3DNEA

Camp-dependent protein kinase pka catalytic subunit with pki-5-24
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
336
Chain Sequence
b'ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Crystallography-independent determination of ligand binding modes
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
total genus 105
structure length 336
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dneA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dneA02
2GS7A 4L3PA 3D2KA 5CNNA 4BZOA 2XNOA 3GENA 5EK7A 2E9PA 3FXWA 1B38A 3QCXA 4M67A 4MNEA 5H2UA 5T6KA 3UMWA 4B4LA 5L4QA 4O7RA 4E5WA 2OZOA 4FSWA 1IAHA 1Q8WA 3HZTA 3Q4UA 5TR6A 1E1XA 4JR7A 2IVSA 1YDRE 2YLFA 5AMNA 3MN3A 4ZZMA 1IG1A 1KE5A 4EUUA 3U54A 3RPYA 5D10A 2BROA 2VNWA 4YC3A 5AM7A 3MW1A 3EL8A 3R7GA 4QYYA 2I7QA 5IQIA 4CGAA 2C0IA 4UZDA 2IWIA 4BCFA 1GZKA 5GJFA 3QRUA 5IH4A 4PNIA 2PPQA 3NUAA 3ZO3A 4BWKA 4EBVA 3VBWA 3ZUTA 1OUYA 3QRJA 1S9IA 3D83A 3R71A 4FX3A 4JIKA 2IJMA 2FGIA 1CTPE 1QMZA 4XP0A 5AR2A 2VWZA 4BB4A 4E4NA 4ZTMA 1M14A 3DK7A 2LGCA 2OH0E 4NCTA 5ACKA 3R7YA 1YHVA 5KMJA 1FGKA 4U81A 2HYYA 4GYGA 4JQ8A 3F5GA 2W1FA 4FTUA 4GIIA 3VBQA 3WZJA 4I94A 2EVAA 2CGUA 4FIGA 5BMMA 3QX2A 2OIBA 3FHRA 4BL1A 3R7UA 4RIXA 3RP9A 2PHKA 4Z16A 4XG6A 4DEDA 3BGPA 3AGLA 4MXCA 3Q9YA 3F2RA 3PSBA 3QTQA 5LXMA 4J97A 1YKRA 1GOLA 4MHAA 2WELA 4W8EA 5LARA 3ZSHA 4FSZA 1WCCA 4M8TA 4C0TA 3Q5ZA 4EK4A 4FVPA 3PJ1A 1XR1A 3FZOA 4FSMA 3VBXA 4DAWA 4QD6A 5AR3A 4O91A 2H9VA 3RINA 5BNJA 4JG8A 3T8OA 4N70A 2C5VA 3TNIA 2GTNA 4TT7A 3DS6A 4C59A 3MVJA 3OXIA 3UOLA 1WBWA 3FMNA 1G5SA 2Y7JA 5FQDC 5IA0A 3PLAE 4LV5A 4L3LA 3LJ1A 4D9TA 4GK2A 2PVNA 4EH4A 2ZV9A 1GY3A 2B4SB 2BRHA 2GS6A 3PZEA 4G9RA 4HCUA 4J53A 4QTAA 2WMQA 4H58A 3VS2A 3B2TA 4GL9A 3OOGA 3NYOA 1JKKA 1ZY4A 3F5XA 4QPAA 2PTKA 3VIDA 2X2KA 2VWUA 4MBLA 3FUPA 3R7EA 2XK7A 4Y73A 2YITA 3UO4A 4RG0A 4EHEA 5CT0A 4O21A 5HLNA 5IEXA 3D4QA 3GB2A 3NUUA 2QNJA 2IZUA 1LEWA 4WNKA 4BDKA 4BGHA 4ZSLA 4D5HA 3VUHA 2CLQA 2IVTA 4C37A 3LCOA 4OTDA 5DGZA 2BDJA 2ONLC 2YISA 3FL5A 3HVCA 3KULB 3FLNC 2X1NA 2QVSE 3C50A 3ETAA 3NW5A 4IMYA 4O7SA 2WMWA 5AV0A 4O1OA 3FKOA 3ZO4A 3DKOA 4TPTA 4D9UA 3FDNA 5KKRB 4IAZA 3LJ0A 3D7TB 5D11A 5KNJA 4FKOA 4G3CA 1QL6A 4A9TA 4C4HA 3HV4A 3ORMA 1URCA 5I9VA 4EZ7A 3RTPA 5TKDA 3VW6A 2QOKA 1R1WA 4L6QA 1MRVA 4G5JA 3WYXA 5EQYA 2FYSA 2J0LA 4EK3A 3P4KA 5GNKA 3OY3A 4IB1A 4KKHA 2XK4A 3PIXA 3C4FA 3TIZA 4JG6A 2ITOA 3F3UA 4CRLA 1PRYA 3D5WA 1VYWA 2XNNA 2ITYA 5I9UA 2C68A 4I6FA 5C8MA 3WE4A 5HI2A 3UNJA 2FSTX 1JLUE 3OUKA 4AT5A 2QODA 4FTLA 4FE2A 4FUXA 1KE7A 2NPQA 3Q2JA 4FODA 3D14A 2UZLA 3IGOA 3FE3A 5C01A 2R5TA 4LOPA 2VGOA 5BVEA 4IX5A 3CSVA 1GNGA 1GZ8A 3PIYA 4ANSA 2UW5A 4YTIA 4AT3A 5DT3A 4NIFA 1MUOA 4FNXA 4TNBA 4DEBA 5HCZA 2ETMA 3LXKA 1QCFA 4Z55A 2UW6A 2WAJA 2UVZA 4XG7A 3SG9A 4U3YA 4G3DA 5DG5A 4OTIA 4XRLA 4AN2A 3QKLA 4QP4A 1TQIA 4YGAA 3WIKA 2X2LA 3KXNA 4AT4A 4RWIA 4MTAA 4UMTA 3R8UA 4C58A 4EI4A 1ATPE 2JD5A 3U6JA 3ORNA 3I7BA 1LR4A 2Q0BA 4V0GB 4XMOA 1YI3A 4H1JA 1P14A 4EJ7A 1Y8GA 2HXLA 5AFVA 3U8WA 4FI1A 3KEXA 5CF4A 4YTHA 5BVNA 2PVYA 3W16A 4TWNA 2PMIA 2OH4A 3CLYA 5KO1A 3S4QA 2YZLA 3B8RA 5LVNA 3I79A 4K18A 5JZNA 1WBTA 2ZB0A 1NT2A 2G2FA 2R0UA 4DEGA 1OL2A 3PA3A 5F94A 3FI3A 4IAIA 4RFMA 3K5VA 2B54A 3AC4A 3OBGA 3LFBA 4FSQA 4ZY4A 3K54A 4O0YA 4HNFA 5B2LA 4BDHA 3OWJA 4ZOGA 3IGGA 3MB6A 4FZAB 2RIOA 5F4NA 3V5TA 2JDOA 1GZOA 4YLLA 1YWVA 3ULIA 4XUFA 1RW8A 4BY9E 3D94A 1G3NA 3C5IA 3KKVA 4RLKA 4XH6A 5HORA 1Z5MA 4IAYA 4D2TA 3SRVA 2XK8A 4E5BA 4ANQA 4YBKA 2X4ZA 1URWA 3DKCA 4GEOA 4LV8A 3FSFA 4WIHA 4PDYA 2VTRA 1YI6A 5HG7A 4LG4A 4F0FA 4O7NA 3R2BA 4S2ZA 4IWQA 4RVKA 1M17A 4OAVB 2WMVA 5IUHA 5CQUA 3RNIA 5J7BA 1OL5A 3ZS5A 3F61A 4MAOA 5J9LA 3O17A 5LCJA 3OXTA 