4BCHA

Structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
321
structure length
308
Chain Sequence
SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKAGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 9
total genus 84
structure length 308
sequence length 321
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bchA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4bchA01
4QP1A 1AGWA 1X8BA 3A4OX 5JZJA 4FIHA 4YSMA 3R8PA 4PDYA 1YOJA 4APCA 2UZWE 2ZDUA 3F5PA 4EOPA 4TTHB 2CMWA 3ORZA 2BALA 3R8LA 4KABA 1Q8ZA 1P4FA 5IMXA 2VO0A 3CQEA 3BI6A 3RKBA 3FSFA 2VWWA 5E8WA 4DGMA 3ZEWA 3ITZA 4ASEA 3IDCA 2GCDA 3NLBA 3F9NA 3V5PA 4CFVA 4YU2A 4MVFA 1OZ1A 2R3HA 3M42A 1CMKE 5DG5A 1BL7A 5LARA 5LWNA 3W10A 4BFMA 1XH6A 3VBQA 2YN8A 1YXVA 3ET7A 3RK7A 4QNAA 5DNRA 4AGUA 2C6DA 3IG7A 1XH9A 2CGVA 2PVNA 5EH0A 3PP0A 4IE9A 3TN8A 4ZK5A 5DR2A 4U9AA 2HK5A 5FQDC 5ITAA 1BL6A 3PTGA 1G8SA 2B1PA 4EOKA 2RFEA 3EMGA 3K3IA 4B0GA 4DFBA 2R3OA 2PUUA 3NNXA 4IXPA 3CPCA 2DQ7X 1ERKA 2XCKA 4IX3A 4U97A 3L8PA 4F6SA 3K54A 4ACMA 5L4QA 3OW4A 4BCOA 3HV5A 4EH4A 3MI9A 2QOLA 5GIOE 2JDTA 5J7HA 4NM0A 4Y8DA 1BKXA 3WZKA 4LOQA 1OUKA 2ITZA 2XK7A 5CEPA 3A8XA 3QUPA 2PUIA 1XH8A 3L8XA 2J50A 3PVUA 5ETAA 5C26A 5I9XA 5EW8A 4CFXA 2Z7SA 4BCIA 1ZOEA 3D2IA 3E8NA 4UB7A 3VUKA 4BDJA 3LCSA 4YC8A 2Y0AA 3AT4A 4M67A 2XNPA 3MH2A 2HW7A 4R3CA 4R5YA 3PRIA 4FKTA 2R3FA 2HY81 3EYHA 4F08A 2QKWB 5EYMA 3ZUVA 1KV2A 3IGGA 4EORA 4H1MA 2XKDA 3JVRA 5E4HA 4FEUA 3G6HA 4YJVA 2OJGA 5AIKA 4AQCA 4QYHA 3KRWA 3DB6A 4XG3A 4JG8A 4BICA 3DNEA 4FEWA 3MVMA 2O5KA 3HX4A 5DE2A 3W2PA 4BCNA 1PKGA 3AMYA 3R8VA 5AA8A 1GJOA 3EQDA 4MTAA 4YC6A 3LLAA 5IDNA 4F6WA 3PJ3A 4I0SA 4LRJA 5CZIA 2ZV2A 3CEKA 4XLVA 4EOIA 3ZC5A 3UJGA 2F9GA 4RIWB 4AOIA 2HOGA 2C47A 3MPTA 5IQDA 3G2FA 3KFAA 4QMZA 4CYJA 2ERZE 3TXOA 4UMTA 4P90A 3R7YA 4B8LA 1GOLA 1R78A 3NUXA 3DTWA 4I20A 4N70A 4A4OA 5BYLA 4HGTA 5DA3A 2W0JA 1QPEA 4FKVA 1OIYA 4H1JA 4QTBA 4DH5A 2W1DA 1IEPA 5ANJA 2X8DA 4KKHA 3R1QA 3VS2A 1Y8GA 4PTCA 2C5YA 1NA7A 3JUHA 4FI1A 4I0TA 3RPOA 4L43A 4NTSA 3U87A 3VBTA 2CKPA 5BMMA 3P86A 3KXXA 3WZDA 2QO7A 2V7AA 4NT4A 2ETRA 1R39A 1JSVA 4FKSA 3B8RA 4BHZA 5J5SA 4FR4A 2UZUE 1VYWA 4H3BA 1A9UA 3ORXA 1Q8YA 4BTFA 4Y46A 3PE1A 1H8FA 1YXTA 5CVFA 4CVAA 4O7WA 3F6XA 2B4SB 3KKVA 4RJ6A 2NPQA 4L67A 3FHIA 3GNIB 4EOQA 1BX6A 4PMPA 2OFVA 4ZSGA 2X2LA 3BHVA 3G0FA 3KCKA 4D1XA 4QMYA 3TUDA 2YERA 4UZDA 3L9LA 2R3IA 2VV9A 3ENHA 3KN6A 4C58A 5C01A 5BVWA 1IA8A 4NTTA 3BU5A 1H26A 4O22A 2H6DA 3A7GA 4X2FA 2XRUA 4V0GB 3PY3A 3AMBA 2FA2A 4EH3A 4F65A 4EKKA 3R9RA 4YO4A 4GL9A 4PMTA 3W2QA 4BDIA 3DBFA 3G0EA 4QMWA 5D41A 4EH2A 3V8TA 3S0OA 3PVBA 4GVAA 4XYFA 4Y83A 4EK6A 3WF7A 3RWPA 4FTCA 4ANSA 2VWUA 3LFFA 3LXKA 2BIYA 3TNHA 5HTBA 3BGZA 3B2WA 4BIBA 5CZHA 4FIIA 5E8UA 4IAFA 4CT2A 3ATSA 2WQBA 2X39A 4X21A 4E5BA 4RLKA 2FO0A 5LVMA 4D2TA 2O63A 2XVDA 3QRTA 1QMZA 3R73A 4F1TA 2W1FA 4FTUA 3KF4A 4MKCA 2YM3A 4U6RA 3FKLA 3LKMA 2CKOA 4WKQA 4H3QA 2PWLA 2C0IA 4AGDA 3FQEA 2PL0A 4E6DA 3GOKA 4ZSLA 4AA0A 1RW8A 3MDYA 4BWPA 4O0UA 4S32A 4EH5A 5BVDA 1H1RA 5HOAA 2F7XE 4I94A 1TQIA 4BRXA 1UWJA 5I9YA 2ZAZA 2YM7A 3ERKA 2IVUA 4OBQA 4XNEA 4DYMA 3G51A 3L8SA 4BC6A 1T46A 4FTRA 4OTRA 2WU6A 5FP6A 4FK3A 5AUZA 4DCEA 3LQ8A 5HG5A 2BVAA 3W16A 2F2CB 1PMUA 3CC6A 3MA6A 4K8AA 3QL8A 5FM3A 3TV6A 3NVKI 4D9UA 1WBPA 4C38A 4LG4A 4XMOA 5C03A 1YXSA 2Y4IC 3UC4A 3ZFMA 2O64A 3VULA 2F7ZE 4NSTA 2DWBA 3D7ZA 4IJ9A 5AUVA 5BVEA 1WAKA 2UW4A 4E6QA 3KY2A 1OMWA 3DXQA 3KMWA 5HG8A 4FMQA 3RCJA 1NXKA 3IO7A 2ETKA 4ZY4A 4UYNA 2QNJA 5JGDA 2IJMA 4JBQA 5CT7A 4O6LA 3OCBA 2VGOA 4L3LA 2GSFA 4GIIA 2JDOA 2VTLA 3EL7A 4EOLA 4FKOA 5GJFA 5IQEA 3F3WA 3H0ZA 3VBWA 5HNBA 2WQNA 3RP9A 4BDBA 4UN0C 1BYGA 2A19B 2PMIA 5DWRA 5KX8A 5IQAA 2IZRA 3QXOA 3EQIA 4IX5A 2H8HA 4RVKA 4KIPA 2B0QA 2KULA 2R3GA 3AQVA 2WTWA 5H2UA 5HIEA 3BV2A 3ZZEA 2OBJA 5DR6A 2WIPA 3Q4ZA 2J0IA 4JX7A 4FGBA 2F7EE 3MH3A 4IFCA 4P5ZA 4ERKA 4UMQA 4CSVA 2BKKA 3PA4A 3HMMA 1V1KA 2QVSE 1WBTA 4MBLA 5KE0A 3OCSA 1JSTA 1LPUA 2ONLA 3EN6A 1P14A 4RA5A 4D1ZA 4MNEA 5E7RA 2VX0A 2DUVA 2IN6A 2X8IA 2XB7A 2ZDTA 3GP0A 3R30A 5DH3A 4KBAA 3HKOA 3E87A 4LUEA 3QGWA 4G16A 4ASXA 4CXAA 5IQGA 3JY9A 4ZP5A 4DEIA 4LQMA 3O2MA 2CCHA 3QGYA 2IVSA 4DFXE 2JC6A 3NIZA 5IA2A 2R3PA 2Z02A 3HECA 2BAQA 4FG9A 1EH4A 4YUQA 2P4IA 4EONA 1SMHA 4PWNA 4ZSAA 3TT0A 3U9NA 4C2WA 1P4OA 3ZU7A 5HD4A 3QTUA 3IOKA 2NRUA 3RPRA 3UIBA 2WTJA 4OTPA 1PJKA 1J3HA 2BCJA 2CGUA 2YJSA 3N51A 4PNIA 4E4MA 4AW0A 3VUMA 4KRCA 4U44A 3F5GA 3RNIA 3TACA 5EOLA 5C9CA 3ZFXA 4GU6A 4R3PA 3VWAA 3BE2A 3DPKA 4E5WA 3PYYA 3K3JA 4L44A 3HYHA 3QQKA 2QO9A 3MPMA 3KRJA 3R00A 3ORNA 4K1BA 3NUPA 3KK9A 3WF9A 2OH4A 2G9XA 4ZEGA 4F70A 4Y72A 2XNEA 2EB2A 1OPLA 3C4CA 1AD5A 3GB2A 4AACA 4RA4A 4E3CA 3V5TA 4F0IA 2UV2A 5CALA 4RJ4A 1Q61A 4KSPA 2XEYA 2BIKB 5JFSA 4D2WA 4NCTA 4C37A 5D12A 5E8YA 5LVOA 2X6DA 3UP7A 4OR5A 4W9XA 4HVIA 4QQCA 4IEBA 3ZYAA 5KMNA 5BUJA 4DLJA 5FDPA 2JLDA 5KCVA 4EUUA 3B8QA 3PUPA 3NUSA 4IACA 3ZFYA 2XF0A 3E3BX 3DKGA 4QOXA 3PIZA 2VWXA 3F5XA 1GIIA 4LL0A 4RMZA 3H3CA 2HWPA 1XJDA 4FEQA 4L7FA 1GNGA 3C0GA 5JQ8A 4FL2A 1ZWSA 2WNTA 3R7OA 4XRLA 3COIA 