKDA 4X2KA 2J5FA 5DH3A 5CENA 3DZQA 4EWQA 4F9YA 5EOBA 3CJGA 2W1GA 3T9IA 3GC7A 4AN2A 3G0FA 3L8XA 4BWKA 5HGIA 2Y8OA 5CLPA 4R3PA 3FI8A 3ID6C 4BZNA 3C0HA 3OVVA 5EM8A 1QPJA 3D9VA 4I5PA 3LFBA 3F3TA 2C6KA 3SXRA 3W8QA 2R3NA 4HZRA 2ZM3A 4BYIA 3R28A 3HP5A 1JLUE 3I7CA 3MDYA 2UZLA 4QP8A 3ZO2A 2BHHA 3NYNA 4FG9A 1GIJA 3D15A 4BFMA 4GW8A 5EW3A 5HIDA 4RG0A 5LMBA 1PMVA 3EN5A 4JQ7A 2QI8A 4P5ZA 4YHFA 5HNIX 3BKBA 1J1BA 4UMUA 1ZLTA 3CS9A 1H00A 4R77A 2YITA 3TWJA 2BILB 3LCTA 4I4FA 2NNWB 4YC3A 2VD5A 2XRWA 4QMVA 1URCA 2EB3A 4RIYB 3ZZEA 4F65A 3LMIA 5ANDA 5K0XA 5I9YA 3R8PA 4EHGA 4TL0A 4MHAA 2R3OA 5AP3A 3PY0A 1PKDA 5ACBC 3EN7A 5L8LA 2VTOA 1RDQE 1Y6BA 3HRBA 3KXZA 2B4SB 3NUAA 2G2HA 2JAMA 3KC3A 4RX8A 1MQBA 3PVGA 3UJGA 3I5NA 4DCAA 3E64A 2XA4A 2WO6A 3GC8A 2W06A 5EKNA 3MY0A 4M15A 2C5NA 4L52A 1YVJA 2ZOQA 4FTMA 4V04A 3DGKA 4TWOA 4U8ZA 4DEAA 3JR1A 4M8TA 3ORNA 3E93A 4C4JA 3MH0A 3TV4A 3WF8A 3RGFA 1B39A 4JDIA 4FTOA 2X4FA 4AG8A 5M07A 2WMWA 3HA6A 4Q9SA 5FGKA 4RX7A 3OROA 4JJRA 4D55A 3DS6A 3VS7A 4IADA 5AIKA 4I6FA 3UYTA 4ERWA 4MNFA 3NNUA 4QOXA 4TN6A 3Q52A 4FTUA 3TEIA 3WZUA 3AMBA 4UBAA 3GQLA 2X6EA 4ITHA 1PY5A 3SKCA 2QOIA 4BGHA 4QQ5A 4DEDA 2J0JA 4G6NA 3W8LA 4IACA 2I0HA 5D1JA 2W1DA 4XG3A 2FGIA 3QC9A 2O63A 5E90A 3HDNA 5A3XA 4XG7A 2VUWA 4CMOA 3EQBA 1WBTA 1PJKA 5AUUA 3TZ7A 4D1XA 4FUXA 4WG4A 1NVRA 2GCDA 2HYYA 3I0OA 5T6KA 3R8LA 3AT3A 3NW7A 3POZA 4F9CA 2CKQA 3HKOA 3M42A 2O2UA 3MIAA 1XBAA 3FXZA 4E4MA 2C30A 3QCYA 3OXZA 2ZV8A 3FEGA 3F5UA 1YHVA 3NUYA 5LMAA 4XX9A 4EHVA 5L2TA 3A8WA 5CI6A 1YHSA 3QF9A 3LFQA 3HAVA 5DI1A 1SVHA 3H0YA 4AZEA 3UQCA 3FPMA 3OT8A 2DUVA 4TWCA 4XP0A 2HENA 3CY2A 4FSTA 5GJGA 3W33A 5HICA 2GQSA 2UW3A 1LR4A 5CAVA 2VN9A 3F7ZA 3FYJX 3S0OA 2H96A 1XJDA 1K3AA 4HYHA 5K3YA 3EFKA 4HNIA 4J8NA 5ETIA 3UTOA 3OXTA 2W1CA 1VJYA 2RGPA 2ERKA 4RBLA 3F88A 1M2RA 4MBLA 5KKRC 2R3MA 4O82A 3KEXA 4IZ7A 5C26A 1E1XA 3W32A 1IAHA 2JKMA 4O84A 4NIFB 3BYMA 2UZWE 2X4ZA 3QGYA 4GK4A 3UIXA 4IAYA 4RLKA 3BX5A 2PK9A 5CEPA 1ZMWA 4E4NA 1ZWSA 1JKTA 4FIHA 5GHVA 4D0WA 5T68A 3LJ1A 3BWJA 4TYJA 5CAOA 5TO8A 4RSSA 5KMJA 4MQ2A 5IH5A 2WXVA 4FTKA 3ATSA 2PVKA 2BZHB 5DT3A 2QOLA 1JSTA 2E2BA 2AC5A 2WELA 4IEBA 2YERA 4J53A 1KE5A 