2BDWA 2I0HA 3C4WA 4GT5A 1E1VA 3E87A 2PULA 1V0BA 3I60A 4IAAA 3RJCA 2C6TA 3TG1A 3O23A 3L9MA 4R3CA 1OM1A 2W1HA 1G8AA 4L8MA 4ALUA 2DWBA 5HVKA 3EFLA 3MH0A 2EWAA 4Y46A 4C3PA 5BUEA 1H27A 3KRJA 2JFLA 4GJ3A 4TL0A 4PPBA 3R1QA 2KULA 4I5HA 5HHWA 2HZIA 3JY0A 4X2FA 4XV9A 2HAKA 4L53A 5FDXA 2VN9A 2WMTA 2XNGA 3A4PA 3PVUA 4NTTA 2VTSA 4U79A 4ZP5A 1YHWA 5DRBA 5KZ0A 3SC1A 5GZ8A 2C4GA 1H8FA 3QTUA 4X6QC 1CSNA 3UOKA 1ZRZA 2XKFA 5HE0A 3AT3A 3MH1A 3QBNA 4EL9A 5EHLA 4QP3A 2A4LA 3UGCA 2HW6A 3BI6A 3DA6A 2YIXA 2QOBA 4CTBA 4KSQA 2BR1A 2J90A 3NVMB 3C4XA 4QNYA 3ZFYA 4BYJA 2JITA 2BAKA 5F9EA 4I41A 4JS8A 3HRCA 1ZARA 4UYAA 3ENHA 3FZPA 3KRWA 5I3RA 2BZJA 2XNEA 5AP7A 4CFXA 3MA3A 5AA9A 2W1CA 4QRCA 5AADA 5C9CA 3DZQA 5J5TA 4R5SA 2CN8A 4B9DA 2A19B 4QMLA 3EL7A 2IVVA 2C3KA 4F7JA 5CNOA 5AUYA 4BKYA 5IH5A 2QOLA 3NIZA 3KMMA 5CVGA 3OW3A 3KC3A 3LW0A 5LJJA 4NSTA 4LI5A 4PL5A 4TYGA 3EB0A 3BQRA 3LFEA 3QD3A 1T45A 3E93A 2UZBA 2WTWA 4XV2A 4ZTHA 2ITUA 4FVQA 2C1BA 4CFWA 1SVEA 3P23A 4RZWA 2QR7A 3GQIA 2P2IA 4APPA 2CMWA 2R64A 4CG9A 1IEPA 3CS9A 3COKA 4CEGA 2AUHA 1U5RA 2J5FA 2YA9A 3QWJA 4OTQA 4TRLA 5GZ9A 4ANLA 2QO9A 2CSNA 4PTGA 4BR3A 4O0VA 4BGQA 3ZUVA 3VVHA 2XIXA 4HW7A 2X6EA 4GMYA 4FV9A 3RGFA 3EKKA 3FZ1A 4IACA 4R3PA 3FXXA 1HCKA 3MV5A 2B53A 2BAJA 3BYMA 5B2MA 2QO2A 4X3FC 2BPMA 5JH6A 3RCJA 2XP2A 1FQ1B 4YZMA 4YSMA 2XF0A 2FSMX 3RI1A 3EQGA 2VTLA 3EZVA 1WZYA 4YJOA 4YJTA 3E8NA 5EQPA 4NJDA 2C5OA 4EH5A 4OBOA 5HGIA 4IB5A 1J1CA 1H24A 2HY81 4O96A 4FC0A 1L3RE 4GVJA 4G2FA 5A4EA 2OXXA 4BDDA 4TZRA 3OWLA 4Y8DA 2BIYA 2E9VA 2O64A 3DBFA 4WRSA 3RK5A 3UC3A 4FKSA 4ZJVA 4H05A 4BBEA 4EOJA 2VO7A 4KS8A 4J8MA 2WMRA 2ZJWA 4FT3A 5LMBA 4GK4A 4ITJA 1JVPP 1FOTA 1WBOA 4JVGA 5CZIA 2RFEA 4PMTA 4XEYA 3PXKA 2E9NA 4M3QA 3WF6A 2AC3A 2ONLA 3PSDA 4WHZA 1R0EA 5J9ZA 2JKMA 4YNOA 3E5AA 4YC6A 3DFCB 3QQHA 1MQ4A 2GNHA 4J8NA 4YR8A 4EOSA 1XO2B 1UNLA 4AFJA 3P9JA 1BUHA 4A9YA 5K4IA 3R2YA 1U46A 4EUTA 4TYIA 5ETCA 3PSCA 5IQFA 3RZFA 4TWCA 3Q5IA 4W4VA 4WUAA 4AA5A 4ZMEA 4H1MA 5DR9A 3O8PA 5CSVA 5K0KA 5JGDA 4D5KA 2HZ4A 4I92A 3RPVA 5KUPA 4FGRA 1L8TA 2ZVAA 4O1PA 2QU6A 4PDPA 3Q4ZA 4HVIA 3DXPA 1XH7A 2R3GA 1ZMVA 3R73A 4AQCA 4ENYA 3QD4A 2ETKA 1YOLA 3OCSA 1CKIA 2XYNA 4L00A 3IKAA 4RC4A 5HD7A 1YXSA 4FTOA 4XG3A 3BQCA 4FKVA 4FV7A 3LE6A 1JKLA 5LCKA 3B8QA 3PP1A 4EK6A 3CJGA 3U9CA 3TNWA 4FGBA 3R6XA 2BTRA 3WZUA 3ORKA 3ERKA 3QLGA 1H00A 4FT0A 1JKTA 2VWVA 3WZEA 4QT1A 4B8MA 3NPCA 1OI9A 2RGPA 2YHVA 3SW4A 1PXMA 4XBUA 3RM7A 4UB7A 5HLPA 3EZRA 5L2IA 2GDOA 3BLRA 3V01A 4AUAA 2R7IA 3ZO1A 1H26A 4FTKA 2FSLX 3ZOSA 2HZNA 4DFLA 2P0CA 3LMIA 2BRBA 2VTAA 4EOLA 5E8WA 4IJ9A 4CZUA 5DA3A 4DN5A 5CQWA 1CM8A 2O5KA 2X6DA 3G33A 5ICPA 4J99A 4CG8A 1XH4A 1Z57A 4R6VA 3VHEA 3IDPA 2OICA 4GT3A 1ZZLA 3ORLA 1H25A 5CEOA 5CAPA 4CZYB 2Q83A 3QXPA 2PYWA 4PL4A 1OMWA 2X81A 4HGSA 3HDNA 3V51A 4YLJA 4ORKA 3ZBFA 4G16A 3K3JA 3IONA 5HIBA 2X7FA 4HCVA 4QQTA 1I44A 3QRTA 4CKIA 4WO5A 5HKMA 2EXEA 4FTQA 3R7IA 4HVSA 2YIYA 2GCDA 1AD5A 4MWHA 5FUTA 2WPAA 4BICA 3DBDA 2J6MA 3PIZA 5JFXA 2JDVA 4G6LA 2WTKB 5M09A 1ZYLA 2UW8A 1WVWA 3ODZX 4TYJA 3TJDA 4BHZA 5H8GA 4C8BA 3GCSA 4FIJA 2OJIA 1OECA 1BMKA 3F3ZA 4CRSA 3W2QA 4C36A 2BKZA 3TKIA 3HAVA 4FKGA 5HBJA 4UWCA 3UG2A 1MP8A 3BE9A 4LRJA 4YNEA 3ATSA 3C4EA 3JYAA 4IB3A 1UWJA 1PXJA 3CGOA 5EM6A 4USFA 4BCHA 2W96B 4UEUA 2GMXA 4U8ZA 3LXNA 5DLSA 5L3AA 4L7SA 2OZAA 1CKPA 3LQ5A 1GIIA 1U54A 3O71A 4DTKA 4E73A 4PTEA 5HU9A 1S9JA 4JR3A 3I4BA 1O6YA 3OC1A 1VEBA 4BKJA 3TV7A 3I5ZA 2PMNX 5A4QA 1IRKA 5I5ZA 3PPJA 2C6EA 3BZ3A 5CEPA 4DEAA 3HV5A 5L6PA 2W1ZA 3UE4A 4YU2A 1PW2A 4JL9A 3VQHA 4F09A 4MXAA 5BYLA 2QU5A 2VTIA 2WEIA 3GC9A 5AV4A 4YJUA 3NVKI 1P5EA 4II5A 5I9XA 3MPMA 3RAIA 4BDJA 3L9NA 4H3QA 3FL4A 3FWQA 4KKEA 3FY2A 3H10A 4EHGA 2XNBA 4LL0A 