3BEGA 3BLQA 4IIRA 4YTCA 4ZMEA 5JT2A 1JKSA 3K5UA 2R7BA 3C5IA 3R9NA 1KE8A 2QC6A 4EHZA 3CD8A 5IQBA 5K4IA 4FZ6A 5DMZA 4FIGA 5AP0A 4Q5EA 4ANQA 3A62A 1BLXA 4L8MA 5HIDA 4I93A 4O7LA 3LQ5A 4MH7A 3UNJA 4HCVA 2YM4A 5EKOA 4F9WA 4HVGA 4TYIA 5CSVA 5FTOA 3LCKA 5D10A 4JDHA 4K9YA 4AP7A 3D7TA 4WOVA 4PP7A 4KUJA 3PPJA 2YHVA 4GT5A 4GUBA 4FK6A 1W84A 5HNGA 2ZM4A 3Q5IA 5L8JA 5A46A 4E73A 4S31A 4YJUA 3IW4A 4U43A 5F94A 5AA9A 2WQEA 4RIWA 3SV0A 5CEKA 3E64A 3HMNA 2ITPA 2BAJA 3KXNA 3R9DA 1YWVA 3FC2A 5DN3A 3LFCA 1OL7A 5FM2A 4BDHA 5F9EA 5ICPA 3NSZA 1J7LA 2YIRA 2GNLA 4QQ5A 3RBWA 4C36A 5AP1A 3HA8A 3DY7A 3TJDA 4AW5A 5BVNA 1REKA 2SRCA 2XCHA 3PVGA 3OTVA 3QD3A 4GFMA 1Q8UA 4FF8A 5E8SA 3ZRKA 4JL9A 1AQ1A 3O8PA 3VS1A 2GNFA 5CF5A 4RPVA 4D2RA 4Z7HA 2VTSA 4FV9A 2YCRA 4XX9A 3O23A 5EI8A 4JS8A 4RVMA 2ITVA 5C8NA 2ZJWA 2HCKA 2RIOA 4LGDA 5KMKA 1PHKA 2HXLA 4UMUA 2ITYA 3HA6A 3MTLA 2YZAA 3KRXA 4MD8E 4ZTSA 1B6CB 3BBWA 4RX5A 4EHGA 1YRPA 2CNUA 1Z57A 3LFBA 5IA5A 3QA8A 4NEUA 3MVHA 5AUXA 4WNOA 4LV8A 3BRBA 5KMJA 1ZYCA 2B7AA 3I6UA 3NGAA 3PG3A 5DI1A 4XP2A 3ZTXA 5KMIA 4FE2A 4G9RA 2E9OA 4FIEA 5E1SA 2BRNA 4FZ7A 5AJQA 2YDKA 4GG5A 3LE6A 4BZNA 3I0OA 4IB3A 3TJCA 3IPHA 3Q4CA 1YQJA 4DEAA 5HZNA 3WYXA 4K77A 3R21A 2QODA 3DLZA 1UVRA 4DG0E 1OIRA 4CKJA 2PY3A 3OCGA 4M12A 5ETFA 1Y6BA 3OWPA 5HE1A 5BX0A 5GZ9A 2BDWA 3UO4A 3DK7A 3GBZA 1H1PA 3ZBFA 3QC9A 5JN2A 2XIKA 2DS1A 4RJ8A 2NP8A 4CMTA 5K3YA 5HVKA 4DEBA 3VRZA 3D14A 3DLSA 5JK3A 3F3TA 4FT5A 3Q9YA 4Z55A 3I6WA 4BYJA 4X2JA 4AX8A 5ANGA 5BUEA 5BVKA 1FVTA 4O91A 4UXLA 3DQXA 3S95A 4DHFA 3CSVA 5FP5A 3GEQA 4IX4A 5GJDA 2IZSA 2GHGA 3NW6A 5DT4A 3VHEA 1UA2A 2UW5A 3NNWA 2CHLA 4L52A 4BCJA 2IPXA 3RNYA 3D83A 4KKEA 5IQFA 1PXPA 2GHLA 3LJ0A 4FT7A 4DH1A 4O7NA 3GC0A 3QXPA 4C0TA 1BI8A 4U42A 4AFJA 2VRXA 2XNOA 2WXVA 5AR5A 1R3CA 2C1AA 4PDPA 2GFCA 1PXKA 3CJGA 4U5JA 3VUGA 3VW8A 4ERWA 3RM6A 1NVSA 2X4ZA 4X6RA 1UU7A 1O6KA 4RJ5A 3T3VA 3L9NA 4ZTHA 3UMWA 3NCZA 5AM6A 1JKKA 3QU0A 4F9BA 3GUBA 3PJCA 3QKMA 3RK5A 3SD0A 4AU8A 4C4IA 3OY1A 4KBKA 4MWIA 1PXMA 4PL3A 3TKIA 4B8MA 2AUHA 3F3UA 2PE0A 2WELA 4YLJA 3ZLXA 1ZZ2A 5AV4A 4JR7A 5AV1A 5F4NA 3NMUF 2CDZA 3QLFA 1Q62A 2XNNA 2HZ0A 5G1XA 3BQRA 4N6ZA 5HVJA 4FTNA 4D4VA 2GQGA 5AP5A 4B4LA 4R1YA 4ZLOA 5IISA 1QPJA 2PMLX 3C4ZA 5K0XA 2JDVA 4C3FA 3PLAE 2PZIA 2PZPA 4QMTA 5EYKA 4ZJVA 4FKUA 3RPYA 4RIYB 1OL5A 2CN8A 4CLIA 4NIFB 3VS7A 4FNXA 4V01A 3FBVA 3UZPA 4EZ5A 4YJOA 2W06A 3CBLA 3NIEA 4RGJA 4CZUA 3MA3A 4DGLC 1HOWA 5CAOA 1PMNA 5AV2A 3SXFA 2OXDA 4NM7A 4CMOA 5J8IA 2C68A 4ZZOA 5JGBA 3UQCA 4FEXA 4TZRA 5CSXA 4GMYA 3DKCA 4J95A 4QP9A 2BROA 2B9FA 4IB5A 4BCMA 1J91A 3G9NA 2WTDA 4RX8A 2QU5A 4BYIA 1OL2A 3FPMA 3LFNA 4RX9A 3PIYA 5K4JA 4GK4A 4XOYA 4WNPA 5AP4A 2XBJA 3NWWA 3DBEA 3ELJA 4IB1A 3R6XA 3MTFA 4XV9A 3U51A 4TKSA 4FICA 3UIMA 2ITWA 5AP3A 5I9VA 4EH8A 2NO3A 3OUNB 2PVHA 3FQSA 2YLFA 3KA0A 3OXIA 5DFPA 5FBOA 2OICA 4NU1A 1F3MC 5TF9A 4BIEA 5M08A 2UZNA 4PTGA 3QX2A 1IG1A 3R02A 5D9HA 3DA6A 2J2IB 4FVPA 4HYSA 4ANMA 2VTQA 4LRMA 5HESA 3WF6A 4BDAA 3PVWA 4DINA 4BCKA 2C5XA 3IS5A 3BIZA 1WVYA 4L7SA 4B99A 5DEYA 2XYNA 4XG9A 2PVMA 2C3LA 5I9ZA 3NVMB 3FLWA 3OWKA 1M7NA 5L6OA 5ACKA 1FGIA 3LW0A 3QKLA 4PP9A 1YXXA 4FUYA 3Q5ZA 4ENXA 4TT7A 1CKJA 1PXJA 3QD4A 5EM5A 5JZNA 2G2FA 5CXZA 3UO5A 1U54B 5CI7A 4FSTA 2VGPA 3BLHA 3F69A 2VO7A 4FIJA 2A1AB 2R3QA 5M44A 3U9CA 3LFEA 4OTIA 4G6OA 3VBVA 3RHXA 1ZY4A 3NR9A 5HTIA 4FZFB 4BN1A 2PE2A 5GHVA 3ULIA 3IKAA 3C50A 4LL5A 4K33A 2QOFA 5LMAA 3P1AA 4P2KA 3CTQA 2ERKA 2R2PA 3C51A 4BI1A 3R28A 2GPHA 3OD6X 3OY3A 4QP6A 5M07A 3IGOA 3VS5A 3KMMA 5E90A 1A06A 3DXNA 3A7HA 3FLSA 5FEEA 4BDKA 4MXZA 3RMFA 4I5MA 3QX4A 5AUWA 3DKOA 5CVGA 4P4CA 4RFMA 2WAJA 4M84A 5CENA 4DN5A 3I5ZA 4EK3A 4EWHA 5DLSA 4EQCA 2J5FA 3BBTB 2J0LA 4GYIA 5ANOA 3PZHA 3I0QA 2ZYBA 4QYGA 4OT6A 1R1WA 2BAKA 1ZYJA 2XH5A 4WNKA 3KN5A 3FMMA 2I6LA 2JIVA 2JKOA 3GOPA 4HOKA 5M57A 3IW5A 4U45A 5IUHA 2R3LA 4U8ZA 2JKKA 1URWA 3KXMA 4Q5HA 4HPTE 3TNWA 3ZO4A 2ITQA 4G6NA 5JMSA 4I24A 4KWPA 3S2PA 4HVSA 4FUXA 2QO2A 4IVBA 2X8EA 3MS9A 4AS0A 2FSMX 2VN9A 3QTXA 4C57A 4K11A 5C1QB 3TDWA 1IAHA 4O81A 5C4KA 4RRVA 2QONA 4XHKB 4QMSA 2OXXA 1F5QA 3ZSHA 3ETAA 3OS3A 3V5JA 3MESA 2JBPA 4O82A 5T3QA 3SRVA 1GZOA 2YIQA 3N4TA 5CAUA 1H1QA 3C4EA 1M17A 5CF8A 2BRGA 3DAJA 5EOBA 3KQ7A 4IM0A 2B53A 3MN3A 2WTCA 4G3DA 3WZJA 4RJ7A 4XJ0A 3EN7A 5A4QA 4L68A 1XWSA 1ZY5A 4XV1A 3DBQA 3KULA 4BKJA 4GUEA 3WZEA 3ZM9A 2X2KA 3BHHA 3ORMA 4BZOA 3BE9A 1ZYDA 3DJ6A 3GT8A 4TYJA 4APPA 3VAPA 2AC5A 1M14A 4O0RA 3BGPA 2GNHA 1QPDA 4PL4A 2H34A 4J99A 3P23A 3HP2A 4QRCA 2WTKC 3QWJA 4QP3A 2OG8A 3AG9A 5IDPA 3R2YA 2BDFA 3W18A 1Y8YA 5TKDA 4AUAA 1NVQA 3IDPA 3A7JA 1JBPE 2WEIA 4FSYA 5CVHA 3GC7A 4X2KA 1YI3A 3EFJA 4OTGA 1IR3A 2P2IA 3E5AA 2BKZA 3TL8A 4BDCA 3QCYA 4QYFA 4FSWA 2IZTA 3CXWA 2WTIA 2E9NA 4LMUA 5I3OA 3GC9A 5IQIA 3REPA 4IWQA 4OTWA 4LMNA 3SKCA 3DZOA 3H10A 4BGGA 4FTMA 2OW3A 3MYGA 4NWMA 2C6TA 2C6IA 2GU8A 2XJ0A 1YOLA 3O17A 5AUYA 1OBGA 5FBNC 3RGFA 3SAYA 4ANBA 1SVEA 4CEGA 5IA0A 2UW9A 5EK7A 3A7IA 3FSKA 3TIZA 2VO6A 4ZTRA 1KOAA 1QL6A 2Y6OA 3V5LA 5IMEA 1VR2A 4C8BA 3Q4UA 4O7SA 4NKSA 4GFGA 4FT0A 2XNBA 4GSBA 2UUEA 