4CSVA 3HRCA 3MA3A 4FV0A 3LPBA 4F4PA 5FXRA 2WU6A 2XNGA 3EKKA 4XRJA 3IPHA 4ZMEA 2HXQA 4KIPA 1SYKA 3LXKA 4BCNA 5ICPA 5M53A 4BKYA 2VTMA 2VWVA 3NUSA 2I40A 3AG9A 4N4SA 4A9SA 1U59A 3ORTA 4MAOA 4RIYA 4EOSA 3C5IA 1MRVA 3ORXA 4N57A 4IX6A 2BAJA 3VBWA 5DLSA 3CJFA 4LQMA 4KABA 1OKVA 3KB7A 3E7OA 1U54A 4EOJA 2UW7A 3PE1A 1W84A 1X8BA 2WHBA 4KINA 3CIKA 3R0TA 1KOBA 1EH4A 5JFSA 3AC1A 3QRKA 4CEGA 2R9SA 4CFXA 5HIEA 4DBXA 4E8AA 4YBKA 1WBOA 5FDPA 3OD6X 3V04A 4BDGA 4B99A 4UMRA 3A4OX 4YHTA 2OXDA 2VTIA 2PVMA 3PA5A 1OL2A 2QR8A 5AA9A 3G6HA 4A4LA 4E20A 4I23A 2Y6OA 3IGGA 1PXJA 4AT4A 4PX6A 4QT1A 1F0QA 4M69B 4TYGA 2J50A 1ZARA 2XYUA 5GJFA 1HCLA 4OR5A 2BFXA 2UZBA 2PVJA 1CKJA 4DLIA 2ITUA 2J0KA 3FL5A 5BUIA 2VTAA 5AJQA 4RWJA 5JN2A 3R8UA 1W8CA 4QMWA 2P2IA 5HVKA 5HTCA 3QZHA 5L3AA 2HZNA 4AGCA 5HU9A 1PXOA 4DGOA 1I09A 3QHRA 1BKXA 3A99A 4I5MA 2QG5A 4MWIA 5EYCA 5C4KA 3IKAA 3RPVA 1BYGA 2BRNA 3QAME 4XCUA 4PPAA 3RALA 2YLFA 3NUPA 1YWNA 4LOQA 1Q97A 5TF9A 3ERKA 4XH6A 3R1NA 2YM6A 5JQ8A 3V8SA 1PF8A 2VTNA 4MBIA 3ZU7A 2YCQA 4LL5A 5I3RA 3F2AA 4KKHA 5DN3A 5KZ0A 1UU9A 1H1RA 2JITA 2C5YA 2UW8A 5M44A 4L01A 4TZRA 1TQIA 2IN6A 2VTPA 1LEWA 2UW6A 3DOGA 4M84A 5H3QA 4AA5A 4IVBA 3VRYA 4F9WA 3O96A 4IB3A 3TNQB 5KHXA 3UVPA 4NKSA 3UGCA 5E8UA 1DI9A 4DCEA 3QA0A 4MVFA 2YM4A 4R7BA 4UY9A 1J3HA 3U8WA 2UVYA 2RL5A 4OTQA 4FEVA 4MKCA 4MYGA 1FMKA 4WKQA 4FX3A 4MX9A 4EBWA 4GSBA 3COMA 3IW7A 5CYIA 5GZ8A 3QTQA 5ITAA 4WBBB 4NIFA 4FVPA 2YIWA 5BVKA 2X7FA 2I0VA 2EVAA 3ZDIA 2JKOA
chains in the Genus database with same CATH superfamily
3C4WA 3FWQA 4FOBA 3P08A 5JSMA 1QPDA 3CTQA 4X3JA 3OW4A 5TOZA 3TUCA 4FV3A 3GCPA 1Y8YA 3QGWA 4X2NA 2ZV9A 5HOAA 4IC8A 1OIQA 1TKIA 5JZNA 2VWUA 4FV2A 3VJNA 5CSPA 4CLJA 4QQCA 2OXYA 3LXLA 1P14A 3JVRA 1I44A 3LFEA 3PJ8A 4ZTRA 2A98A 5HBEA 3H9FA 2Z7LA 3KN6A 1JQHA 5J9ZA 4BTMA 3MPTA 5HKMA 5HESA 4OTFA 4C4GA 5BUEA 3JS2A 2UW9A 3ZLXA 4ZTNA 5CEKA 4AWIA 2GNLA 2PVNA 3H10A 5HVJA 3BL7A 4M13A 1DAWA 3A60A 3LFDA 5CASA 1H25A 2R3FA 4AZTA 3FMLA 5DYJA 3TL8A 3BYVA 2JDVA 4FNWA 4XHKB 2EB2A 3DTCA 3OOMA 4FV6A 3QFVA 4ID7A 4QP9A 3TJDA 1ST0A 3A7GA 4OTDA 3UQGA 2BDJA 4WG3A 4FKVA 5L6PA 3BPRA 3DJ7A 4RT7A 1VZOA 2XIKA 2PVHA 3HMMA 