4UN0C 3W10A 2RFNA 2XIZA 3R9NA 3BELA 5TF9A 5HG9A 4JXFA 4U0IA 2PVFA 3MPTA 1XHAA 1ZMUA 1Q97A 3W2CA 5DIAA 3ZHPC 1JOWB 3P86A 4QP6A 3PJ2A 3FY0A 3L8PA 4YTFA 5HO7A 3PRFA 4ASEA 4HYIA 3QQKA 5E92A 1WVYA 4IAKA 2W1DA 3KVXA 2YIWA 4W9XA 2WMSA 4O0SA 3SXFA 2CKOA 4FNZA 3SKCA 4FT9A 4J96A 2FSOX 5CWZA 4J52A 3OT8A 3MVHA 3GCVA 5BUJA 5FM2A 3QQLA 4WBBB 4ACHA 4ZTRA 3OW4A 2HENA 3R21A 4JBOA 3RWQA 1W7HA 3P5KA 2X9EA 3LM5A 3Q9WA 3FQEA 4FSNA 4MYGA 5DEWA 4AOJA 5A4LA 5AP5A 3HNGA 4O27B 3LPBA 2QG5A 2UW0A 2X7OA 4MNFA 5EYCA 3F88A 2XZSA 2AYPA 3FZTA 4MXYA 3RK7A 2BIKB 2X7GA 5IDPA 4OTPA 2BFXA 2F9GA 4KD1A 5L8JA 5IF1A 4UZHA 4RWKA 5KMNA 5M4IA 3ZRLA 4QMYA 4EEVA 2XIYA 4OTGA 1A06A 2JEDA 3AMYA 1Q8ZA 5HBEA 4MBJA 5CTPA 4E6QA 2A1AB 4QP1A 4ZLZA 3V5PA 4D2WA 2VTJA 1OPJA 3M1SA 4BCOA 3ORZA 3N4UA 1ZOHA 4FEWA 1YDTE 4M69A 5HZNA 4U42A 3EN5A 2F2UA 2H96A 4KIKA 3SD0A 4GJ2A 3VJNA 3S3IA 1OBDA 5E1EA 1OKYA 2GFCA 3ATTA 4XG2A 4D1SA 1DI9A 1APME 2VTTA 4FTJA 4KB8A 5HX8A 3BGQA 1SVHA 2VO6A 4IM2A 4M84A 5KE0A 3L1SA 4U3ZA 5E8TA 3ZRMA 1B39A 4G34A 1R0PA 3EKNA 2NNWB 4JX3A 5HOAA 3TTIA 2CKPA 5EW3A 4G6NA 3ZC6A 4GUEA 4ANOA 3L8VA 4DFZE 2PVKA 4GU6A 5JSMA 3EQCA 2YEXA 3FQHA 5AR7A 4AZFA 4EJNA 5AV1A 3FMMA 5FD2A 3UVRA 3AOXA 1YW2A 3I1AA 3QTSA 4Y95A 4IZ5A 2XIKA 5AA8A 5JEBA 3UZPA 4U40A 5CU0A 4EH6A 5BMSA 4GT4A 4X3FB 1M2PA 2F7XE 4G3FA 2ITXA 3QKMA 3HDMA 1BX6A 3AD6A 1W8CA 3JR1A 5K0XA 4DE4A 4W4YA 2Y6MA 3NRMA 3QCSA 2QLQA 4BCKA 4V04A 2R3FA 4C34A 4G3GA 3IW6A 4YTCA 5JT2A 5KMLA 4ZJIA 2JAVA 2IW9A 4FOBA 2QCSA 4XHKB 3OCBA 5FBOA 2GS2A 2YERA 4YP8A 4HOKA 5E8YA 2R2PA 1Q8UA 2IN6A 3GUBA 4GVAA 1STCE 1ZYDA 3W33A 1YWRA 2Z7QA 4QYFA 3PZHA 4GYIA 3S1HA 1RDQE 1UV5A 3II5A 4BZDA 2PK9A 4X6RA 2KTYA 3A8XA 3A8WA 4DG2E 3A7IA 4BCJA 1OL1A 2VWXA 4NT4A 4OGRA 4MF1A 2PL0A 1QPDA 4FTRA 2BTSA 2OO8X 4QQJA 2REIA 4I0SA 3R1NA 4AOIA 3CPCA 3KGAA 4X3JA 5BVWA 3CKWA 3DOGA 4MD7E 1LP4A 5FEEA 3A7FA 1OKZA 3KMWA 4N6YA 4BTJA 2WOUA 4XLIA 4IHPA 3NUYA 3CJFA 2PUUA 3DBCA 4RJ5A 3VS1A 4I22A 2X9FA 4JNWA 2DYLA 4GW8A 5AAFA 4G31A 4MNEB 3VW8A 4BCQA 2ZM4A 2UW3A 2C47A 5EW9A 2WTJA 3UO6A 4UMQA 5CEMA 3GFEA 1XBBA 4F1OA 5CAQA 4RLLA 5ANGA 4RQKA 4WNPA 4FG7A 2BZHB 3GGFA 5IPJA 3FMJA 4Y85A 3PFQA 1SVGA 4I5CA 4NFMA 4L67A 4UYNA 4FL3A 4U45A 3CPBA 3PYYA 3H9RA 2WU7A 1U5QA 3QALE 2JAMA 4CCBA 4KA3A 3T3UA 4HNIA 3F5PA 4FNWA 4K77A 3QZGA 4DFBA 5FEDA 3HV6A 2R3HA 3ULZA 2JDSA 3F6XA 4RJ6A 1LUFA 3QUPA 2OSCA 4I3ZA 4IVDA 2R7BA 3AC2A 2V22A 1H28A 3HECA 4WG3A 2JKOA 4OBQA 1EH4A 2VO0A 4ZIMA 4AGUA 2Y4IB 4ZZOA 4RPVA 3MY5A 3GCPA 4Q5HA 3R9HA 2XEZA 4MXOA 3FEGA 2P2HA 4R3RA 4RIXB 3TV6A 3KXMA 1OKWA 4JX7A 4QTBA 3PJ8A 5C03A 4HGEA 3SW7A 4YC8A 3UODA 4RQVA 5JGAA 3FMEA 4XX9A 5CANA 3KQ7A 3G0FA 2PWLA 3DKGA 3LLTA 4JJRA 4NKAA 3C4CA 5KCVA 3OCGA 4KINA 3LOKA 4QNAA 3TI1A 4JQ7A 1M52A 2YDJA 3A7GA 2OXDA 3QF9A 3UQFA 3A60A 3AG9A 3MIAA 4HYSA 3ET7A 2YFXA 3DLZA 4BKZA 5DT4A 3NWWA 3MY0A 4IWOA 4QP9A 4FKIA 3P7CA 2EUFB 1Q99A 1PJKA 2W1EA 4LFIA 3BU5A 5HO6A 4I20A 2OG8A 3MVMA 4BGGA 1HCLA 4CKRA 2BZIB 4AOTA 2J9MA 3W2SA 2F4JA 3CTQA 3RALA 4FIHA 2O2UA 3MH3A 5FLFA 4MWIA 3EQHA 3U51A 4AW2A 3PTGA 4G6OA 4JAIA 5FG8A 1LPUA 5E8SA 1BI7A 3DZOA 4IH8A 1YDSE 4E6AA 4BIDA 4PV0A 2W9FB 3IPHA 4C3FA 3AXWA 4N57A 4DA5A 4NM7A 4AE9A 5BVFA 3OROA 5CXZA 2PY3A 3N9XA 3FMHA 3BRBA 3NUSA 4IJPA 1UU7A 4GS6A 2H6DA 2W99B 1DS5A 2OF2A 4HGLA 1W83A 2C69A 1FGIA 3DDQA 3QCQA 3AT4A 1YXTA 3MJ1A 3COHA 4NK9A 3OUNB 4CV8A 3MBLA 3D7ZA 3FC1X 3SQQA 2CCIA 3FLYA 3ZEPA 3SV0A 2ZV7A 3BIZA 1FINA 4ASXA 2R0IA 4CFNA 3MIYA 4CKJA 1OPKA 2W5BA 4U80A 3E92A 3Q32A 3A7JA 1FVTA 4KIOA 4XLVA 4HCTA 1WBVA 3FSKA 2GPHA 3DNEA 1RE8A 2YIQA 3GVUA 1SYKA 2O8YA 3NUNA 5EM5A 4JDJA 1MRYA 2HOGA 3KF4A 3DAJA 5IG1A 3NSZA 3QD0A 5J9YA 2PZPA 4OTHA 2H34A 4DTBA 3OVVA 4X2JA 3EWHA 