4FKLA 2BILB 2BHEA 3GU7A 4MAOA 4RJ3A 4WG4A 4O27B 4ZJIA 3COKA 2R0IA 4IANA 4PF4A 3FMKA 5CU2A 1B38A 4C4EA 4R77A 4G2FA 4RWIA 3FMNA 3EKNA 5FTQA 3LMGA 2P0CA 2QHNA 4C33A 4ZMFA 5AM7A 4YTFA 3FEGA 2A0CX 2VTPA 3CTHA 4OTHA 4TY1A 4ZLZA 4DEDA 3TDVA 2C6OA 3NNVA 1GY3A 4ZY6A 4TL0A 2JD5A 2GFSA 5AX3A 4ALWA 3HV4A 5CEMA 2LAVA 3BWFA 5L8KA 3EN5A 3MY0A 2XKEA 4S30A 1OIQA 3E7OA 3EB0A 3JYAA 4JG7A 2WMRA 2Q83A 3V5QA 4OW8A 3FI2A 4DFYA 3HV6A 2IW6A 4JR3A 5HQ0A 3R01A 1KE9A 5BMSA 3RWQA 4QD6A 4FV2A 4IAYA 2OF4A 3FLZA 3MSSA 2RFNA 3HRFA 4UY9A 1O6YA 4ZTLA 4C34A 5CEQA 5HU3A 3BPRA 3L9PA 3E8EA 4UBAA 5A4EA 3RALA 5ETCA 3GCUA 3ALOA 4CNHA 4EBWA 3ENMA 4IX6A 1JAMA 1JLUE 3CKWA 3O96A 5LCKA 2WMSA 1JKLA 2J51A 2YIXA 5KNJA 3QYWA 4WHZA 4O86A 5D7VA 5L2IA 3ODYX 5A6NA 5DEWA 4LYNA 3K5VA 4ZSEA 4CZYB 4V05A 2I0YA 3KF7A 3ATTA 5CF6A 3GCVA 4Y95A 5FXSA 1L3RE 4M66A 3UNZA 5DGZA 4E20A 3D15A 4I22A 3TWJA 3JVSA 4RLLA 4ZS4A 4DGNA 3HEGA 2J4ZA 5AP6A 5GZ8A 3OWLA 2HWOA 5KBQA 3TM0A 3K2LA 3POOA 5DRDA 4HVHA 2QOIA 3SDJA 1L8TA 5CAVA 4HGSA 4IB0A 4QPAA 4A9UA 4AT3A 4DH3A 2ITUA 5LMBA 4HZRA 2V7OA 2VTTA 4CFMA 3R9OA 5J95A 5KHXA 3QZIA 2CPKE 2R5TA 3TZ8A 4M7IA 5D1JA 4IVCA 4U79A 4HGEA 2ZV7A 2C6EA 3QHRA 3FYJX 4RIOA 4KD1A 3DV3A 5KHWA 3BU3A 2I0VA 3E93A 4M68A 4BVUA 3OTUA 3JS2A 3FAAA 2WQOA 4JBOA 4YZDA 4TN6A 4GH2A 4WSYA 4YZNA 4JQ7A 3HV7A 2V0DA 2VWBA 5L8LA 4BCHA 3OHTA 3QCXA 4YHFA 3TV7A 4CFUA 4G3CA 3C13A 3OF0A 1OBDA 4X2GA 4AZSA 2VZ6A 5LJJA 5AUUA 4AZEA 2UZTA 4X7QA 4DITA 3GCQA 4FKWA 5BQ0A 4FV8A 2R4BA 4KSQA 5JFXA 3DK3A 4USFA 4IFGA 4CQGA 3R22A 4O7RA 3UG2A 4AT5A 4C4JA 3DBCA 4FTKA 2JDSA 4C62A 1WMKA 2EXCX 3DDPA 4BR3A 3W1FA 3P5KA 4JXFA 4E7WA 3PSBA 3BV3A 1H0WA 3ID6C 5IEXA 2PULA 1YDSE 3IW7A 4J96A 4UMPA 4FVQA 2H9VA 2LGCA 2I1MA 3O8UA 1XHAA 4FSQA 2WQMA 3UDBA 3OOMA 2O65A 3DXPA 2JGZA 2FB8A 2Z7QA 3C4FA 4QMUA 4CCBA 4ZTNA 1WFCA 2ZM1A 3NW5A 3FLYA 3JY0A 3FE3A 4BB4A 3SVVA 4G3GA 4XBUA 3VS0A 2IG7A 4E26A 3O7LD 4IHPA 4A7CA 3VHKA 1Z9XA 5H3QA 4FV5A 2CLQA 4QMMA 1XH5A 2VWYA 2X7FA 4F99A 4H39A 5BUIA 3PWYA 1TVOA 4MWHA 4TNBA 5JEBA 4HPUE 3SC1A 3R83A 1ZMVA 3GCSA 4N6YA 3ZLWA 3DKFA 1UKIA 2R9SA 3P7CA 3ZEPA 5M56A 2QU6A 3U6IA 3U54A 2PMOX 4DTAA 4YC3A 2GNIA 1NT2A 4RC2A 4FTQA 2B9IA 3FV8A 2W5AA 4Y85A 2VNWA 2CNVA 4Z16A 4PMSA 3BGQA 4CFWA 3MJ2A 3CJFA 5BPYA 2A27A 3LXPA 1OKWA 4WIHA 2BHHA 4BCGA 2CGXA 3MPAA 2CKEA 3H4JA 3R1NA 4ACDA 3UYSA 4UMRA 3OW3A 4IZ7A 5CNOA 4AE9A 1U54A 3MGYA 2EUFB 1H4LA 5EM6A 2RG6A 5HD7A 5HGIA 1G3NA 2XRWA 3L1SA 3MIYA 5ACBC 3TTIA 3O51A 4EOOA 3HAVA 5M06A 4AXAA 3R8ZA 3TKUA 4YR8A 2X2MA 4CV9A 1PMEA 3E88A 5L2WA 3FY2A 2F57A 2ESMA 1DM2A 3FMJA 4NJ3A 3FXWA 3RPSA 3CKXA 4GT3A 5AV3A 4C4FA 1SVGA 4O83A 3TNQB 1E1XA 3BLRA 4YHTA 2ZV8A 3ZOSA 5IH6A 3FMHA 3T9TA 4FODA 3WYYA 4L00A 4A9RA 4Z7GA 4C7TA 4XG4A 2V55A 3E8CA 4FSRA 4JAJA 4BKZA 2R3RA 4ZS0A 4WUNA 2FGIA 3CR0A 2EXMA 5AIRA 4HNFA 5HX6A 3ZH8A 4A9YA 4ANLA 4O0YA 5I3RA 2XK6A 5HI2A 5L6PA 3KVXA 2QCSA 3VO3A 3ZSIA 2XIXA 4S33A 3ZHPC 2UVZA 3COMA 2V22A 2G2HA 3BHYA 3LCOA 4RSSA 2W9ZB 4WBOA 5IQCA 4GCJA 4DLIA 3COHA 4L3PA 1DS5A 3QQFA 1APME 4CZTA 4E8AA 5EKNA 5M53A 3PDTA 2WMBA 3C0IA 4JDKA 1UNLA 4MNEB 1H25A 3P4KA 4G34A 4R8QA 5TE0A 1K9AA 3ZSGA 5LMKC 1OKYA 2RKUA 3T9IA 2WOTA 5E9EA 3I4BA 4RVLA 3TI1A 4JNWA 5FTGA 5H8BA 1W7HA 5FXRA 1GZKA 2I0HA 3PLSA 3II5A 4D58A 3DAEA 4FYNA 3MFRA 2OKRA 4Y5HA 2G2IA 3RI1A 4UWYA 2OWBA 3GFWA 1U4DA 3I7BA 2WEVA 3MVJA 5EHYA 3KU2A 2G15A 2BRBA 1JQHA 5L3AA 2XUUA 2WPAA 3PIXA 4M69B 1UWHA 3D5XA 3W2RA 3FZ1A 1OITA 4J8MA 3FXXA 1SZMA 1A48A 3TV4A 2VNYA 5FUTA 4FL1A 2IW8A 3QCSA 2PMNX 1XKKA 2XYUA 2YDIA 3AC4A 5IUIA 2E9VA 2Z60A 3AOXA 4H58A 4LGGA 5M09A 4BY9E 2QOBA 4WD5A 3PWDA 5CY3A 2JKMA 5ANDA 2PPQA 5L2TA 4H36A 2HENA 3RHKA 3LFQA 5DR9A 3OXTA 4I6BA 2B55A 3G90X 4MXOA 3VN9A 5IH4A 2YIWA 3DGKA 3EH9A 4C3PA 3HRCA 4EL9A 1WBNA 3R7EA 5HBJA 5DVRA 5KMLA 3KRRA 4CCUA 3QF9A 4CRLA 2PYWA 3CY3A 2PHKA 3NYNA 2C6MA 4HNIA 3EFLA 1VYZA 4DFUA 5CSHA 4D5HA 2WD1A 4FC0A 3H9RA 4BHNA 4CD0A 4Z9LA 2C69A 5IG1A 1MRYA 3C1XA 3QQLA 3W8LA 5HU9A 3EN4A 4WBBB 1OIUA 4I41A 3WF8A 4BCFA 5LQFA 3EQGA 4G1WA 1U59A 4EEVA 5HCZA 4YLLA 1OKZA 3A99A 1T45A 2ONLC 1P2AA 3NYOA 4M3QA 1MRVA 4MD9E 4YBKA 3SG9A 2W4JA 3O8TA 4Y73A 3LLTA 1NW1A 4II5A 1VZOA 3AC8A 3M2WA 2UZVA 5E1EA 3BKBA 2AYPA 4FTTA 3F7WA 2WZJA 4I5PA 2JEDA 2WMTA 3LFSA 4OGRA 4QO9A 2W99B 1MRUA 2W4KA 5L2QA 3V5WA 3VIDA 2CKQA 3R7GA 3RPVA 3MIAA 3LXNA 3DT1A 3FI4A 3P7BA 4WG3A 3UZRA 4PY1A 5CEIA 2UW0A 2XM9A 3TTJA 5IUGA 1Y91A 4C3RA 4ALVA 3QC4A 4IM3A 4XS2A 3MJ1A 4I6HA 2BR1A 1YOMA 4OBOA 3AC2A 3QUEA 3NS9A 3R04A 3EL8A 4GJ2A 5HBEA 1GZNA 2WO6A 5H8EA 4EJNA 2IO6A 3ROYA 3OMVA 4D4RA 3SG8A 3ZBXA 1SYKA 2WMVA 1S9IA 3ORLA 3FLQA 4LFIA 4FIFA 4NIFA 4QMPA 5AR3A 4BWXA 5CAQA 3U6HA 2I7QA 2YFXA 1WVWA 3C7QA 1KOBA 2C3KA 2UZOA 3FLNC 3GC8A 2W1HA 5AAFA 4EH9A 5CQWA 3QRKA 4CFNA 1VJYA 4HZSA 2X1NA 3HRBA 4YPDA 4QPSA 4F9CA 4ITIA 4S2ZA 4B7TA 2VTRA 2HXQA 5IEYA 2B9JA 3GU8A 3KCFA 2HZNA 3OZ6A 4AOTA 1PRYA 2YABA 4BTMA 3BYSA 3KXGA 4U80A 4PPAA 2W17A 3ALNA 1RQQA 2VTHA 4XP0A 2O2UA 4ID7A 2GMXA 4DEHA 3Q52A 3OWJA 5K5XA 5CT0A 1YKRA 2WOUA 3QCQA 1PW2A 1JWHA 4XG6A 2IW9A 1J1CA 3LQ3A 3CLYA 