3CR0A 3W1FA 3E8DA 2PPQA 2C5XA 4P4CA 3KY2A 1M7QA 3POOA 4F63A 3ENHA 4QEBA 4JMQA 4D0XA 4DGLC 3I60A 2ZM4A 4EHEA 4U80A 4FG8A 3NGAA 4YC6A 4MXYA 2VWYA 4GMYA 5I9UA 3FQSA 4IB1A 4P5QA 4W4XA 1KV2A 3TMOA 4U6RA 3JUHA 4NM0A 3KGAA 4ZIMA 2E9OA 4AOIA 4CRSA 4L67A 3HYHA 5HI2A 5JGAA 1F3MC 5JKGA 3KCKA 4OBPA 4M67A 2ESMA 3FMJA 3ZLWA 3ELJA 2I6LA 4M69A 3RPRA 3UNJA 2ITOA 2R64A 4TYIA 4PY1A 2YZAA 3C13A 2CLXA 4D2VA 4EQCA 1FVVA 2BRGA 4ZY5A 4LGHA 3BYUA 5JGBA 3C7QA 2R3LA 2QOCA 3FC2A 5I3OA 3IW4A 2PUNA 4ITIA 5IH4A 2CKOA 4IAFA 3BRBA 3ZM4A 4YJSA 4FTTA 4ALVA 5IA4A 4C38A 3FBVA 4E26A 2IF8A 5L8KA 4TTHB 3KVXA 2RG5A 3PIYA 3AC5A 3OWJA 4ZAUA 4FVRA 3V5JA 3WZDA 5CZHA 5BVFA 1G5SA 3MGYA 4FKSA 5AV3A 2CCIA 1OGUA 4JDJA 5HE2A 3R1QA 4DH5A 4O0VA 1ZOHA 3ZZWA 4O7RA 3A7FA 3GNIB 3HDMA 3KMMA 1OECA 2OICA 4IX5A 4ASEA 3ZFMA 2I1MA 1V0PA 3ZHPC 4DDIA 4O2PA 3VS3A 4GVJA 1VLRA 2B9JA 3LOKA 2OSCA 3NNVA 4ACHA 4R1VA 2YLEA 3IK3A 2GFSA 1YDSE 4UWYA 5FP5A 4QRCA 5EKOA 4BCJA 3OUNB 4IAAA 4FL2A 2OZAA 1JSUA 4KRDA 3R7VA 4EZ3A 4J96A 4PTGA 3EN4A 3AMYA 4LMUA 4FRFA 3UIBA 2I0YA 2GHMA 2XIXA 4IWQA 5CF8A 3L8SA 4A4OA 5J1VA 4DFZE 4F0GA 1XMMA 1ZXEA 3N9XA 3NUUA 3MFTA 3QTRA 5HE0A 2QURA 2YIRA 4J7BA 2YACA 3KVWA 4U81A 4YZDA 4RRVA 4DN5A 3BBTB 3EFLA 5FXQA 2XK9A 4JT3A 5HX8A 2B9IA 2BTRA 1L3RE 2ONLA 4XOZA 2F49A 2P33A 3DT1A 4I22A 1FGKA 1WVWA 4PMTA 3UIMA 4YUQA 3EQGA 1HOWA 4BL1A 5FTOA 1XWSA 4RZWA 3UOJA 2PUIA 2PZPA 3DZOA 3SGCA 4M97A 3KULB 4JI9A 2B0QA 4U7ZA 4ANNA 2Q0BA 5FRIA 3PFYA 5KMIA 5CAUA 5I0BA 3L9LA 2YIQA 2C6DA 2QU6A 3ALOA 3Q2MA 4FGBA 5C03A 2GNFA 3VF8A 4D2SA 4ENYA 4AXAA 3JPVA 4AT5A 4O4FA 4PP7A 3LLAA 3D5VA 1O9UA 4GUEA 2XAMA 4AN3A 1H24A 4JNWA 2VWXA 5J5SA 4QTBA 3ZEWA 3BHVA 3EFWA 4Y46A 1DM2A 4XG2A 1H28A 5LXMA 4UEUA 3BE2A 3ODYX 4JDKA 2VNWA 4JQ8A 3LCSA 3R2BA 1V0OA 3A8XA 3BGPA 3DB6A 3IS5A 3VUDA 4GYIA 5JGDA 2XJ2A 3D7TB 3NW5A 3OY1A 2R4BA 4PDSA 4F6WA 1OIYA 3PE2A 1U4DA 2Y4IC 4C34A 4Z7HA 2VTSA 5AV1A 2JDOA 1ERKA 3E87A 4I92A 5E8SA 1YOJA 3AC4A 1G8AA 3UZRA 4EH8A 2Z8CA 4UMPA 1XHAA 2QCSA 5GIOE 4EC9A 1FVTA 2QOFA 1GIHA 4H1JA 4N6ZA 2IO6A 4RVMA 3PFQA 4YHJA 4MF1A 3SW7A 4AA0A 2WMVA 3PSDA 3UOKA 4L3PA 3VS2A 3ZO3A 2BZIB 2BFYA 3O8TA 5LCJA 5LVNA 4N6YA 