3JPVA 2OIQA 5FGKA 2I0EA 3GU8A 4E20A 1OITA 1REJA 2HXQA 3ZXTA 4CMOA 4EQCA 5M56A 4CFMA 5FXRA 3OS3A 4IBMA 2GTMA 4XRJA 4NM5A 5JKGA 1G8SA 4QP7A 5IA2A 4UV0A 1JWHA 2GNGA 4O38A 5CALA 3G5DA 3D5XA 2JKQA 4RC2A 4KIPA 4WG5A 4BI2A 2VTNA 2IZSA 5HICA 2BUJA 5LQFA 3DJ6A 4BTFA 1CDKA 3N4TA 3IOPA 2OKRA 3OTVA 2VTOA 3BYOA 1BKXA 1M7QA 3VJOA 1SNXA 2OIDA 4RX5A 4ZJJA 2X8IA 2XM8A 4BCNA 5M4CA 2WMAA 5AR5A 5IA1A 4DH5A 3VF8A 4RVLA 4L68A 3TDVA 4NIFB 5IA5A 4I6HA 3MFTA 2GNJA 5M06A 3DCVA 3PXRA 4XP2A 3WOWA 3BWJA 2O3PA 1XKKA 3U4UA 5F95A 3VUGA 3VWAA 4BC6A 3W32A 4FKTA 4YJVA 3REPA 2R4BA 4DH8A 4ERKA 4F6SA 3DTCA 2C6IA 3BHUA 3JVSA 5CYIA 4FSRA 3PRIA 4RSSA 4IQ6A 2I6LA 4CQEA 4RMZA 3DT1A 4ALVA 3UP2A 3IECA 2PVRA 3LFDA 2Z7LA 2X0GA 4GG5A 3D5VA 3R8PA 2B1PA 3LFNA 5IMXA 5L8KA 2CNVA 2HW7A 4GKIA 5DPVA 4AFEA 4YO4A 4FZDB 3VBYA 1O9UA 3LMHA 4MEDA 3ZSGA 4FV3A 2PVHA 5ETAA 5JQ5A 4W8DA 5AR4A 3IW4A 4D2SA 2X39A 4EZ3A 2UW9A 3C0HA 3UBDA 1REKA 1OZ1A 4IFGA 4BHNA 2XBJA 3EH9A 2R3NA 2ERZE 3MS9A 1Q3DA 2UW4A 4ACGA 4YPDA 4RX9A 2VX3A 3G51A 3UIMA 4MQ2A 3E7VA 1K2PA 1U59A 4LM5A 5B0XA 4FT7A 2QC6A 4I4EA 3GU7A 2ITVA 3VUMA 4F7NA 2WZJA 3JVRA 5HX6A 5EI2A 2WD1A 3U87A 3P7AA 2R9SA 1UU9A 4IANA 3JUHA 3G9NA 5L2SA 3QZHA 4K6ZA 3SRVB 3NX8A 3FMDA 2XB7A 1NXKA 4FL2A 4NKSA 3SVVA 4J98A 2W1IA 1J7LA 5AJQA 3EHAA 4DG3E 1YOMA 4YJSA 3DFAA 2XJ2A 1ZOEA 2PZ5A 4C4IA 3SGCA 3CIKA 5JMSA 3SX9A 4EH2A 3MH2A 3FPMA 3NS9A 2OBJA 5GJGA 4FBXA 4WKQA 3FZSA 3QRKA 4DGGA 3ZUUA 4DLIA 3ZEWA 2F2CB 3HV3A 3OD6X 3LCKA 4I23A 2I1MA 1CKJA 5L8LA 3IO7A 4JLCA 3R22A 3NUXA 2LAVA 4LMUA 2NP8A 2RSVA 1JSTA 3LXPA 1ZZ2A 2QOHA 4AZTA 4O7ZA 5EH0A 1YWNA 3EQRA 2XK9A 3NGAA 4QMXA 4C38A 2UZDA 2XMYA 3F82A 4S34A 1Q62A 3VS7A 4KNBA 4XBRA 2OXYA 4YBJA 4Q9SA 4F9WA 3R1YA 4I6BA 4ZTLA 5J87A 4JQEA 1WFCA 4LOQA 4RWJA 2C6LA 4U7ZA 4TYHA 2UZWE 3RHXA 2BAQA 3FLQA 3DK3A 1PMNA 2UZUE 4J7BA 3HUBA 4XP3A 3C7QA 3TEIA 4AS0A 3F69A 4C62A 3RMFA 4BTMA 4CYJA 2ITZA 4FKWA 3U6IA 1M7NA 4Q2AA 3EN7A 2C6OA 3IS5A 4UWBA 1ZWSA 4E8AA 3QTXA 2SRCA 3KN6A 4R1VA 2OLCA 3C9WA 5CVHA 1R3CA 4FTNA 4JBPA 5KBQA 5AP2A 3EYGA 3H0ZA 3HL7A 4O7LA 4ID7A 4BIEA 1T46A 4ITHA 3UPXA 1H1QA 4K9YA 1OVEA 5BVDA 3FPQA 2GHGA 3S00A 5M07A 2YM8A 4EYJA 3OHTA 1OKVA 1H1PA 4U97A 3WZDA 4AACA 4F99A 5JN2A 3V6SA 2G2HA 5DT0A 5HLWA 1GIHA 3HUCA 3UO5A 3HGKA 5CU2A 3VHKA 4BDEA 2WKMA 3PY3A 3BV2A 4MK0A 2J0KA 4O86A 4O0TA 5D7VA 4CD0A 5K3YA 4KABA 4FTMA 4K2RA 4L42A 3LFSA 4P5QA 3HMPA 2YWVA 4E6DA 3BEAA 4RJ4A 4D2VA 4BDAA 5F1ZA 4DEHA 2XA4A 4BRXA 1V0OA 3FKNA 5AV3A 3DQWA 3UDBA 4UMUA 4W9WA 1Q61A 5IH6A 4CFUA 3AC3A 4QYHA 2YAAA 3BHTA 2H8HA 5KMIA 1OIYA 4QMWA 4X2KA 4I0RA 3FZRA 4BYIA 4M7IA 3EN4A 3LZBA 3CEKA 4BDCA 2GSFA 2YCFA 4K11A 2ZDUA 2VTPA 3EN9A 2GHMA 4XG9A 5CSHA 3FXZA 4BDGA 1GJOA 3FYKX 1Q24A 3KF7A 4EC9A 4RT7A 3OP5A 4NUSA 5HE2A 3G9LX 4AN3A 2VX0A 5EDRA 4OT5A 3F7ZA 3TKHA 4AG8A 4AGCA 3PXZA 3COIA 4CV9A 3E7OA 4O84A 2OJ9A 3BYSA 4J71A 5HE1A 2R3LA 3CC6A 4RFYA 2ZMCA 1YHSA 1MRUA 2HCKA 3CY2A 4WUNA 5B2KA 3LCDA 2ZDTA 3QLFA 4Q5EA 5HU3A 4IX3A 3U9NA 2R3MA 3TACA 3EQDA 1KV1A 2B55A 4O6EA 4UY9A 3R7OA 5KMOA 2R3QA 2OI4X 3E88A 3ZM4A 4HZRA 5ITAA 1YVJA 3NLBA 4ZSJA 3OOMA 4PTCA 2R3PA 5EI8A 4ZLYA 2WQNA 1KE9A 4YZCA 3OFMA 4CLIA 1K9AA 2XUUA 1RJBA 2C5NA 3VUKA 1ND4A 2VTHA 3ORIA 2UZNA 4S32A 1XBCA 2JDTA 4QMNA 3DB8A 2HELA 2WO6A 5M51A 5L2QA 4YJQA 4TWOA 2Y9QA 1ZXEA 1OIRA 4S33A 5LVPA 3OBJA 2QLUA 3ELJA 4FL1A 3HX4A 3ZFXA 4D4SA 2J4ZA 3NAXA 3TV4A 3K5UA 4U41A 2UVXA 2WMXA 3CQEA 3PWYA 2XJ1A 2VTQA 2DQ7X 5FM3A 2B52A 2O65A 3THBA 5CSXA 3MFUA 3OZ6A 4LGDA 3MSSA 5ANEA 2IW6A 4LOOA 1XH9A 4LGGA 2XK3A 2C3IB 3V5LA 4EKKA 5GHVA 3DV3A 4YLKA 5DWRA 1IA9A 5A3XA 4CYIA 4KWPA 2Z60A 3HAMA 1Q41A 4AX8A 1RQQA 1SMHA 4IADA 4EYMA 5CF6A 3CTJA 4RVTA 3MWUA 3ITZA 2YM7A 5AUVA 3EQPA 