2UW8A 3HUBA 5A9UA 4QMNA 2J6MA 4XRJA 4DH7A 2ZB1A 4DGGA 4QTDA 4O7TA 4L45A 2FSTX 5IEVA 4XUFA 2ITNA 4LV5A 3VF9A 3IQ7A 1ZZLA 1MUOA 4L42A 4RC3A 3ZUTA 4AT4A 3BQCA 3CY2A 5HX8A 2R64A 4CG8A 2QOCA 1PMVA 3EHAA 5B0XA 2BTSA 2XP2A 5AAGA 2W96B 4I1ZA 5FXQA 3MB6A 1B39A 3IW8A 3ACKA 3AGLA 1UV5A 4FSUA 2YM6A 1Y6AA 4QTEA 3OFMA 2OFUA 3G9LX 4HCUA 4JIAA 4WA9A 4FNYA 3F3ZA 2J0JA 2XKCA 4J71A 4QMXA 5B7VA 4EK4A 4DF3A 1QCFA 2Y6MA 3Q6UA 3ORPA 1IASA 4MNFA 4DH8A 5LVLA 2EU9A 4U41A 2GDOA 2QOKA 4WT6A 3F2RA 5JKGA 3BHUA 1HCLA 1YVJA 2WMXA 2CSNA 4FKRA 5C27A 3RAIA 4EKLA 4MHAA 2FYSA 4K6ZA 4R1VA 3DNDA 3QUDA 4NM5A 4GT4A 2YM5A 3UNKA 3GU6A 3WE8A 1YWNA 3W2SA 2VWVA 4RX7A 2OO8X 4AZTA 3V3VA 2JFMA 5HLWA 4FVRA 5EHOA 4YSJA 4XG7A 2V5QA 4N57A 4KAOA 2GS7A 3NNUA 4K18A 1G5SA 3Q96A 4H05A 2GNGA 2IZUA 3CD3A 3P9JA 3ZO2A 2WU7A 2VTIA 4LGHA 5ANIA 4DTKA 1LEZA 1O9UA 2YITA 3PPZA 4ITHA 2YLEA 4F6UA 2I40A 1OB3A 2Y4PA 3IECA 5FEQA 4EK8A 3BYMA 3D0EA 3BEAA 3D2KA 2EXEA 4A4LA 5KKRC 4IJPA 1PXIA 3VQHA 5J1VA 3Q60A 3GXLA 5EDQA 4BF2A 1BUHA 1R0PA 4ZZNA 4FTLA 3MFSA 3ORKA 4W4WA 3ZM4A 4DBXA 2QQ7A 3FZOA 4FSZA 1P5EA 4AA4A 3P0MA 4HJOA 3AD5A 4RQKA 4R7HA 4TYEA 1CKPA 3R7UA 2OZAA 4KBCA 3SOAA 5JGAA 4IW0A 1J1BA 1FOTA 1Q4LA 2XK3A 3ORTA 4ONAA 5DYJA 3NEWA 2PU8A 2F49A 3DDQA 4ALUA 2UZBA 4ASDA 4CRSA 5KMOA 5CEOA 3JR1A 2VWZA 4TWPA 3FZTA 4I6FA 4IC7A 4HW7A 2C3IB 4O21A 1KSWA 5EW9A 3C0HA 3DTCA 4MCVA 4NW6A 4TYHB 2WKMA 1Q41A 2WMWA 4CQEA 1XO2B 3VRYA 3ZRLA 2QR7A 1OVEA 3GFEA 3CTJA 4O1PA 4RWLA 4UWCA 3TUCA 2FSLX 2YA9A 2XKFA 4FNZA 3NW7A 4Q9SA 2I0EA 4D0WA 1ZOHA 3PZEA 2C30A 3QBNA 3EFWA 3QTIA 4PDSA 4KINA 3UQFA 3QTQA 4N0SA 3FPQA 4I4EA 2PTKA 3D5WA 4KIOA 4EK5A 3I60A 2WMUA 4AN2A 2OIBA 3CCNA 3PSCA 3Q2JA 4KA3A 4N4SA 2OJJA 1URCA 4PNKA 3ZC6A 2VTMA 1H27A 5AAEA 5GNKA 2Z7RA 4YHJA 5EDPA 4QTAA 4ZLYA 1WCCA 1DAYA 3EIDA 3I7CA 3EQHA 3Q2MA 4ITJA 3SGCA 3OOGA 3DK6A 1ATPE 5GIPE 3Q53A 2W1GA 1BI7A 4I3ZA 4OT5A 4USEA 4XH6A 5LVPA 2FSOX 1Z5MA 5HE0A 1Q8TA 4HVDA 4MBJA 5CWZA 2YACA 3C5UA 3FY0A 3M1SA 4IZYA 4DT8A 3D7TB 4JRNA 5J9ZA 4WRGA 3HP5A 2XK8A 3ZONA 5A4TA 4YLKA 3H30A 2OZAB 1CSNA 3QQUA 3AT2A 1JKTA 2VX3A 4RIYA 4PPCA 4BIDA 1JNKA 4D2SA 4ZY5A 4FKJA 2ITXA 2W5BA 5I0BA 5EQPA 3GGFA 2QKRA 3HMIA 2FVDA 5GZAA 2P33A 1ZMWA 2F2UA 3G6GA 4V04A 5DT3A 3UP2A 3KMUA 3QRJA 2Z8CA 2GTMA 3LZBA 4J8NA 5LVNA 4S34A 2R3NA 3DS6A 3G33A 4G5PA 5FRIA 5A54A 3PY0A 5AADA 5M4CA 4O84A 2YISA 3GQIA 4RZWA 4F9AA 4XBRA 3RZBA 4LM5A 1PKDA 5KUPA 1CM8A 3R1YA 3OBJA 4O7ZA 4EZ3A 5CU4A 3LFAA 4AAAA 3CP9A 4MBIA 4F7LA 3ZLSA 3LMHA 4C02A 4CKIA 4NYEA 4WNMA 4CFFA 4O0WA 2B52A 3FL5A 3ZO3A 4R3RA 1I44A 4AA5A 1XR1A 1CKIA 3ZLYA 3POZA 4XV3A 2OIDA 4FOBA 3EYGA 4NM3A 3F7ZA 1OGUA 3FC1X 3F88A 2Y4IB 3I79A 4Q2AA 3WILA 3ZUUA 3ZXTA 4BGHA 1ZLTA 4FKPA 3PXZA 4JLCA 5C4LA 4IC8A 3KXHA 4MD7E 3W32A 4I21A 5ANKA 3U4UA 4FV6A 5CLPA 4MF0A 4I5CA 3SLSA 2XNMA 1WBOA 1JVPP 3EZVA 3SQQA 3KRLA 1PYXA 4LI5A 1J7UA 2HZIA 2PVLA 3W2OA 4FT3A 4GEOA 4DAWA 5HCXA 5AV0A 3G15A 4I23A 1UU3A 1XBCA 4TWNA 3VW6A 4PQNA 1FBNA 5CS6A 4K0YA 3WOWA 4YZMA 4IMYA 5EDRA 5KMMA 3DQWA 2A4LA 2J9MA 4HYHA 4ASZA 4ZAUA 5J9YA 4HCTA 4YURA 4TYHA 5J9LA 1M2PA 2BZKB 5D11A 5D7AA 3R8MA 3UMXA 1WVXA 3NUUA 4UV0A 3VF8A 5EHLA 2VTNA 1GAGA 4QT1A 3THBA 3ZXZA 3TNPC 5B2LA 4O7VA 2QR8A 4RVTA 4BDGA 3QFVA 4A9SA 2W7XA 2GS2A 3ANQA 2EB3A 4XP3A 5DBXA 2RG5A 5A3XA 2QI8A 3UPZA 4FSNA 4F7JA 2YZLA 3V04A 4AGCA 3EQRA 5I5ZA 1FVVA 5DOSA 4GS6A 4FBXA 4PRJA 4RQVA 5H9BA 1FINA 4F63A 4NK9A 4O38A 3EQFA 2B54A 2PVKA 4JDJA 2OXYA 5CANA 1SVHA 3PXRA 3FI8A 3AD6A 3HNGA 4W8EA 3BELA 4FV3A 5EM7A 4BI2A 1FQ1B 3MVLA 5EQEA 4I92A 4JBVA 3NUNA 5JH6A 4DG3E 1SNUA 2YIYA 2O8YA 1XBAA 2OI4X 2KTYA 4D9TA 1YW2A 3NAYA 4UEUA 4FSMA 2UVYA 5I9UA 5IPJA 3U55A 2X7GA 4QTCA 4FG7A 2CLXA 2X6EA 4MXYA 5CF4A 4J97A 4GIHA 3FKOA 4IAZA 3A7FA 3U4WA 1GIJA 3GI3A 4NZWB 2OJFE 3R2BA 3GU5A 3VS4A 3WI6A 2G01A 2C6LA 4I6QA 3TKHA 2BPMA 5KZIA 2ZV9A 5M51A 2YDJA 3HMOA 4YTIA 2YM8A 3EQCA 4QMOA 2JIIA 4QMVA 3QZHA 3R71A 4AN3A 3UVPA 1V0OA 4UYAA 3SX9A 4D0XA 4E1ZA 4FTJA 3D4QA 2CCIA 3ZS5A 3PPKA 3Q6WA 1U46A 3F82A 5AR2A 1KE6A 4YNOA 3WARA 5KKRB 5AX9A 3MBLA 3QZFA 4OUCA 2QOQA 2OJ9A 3Q4TA 2HIWA 4QPMA 5TOZA 2CN5A 3QRUA 3EN9A 3N4VA 4PTEA 2R7IA 4GK2A 5C8KA 4ANNA 2XK4A 3GU4A 2YEXA 4JI9A 2X0GA 4IDTA 2RL5A 4UXQA 3PJ2A 4QYEA 4GRBA 1FPUA 3W8QA 5IU2A 4YNEA 3U6JA 4DFNA 4KS7A 4JT3A 2ETMA 3V8SA 3V6RA 4E6AA 3V8WA 1NY3A 2FH9A 2PSQA 4CGAA 1YXUA 3PY1A 3V6SA 2QG7A 4FTIA 5J79A 4EQUA 3TZ7A 5A4LA 2WMAA 1OUYA 3FZPA 1M2RA 2ITTA 4QYYA 3CPBA 5IF1A 5F1ZA 3PG1A 4DFLA 3S4QA 4X3FA 4BDFA 2X4FA 2BDJA 3NYVA 1IRKA 2PVFA 5IA3A 4KIQA 3S00A 2BMCA 4NH1A 1NVRA 3KGAA 4DTBA 3KREA 5L2SA 4C2VA 2XK9A 2IVVA 3PXYA 3UZTA 3IW6A 3S1HA 5EYCA 4ENYA 1LR4A 1YHVA 2RFSA 3FDNA 3NCGA 3WZUA 4BI0A 1ZMUA 4U3ZA 3TCPA 3AC5A 3BX5A 4AFEA 4M13A 4M97A 4ZZMA 3KEXA 4OTDA 2J0MB 1W83A 5DT0A 3UOKA 3C4WA 5HE2A 4D1SA 1Q3WA 4I4FA 2W1ZA 3C4XA 2FUMA 3V01A 4EHVA 1Q97A 1GIHA 4DE4A 4IZAA 3DB8A 4J98A 3RAKA 4F09A 4DCAA 5IZFA 1W82A 3OBGA 4M69A 2C3JA 1WBWA 1LP4A 1UU8A 4DT9A 1PYEA 1F0QA 2C0OA 4AOJA 1MP8A 1CTPE 1IAJA 4KKGA 3NAXA 3C9WA 1H00A 4KIKB 2X7OA 2W1CA 4QP7A 4JAIA 3ZDIA 3I1AA 2X81A 