4ONAA 4TT7A 4R3RA 4BGQA 1Q3WA 4HGSA 2GQGA 3IG7A 4O0UA 3MFUA 3DA6A 5DNRA 5EM6A 2ZDUA 3W10A 5BVDA 2VO7A 1L8TA 4CGAA 4L3LA 3A2CA 3BEAA 2XKEA 4BTKA 3DJ6A 4HYSA 3CSVA 2FYSA 5KE0A 4PNKA 5C01A 4UMTA 3BWFA 3ITZA 4FTLA 2UV2A 3KXHA 4QNYA 4DEEA 1TZDA 4IZYA 2WQOA 4AN9A 1R0PA 4U5JA 3R6XA 3HMIA 5EG3A 4AZWA 4F7NA 1ZYDA 1Q41A 4BHZA 4QYYA 3FE3A 3ZSHA 5JFXA 1PYEA 4W9XA 5A9UA 1P4FA 4Y5HA 2PE0A 3D2KA 3UO4A 5CSWA 4MTAA 3RM7A 3P78A 5M08A 1OIRA 4MXXA 3NIEA 4S30A 4OUCA 5GINE 4FSQA 3TKIA 3I7BA 3FLZA 4OW8A 3E62A 3HLLA 4G1WA 4QPAA 4CTCA 4BDAA 3FMDA 2ETRA 3IW6A 3QUEA 4JVGA 4ANBA 3R8ZA 3NYVA 3GOPA 4DG3E 4L7FA 1WCCA 3UPXA 5CAQA 2OF4A 1JAMA 2R3QA 4ASZA 3HECA 3LXNA 3KU2A 1UU8A 2IVSA 3DFCB 4JBPA 5GZAA 3AKLA 2JFLA 2XNOA 4M12A 3ZFYA 4BI0A 3R7GA 4QMZA 2Y7JA 2WTJA 3L8PA 2X1NA 3GP0A 4TNBA 3SD0A 3ZUTA 4GKHA 3BQCA 3LVPA 5DWRA 1R39A 4S32A 4RIXB 3RCDA 1Q62A 4R1YA 4Z55A 5JH6A 4AGUA 1WVYA 3IOPA 4EUTA 2ZB1A 3QXOA 3PA3A 1NVQA 5F94A 4GT5A 2ITWA 2VGPA 2VTHA 3FMEA 4O22A 4MQ1A 4XBUA 4GRBA 3DKOA 3GCVA 3W0PA 5IQAA 2RF9A 4GL9A 4U43A 3QD0A 2WGJA 3BYSA 3GB2A 4O4BB 3ODZX 4O1PA 5AR5A 1OBDA 3BV3A 5L2WA 2WTDA 3KULA 4U0IA 3A7JA 5E8XA 1O6YA 4EK4A 4CG8A 1M17A 4AW1A 4XP3A 4BJJB 1XH5A 3BU5A 5BV3A 2BDWA 3QKMA 5AP7A 3A7HA 3PJ3A 3NEWA 5BVOA 4RFZA 4YZ9A 4NJ3A 4BRXA 2IVTA 3NWWA 3V01A 3BV2A 5IQHA 4RC4A 3FV8A 3H3CA 3IW5A 4FV8A 2RSVA 4EOPA 2ZVAA 2IEWA 5C8MA 1B6CB 3ZSIA 4G34A 5H2UA 4F6UA 3RP9A 3C4EA 5AUVA 2ERZE 3AT2A 5CVFA 4CV8A 5J8IA 3AC3A 4BBMA 3D7TA 3GC0A 4FGRA 3F2RA 3NUNA 2V22A 3EHAA 4QMMA 4YNEA 3F7WA 4H05A 3GOKA 4O0TA 5E8TA 5IUGA 3G51A 4KB8A 3I79A 5M4CA 3U6IA 1NW1A 3CEKA 3QCSA 4UN0C 2ZV2A 2ACXA 3VHEA 3LQ3A 3K3IA 3CTJA 2W4JA 2E9UA 1REJA 3NW6A 3R2YA 4JLCA 3WI6A 4V0GB 4H39A 2X9FA 3BQRA 1CM8A 1YHWA 2C0OA 3TXOA 1H26A 4KSQA 4EOKA 4ACMA 5EW8A 2Y0AA 5HO7A 3PYYA 1ZZ2A 4AW0A 3FKNA 5F95A 4YTHA 5LARA 5CEIA 1XBBA 2B7AA 4I5HA 5IH6A 5IG1A 3EWHA 5FBOA 2W05A 3TIYA 5AP0A 4BVUA 5I9ZA 4EJ7A 1ZZLA 1O6KA 4DTKA 5M56A 3HEGA 5AAGA 3EQCA 1OKZA 2GDOA 1NXKA 3HUBA 4MH7A 1FGIA 4EJNA 4NM3A 4DTAA 3UDTA 3CD8A 3KMUA 3S3IA 4AW5A 4DEGA 5JRQA 2FO0A 4ZTQA 3UG1A 4YPSA 4Q9ZA 1Z5MA 3Q32A 4FTCA 5LWNA 2BKKA 3QX2A 4NUSA 3TIZA 2X0GA 