5JFSA 4X0MA 4MD9E 4NZWB 3W2OA 3TNPC 3RHKA 1FMOE 2EXCX 2G15A 4RIWB 3ZRKA 5KX8A 3ZFMA 3KL8A 4W4WA 2X8DA 3POOA 5CLPA 5ANDA 3R8MA 4FKRA 3NIEA 4DC2A 3VUIA 4I1ZA 2W5AA 2BFYA 3D5UA 3VS6A 4M13A 3G90X 5KBRA 1VZOA 4OTWA 3COMA 4ANBA 3QGWA 3TUBA 3EQBA 4NW6A 5K5NA 1NW1A 4FIEA 1AGWA 1GIJA 2CLXA 2X2MA 4IX6A 2WOTA 3DY7A 2WHBA 5AM6A 1DI8A 3BGZA 4K1BA 3ZH8A 3BKBA 3AD4A 5HNIX 2OJJA 1Q8YA 4YJNA 5AP4A 4CT2A 4O7WA 3Q6UA 3MFSA 1WBPA 3HV7A 2YIRA 3Q96A 3VF9A 4D58A 3SOAA 2ITPA 5EQEA 2HZ0A 2BILB 5BYZA 4F08A 5A54A 1J3HA 3KXXA 3RK9A 2R3JA 5EYKA 4PMPA 5AEPA 4Z3VA 3R04A 4O81A 3D2IA 4JG7A 4LL5A 3EFJA 3EOCA 4OBPA 4Z7HA 1WBNA 2RKUA 5DFPA 5CENA 4CQGA 2B0QA 3CR0A 1PYEA 3ZYAA 4ZSGA 4A9UA 3C5UA 1OL6A 4QTDA 5IEVA 3V5WA 4UMPA 3ID6C 2XCKA 3WE8A 3QZIA 4FOCA 5I9YA 2PUPA 3PPZA 5CI6A 4DEIA 3E8CA 5FXQA 2FH9A 5A14A 3G6HA 4R7BA 2ACXA 4AP7A 5IQDA 4HZSA 1XH6A 2VU3A 3B2WA 5AP3A 5ETFA 2J51A 5LOHA 2OZAB 5AUWA 1U54B 3LJ2A 2VAGA 2R3OA 4D4VA 4E6CA 2B7AA 2J5EA 4PMMA 4JIAA 4X2GA 3UNKA 3CGFA 1H1WA 4E4LA 3F3WA 4GRBA 2ITTA 3G6GA 4EQMA 4FZ6A 3UQCA 4DCAA 2P33A 4IZYA 5A4TA 4F7LA 4PF4A 2IG7A 4B6LA 1IASA 3FC2A 3FI8A 2QOIA 4P5ZA 2WTIA 2W4KA 4XOZA 4R77A 4DFUA 5G1XA 3I6UA 2I0YA 5CSWA 2CGXA 2YDKA 5AIRA 4DHFA 4DINA 5DBXA 2IPXA 3KCFA 4GSBA 2QKRA 4D1XA 2JLDA 5FTQA 4XS2A 4GV1A 4YPSA 1U4DA 5J5SA 4FV5A 3OY1A 1M2QA 3BHYA 3AD5A 2WQMA 3QTIA 4F6UA 3P79A 4IVBA 5C4LA 4QYEA 4RIYA 3NYXA 1WAKA 3O0GA 3DK6A 4QMPA 4FV1A 3DQXA 4ZY6A 2BHEA 3A61A 3QKKA 4IZ7A 4KBCA 4MH7A 1H0WA 3JS2A 2P55A 4P2KA 3T9IA 4PDSA 2UV2A 4PPAA 2J0IA 4M66A 4GFMA 1H0VA 3O96A 1NVQA 3O8UA 5HEZA 3KK9A 4NYEA 2J0MB 3JY9A 2A0CX 3KU2A 3NNWA 4RJ3A 5A6NA 3SA0A 2BKKA 4EORA 1KE6A 4BCIA 4CZTA 4LRMA 5DI1A 3UZRA 4CMTA 4BBFA 2CKQA 4CT1A 1PXLA 3VQUA 1DAYA 3NUPA 3R8LA 4O7VA 3ZLXA 2W17A 4DH3A 4NWMA 4A4OA 3M42A 5IKWA 2IVUA 2VTMA 4E4MA 5HVJA 3MFRA 2WIPA 4TYEA 3SLSA 2E9UA 2XRUA 4G9CA 1W98A 5E8UA 5M55A 4DBNA 5DR6A 5B7VA 3QFVA 2XNPA 4MVFA 4V01A 4MF0A 2OW3A 3A62A 3KXHA 5CF5A 5H8BA 4FNYA 3AMBA 4K33A 2GU8A 2YN8A 5CS6A 1FBNA 3LQ8A 1PHKA 5D9HA 3WARA 2PVJA 2XIRA 1Y91A 5HE3A 4C4FA 3HRFA 2XM9A 4OLIA 4PDOA 4L9IA 1Y57A 2J0JA 3UMXA 3AGMA 3LVPA 4CXAA 3W55A 1OBGA 1UU8A 4IAFA 4M69B 4G17A 4IB0A 4KIKB 4CTCA 2VWWA 2WMUA 4IE9A 3C51A 5HQ0A 3BYVA 4A9RA 4DFXE 3OMVA 4KUJA 4CLJA 3GCQA 2XEYA 5DEYA 4ZS0A 4IVCA 1NY3A 3WIGA 5IEYA 1PXNA 1FVVA 1FMKA 2PE0A 3EIDA 1ZOGA 3QUEA 4NTSA 5HVYA 4QMZA 4PP9A 3KY2A 3QHRA 5HTBA 3BHVA 5I9ZA 4KAOA 3QQFA 4AGDA 2UUEA 3R7VA 1WVXA 4TNDA 4IWPA 3FI4A 5C1QB 3QRIA 2C30A 2YM3A 2FA2A 4FTAA 3ZDUA 1H4LA 4C61A 4CMUA 2J2IB 2JGZA 4RX8A 4ACMA 4TN6A 1B6CB 2VO3A 3PXFA 5M4FA 4E4XA 2W5HA 4I5PA 3WYYA 3TJCA 3EYHA 2UW7A 5D1JA 4ERWA 3S0OA 2QQ7A 3UVPA 4QMSA 3Q60A 2Z7RA 5HTCA 5K5XA 4Z7GA 5JRSA 4PNKA 3TUDA 1PKDA 5TOZA 3A7HA 2J7TA 3CD3A 3Q2MA 3UYTA 3T3VA 5JRQA 3PA4A 4IZAA 4QOXA 3ROCA 4OTFA 3ORXA 5CT7A 3IK3A 2DS1A 4QMVA 2Z2WA 5EOBA 4WNOA 3RNYA 5AUUA 3S2PA 3Q4CA 4JRNA 3Q4TA 4QMOA 4FUYA 4NFNA 3LFQA 4GFGA 3NW7A 3TKUA 4L52A 3VC4A 4BWPA 3NNVA 2Y0AA 3PE2A 3P78A 1W82A 3U55A 2YAKA 3RAHA 3WF7A 2HWOA 3QQUA 5DOSA 1XQZA 3NCGA 5T3QA 5C8NA 5I4NA 4XYFA 3TTJA 3L9LA 3EFKA 3M2WA 4YZDA 5E8VA 4QP8A 4EK5A 4E93A 4DT8A 4ACCA 3SAYA 2PZRA 3H9OA 4PX6A 4HPTE 4UX9A 2YCQA 3VO3A 4RGJA 3RBWA 2XYUA 3PG1A 3VS4A 4FEUA 3ZZEA 2XBAA 3NMUF 4BFMA 2ZM1A 5T68A 4PQNA 5GINE 3Q9ZA 3KK8A 1ZYJA 4FYOA 4D1ZA 3I81A 3ZONA 4UMRA 2GNIA 4F9BA 1BL6A 3QC4A 2PSQA 3MB7A 5CVFA 2RFDA 2HK5A 3GOPA 4HYHA 1ZYSA 4Q9ZA 4FVRA 3KA0A 1A48A 3OWPA 4MCVA 4EH3A 5HNGA 3GQLA 3DNDA 2W4JA 3R9RA 3VUTA 4Y72A 3P7BA 2WXVA 2V55A 3PWDA 3VRYA 3S95A 3O7LB 3LQ3A 5E4HA 4IVAA 1H1RA 3QU0A 1KOAA 3CCNA 5DRDA 3OCTA 4LUEA 1F0QA 4FKPA 3PE1A 2WFYA 2ERKA 2C0TA 4R7IA 2X4FA 2OFVA 4X7QA 4DG0E 5HD4A 5J1VA 