1ZXEA 2RF9A 2OF2A 4JG6A 5AP7A 3F66A 1Q8WA 2BUJA 2J0KA 4D4SA 3FZRA 5HO8A 3EZRA 4ZOGA 4G17A 4UALA 3SW4A 1WZYA 4AZFA 2XIRA 1ZRZA 2GHMA 4J52A 3CS9A 5AR4A 3UE4A 3VS6A 1JOWB 1LEWA 3OT8A 1JPAA 2OU7A 4EUTA 4F7NA 2UW3A 2WHBA 4NW5A 4TPTA 3SRVB 3VQUA 5CU0A 4KB8A 2PUPA 4MYGA 4DBNA 2Q0BA 4JQEA 4AW2A 4YJQA 4I0RA 3FI3A 3VC4A 4G31A 4YP8A 1ZOGA 3KXZA 1Q5KA 4O0XA 3WIKA 2P3GX 2XMYA 4GU9A 5T68A 4TWCA 3W55A 2F4JA 1TQMA 4ORKA 1RDQE 4W8DA 5CXHA 4XEYA 4CTBA 2XJ2A 4B6LA 3DU8A 4F9YA 5IH5A 2PZYA 4YMJA 4NL0A 2OK1A 4MF1A 4X2NA 5LCJA 4Z3VA 4U81A 3HUCA 1KWPA 4RFYA 2UW7A 3DCVA 3F2AA 4RC4A 3PSDA 2C5VA 4KRDA 4RFZA 4EWQA 4R6VA 1OM1A 5BYZA 3BYOA 1H1SA 3KC3A 3LCTA 4O0SA 4D2PA 3PXKA 4U40A 1YDTE 2P55A 5KBRA 3D5UA 3LM5A 4TXCA 4RBLA 4E6CA 1ZAOA 3FQHA 3R63A 4CKRA 2PVJA 4A9TA 1OI9A 4KNBA 3MFTA 5CI6A 4TYGA 4J1RA 3AC1A 2NNWB 5CSWA 4E4LA 2QOHA 4RG0A 4DFZE 5DRBA 2W05A 4FL3A 5H8GA 3Q04A 4DG2E 2PUNA 3TIYA 3IONA 3TG1A 5IA1A 4C61A 3LAUA 2UZDA 5CU6A 4FOCA 3FXZA 3TEIA 1UU9A 5LWMA 1MQBA 1W0XC 2XM8A 2ZM3A 3UOHA 5J1WA 1CDKA 3SW7A 4P5QA 5HO6A 3NYXA 3FHRA 5EI6A 2G1TA 2VAGA 3CGOA 5CU3A 5J87A 4DEEA 1YDRE 4FG8A 4J7BA 3BYUA 5E91A 3SHEA 2O0UA 2Y8OA 4AWIA 4QP4A 4YJTA 2YJRA 2Y9QA 4CV8A 4G3EA 4NUSA 3CE3A 4TRLA 3UO6A 2J90A 2VTAA 3VUIA 2VUWA 4RIXA 5HEZA 2JITA 4AE6A 4BBEA 4BBFA 2DYLA 5FLFA 4KIKA 3ANRA 3AXWA 1PXNA 1PY5A 4USDA 5K9IA 4X3FC 3A2CA 4UWBA 4TWOA 3LXLA 3RVGA 1U5RA 1DI9A 3MH1A 2O3PA 5HKMA 5CX9A 4F1MA 4ZSJA 3EQPA 4MQ2A 3RCDA 4IH8A 2BZHB 4BBMA 2XBAA 4CMUA 2B9HA 5A14A 4L3JA 3HAMA 1R0EA 4M8TA 3Q3BA 4ZXTA 2RSVA 1REJA 4W4XA 4ACGA 2WB8A 5HE3A 3OROA 1PXOA 3KB7A 4MXCA 3N4UA 5G6VA 5CASA 4P7EA 2REIA 4HYIA 4NFMA 4YZ9A 2WGJA 4IWDA 3MW1A 4MQ1A 4IDVA 2QHMA 3O7LB 1M7QA 2UZEA 5HLNA 4ACHA 5CAPA 1K2PA 2XNGA 3ORIA 4WO5A 2J7TA 4AN9A 2ZMDA 4H3PA 5TO8A 3FJQE 3LFDA 5FD2A 3BHTA 1PXLA 3NX8A 5M4IA 2PVYA 1S9JA 3FMLA 4X0MA 3OT3A 4QMQA 2PZRA 3QA0A 3PXFA 4IWPA 3P7AA 3CGFA 5LXMA 3OC1A 4RZVA 1YWRA 3CIKA 3QKKA 3AD4A 4UZHA 3GCPA 1GZ8A 2H96A 3LM0A 4D28A 3T3UA 2X9FA 5LMKA 5AFVA 3RAWA 1DAWA 1PF8A 2OJIA 2YCSA 2YWPA 4EC8A 3UG1A 4FKQA 4LRKA 5EYDA 1BMKA 4RIXB 4IQ6A 5M4FA 5CTPA 2ZMCA 1ZARA 3PP1A 5EI2A 5L6WL 3LCDA 1I09A 4OBPA 4EOMA 3E7VA 3RJCA 2OZOA 4PPBA 4BCQA 1OKVA 4FV4A 3VUHA 4BGQA 1KUTA 4R7BA 5E8VA 5A6OA 3D5VA 4CT1A 2WTKB 1H07A 1ZYSA 4HGLA 5HORA 5ANEA 2CNQA 1FVRA 4LUDA 5A4CA 3LJ1A 1JSUA 4K2RA 5F95A 4WRSA 1HCKA 3CQWA 2GQRA 5HG9A 5AWMA 5K0KA 4EBVA 4OAVB 4XOZA 3EWHA 5FDXA 3VVHA 1RJBA 4BZDA 4F7SA 1G8AA 4CG9A 3FWQA 3M11A 5M4UA 3DJ5A 5BYYA 5IQHA 2BZIB 3QTZA 2PE1A 3QTWA 2PK9A 5E8TA 3ZMMA 3F61A 5HCYA 3AGMA 3QRIA 4FKGA 3DZQA 1YHWA 3QTRA 3RAHA 3CQUA 3WBLA 1W8CA 4QP8A 2JFLA 3PXQA 3QHWA 4FEVA 3JXWA 4FKIA 4EHEA 4YGAA 4YJPA 3GQLA 4QQJA 3ZCLA 4QMLA 2QLQA 1KE5A 3R7IA 4F0GA 5IKWA 2C0TA 2HW6A 3V51A 4EZ7A 4FT9A 3I5NA 4FGRA 3NZ0A 2R3MA 3F2NA 3FMEA 3O71A 4G9CA 4MK0A 3ZRMA 2YCFA 2ZB0A 4FZDB 3ZZWA 2VU3A 1FGKA 3F5UA 3IK3A 4ZIMA 3OCTA 2GTNA 4IWOA 5JQ5A 4FX3A 4JQ8A 4C4HA 3QD0A 2W4OA 4L53A 3OP5A 2BFYA 3W2CA 1U5QA 3HV3A 2JAMA 3MY5A 4YJNA 3UYTA 4C59A 1UNHA 4J53A 5CQUA 4BCPA 2E9UA 4EH6A 1H0VA 3IOPA 4JDIA 4AF3A 4LOOA 4JRVA 3B2TA 4EJ7A 3QQJA 5DHJA 4IADA 2QD9A 4O2PA 3UIXA 2VO3A 2ACXA 4ZJJA 5TT7A 4FA2A 3GVUA 5HVYA 4AZVA 3D94A 3EOCA 4EYMA 3UOLA 5CYIA 3SA0A 1KE7A 1QPCA 3VNTA 4D2VA 5JFVA 4BWKA 3DBDA 3ZO1A 1SNXA 3PA3A 4E93A 3EFKA 3BWJA 5CSPA 5CNNA 2R3KA 5FG8A 3QQGA 2YAKA 4AW1A 4GVJA 5HTCA 3VBYA 3QAME 3WF5A 3OXZA 3DOGA 5ETIA 3A8WA 4ARKA 1ND4A 3UC3A 1OL1A 3ACJA 4CYIA 4YZCA 2YWVA 2UW6A 2OGVA 2YCQA 4FTOA 4O6EA 2YAAA 5DPVA 2UZLA 4ZTMA 5AP2A 3HDMA 3EQBA 5AR7A 4L6QA 3LOKA 3MY1A 2XIZA 1H24A 2W5HA 3F3VA 4O1OA 4W4YA 4B9DA 3OEZA 3KK8A 4MXXA 3VUDA 1XQZA 3HDNA 3MB7A 4I5HA 3OG7A 4G6LA 2OSCA 4FTAA 3MFUA 1M52A 3UPXA 2JIUA 3DJ7A 3O0GA 3VS3A 4EOJA 5HNIX 3JPVA 1ZYLA 1Q24A 4BDEA 4E4XA 3PE2A 4RWKA 3E63A 4MX9A 2RGPA 1YI4A 3OUKA 3NUAA 1YI6A 4HYUA 2NRYA 3A60A 3AT3A 1VEBA 4JBPA 1TQPA 2C5NA 2WMQA 4L46A 3I81A 1DI8A 3UQGA 4EI4A 3UVQA 4FNWA 3N9XA 2A2AA 3FKNA 3RK9A 4F4PA 3LMIA 5F20A 4GG7A 4GJ3A 5IA4A 3HGKA 4O2ZA 5J7BA 2W1IA 3O50A 3QWKA 3LJ2A 2ZVAA 4DC2A 2JKQA 4AG8A 2XA4A 4W9WA 2HAKA 4U0IA 5JSMA 2BRHA 4BTKA 2ZOQA 4R7IA 1FMOE 3KVWA 4BDDA 4NKAA 4W4VA 4YBJA 3FYKX 4G5JA 3WIGA 4F1OA 3UODA 2R3JA 4FYOA 3H9FA 5HO7A 2RFDA 3R8UA 4GKIA 2E2BA 3Q9WA 5FGKA 3DFAA 1V0PA 2EWAA 2R0UA 3QZGA 4GW8A 4WUAA 3NDMA 2WTVA 4X3JA 2JAVA 4WG5A 3PA5A 4JIKA 4D5KA 2W1EA 2HZ4A 5B2MA 4WSQA 3NRMA 4UX9A 4FV0A 1LUFA 5EFQA 4V0GA 1OPKA 5E92A 3L8VA 3WE4A 3A4PA 4RT7A 2OLCA 2XIYA 3VBXA 3BCEA 5HHWA 4IAKA 2WIHA 3R9HA 4IM2A 2IWIA 4U7ZA 2UVXA 2JBOA 3ZDUA 5GJGA 3BYVA 5B2KA 3PFQA 4CLJA 3FMDA 4XG8A 2X9EA 2HY0A 3ODZX 3PJ1A 3RZFA 4G3FA 3E8DA 2BRMA 2IVTA 5AR8A 4NCTC 3W33A 5J5TA 4EYJA 4NFNA 4OAUC 1OL6A 1XH7A 5EG3A 3S3IA 4C4GA 4X6QC 2C6KA 4M0ZA 4EOSA 4PDOA 4OTQA 4QQTA 1RE8A 4O0TA 4BL1A 1E9HA 1OPJA 1XH4A 4GYGA 4L01A 5JRQA 4BTJA 4Q9ZA 4XCUA 5FEDA 2BFXA 4YPSA 4OLIA 2ITOA 5HLPA 4EC9A 4EH7A 4A07A 2QOOA 3EKKA 4JOAA 1WBSA 1STCE 1YHSA 3PJ8A 3FZSA 4FV1A 3T8OA 4DEGA 4F64A 2OIQA 2BZJA 5M55A 5FWKK 2E9PA 3HVCA 4QNYA 1UKHA 2PVRA 3OVVA 4MXAA 