5K9IA 3IO7A 4YJTA 4C61A 2P55A 3BI6A 5AA8A 3FZOA 1ST4A 3U55A 5F1ZA 4EORA 3QQKA 2Z02A 4FODA 2HELA 5IUIA 2F7XE 5CAPA 3T9TA 3FY0A 4BDFA 4BKJA 4F7LA 3HV7A 1PW2A 3NLBA 3PSCA 2EWAA 4FNZA 5F9EA 2PVFA 4WUNA 3KMWA 5EFQA 4FIJA 2GNGA 4GK3A 1H27A 2OJ9A 4ERKA 2UZOA 4RFYA 2JDSA 3QRUA 1YDRE 1ZAOA 4ANQA 4OBQA 2GTNA 3GCSA 3QRTA 3QTUA 2X9EA 2PZYA 4H1MA 3GUBA 2A2AA 1MQ4A 5H8BA 5AAEA 4ZK5A 5IA0A 4P7EA 1UNGA 3QRJA 3QLFA 1OZ1A 1WBPA 2C6LA 2R7IA 5HD7A 4E3CA 3ZDUA 2FA2A 1T45A 1OMWA 3CXWA 3C0IA 5DHJA 4QTCA 3OP5A 3SG9A 3NVKI 4RIXA 1JWHA 4DFUA 1H01A 3F69A 3MVHA 3O51A 2FSLX 1H08A 2GHGA 2X81A 4D4SA 2BRMA 3D5UA 5E8YA 2OG8A 5AUWA 3B8QA 2XK3A 3VF9A 2XH5A 3OEFX 4EH5A 1WMKA 5BYYA 4YJOA 3FLSA 5CSXA 3MS9A 3RCJA 2OO8X 4BWPA 4LGGA 2UZDA 3OCSA 4U42A 4UYNA 4W9WA 3ZC6A 5HCXA 5IQEA 4C3RA 5CF5A 3E88A 4AXFA 1YXSA 1Y6AA 2QQ7A 3KL8A 3PXKA 4O7YA 5J9LA 4LOOA 4EOQA 2QOBA 3OG7A 3K2LA 3Q4ZA 4PMPA 3KA0A 3P7BA 5DT4A 4E73A 3NFGB 3LFAA 3R9HA 4RLLA 3OC1A 2IVVA 2CKEA 3BLRA 3FKOA 3GXLA 2YEXA 3QUDA 4KIOA 3FZRA 3Q4CA 2YM3A 3VS4A 4F0FA 1MRYA 3AGMA 3PJ2A 4GVAA 5DMZA 2OH4A 3BE9A 4FTAA 4RX9A 3OWPA 2QOKA 3GFWA 4IFCA 4FKQA 4OTHA 2HIWA 4BC6A 2Q0NA 5IMEA 5DVRA 2XNMA 5DEYA 3MPAA 3LKMA 5DA3A 5AP5A 2Q83A 2J51A 2WD1A 4FZDB 3FXWA 5HBJA 2XALA 4AXDA 4G6LA 4AQKA 4ENXA 2ONLC 2AC3A 1UWJA 2XK6A 4C4EA 2WTWA 4GU6A 4EH3A 2WMXA 4C62A 4C8BA 4CFNA 4BHNA 4JBOA 2HZ0A 3OCBA 3TV7A 3NS9A 4V0GA 4DG0E 1JVPP 4S33A 3U6HA 3IDBA 4LI5A 3ORMA 1T46A 3KRXA 4BN1A 4PNIA 3ZS5A 3VWAA 3WF9A 3VJOA 4FZ6A 2VO6A 2CCHA 3OFMA 3AMAA 1IG1A 3EQFA 3C4ZA 4O6EA 3MY1A 2KULA 2PUUA 3RK5A 4BIEA 4YZCA 4LUEA 5ETAA 3SXSA 3F9NA 5BMMA 3W2PA 2XKFA 4W4YA 5AUZA 5IEVA 5KMLA 3LJ0A 4BCIA 2Z7SA 1R0EA 2FSMX 1HCKA 4N0SA 1W2CA 3EKNA 5HTIA 2ITQA 4HNFA 4LM5A 1RJBA 5FEQA 2NPQA 4F9AA 1JKSA 5LVLA 4WO5A 2XIYA 3DNEA 2XS0A 5DRDA 3KRLA 4IDVA 5JZJA 2XEYA 3OCGA 3FPQA 5DGZA 3Q3BA 3W0RA 5C4LA 3KIOC 4FF8A 2YJRA 1XO2B 3D83A 1KOAA 3FUPA 5HU3A 2C1BA 2YWPA 3FSKA 4Y5QA 3UOLA 1E9HA 3KK9A 4WBOA 5CEOA 5KMKA 2PZ5A 3NAYA 2JC6A 4GG7A 1OPKA 1SNXA 4PV0A 5ETFA 4JR7A 2JIUA 4OAUC 3MVLA 3S2PA 3SAYA 1KE9A 3F5GA 4NT4A 3VIDA 4BCHA 3OHTA 4O83A 3U51A 1M52A 4IWOA 1J1CA 3UZPA 5LVPA 3CKWA 4FOCA 4ANSA 