5CEKA 4DFYA 4QMTA 5C26A 4PPCA 5IA3A 5BYYA 3LCSA 4LMNA 5BVOA 4CFVA 3UOHA 3DGKA 3IDBA 1P4OA 3NNXA 4EC8A 3MESA 2G1TA 2QONA 3ZM9A 2J50A 2PMOX 4X2NA 4J95A 4RFZA 3I6WA 4G5PA 4XOYA 2G9XA 3L8SA 1SNUA 4WOVA 1UVRA 5HG5A 2PUNA 3AC1A 3PP0A 2CKEA 2Y8OA 4YZBA 2JKKA 4HVGA 4O2PA 2WNTA 3ZLYA 4YJPA 3AC8A 4O0XA 1TKIA 2XNMA 4TW9A 3DXNA 5AUTA 2XRWA 4XCUA 4PL3A 3V8TA 3V8SA 3PDTA 3LCTA 5HNBA 3P0MA 3LMGA 4GFOA 5ANJA 1WMKA 3H3CA 3BLHA 1VYZA 4XV3A 4D2RA 4FEXA 5KMMA 5HG8A 2EB3A 3OEZA 5IMEA 3ACJA 3T9TA 4BDFA 4C3RA 3WF5A 4L7FA 4C02A 4DF3A 1PMUA 2IO6A 3KFAA 4O6LA 3RKBA 4R7HA 1PXIA 2ETRA 3KREA 3Q3BA 3KRLA 3LXLA 2V62A 1KWPA 4O0UA 4NM0A 5KHXA 3CQWA 2W1GA 4LQMA 3GT8A 2WQEA 3ZLWA 3LAUA 4EOOA 2CPKE 5EYMA 2YACA 4FSTA 3W2PA 4PP7A 4F9AA 5HIEA 2A2AA 3GEQA 2B9FA 3AC5A 3GCUA 4FZFB 4WBOA 2CGWA 3GBZA 4GH2A 3PPKA 4GU9A 2PMLX 3A2CA 4EONA 3KRRA 3GI3A 1O6KA 3E62A 3TZ9A 3R8ZA 2Y4PA 4AE6A 1BI8A 5CY3A 4DH7A 1H08A 4Z9LA 2P4IA 2UVYA 3MPAA 5AV2A 3KULA 3GXLA 3BU6A 3V5JA 2G01A 5DNRA 3DXQA 4ITIA 4FG8A 4MBIA 3V04A 4PY1A 3WZKA 5IU2A 4U6RA 2Z7SA 3OT3A 4H3PA 3D7TA 4A06A 5BX0A 2PUIA 3C0IA 3G0EA 1SM2A 4YHFA 4PWNA 3UIUA 1NVRA 5M53A 3CD8A 4FKLA 4KS7A 4TY1A 3L8XA 4P90A 4L45A 3TZ8A 3LLAA 1PXKA 4M0YA 4A7CA 2QKWB 2C6MA 2OWBA 3ORPA 4P7EA 3RAKA 2V7AA 3IDCA 4UWYA 4AZSA 1OPLA 3ALNA 4ZTQA 3LM0A 3UTOA 3NNUA 2C0OA 3EN6A 4DITA 1QPJA 3F66A 3NYNA 3QQGA 3PA5A 3EMGA 4ZAUA 4AU8A 4C2VA 4HVHA 2C5YA 4O2ZA 3ZLSA 5I9WA 4FZ7A 4JDHA 5IQCA 2R3IA 1UNHA 5E8ZA 4RBLA 4XG8A 5IA4A 1LEZA 1UKIA 3RPOA 3E63A 4M68A 4FV2A 3FMKA 5TE0A 3HMOA 1UNGA 5K4JA 3FYJX 4F0IA 4RA5A 3E3PA 5D41A 4F63A 2CGVA 5CEQA 1XWSA 2B9JA 3HMIA 1P2AA 3R02A 4K0YA 3TIYA 4BDIA 2B9IA 1BLXA 4A07A 4AZVA 4DFNA 1PMVA 5KZIA 5CAOA 4IIRA 5ANKA 2IZTA 4IX4A 2W05A 3HP2A 2E2BA 3GNIB 4FICA 3WI6A 4QO9A 4DEEA 5C8KA 2C6KA 2VRXA 2UZTA 4ZLOA 3UC4A 3BE2A 5FBNC 3TL8A 4O7TA 3DJ7A 3VBTA 4D28A 2GQSA 4I6QA 1YXUA 3O50A 4L3JA 2W4OA 4V05A 4NU1A 4JDIA 4OR5A 5LMKA 3N4VA 4YURA 3H4JA 4V0GA 4ZXTA 4QPSA 4NL0A 2XJ0A 5GIPE 5E8XA 4C4GA 1W84A 4YUQA 1Y6AA 4E1ZA 3H9FA 5BUIA 3VNTA 3NEWA 1DM2A 1FVRA 4IDVA 3OF0A 1JKSA 1JBPE 3QA8A 4QTEA 1UWHA 3BLQA 4MX9A 4BDBA 4U44A 2DUVA 1IR3A 4FKUA 4QQCA 3VBVA 4FR4A 3UIBA 5EI6A 1IAJA 4EOPA 3C1XA 3HLLA 4RJ8A 1YI4A 4JDKA 3DB6A 4MD8E 3O8TA 1HOWA 2WTKC 2W0JA 3VS5A 3LKMA 5DHJA 5KHWA 3KN5A 4GCJA 3IOKA 4XV1A 2F57A 2ZAZA 4I93A 3W8LA 4M0ZA 4BIBA 2QOOA 2YM5A 3E8DA 3JXWA 4QYGA 4TTHB 4X21A 3ANRA 3HA8A 3LFFA 1OL7A 2WIHA 4AW1A 2C5XA 3MVLA 2YJSA 3QC9A 2PZYA 2WU6A 4RZVA 5ETIA 5CX9A 2Q0NA 4B0GA 4EWQA 3RZBA 3CY3A 2R3RA 2BRNA 4QMQA 4I5MA 2V5QA 3VUDA 4GKHA 3Q6WA 5FEQA 2XVDA 4FKJA 4MKCA 3W2RA 4EHVA 4AF3A 3FLSA 1P4FA 2W9ZB 4CFFA 3E3BX 3OXZA 5FTOA 2PE1A 1MQBA 3CXWA 3KXGA 5EKNA 1PXPA 5IISA 2XS0A 4G3EA 2IW8A 3L9PA 4ACDA 5IUGA 3OEFX 3V3VA 1OGUA 3UJGA 4F1TA 2QOQA 3TUCA 2BRGA 3FHIA 2OK1A 3MTFA 4WA9A 4RC3A 3PVWA 5E7RA 1XH5A 4DLJA 1UU3A 4L46A 4BWXA 4EOQA 4C57A 3F3VA 3HYHA 5EHYA 5CF8A 1TVOA 4TXCA 4UXQA 1YXVA 4F64A 3NDMA 3R83A 1X8BA 4EOKA 5LVOA 4PUZA 3QTWA 5CI7A 3RM6A 2CNQA 2CNUA 4FK6A 2W7XA 4W4XA 4LGHA 4DGLC 4H3BA 4QQ5A 4JAJA 1E9HA 2XK6A 4C4EA 3NR9A 4DYMA 3EJ1A 4HVDA 2QO7A 5CSPA 5M4UA 1BL7A 4KRDA 1Y8YA 1JAMA 1IA8A 2WGJA 3CQUA 3D0EA 5E9EA 5D7AA 3PVGA 2QHNA 4IDTA 4ZTNA 2ZMDA 5FXSA 4FV4A 2BCJA 3RWPA 2YZAA 5IQEA 3MYGA 1JSUA 3TNQB 3CE3A 3GC0A 3GU4A 2OGVA 2PVMA 4QPMA 2RFSA 4XG4A 5EG3A 1WBSA 5HO8A 3RPSA 4AAAA 4ANMA 4FT5A 2CCHA 4OUCA 3U6HA 4FV8A 1J1BA 4TYHB 3CBLA 4BI0A 4ZZNA 5AX3A 3WF9A 2EXMA 2ZM3A 4M15A 3UNZA 2YABA 4XJ0A 4AN9A 4B8LA 4AW0A 4GK3A 2IZRA 5G6VA 2VWIA 2F49A 2VX1A 5CU3A 2PU8A 3PXYA 4FF8A 4NM3A 1JSVA 4LRKA 2O0UA 4L01A 2ESMA 3BYUA 3DLSA 4KRCA 4M97A 1Q8TA 3PG3A 4PRJA 3BWFA 2WB8A 4DGNA 4O0RA 1CMKE 2QURA 2YWPA 4S31A 