1K3AA 1O6LA 3LIJA 3UBDA 3TZMA 2VWIA 4C35A 3VUTA 3R7VA 3UIUA 3UTOA 1TKIA 5K5NA 3LPBA 3TZ9A 4XG2A 3NPCA 2GS6A 3EJ1A 3GENA 4PX6A 4GV1A 3AC3A 3OEFX 2J5EA 4PV0A 3SXRA 1H28A 2QG5A 5DIAA 4L9IA 4IAIA 2Q0NA 4M15A 5C8MA 3H9OA 1UNGA 1E1VA 4DA5A 2XS0A 5E8ZA 5EQYA 1Q99A 4O7YA 3BZ3A 1M2QA 1Q3DA 3BU6A 3HMPA 3ULZA 4D4YA 3TUBA 3HLLA 4R5SA 4BKYA 5JFWA 4R78A 2HYYA 5AUTA 5I4NA 1XBBA 1W98A 3SXSA 4Y5QA 2VTJA 2PZ5A 3RTPA 2C1BA 4JJRA 4YTHA 3MWUA 4PL5A 4IVAA 2C4GA 3DFCB 4TW9A 2OH0E 3H0YA 4AGWA 4QP2A 5LOHA 1V0BA 1H01A 5GINE 3Q32A 2VX1A 3E92A 4O0VA 5HG7A 3Q9XA 4KS8A 4IZ5A 5T6KA 4E4NA 4YJRA 1J7IA 5HICA 4M0YA 4PMMA 3MH0A 5HIBA 5HBHA 4GFOA 2CJMA 4MEDA 3ROCA 4CTCA 5BNJA 5KO1A 4FV7A 5AEPA 2QURA 2VD5A 4PUZA 4XLIA 4ZTQA 3E3PA 3NUYA 4YZBA 3AMAA 4A06A 3E62A 5EW3A 5I9WA 1OECA 1FMKA 3R1SA 4TNDA 3HL7A 1H08A 4IBMA 3U8WA 2JDRA 3Q9ZA 4O96A 3TNIA 3QQHA 4EQMA 5EM8A 3RM7A 2GQSA 2AC3A 5KZ0A 5E8XA 4D55A 3QYZA 4OTFA 2XEZA 3LVPA 4YO6A 3UGCA 3UVRA 4GK3A 1H1WA 3VJNA 3P08A 4IVDA 4M14A 2BTRA 1KV1A 4IAAA 3G5DA 3P78A 4YJSA 2HELA 2CGWA 2Z7LA 1WBVA 2XZSA 3KULB 1MQ4A 3LHJA 4U3YA 3R0TA 4LOPA 3QTSA 5AMNA 5BVFA 3P79A 3RINA 4DGOA 2XJ1A 3A61A 2V62A 4ANOA 5TR6A 3IDBA 4E5AX 2EVAA 4JX3A 1SM2A 2WFYA 3QALE 1Y57A 2GNJA 2QLUA 4F0FA 3MV5A 4FZAB 5BVOA 4GKHA 3KL8A 4RWJA 3QD2B 3PRFA 4NJDA 3HZTA 3QLGA 2Y7JA 3VJOA 4ACCA 2C5OA 2P2HA 3FUPA 1IA9A 3UOJA 4X3FB 3DAKA 5JRSA 3SOCA 2VTOA 4AZWA 3L9MA 4JVGA 4XV2A 2Z2WA 3FL4A 3D9VA 2W9FB 4A4XA
chains in the Genus database with same CATH superfamily
4QP1A 1AGWA 1X8BA 3A4OX 5JZJA 4FIHA 4YSMA 3R8PA 4PDYA 1YOJA 4APCA 2UZWE 2ZDUA 3F5PA 4EOPA 4TTHB 2CMWA 3ORZA 2BALA 3R8LA 4KABA 1Q8ZA 1P4FA 5IMXA 2VO0A 3CQEA 3BI6A 3RKBA 3FSFA 2VWWA 5E8WA 4DGMA 3ZEWA 3ITZA 4ASEA 3IDCA 2GCDA 3NLBA 3F9NA 3V5PA 4CFVA 4YU2A 4MVFA 1OZ1A 2R3HA 3M42A 1CMKE 5DG5A 1BL7A 5LARA 5LWNA 3W10A 4BFMA 1XH6A 3VBQA 2YN8A 1YXVA 3ET7A 3RK7A 4QNAA 5DNRA 4AGUA 2C6DA 3IG7A 1XH9A 2CGVA 2PVNA 5EH0A 3PP0A 4IE9A 2AEGA 3TN8A 4ZK5A 5DR2A 4U9AA 2HK5A 5FQDC 5ITAA 1BL6A 1W2CA 3PTGA 2B1PA 4EOKA 2RFEA 3EMGA 3K3IA 4B0GA 4DFBA 2R3OA 2PUUA 3NNXA 4IXPA 3CPCA 2DQ7X 1ERKA 2XCKA 4IX3A 4U97A 3L8PA 4F6SA 3K54A 4ACMA 5L4QA 3OW4A 4BCOA 3HV5A 4EH4A 3MI9A 2QOLA 5GIOE 2JDTA 5J7HA 4NM0A 4Y8DA 1BKXA 3WZKA 4LOQA 1OUKA 2ITZA 2XK7A 5CEPA 3A8XA 3QUPA 2PUIA 1XH8A 3L8XA 2J50A 3PVUA 5ETAA 5C26A 5I9XA 5EW8A 4CFXA 2Z7SA 4BCIA 1ZOEA 3D2IA 3E8NA 4UB7A 3VUKA 4BDJA 3LCSA 4YC8A 2Y0AA 3AT4A 4M67A 2XNPA 3MH2A 2HW7A 4R3CA 4R5YA 3PRIA 4FKTA 2XALA 2R3FA 2HY81 3EYHA 4F08A 2QKWB 5EYMA 3ZUVA 1KV2A 3IGGA 4EORA 4H1MA 2XKDA 3JVRA 5E4HA 4FEUA 3G6HA 4YJVA 2OJGA 5AIKA 4AQCA 4QYHA 3KRWA 3DB6A 4XG3A 4JG8A 4BICA 3DNEA 4FEWA 3MVMA 2O5KA 3HX4A 5DE2A 3W2PA 4BCNA 1PKGA 3AMYA 3R8VA 5AA8A 1GJOA 3EQDA 4MTAA 4YC6A 3LLAA 5IDNA 4F6WA 3PJ3A 4I0SA 4LRJA 5CZIA 2ZV2A 3CEKA 4XLVA 4EOIA 3ZC5A 3UJGA 2F9GA 4RIWB 4AOIA 2HOGA 2C47A 3MPTA 5IQDA 3G2FA 3KFAA 4QMZA 4CYJA 2ERZE 3TXOA 4UMTA 4P90A 3R7YA 4B8LA 1GOLA 1R78A 3NUXA 3DTWA 4I20A 4N70A 4A4OA 5BYLA 4HGTA 5DA3A 2W0JA 1QPEA 4FKVA 1OIYA 4H1JA 4QTBA 4DH5A 2W1DA 1IEPA 5ANJA 2X8DA 4KKHA 3R1QA 3VS2A 1Y8GA 4PTCA 2C5YA 1NA7A 4I6LA 3JUHA 4FI1A 4I0TA 3RPOA 4L43A 4NTSA 3U87A 3VBTA 2CKPA 5BMMA 3P86A 3KXXA 3WZDA 2QO7A 2V7AA 4NT4A 2ETRA 1R39A 1JSVA 4FKSA 3B8RA 4BHZA 5J5SA 4FR4A 2UZUE 1VYWA 4H3BA 1A9UA 3ORXA 1Q8YA 4BTFA 4Y46A 3PE1A 1H8FA 1YXTA 5CVFA 4CVAA 4O7WA 3F6XA 2B4SB 3KKVA 4RJ6A 4AXEA 2NPQA 4L67A 3FHIA 3GNIB 4EOQA 1BX6A 4PMPA 2OFVA 4ZSGA 2X2LA 3BHVA 3G0FA 3KCKA 4D1XA 4QMYA 3TUDA 2YERA 4UZDA 3L9LA 2R3IA 2VV9A 3ENHA 3KN6A 4C58A 5C01A 5BVWA 1IA8A 4NTTA 3BU5A 1H26A 4O22A 2H6DA 3A7GA 4X2FA 2XRUA 4V0GB 3PY3A 3AMBA 2FA2A 4EH3A 4F65A 4EKKA 3R9RA 4YO4A 4GL9A 4PMTA 3W2QA 4BDIA 3DBFA 3G0EA 4QMWA 5D41A 4EH2A 3V8TA 3S0OA 3PVBA 4GVAA 4XYFA 4Y83A 4EK6A 3WF7A 3RWPA 4FTCA 4ANSA 2VWUA 3LFFA 3LXKA 2BIYA 3TNHA 5HTBA 3BGZA 3B2WA 4BIBA 5CZHA 4FIIA 5E8UA 4IAFA 4CT2A 3ATSA 2WQBA 2X39A 4X21A 4E5BA 4RLKA 2FO0A 5LVMA 4D2TA 2O63A 2XVDA 3QRTA 1QMZA 3R73A 4F1TA 2W1FA 4FTUA 3KF4A 4MKCA 2YM3A 4U6RA 3FKLA 3LKMA 2CKOA 4WKQA 4H3QA 3BL9A 2PWLA 2C0IA 4AGDA 3FQEA 2PL0A 4E6DA 3GOKA 4ZSLA 4AA0A 1RW8A 3MDYA 4BWPA 4O0UA 4S32A 4EH5A 5BVDA 1H1RA 5HOAA 2F7XE 4I94A 1TQIA 4BRXA 1UWJA 5I9YA 2ZAZA 2YM7A 3ERKA 2IVUA 4OBQA 4XNEA 4DYMA 3G51A 3L8SA 4BC6A 1T46A 4FTRA 4OTRA 2WU6A 5FP6A 4FK3A 5AUZA 4DCEA 3LQ8A 5HG5A 2BVAA 3W0NA 3W16A 2F2CB 1PMUA 3CC6A 3MA6A 4K8AA 3QL8A 5FM3A 3TV6A 3NVKI 4D9UA 1WBPA 4C38A 4LG4A 4XMOA 5C03A 1YXSA 2Y4IC 3UC4A 3ZFMA 2O64A 3VULA 2F7ZE 4NSTA 2DWBA 3D7ZA 4IJ9A 5AUVA 5BVEA 1WAKA 2UW4A 4E6QA 3KY2A 1OMWA 3DXQA 3KMWA 5HG8A 4FMQA 3RCJA 1NXKA 3IO7A 2ETKA 4ZY4A 4UYNA 2QNJA 5JGDA 2IJMA 4JBQA 5CT7A 4O6LA 3OCBA 2VGOA 4L3LA 2GSFA 4GIIA 2JDOA 2VTLA 3EL7A 4EOLA 4FKOA 5GJFA 5IQEA 3F3WA 3H0ZA 3VBWA 5HNBA 2WQNA 3RP9A 4BDBA 4UN0C 1BYGA 2A19B 2PMIA 5DWRA 5KX8A 5IQAA 2IZRA 3QXOA 3EQIA 4IX5A 2H8HA 4RVKA 4KIPA 2B0QA 2KULA 2R3GA 3AQVA 2WTWA 5H2UA 5HIEA 3BV2A 3ZZEA 2OBJA 5DR6A 2WIPA 3Q4ZA 2J0IA 4JX7A 4FGBA 2F7EE 3MH3A 4IFCA 4P5ZA 4ERKA 4DHJA 4UMQA 4CSVA 2BKKA 3PA4A 3HMMA 1V1KA 