3M11A 4OTWA 4IIRA 5ANOA 5H8GA 3NSZA 3V5PA 4FNYA 3ZFXA 2JBPA 4P90A 1XH6A 4R5SA 1KWPA 3P5JC 3QWKA 3KRRA 4DG2E 2QONA 3DTWA 4O0XA 3PVUA 1TQPA 4ZS0A 1Q8TA 1CDKA 3P4KA 3QUPA 3GGFA 1GOLA 4NCTC 3SQQA 3U4UA 4CVAA 2XRUA 5L2IA 4UX9A 3DPKA 5CZIA 3R9OA 4ZMFA 4HGLA 2XCHA 4IZ5A 3COHA 2GNIA 2XANA 4JG7A 4I94A 5B2LA 1TQMA 4PF4A 5CQWA 1J7LA 4G3CA 3VS0A 3QQGA 4AGWA 2R3HA 3A4PA 2X39A 4L9IA 4K2RA 5A46A 2J4ZA 3K3JA 4YLKA 3U9CA 4U79A 4O4CA 4X0MA 4JQEA 1M2PA 3KK8A 2XIZA 5I9WA 5BMSA 1WZYA 4NW6A 2PHKA 1P2AA 4H3BA 2GMXA 1H0WA 4F08A 5I9XA 4C2VA 4KA3A 2XJ0A 4LG4A 5HO8A 4J98A 1FBNA 3S4QA 3FMKA 3FYKX 4M0ZA 2WTKB 3OY3A 3R71A 3M2WA 4FSUA 4FV5A 4EH4A 2YIXA 1H1WA 1YKRA 5CEQA 4F99A 2WPAA 2XAOA 1KE8A 4M3QA 4WHZA 2VTLA 4M66A 4AS0A 5FTGA 2BIYA 5IA2A 3LZBA 3MTLA 3PTGA 3EYGA 2QR7A 3G6GA 4U97A 2HZIA 3D94A 4BBFA 2YFXA 4RPVA 3Q4TA 4AZFA 4AA4A 4DC2A 2W0JA 3ENMA 4HPTE 2WTIA 3RTPA 5HX6A 3PY3A 2YA9A 5D41A 3UO6A 2OLCA 1GJOA 1W98A 3R04A 3OT3A 4RWIA 1RW8A 2UW4A 3BHTA 3H30A 3HGKA 3PRIA 4B8MA 2PZIA 4AP7A 1A06A 3UYSA 5HNGA 4MD9E 4EKLA 2PWLA 4EYJA 1KSWA 3Q6UA 2W17A 4FKRA 4IAZA 4KRCA 3DXNA 4ZTSA 3MI9A 5HG8A 4KKGA 2GQRA 3QA8A 5IMXA 2REIA 4RQVA 1ATPE 3NCZA 3OTUA 3HA8A 3PWDA 4DYMA 4UB7A 3S00A 2VZ6A 5IQDA 4YO4A 3VUGA 2CPKE 5CS6A 2DS1A 3QQLA 5C9CA 3SW4A 3ZRLA 4FYOA 5AX3A 4FUYA 2PVLA 3D7ZA 4ALUA 4ZLOA 2QLQA 4DH3A 2BUJA 4I5CA 2ZAZA 1OB3A 4YSJA 1V0BA 5DIAA 5EDRA 4TKSA 3L9PA 3ZRKA 4CFVA 4PQNA 3BHYA 3UMWA 3SG8A 2IVUA 3TTJA 1UVRA 5E7RA 4FSYA 2BTSA 5LMKC 5AV0A 4AF3A 4L45A 2QODA 4XG8A 5CQUA 2HY0A 3W0SA 5AWMA 1PMNA 2WU7A 3MN3A 3QQFA 4J8MA 1PXMA 2W4KA 3O17A 4UYAA 4GS6A 4KSPA 5B2KA 4F09A 5CVGA 3ZTXA 3WE4A 2ITNA 4EBVA 2QOQA 4DGMA 3VBTA 4E7WA 2CGXA 3PWYA 2XUUA 5CSVA 2E9NA 4K9YA 4IH8A 4J97A 4R6VA 4FBXA 5HO6A 4CG9A 4XUFA 4R3CA 3R8VA 3G33A 4O27B 4ZSEA 4ZLZA 5IA3A 3DCVA 3LCKA 2XM9A 2X8EA 4DGGA 3FQHA 3R9NA 4UXQA 4AACA 3F3WA 3Q5ZA 2JDRA 2F4JA 3LLTA 4OLIA 4K11A 4QTAA 5ETCA 4DF3A 4X2FA 3BCEA 3CP9A 3P5KA 4NL0A 4U45A 4ZZNA 3VNTA 4DHJA 4LOPA 3LM0A 4G31A 3MBLA 5D7AA 4D28A 4EH2A 4UMQA 4LUDA 3DAJA 3RZBA 4EWHA 4XBRA 5IEYA 1K9AA 2VX1A 1Q99A 3AD6A 3BHUA 4WNKA 3TKHA 2CGWA 3OMVA 3QU0A 3OBGA 3SOAA 3TTIA 2CSNA 3O0GA 