3FQSA 2GQRA 4ZTSA 4FA2A 3QD2B 1YOJA 5CEIA 5GIOE 4RVMA 3ZC5A 3BCEA 4NW5A 3I0OA 4IXPA 3R9DA 5J7HA 4D2PA 3ZZWA 3H30A 2YCRA 4RWLA 5JK3A 2V0DA 3R0TA 3I5NA 5IUIA 5JQ8A 2ZOQA 2GFSA 4ZEGA 4ZSAA 4FTCA 1XH8A 2FO0A 2VWBA 2WQBA 4F70A 1TQPA 3TZ7A 3QL8A 2Y6OA 4FEQA 3UPZA 2RL5A 2C6DA 3K2LA 2OF4A 1KUTA 4E26A 3P08A 3TCPA 5LWMA 5H8EA 4B7TA 2ZV2A 3LFAA 3QYZA 1XJDA 3DU8A 3RVGA 2R3KA 3FV8A 3ODYX 5L6WL 5E1SA 4IFCA 4WG4A 3TN8A 3TXOA 5AWMA 4J1RA 5K9IA 2FB8A 2C1AA 5EFQA 2ZV8A 1KE8A 1YQJA 2QOFA 2BMCA 5CU6A 2VZ6A 4NJ3A 3F7WA 2ITQA 4N0SA 4EOIA 3SXRA 1I09A 4F4PA 3F9NA 5ACBC 5DH3A 3GU6A 3VAPA 1NA7A 5AUXA 4C4JA 3EFWA 3VS3A 5L6OA 2PE2A 4JRVA 3R01A 5AP1A 4L44A 1PF8A 2WTVA 5HTIA 3POZA 3IW7A 4F65A 3GC7A 2VV9A 3QUDA 3IG7A 5DYJA 4Y5QA 3R00A 5A9UA 2NO3A 2RG5A 4WNMA 2RG6A 2WMBA 3LIJA 5FDPA 3I7CA 1W0XC 3OWKA 4F1MA 5EM8A 4AZEA 3Q52A 3FI2A 3U4WA 4AA0A 1ZMWA 3UP7A 2F7ZE 2QOCA 3Q9XA 3PY0A 4TKSA 1V1KA 5AAEA 3KXZA 2OJGA 3VULA 3PJCA 4DT9A 5IQHA 2W06A 4YZNA 4ANNA 4BCMA 4FYNA 4EHZA 5FWKK 5BVKA 5FTGA 4EQUA 3O51A 5AP0A 3NCZA 5HESA 4TWPA 5CAVA 4UALA 3Q53A 4FG9A 4ASZA 4KIQA 4DGMA 3A4OX 3NYVA 5BPYA 3ORTA 3HEGA 5HIDA 4F0GA 4EZ5A 2QI8A 4E3CA 5J79A 5DR2A 2GNFA 2YLEA 4O83A 4LYNA 2QHMA 2RF9A 4EWHA 3R28A 4RJ7A 4WSYA 3QCYA 4YO6A 3PJ3A 3TT0A 3FBVA 2ZYBA 4C7TA 4OAUC 3WBLA 2Z8CA 5A46A 1GAGA 3FMLA 3TNHA 3MTLA 5JZJA 1VR2A 3VS0A 4D4RA 4PMSA 3QAME 2OU7A 2EU9A 3W8QA 4ASDA 5FP6A 3SOCA 3ZU7A 1SZMA 1AQ1A 3ZTXA 1QPEA 3C13A 4EBWA 4USEA 5IZFA 2UZVA 5DVRA 5IDNA 5DMZA 5JFWA 5HCYA 4ZS4A 2CHLA 5I3OA 1Q3WA 2I0VA 3N51A 3V8WA 2YDIA 3DJ5A 3FLZA 4FTIA 2Z02A 4U9AA 4QTCA 2WTDA 3HKOA 3KB7A 4S30A 4M14A 4O7YA 4YSJA 3ZO2A 1J7IA 5AP6A 3OTUA 3R30A 3E64A 3HRBA 3NAYA 4NCTC 3VN9A 4NH1A 5TO8A 3HA6A 4A4XA 4RIWA 1JPAA 4Y83A 2XH5A 1R39A 1JQHA 2Y4IC 1BYGA 2JBPA 3R63A 1H1SA 3WF8A 5HCXA 3O2MA 3KRXA 4OTRA 3RPRA 4E5AX 5CZHA 4DCEA 3LHJA 3PVBA 3QA0A 2XKDA 3PXQA 4GG7A 4U5JA 3DTWA 5H9BA 2VUWA 4FEVA 3FLWA 5DE2A 3UOJA 3GU5A 4O22A 3DBEA 4N6ZA 3LFCA 3BV3A 3UVQA 2C3JA 4D4YA 2WQOA 4QMUA 5AAGA 4I21A 4AW5A 3NZ0A 4QP2A 3ZXZA 3GOKA 3BU3A 4WRGA 5LVMA 3OG7A 5BQ0A 3UIXA 5L2TA 4BCPA 2BRMA 3F5UA 3QXOA 3MGYA 4WD5A 3D9VA 3VRZA 4FSYA 4D0XA 1J7UA 3BBWA 3K3IA 5AUZA 4ZK5A 4YHTA 4ZSEA 4DBXA 3AMAA 5M57A 1ZYCA 4CSVA 4ARKA 5IQBA 1V0PA 4L43A 3FKLA 4HPUE 5CU4A 5AIKA 4BF2A 1F5QA 3QGYA 2I40A 3ZSIA 2OFUA 5A4CA 3IW8A 4F9YA 4ZMFA 5ANIA 2G2IA 2GNLA 2HY0A 2B9HA 5EYDA 5GJDA 4MQ1A 1K3AA 4HGTA 4EKLA 1Q5KA 5KMKA 4FIIA 4A9SA 4A4LA 1ZLTA 4AGWA 5CASA 3W18A 3AQVA 2PVLA 4H36A 4YZ9A 2A27A 3ZDIA 2JBOA 2X8EA 3V5QA 3O7LD 4N4SA 3KVWA 5LMAA 5IQAA 2UZOA 5GZAA 5CAUA 5LVLA 4CVAA 5DN3A 2FUMA 3ACKA 4R8QA 2XKEA 5AX9A 4F7SA 4O0WA 3ZBXA 4C33A 4EH7A 5KKRC 4IW0A 4RIOA 3RAWA 4B99A 3R9OA 1H07A 4FV0A 2C3LA 4ALWA 5LWNA 4IC7A 4RA4A 5I0BA 2JDRA 4K8AA 3CTHA 3F2NA 3F3TA 4G1WA 5L2WA 4KKGA 5H3QA 3C4ZA 3QX4A 4BN1A 1Q4LA 2BVAA 1PY5A 2E9OA 2VGPA 1GZNA 4IWDA 4DTAA 4RX7A 1OUKA 1KV2A 2BALA 3QTZA 4U43A 4FMQA 1NVSA 2HIWA 4EK8A 4R78A 3HMMA 2VWYA 4OT6A 3MJ2A 2WTCA 4I24A 4ONAA 4APCA 3MDYA 3DKFA 4BBMA 4RIYB 4E7WA 4R5YA 3H0YA 1Y6BA 1F3MC 3BEGA 2JC6A 4M12A 4JT3A 4XNEA 3GP0A 4HJOA 5JFVA 3A99A 3R1SA 2P3GX 2F7EE 5D12A 1ZY5A 4MXZA 2ZB1A 4BCGA 3NW6A 2YM6A 2EB2A 5JGBA 4ENXA 5EM7A 3PUPA 5EDQA 3TZMA 3ZCLA 4BI1A 3MA6A 1PXOA 5EHOA 2NRUA 4AXAA 1YRPA 3GFWA 5IQGA 4JOAA 3ANQA 3G2FA 2ITNA 3QYWA 1O6LA 4RRVA 4FSUA 2JFMA 1UA2A 2NRYA 5AR8A 1Z9XA 2UZEA 5J95A 3PLSA 2FVDA 3CP9A 1ERKA 4C2WA 4WT6A 2OJFE 5LMKC 5EKOA 4FKQA 3BX5A 3KMUA 1ZAOA 2CJMA 2YJRA 2XCHA 3F2AA 3QWKA 4HYUA 1H01A 2ITWA 5M44A 4AWIA 2V7OA 3HMNA 4LUDA 3UQGA 4DGOA 1UKHA 3BPRA 3DAKA 5EW8A 3TWJA 4KBAA 1VJYA 4JI9A 4UBAA 5C27A 4AA4A 4BTKA 3RCDA 5FP5A 3G15A 3CKXA 4UXLA 3UZTA 4FTTA 1OIQA 4EOMA 3P1AA 