2QVSE 1WBTA 4MBLA 5KE0A 3OCSA 1JSTA 1LPUA 2ONLA 3EN6A 1P14A 4RA5A 4D1ZA 4MNEA 5E7RA 2VX0A 2DUVA 2IN6A 2X8IA 2XB7A 2ZDTA 3GP0A 3R30A 5DH3A 4KBAA 3HKOA 3E87A 4LUEA 3QGWA 4G16A 4ASXA 4CXAA 4O4EA 3JY9A 4ZP5A 4DEIA 4LQMA 3O2MA 2CCHA 3QGYA 2IVSA 4DFXE 2JC6A 3NIZA 5IA2A 2R3PA 2Z02A 3HECA 2BAQA 4FG9A 1EH4A 1OGYA 4YUQA 2P4IA 4EONA 1SMHA 4PWNA 4ZSAA 3TT0A 3U9NA 4C2WA 1P4OA 3ZU7A 5HD4A 3QTUA 3IOKA 2NRUA 3RPRA 3UIBA 2WTJA 4OTPA 1PJKA 1J3HA 2BCJA 2CGUA 2YJSA 3N51A 4PNIA 4E4MA 4AW0A 3VUMA 4KRCA 4U44A 3F5GA 3RNIA 3TACA 5EOLA 5C9CA 3BL7A 3ZFXA 4GU6A 4R3PA 3VWAA 3BE2A 3DPKA 4E5WA 3PYYA 3K3JA 4L44A 3HYHA 3QQKA 2QO9A 3MPMA 3KRJA 3R00A 3ORNA 4K1BA 3NUPA 3KK9A 3WF9A 2OH4A 2G9XA 4ZEGA 4F70A 4Y72A 2XNEA 2EB2A 1OPLA 4FJVA 3C4CA 1AD5A 3GB2A 4AACA 4RA4A 4E3CA 3V5TA 4F0IA 2UV2A 5CALA 4RJ4A 1Q61A 4KSPA 2XEYA 2BIKB 5JFSA 4D2WA 4NCTA 4C37A 5D12A 5E8YA 5LVOA 2X6DA 3UP7A 4OR5A 4W9XA 4HVIA 4QQCA 4IEBA 3ZYAA 5KMNA 5BUJA 4DLJA 5FDPA 2JLDA 5KCVA 1XMLA 4EUUA 3B8QA 3PUPA 3NUSA 4IACA 3ZFYA 2XF0A 3E3BX 3DKGA 4QOXA 3PIZA 2VWXA 1GIIA 3F5XA 4LL0A 4RMZA 3H3CA 2HWPA 1XJDA 4FEQA 4L7FA 1GNGA 3C0GA 5JQ8A 4FL2A 1ZWSA 2WNTA 3R7OA 4XRLA 3COIA 3BEGA 3BLQA 4IIRA 4YTCA 4ZMEA 5JT2A 1JKSA 3K5UA 2R7BA 3C5IA 3R9NA 1KE8A 2QC6A 4EHZA 3CD8A 5IQBA 5K4IA 4FZ6A 5DMZA 4FIGA 5AP0A 4Q5EA 4ANQA 3A62A 1BLXA 4L8MA 5HIDA 4I93A 4O7LA 3LQ5A 4MH7A 3UNJA 4HCVA 2YM4A 5EKOA 4F9WA 4HVGA 4TYIA 5CSVA 5FTOA 3LCKA 5D10A 4JDHA 4K9YA 4AP7A 3D7TA 4WOVA 4PP7A 4KUJA 3PPJA 2YHVA 4GT5A 4GUBA 4FK6A 1W84A 5HNGA 2ZM4A 3Q5IA 5L8JA 5A46A 4E73A 4S31A 4YJUA 3IW4A 4U43A 5F94A 5AA9A 2WQEA 4RIWA 3SV0A 5CEKA 3E64A 3HMNA 2ITPA 2BAJA 3KXNA 3R9DA 1YWVA 3FC2A 5DN3A 3LFCA 1OL7A 5FM2A 4BDHA 5F9EA 5ICPA 3NSZA 1J7LA 2YIRA 2GNLA 4QQ5A 3RBWA 4C36A 5AP1A 3HA8A 3DY7A 3TJDA 4AW5A 5BVNA 1REKA 2SRCA 2XCHA 3PVGA 3OTVA 3QD3A 4GFMA 1Q8UA 4FF8A 5E8SA 3ZRKA 4JL9A 1AQ1A 3O8PA 3VS1A 2GNFA 5CF5A 4RPVA 4D2RA 4Z7HA 2VTSA 4FV9A 2YCRA 4XX9A 3O23A 5EI8A 4JS8A 4RVMA 2ITVA 5C8NA 2ZJWA 2HCKA 2RIOA 4LGDA 5KMKA 1PHKA 2HXLA 4UMUA 2ITYA 3HA6A 2ZFYA 3MTLA 2YZAA 3KRXA 4MD8E 4ZTSA 1B6CB 3BBWA 4RX5A 4EHGA 1YRPA 2CNUA 1Z57A 3LFBA 5IA5A 3QA8A 4NEUA 3MVHA 5AUXA 4WNOA 4LV8A 3BRBA 5KMJA 1ZYCA 2B7AA 3I6UA 3NGAA 3PG3A 5DI1A 4XP2A 3ZTXA 5KMIA 4FE2A 4G9RA 2E9OA 4FIEA 5E1SA 2BRNA 4FZ7A 5AJQA 2YDKA 4GG5A 3LE6A 4DDIA 4BZNA 3I0OA 4IB3A 3TJCA 3IPHA 3Q4CA 1YQJA 4DEAA 5HZNA 3WYXA 4K77A 3R21A 2QODA 3DLZA 4LDTA 1UVRA 4DG0E 1OIRA 4CKJA 2PY3A 3OCGA 4M12A 5ETFA 1Y6BA 3OWPA 5HE1A 5BX0A 5GZ9A 2BDWA 3UO4A 3DK7A 3GBZA 1H1PA 3ZBFA 3QC9A 5JN2A 2XIKA 2DS1A 4RJ8A 2NP8A 4CMTA 5K3YA 5HVKA 4DEBA 3VRZA 3D14A 3DLSA 4DHIB 5JK3A 3F3TA 4FT5A 3Q9YA 4Z55A 3I6WA 4BYJA 4X2JA 4AX8A 5ANGA 5BUEA 5BVKA 1FVTA 4O91A 4UXLA 3DQXA 3S95A 4DHFA 3CSVA 5FP5A 3GEQA 4IX4A 5GJDA 2IZSA 2GHGA 3NW6A 5DT4A 3VHEA 1UA2A 2UW5A 3NNWA 2CHLA 4L52A 4BCJA 2IPXA 3RNYA 3D83A 4KKEA 5IQFA 1PXPA 2GHLA 3LJ0A 4FT7A 4DH1A 4O7NA 3GC0A 3QXPA 4C0TA 1BI8A 4U42A 4AFJA 2VRXA 2XNOA 2WXVA 5AR5A 1R3CA 2C1AA 4PDPA 2GFCA 4MUQA 1PXKA 3CJGA 4U5JA 3VUGA 3VW8A 4ERWA 3RM6A 1NVSA 2X4ZA 4X6RA 1UU7A 1O6KA 4RJ5A 3T3VA 3L9NA 4ZTHA 3UMWA 3NCZA 5AM6A 1JKKA 3QU0A 4F9BA 3GUBA 3PJCA 3QKMA 3RK5A 3SD0A 4AU8A 4C4IA 3OY1A 4KBKA 4MWIA 1PXMA 4PL3A 3TKIA 4B8MA 1ST4A 2AUHA 3F3UA 2PE0A 2WELA 4YLJA 3ZLXA 1ZZ2A 5AV4A 4JR7A 5AV1A 5F4NA 3NMUF 2CDZA 3QLFA 1Q62A 2XNNA 2HZ0A 5G1XA 3BQRA 4N6ZA 5HVJA 4FTNA 4D4VA 2GQGA 5AP5A 4B4LA 4R1YA 4ZLOA 5IISA 1QPJA 2PMLX 3C4ZA 5K0XA 2JDVA 4C3FA 3PLAE 2PZIA 2PZPA 4QMTA 5EYKA 4ZJVA 4FKUA 3RPYA 4RIYB 1OL5A 2CN8A 4CLIA 4NIFB 3VS7A 2AQXA 4FNXA 4V01A 3FBVA 3UZPA 4EZ5A 4YJOA 2W06A 3CBLA 3NIEA 4RGJA 4CZUA 3MA3A 4DGLC 1HOWA 5CAOA 1PMNA 5AV2A 3SXFA 2OXDA 4NM7A 4CMOA 5J8IA 2C68A 4ZZOA 5JGBA 3UQCA 4FEXA 4TZRA 5CSXA 4GMYA 3DKCA 4J95A 4QP9A 2BROA 2B9FA 4BJJA 4IB5A 4BCMA 1J91A 3G9NA 2WTDA 3AKJA 4RX8A 2QU5A 4BYIA 1OL2A 3FPMA 3LFNA 4RX9A 3PIYA 5K4JA 4GK4A 4XOYA 4WNPA 5AP4A 2XBJA 3NWWA 3DBEA 3ELJA 4IB1A 3R6XA 3MTFA 4XV9A 3U51A 4TKSA 4FICA 3UIMA 2ITWA 5BV3A 5AP3A 5I9VA 4EH8A 3P5JC 2NO3A 3OUNB 2PVHA 3FQSA 2YLFA 3KA0A 3OXIA 5DFPA 5FBOA 2OICA 4NU1A 1F3MC 5TF9A 4BIEA 3W0QA 5M08A 2UZNA 4PTGA 3QX2A 1IG1A 3R02A 5D9HA 3DA6A 2J2IB 4FVPA 4HYSA 4ANMA 2VTQA 4LRMA 5HESA 3WF6A 4BDAA 3PVWA 4DINA 4BCKA 2C5XA 3IS5A 3BIZA 1WVYA 4L7SA 4B99A 5DEYA 2XYNA 4XG9A 2PVMA 2C3LA 5I9ZA 3NVMB 3FLWA 3OWKA 1M7NA 5L6OA 5ACKA 1FGIA 3LW0A 3QKLA 4PP9A 1YXXA 4FUYA 3Q5ZA 4ENXA 4TT7A 1CKJA 1PXJA 3QD4A 5EM5A 5JZNA 2G2FA 5CXZA 3UO5A 3PFYA 1U54B 5CI7A 4FSTA 2VGPA 3BLHA 3F69A 2VO7A 4FIJA 2A1AB 2R3QA 5M44A 3U9CA 3LFEA 3UDTA 4OTIA 4G6OA 3VBVA 3RHXA 1ZY4A 3NR9A 5HTIA 4FZFB 4BN1A 2PE2A 5GHVA 3ULIA 3IKAA 3C50A 4LL5A 4K33A 2QOFA 5LMAA 3P1AA 4P2KA 3CTQA 2ERKA 2R2PA 3C51A 4BI1A 3R28A 2GPHA 3OD6X 3OY3A 4QP6A 5M07A 3IGOA 3VS5A 3KMMA 5E90A 1A06A 3DXNA 3A7HA 3FLSA 4O4BB 5FEEA 4BDKA 4MXZA 3RMFA 4I5MA 3W0RA 3QX4A 5AUWA 3DKOA 5CVGA 4P4CA 4RFMA 2WAJA 4M84A 5CENA 4DN5A 3I5ZA 4EK3A 4EWHA 5DLSA 4EQCA 2J5FA 3BBTB 2J0LA 4GYIA 5ANOA 3PZHA 3W0PA 3I0QA 2ZYBA 4QYGA 4OT6A 1R1WA 2BAKA 1ZYJA 2XH5A 4WNKA 3KN5A 