2FSTX 1IA8A 5AP1A 5EDQA 5HE3A 3D2IA 4PL5A 3NX8A 5HEZA 1PMUA 4KUJA 4C3FA 4QPSA 1WBVA 3MVJA 3PG3A 4C0TA 4LYNA 3HVCA 5E91A 3O23A 1Y8GA 1Q8ZA 2Y9QA 5LVOA 4IB0A 4G17A 4FK6A 4K77A 4X3FB 3K5UA 3EMGA 3ZEPA 2XZSA 3TNWA 3GI3A 1J7UA 3MB7A 3PPKA 4AFJA 3P7CA 5HIBA 5AUTA 2X2MA 2EXMA 4RWKA 1GZ8A 5E9EA 3JY0A 4Y72A 4KS7A 5CX9A 3TACA 4L00A 3A7IA 5FM2A 5HG7A 3SLSA 4CFFA 1M7NA 2ZB0A 1OITA 5AM6A 3SDJA 3LMHA 4B4LA 4FSZA 3ZYAA 4BTJA 3LW0A 3EL7A 1XH4A 2J6MA 5BYZA 1BUHA 1S9IA 1RQQA 4NU1A 4RQKA 4CV9A 1YXVA 4XV2A 1XH7A 5BX0A 5DT0A 3GEQA 3UMXA 3EQDA 4D1ZA 4KBAA 3DXQA 2XNEA 3QD4A 2ITPA 4FIFA 4EK5A 3DBQA 3HV4A 3RPOA 2A27A 5TKDA 3LFCA 4E4XA 1NT2A 2I7QA 4FIIA 3PDTA 4UWCA 1PYXA 4LRKA 3LFFA 3GVUA 4XMOA 3V6RA 4CCUA 4OAVB 2AEGA 2YCRA 4K33A 3P7AA 3QQJA 4IBMA 4MXCA 4ZY4A 5IF1A 2DWBA 3TCPA 1GAGA 2G01A 4ZXTA 2BHEA 4TYHB 5B0XA 3DK7A 2FVDA 2UVXA 4J99A 2BROA 4X7QA 4CCBA 3DB8A 4YJUA 4OTPA 4AE9A 3WILA 4XG4A 3RHXA 3WYXA 3M1SA 4DAWA 3H9OA 3CTHA 3MTFA 4I41A 4IM2A 4APPA 2C3IB 2IZTA 1VR2A 3EQRA 3WF7A 3QX4A 4R78A 2BPMA 4O21A 5DG5A 4TWNA 3VBYA 3R63A 2B54A 1ZYLA 2YAAA 4BBEA 5A54A 3OUKA 3NAXA 4ANMA 2C6IA 2A19B 2R3PA 2XK4A 3HX4A 5C1QB 1VYWA 4FSRA 4JRVA 4BDCA 3O5AA 3SC1A 3OTVA 4AT3A 4CLIA 5KHWA 2YWVA 2GNJA 1JKLA 2WEVA 3C1XA 2RFEA 3VAPA 4DITA 4F7SA 5K4IA 1R1WA 2GFCA 2Z7QA 4LRJA 2ZV7A 3Q9YA 2ITTA 4RA4A 2B53A 3G9NA 4JG8A 1PXIA 3HMPA 2FB8A 1ZYCA 4MNEB 3PZHA 1PXKA 3Q04A 4GJ2A 2QO2A 2PE2A 4XJ0A 4EH6A 4S31A 4JIKA 3VS1A 4BDKA 4FEQA 3FLWA 2OW3A 3MVMA 4GUBA 4WD5A 3UC4A 4IDTA 2UZUE 4AOJA 3UPZA 4YPDA 1YQJA 4RIOA 4R5YA 4WA9A 4C4IA 4O7LA 1U5QA 5A6OA 3MYGA 5EQPA 5M4UA 4QMXA 4RVKA 3R00A 4QD6A 4D2PA 5IZFA 4YU2A 2C6OA 2IZSA 4GK2A 2FSOX 3PXZA 3AGLA 2VWZA 2IW6A 2OJIA 4GG5A 1U46A 2OF2A 3IW8A 3DBFA 2R0UA 4FT7A 1OKWA 4J71A 5EQEA 4PDYA 2G2IA 2XK7A 2WQNA 4KWPA 4XYFA 1Q4LA 4RJ8A 4DFNA 4XEYA 5AM7A 2EXCX 2VTJA 4F1MA 5KMMA 3CQEA 4TRLA 2WQBA 2UVZA 3PVWA 5JK3A 1XH9A 4I6QA 3V51A 3WZJA 5CU4A 4FKTA 5BVNA 3DAEA 4NH1A 3ORKA 1SMHA 4YO6A 3V6SA 2CN8A 4I4EA 4IANA 4WUAA 4FSNA 3VUIA 3ACKA 2IG7A 2PSQA 4I3ZA 1BL6A 3E63A 1CTPE 3CPCA 1P4OA 2ZM1A 5A14A 2HAKA 4CKIA 1CKPA 1AQ1A 1OL1A 2OZOA 3QCXA 4GJ3A 3O8PA 4W8EA 4YJPA 3QWJA 