3FMMA 2I6LA 2XANA 2JIVA 2JKOA 3GOPA 4HOKA 5M57A 3IW5A 4U45A 5IUHA 2R3LA 4U8ZA 2JKKA 1URWA 3KXMA 4Q5HA 4HPTE 3TNWA 3ZO4A 2ITQA 4G6NA 5JMSA 4I24A 4KWPA 3S2PA 4HVSA 4FUXA 2QO2A 4IVBA 4F78A 2X8EA 3MS9A 4AS0A 2FSMX 2VN9A 3QTXA 4C57A 4K11A 5C1QB 3TDWA 3W0OA 1IAHA 4O81A 4AXDA 5C4KA 4RRVA 2QONA 4XHKB 4QMSA 2OXXA 1F5QA 3ZSHA 3ETAA 3OS3A 3V5JA 3MESA 2JBPA 4O82A 5T3QA 3SRVA 1GZOA 2YIQA 3N4TA 5CAUA 1H1QA 3C4EA 1M17A 5CF8A 2BRGA 3DAJA 5EOBA 3KQ7A 4IM0A 2B53A 3MN3A 2WTCA 4G3DA 3WZJA 4RJ7A 4XJ0A 3EN7A 5A4QA 4L68A 1XWSA 1ZY5A 4XV1A 3DBQA 3KULA 4BKJA 4GUEA 3WZEA 3ZM9A 2X2KA 3BHHA 3ORMA 4BZOA 3BE9A 1ZYDA 3DJ6A 3GT8A 4TYJA 4APPA 3VAPA 2AC5A 1M14A 4O0RA 3BGPA 2GNHA 1QPDA 4PL4A 2H34A 4J99A 3P23A 3HP2A 4QRCA 2WTKC 3QWJA 4QP3A 2OG8A 3AG9A 5IDPA 3R2YA 2BDFA 3W18A 1Y8YA 5TKDA 4AUAA 1NVQA 3IDPA 3A7JA 1JBPE 2WEIA 4FSYA 5CVHA 3GC7A 4X2KA 1YI3A 3EFJA 4OTGA 1IR3A 2P2IA 3E5AA 2BKZA 3TL8A 4BDCA 3QCYA 4QYFA 4FSWA 2IZTA 3CXWA 2WTIA 2E9NA 4LMUA 5I3OA 3GC9A 5IQIA 3REPA 4IWQA 4OTWA 4LMNA 3SKCA 3DZOA 3H10A 4BGGA 4FTMA 2OW3A 3MYGA 4NWMA 2C6TA 2C6IA 2GU8A 2XJ0A 1YOLA 3O17A 5AUYA 1OBGA 5FBNC 3RGFA 3SAYA 4ANBA 1SVEA 4CEGA 5IA0A 4O4DA 2UW9A 5EK7A 3A7IA 3FSKA 3TIZA 2VO6A 4ZTRA 1KOAA 1QL6A 2Y6OA 3V5LA 5IMEA 1VR2A 4C8BA 3Q4UA 4O7SA 4NKSA 4GFGA 4FT0A 2XNBA 4GSBA 2UUEA 4FKLA 2BILB 2BHEA 3GU7A 4MAOA 4RJ3A 4WG4A 4O27B 4ZJIA 3COKA 2R0IA 4IANA 4PF4A 3FMKA 5CU2A 1B38A 4C4EA 4R77A 4G2FA 4RWIA 3FMNA 3EKNA 5FTQA 3LMGA 2P0CA 2QHNA 4C33A 4ZMFA 5AM7A 4YTFA 3FEGA 2A0CX 2VTPA 3CTHA 4OTHA 4TY1A 4ZLZA 4DEDA 3TDVA 2C6OA 3NNVA 1GY3A 4ZY6A 4TL0A 2JD5A 2GFSA 5AX3A 4ALWA 3HV4A 5CEMA 2LAVA 3BWFA 5L8KA 3EN5A 3MY0A 2XKEA 4S30A 1OIQA 3E7OA 3EB0A 3JYAA 4JG7A 2WMRA 2Q83A 3V5QA 4OW8A 3FI2A 4DFYA 3HV6A 2IW6A 4JR3A 5HQ0A 3R01A 1KE9A 5BMSA 3RWQA 4QD6A 4FV2A 4IAYA 2OF4A 3FLZA 3MSSA 2RFNA 3HRFA 4UY9A 1O6YA 4ZTLA 4C34A 5CEQA 5HU3A 3BPRA 3L9PA 3E8EA 4UBAA 5A4EA 3RALA 5ETCA 3GCUA 3ALOA 4CNHA 4EBWA 3ENMA 4IX6A 1JAMA 1JLUE 3CKWA 3O96A 5LCKA 2WMSA 1JKLA 2J51A 2YIXA 5KNJA 3QYWA 4WHZA 4O86A 5D7VA 5L2IA 3ODYX 5A6NA 5DEWA 4LYNA 3K5VA 4ZSEA 4CZYB 4V05A 2I0YA 3KF7A 3ATTA 5CF6A 3GCVA 4Y95A 5FXSA 1L3RE 4M66A 3UNZA 5DGZA 4E20A 3D15A 4I22A 3TWJA 3JVSA 4RLLA 4ZS4A 4DGNA 3HEGA 2J4ZA 5AP6A 5GZ8A 3OWLA 2HWOA 5KBQA 3TM0A 3K2LA 3POOA 5DRDA 4HVHA 2QOIA 3SDJA 1L8TA 5CAVA 4HGSA 4IB0A 4QPAA 4A9UA 4AT3A 4DH3A 2ITUA 5LMBA 4HZRA 2V7OA 2VTTA 4CFMA 3R9OA 5J95A 5KHXA 3QZIA 2CPKE 2R5TA 3TZ8A 4M7IA 5D1JA 4IVCA 4U79A 4HGEA 2ZV7A 2C6EA 3QHRA 3FYJX 4RIOA 4KD1A 3DV3A 5KHWA 3BU3A 2I0VA 3E93A 4M68A 4BVUA 3OTUA 3JS2A 3FAAA 2WQOA 4JBOA 2NYAA 4YZDA 4TN6A 4GH2A 4WSYA 4YZNA 4JQ7A 3HV7A 2V0DA 2VWBA 5L8LA 4BCHA 3OHTA 3QCXA 4YHFA 3TV7A 4CFUA 4G3CA 3C13A 3OF0A 1OBDA 4X2GA 4AZSA 2VZ6A 5LJJA 5AUUA 4AZEA 2UZTA 4X7QA 4DITA 3GCQA 4FKWA 5BQ0A 5IQGA 4FV8A 2R4BA 4KSQA 5JFXA 3DK3A 4USFA 4IFGA 4CQGA 3R22A 4O7RA 3UG2A 4AT5A 4C4JA 3DBCA 4FTKA 2JDSA 4C62A 1WMKA 2EXCX 3DDPA 4BR3A 3W1FA 3P5KA 4JXFA 4E7WA 3PSBA 3BV3A 1H0WA 2A98A 5IEXA 3ID6C 2PULA 1YDSE 3IW7A 4J96A 4UMPA 4FVQA 2H9VA 2LGCA 2XAOA 3AKKA 2I1MA 3O8UA 1XHAA 4FSQA 2WQMA 3UDBA 3OOMA 2O65A 3DXPA 2JGZA 2FB8A 2Z7QA 3C4FA 4QMUA 4CCBA 4ZTNA 1WFCA 2ZM1A 3NW5A 3FLYA 3JY0A 3FE3A 4BB4A 3SVVA 4G3GA 4XBUA 3VS0A 2IG7A 4E26A 3O7LD 4IHPA 4A7CA 3VHKA 1Z9XA 5H3QA 4FV5A 2CLQA 4QMMA 1XH5A 2VWYA 2X7FA 4F99A 4H39A 5BUIA 3PWYA 1TVOA 4MWHA 4TNBA 5JEBA 4HPUE 3SC1A 3R83A 1ZMVA 3GCSA 4N6YA 3ZLWA 3DKFA 1UKIA 2R9SA 3P7CA 3ZEPA 5M56A 2QU6A 3U6IA 3U54A 2PMOX 4DTAA 4YC3A 2GNIA 1NT2A 4RC2A 4FTQA 2B9IA 3FV8A 2W5AA 4Y85A 3AKLA 2VNWA 2CNVA 4Z16A 4PMSA 3BGQA 4CFWA 3MJ2A 3CJFA 5BPYA 2A27A 3LXPA 1OKWA 4WIHA 2BHHA 4BCGA 4O4CA 2CGXA 3MPAA 2CKEA 3H4JA 3R1NA 4ACDA 3UYSA 4UMRA 3OW3A 4IZ7A 5CNOA 4AE9A 1U54A 3MGYA 2EUFB 1H4LA 5EM6A 2RG6A 5HD7A 5HGIA 1G3NA 2XRWA 3L1SA 3MIYA 5ACBC 3TTIA 3O51A 4EOOA 3HAVA 5M06A 4AXAA 3R8ZA 3TKUA 4YR8A 2X2MA 4CV9A 1PMEA 3E88A 5L2WA 3FY2A 2F57A 2ESMA 1DM2A 3FMJA 4NJ3A 3FXWA 3RPSA 3CKXA 4GT3A 5AV3A 4C4FA 1SVGA 4O83A 3TNQB 1E1XA 3BLRA 4YHTA 2ZV8A 3ZOSA 5IH6A 3FMHA 3T9TA 4FODA 3WYYA 4L00A 4A9RA 4Z7GA 4C7TA 4XG4A 2V55A 3E8CA 4FSRA 4JAJA 4BKZA 2R3RA 4ZS0A 4WUNA 2FGIA 3CR0A 2EXMA 5AIRA 4HNFA 5HX6A 3ZH8A 4A9YA 4ANLA 4O0YA 5I3RA 2XK6A 5HI2A 5L6PA 3KVXA 2QCSA 3VO3A 3ZSIA 2XIXA 4S33A 3ZHPC 2UVZA 3COMA 2V22A 2G2HA 3BHYA 3LCOA 4RSSA 2W9ZB 4WBOA 5IQCA 4GCJA 4DLIA 3COHA 4L3PA 1DS5A 3QQFA 1APME 4CZTA 1TZDA 4E8AA 5EKNA 5M53A 3PDTA 2WMBA 3C0IA 4JDKA 1UNLA 4MNEB 1H25A 3P4KA 4G34A 4R8QA 5TE0A 1K9AA 3ZSGA 5LMKC 1OKYA 2RKUA 3T9IA 2WOTA 5E9EA 3I4BA 4RVLA 3TI1A 4JNWA 5FTGA 5H8BA 1W7HA 5FXRA 1GZKA 2I0HA 3PLSA 3II5A 4D58A 3DAEA 4FYNA 3MFRA 2OKRA 4Y5HA 2G2IA 3RI1A 4UWYA 2OWBA 3GFWA 1U4DA 3I7BA 2WEVA 3MVJA 5EHYA 3KU2A 2G15A 2BRBA 1JQHA 5L3AA 2XUUA 2WPAA 3PIXA 4M69B 1UWHA 3D5XA 3W2RA 3FZ1A 1OITA 4J8MA 3FXXA 1SZMA 3PUFC 1A48A 3TV4A 2VNYA 5FUTA 4FL1A 2IW8A 3QCSA 2PMNX 1XKKA 2XYUA 2YDIA 3AC4A 5IUIA 2E9VA 2Z60A 3AOXA 4H58A 4LGGA 5M09A 4BY9E 2QOBA 4WD5A 3PWDA 5CY3A 2JKMA 5ANDA 2PPQA 5L2TA 4H36A 2HENA 3RHKA 3LFQA 5DR9A 3OXTA 4I6BA 2B55A 3G90X