4X3FA 2DYLA 3QTXA 4ALWA 1OL5A 1OIUA 3RK7A 3CKXA 5G6VA 4I0RA 4PRJA 3BEGA 3DKCA 2XNBA 4JAJA 3Q96A 3AD4A 4RA5A 4ZSGA 4C2WA 4GEOA 2JFMA 3ZLYA 3KXNA 3G5DA 1QL6A 3MIYA 4FIGA 3FMNA 3I0QA 3W16A 2F9GA 4PMSA 5IQIA 3KN5A 4JL9A 3UOHA 4FTNA 5KCVA 4AW2A 2WMTA 3PVBA 1Z9XA 3R7UA 4APCA 4KIQA 4YGAA 3UZTA 3ZH8A 4MXZA 4RC3A 4YJVA 5EH0A 2ZDTA 4NCTA 1WBWA 4YLLA 5FDXA 3NVMB 1SVGA 3V5WA 4L68A 3N51A 5EW9A 3ZRMA 3P9JA 4E6QA 1XMLA 5AP2A 3NMUF 4FA2A 1ND4A 3PA4A 2ETMA 4V01A 4Q5HA 5E1EA 1ZYSA 4FZAB 5FWKK 4FTJA 5CXHA 4MXAA 1WAKA 5EYDA 2A0CX 1OGYA 2PE1A 3G15A 1STCE 5L6WL 4QMTA 3D0EA 4TYHA 5FUTA 2C0TA 1JPAA 4FR4A 3UODA 2J90A 4EC8A 5JEBA 3LFSA 2JD5A 3DAKA 4FKJA 1BI7A 1QCFA 2C5VA 4R7HA 4Q5EA 1AD5A 4IAIA 4BDIA 2YABA 5JQ5A 4O7NA 3QTZA 4IM3A 4EL9A 2YHVA 4EUUA 3NYOA 3SV0A 4HPUE 5LCKA 3WZEA 5D12A 4X2JA 3MFRA 3I6WA 2V0DA 2XBAA 4ASXA 2YCFA 1OPLA 4OBOA 1YOLA 3GU7A 3F61A 3LCDA 4IB5A 4KAOA 4X2GA 2IW8A 4EK3A 2X0QA 3MH1A 5DFPA 5B7VA 1Y57A 4Y8DA 5IEXA 5A6NA 2P3GX 5AV2A 5J79A 2C6MA 3BHHA 3MW1A 1PRYA 4IWDA 3UNZA 2IPXA 1M14A 2RKUA 2VNYA 2XVDA 3FZ1A 3IONA 3D5WA 3LAUA 3MPMA 4ZJVA 2XIRA 3G9LX 4DHIB 3IQ7A 4ZY6A 3DLSA 1G3NA 4MNEA 4WT6A 2PYWA 3Q5IA 4BCOA 4A4XA 3KXXA 5AV4A 2YCSA 2QU5A 5K5NA 4FK3A 3E7VA 4NM7A 2X2KA 5D9HA 4DLJA 3OW3A 2J9MA 4CT1A 2QVSE 4FG7A 2QO7A 2GSFA 3L1SA 3WZKA 3E3PA 4EZ5A 2WQMA 4C37A 1H07A 3PSBA 1NA7A 2W1IA 1IASA 4J52A 4IM0A 4MXOA 4PPCA 5CI7A 5E8VA 3VS5A 4BI2A 3ZO1A 5KX8A 4XG9A 2W1HA 2XB7A 4QYFA 4GFGA 3RM6A 4WNOA 4KIKB 4DHFA 3Q9ZA 3W0QA 3DDQA 5M55A 4A9UA 5HQ0A 2C68A 2OWBA 1YRPA 5EYKA 2GS7A 4U9AA 2BIKB 3I4BA 4UZDA 3R9RA 3HP2A 1WFCA 3ML1A 3SA0A 2XMYA 3EN9A 1CSNA 1Q3DA 2R5TA 4AU8A 4Y95A 4F7JA 3DQXA 2C6EA 5HLPA 4DH1A 5KBRA 3O7LD 5EOLA 2ZMCA 1OUKA 3QYWA 5LQFA 3ZXTA 3PLSA 3ZUUA 3F2NA 5HBHA 3RAKA 4C36A 1JKKA 2PVRA 4FYNA 2EUFB 5LMKA 2X0OA 2R0IA 1PHKA 1YI4A 4DTBA 5J7HA 3MA6A 3C4FA 3IOKA 5HE1A 3W2QA 5HCYA 2O65A 4BIDA 3C4XA 5HLWA 5C27A 2X8DA 3UP2A 1UKIA 2Z60A 4L8MA 1GY3A 3EL8A 2PMNX 4WNPA 2J2IB 2RFSA 1XKKA 4TXCA 4C58A 2XBJA 4DEIA 2BVAA 4QYGA 1SZMA 3FL4A 2OH0E 1H4LA 2XKCA 3B8RA 4LFIA 5KZIA 3UE4A 3W55A 1IR3A 3II5A 4CTBA 3AKKA 1Q61A 2VX0A 1W83A 2VO3A 4IX3A 4L42A 5K0KA 5BUJA 3P86A