3DPKA 3KCKA 3QTRA 3MI9A 5E90A 3W1FA 3C0GA 1TQMA 2VNYA 2VD5A 3DBQA 3FAAA 3SG8A 1XBAA 1OIUA 4FIFA 4KBKA 3MY1A 4BVUA 3TM0A 3TDWA 3UYSA 4D55A 5TT7A 2XKCA 4GUBA 1J91A 4C35A 4P4CA 1JNKA 4JBQA 4F9CA 4D0WA 2GQGA 4R1YA 5CXHA 1M2RA 2JIIA 4MXXA 5J1WA 4IC8A 1YXXA 4FK3A 4GIHA 4USDA 2QR8A 2BHHA 4CNHA 4IM3A 4X3FA 3BBTB 4JBVA 3E8EA 5F20A 1A9UA 1DAWA 4O82A 3GC8A 4I0TA 3DDPA 4AZWA 3ROYA 3SXSA 2JIVA 3HP5A 4KSPA 5C4KA 3R8VA 5A6OA 2AC5A 4NEUA 3DAEA 3SHEA 3QHWA 1KOBA 5FRIA 2O63A 1QPCA 3FJQE 4DH1A 4IEBA 3M11A 3EQIA 1OB3A 2PZIA 2CDZA 3D15A 5HBHA 3V6RA 4EH9A 3WILA 1FPUA 3EQFA 5EDPA 2QG7A 3Q04A 3PY1A 5ANOA 3ZMMA 4CCUA 3QZFA 4Y5HA 5J8IA 2BZKB 1PMEA 3I0QA 4IM0A 3IW5A 4F6WA 2CN5A 4ZY5A 1R78A 4WSQA 2WEVA 3BHHA 4EH8A 4YMJA 4BZNA 2BDFA 2JIUA 3SDJA 1KSWA 2YM4A 4QMMA 3UG1A 2HWPA 3IQ7A 4FV6A 4H39A 4OW8A 1PKGA 5EOLA 5M08A 1PYXA 4I4FA 2GHLA 2YCSA 3AT2A 3ALOA 4YJRA 4YHJA 5E91A 3ENMA 2QD9A 3QQJA
chains in the Genus database with same CATH superfamily
2GS7A 4L3PA 3D2KA 5CNNA 4BZOA 2XNOA 3GENA 5EK7A 2E9PA 3FXWA 1B38A 3QCXA 4M67A 4MNEA 5H2UA 5T6KA 3UMWA 4B4LA 5L4QA 4O7RA 3W0OA 4E5WA 2OZOA 4FSWA 1IAHA 1Q8WA 3HZTA 3Q4UA 5TR6A 1E1XA 4JR7A 2IVSA 1YDRE 2YLFA 3BL7A 5AMNA 3MN3A 4ZZMA 1IG1A 1KE5A 4EUUA 3U54A 3RPYA 5D10A 2BROA 2VNWA 4YC3A 5AM7A 3MW1A 3EL8A 3R7GA 4QYYA 2I7QA 5IQIA 4BJJB 4CGAA 2C0IA 4UZDA 2IWIA 4BCFA 1GZKA 5GJFA 3QRUA 5IH4A 4PNIA 2PPQA 3NUAA 3ZO3A 4BWKA 4EBVA 3VBWA 3ZUTA 1OUYA 3QRJA 1S9IA 3D83A 3R71A 4FX3A 4JIKA 3W0QA 2IJMA 2FGIA 1CTPE 1QMZA 4XP0A 5AR2A 2VWZA 4BB4A 4E4NA 4ZTMA 1M14A 3DK7A 2LGCA 2OH0E 4NCTA 5ACKA 3R7YA 1YHVA 5KMJA 1FGKA 4U81A 2HYYA 4GYGA 4JQ8A 3F5GA 2W1FA 4FTUA 2X0OA 4GIIA 3VBQA 3WZJA 4I94A 2EVAA 2CGUA 4FIGA 5BMMA 3QX2A 2OIBA 3FHRA 4BL1A 3R7UA 4RIXA 3RP9A 2PHKA 4Z16A 4XG6A 4DEDA 3BGPA 3AGLA 4MXCA 3Q9YA 3F2RA 3PSBA 3QTQA 5LXMA 4J97A 1YKRA 1GOLA 4MHAA 2WELA 4W8EA 5LARA 3ZSHA 4FSZA 1WCCA 4M8TA 4C0TA 3Q5ZA 4EK4A 4FVPA 3PJ1A 1XR1A 3FZOA 4FSMA 3VBXA 4DAWA 4QD6A 5AR3A 4O91A 2H9VA 3RINA 5BNJA 4JG8A 3T8OA 4N70A 2C5VA 3TNIA 2GTNA 4TT7A 3DS6A 4C59A 3MVJA 3OXIA 3UOLA 1WBWA 3FMNA 1G5SA 2Y7JA 5FQDC 5IA0A 3PLAE 4LV5A 4L3LA 3LJ1A 4D9TA 4GK2A 2PVNA 4EH4A 2ZV9A 1GY3A 2B4SB 2BRHA 2GS6A 3PZEA 4G9RA 4HCUA 4J53A 4QTAA 2WMQA 4H58A 3VS2A 3B2TA 4GL9A 3OOGA 3NYOA 1JKKA 1ZY4A 3F5XA 4QPAA 2PTKA 3VIDA 2X2KA 2VWUA 4MBLA 3FUPA 3R7EA 2XK7A 4Y73A 2YITA 3UO4A 4RG0A 4EHEA 5CT0A 4O21A 5HLNA 5IEXA 3D4QA 3GB2A 3NUUA 2QNJA 2IZUA 1LEWA 4WNKA 4BDKA 4BGHA 4ZSLA 4D5HA 3VUHA 2CLQA 2IVTA 4C37A 3LCOA 4OTDA 5DGZA 2BDJA 2ONLC 2YISA 3FL5A 3HVCA 3KULB 3FLNC 2X1NA 2QVSE 3C50A 3ETAA 3NW5A 4IMYA 4O7SA 2WMWA 5AV0A 4O1OA 3FKOA 3ZO4A 3DKOA 4TPTA 4D9UA 3FDNA 5KKRB 4IAZA 3LJ0A 3D7TB 5D11A 5KNJA 4FKOA 4G3CA 1QL6A 4A9TA 4C4HA 3HV4A 3ORMA 1URCA 5I9VA 4EZ7A 3RTPA 5TKDA 3VW6A 2QOKA 1R1WA 4L6QA 1MRVA 4G5JA 3WYXA 5EQYA 2FYSA 3W0PA 2J0LA 4EK3A 3P4KA 5GNKA 1TFFA 3OY3A 4IB1A 4KKHA 2XK4A 3PIXA 3C4FA 3TIZA 4JG6A 2ITOA 3F3UA 4CRLA 1PRYA 3D5WA 1VYWA 2XNNA 2ITYA 5I9UA 2C68A 4I6FA 5C8MA 3WE4A 5HI2A 3UNJA 2FSTX 1JLUE 3OUKA 4AT5A 2QODA 4FTLA 4FE2A 4FUXA 1KE7A 2NPQA 3Q2JA 4FODA 3D14A 2UZLA 3IGOA 3FE3A 4QDVA 5C01A 2R5TA 4LOPA 2VGOA 5BVEA 4IX5A 3CSVA 1GNGA 1GZ8A 3PIYA 4ANSA 2UW5A 4YTIA 4AT3A 5DT3A 4NIFA 1MUOA 4FNXA 4TNBA 4DEBA 5HCZA 2ETMA 3LXKA 1QCFA 4Z55A 2UW6A 2WAJA 2UVZA 4XG7A 3SG9A 4U3YA 4G3DA 5DG5A 4OTIA 4XRLA 4AN2A 3QKLA 4QP4A 1TQIA 4YGAA 3WIKA 2X2LA 3KXNA 4AT4A 4RWIA 4MTAA 4UMTA 3R8UA 4C58A 4EI4A 1ATPE 2JD5A 3U6JA 3ORNA 3I7BA 1LR4A 2Q0BA 4V0GB 4XMOA 1YI3A 4H1JA 1P14A 4EJ7A 1Y8GA 2HXLA 5AFVA 3U8WA 4FI1A 3KEXA 5CF4A 4YTHA 5BVNA 4QDEA 2PVYA 3W16A 4TWNA 2PMIA 2OH4A 3CLYA 5KO1A 3S4QA 2YZLA 3B8RA 5LVNA 3I79A 4K18A 5JZNA 1WBTA 2ZB0A 1NT2A 2G2FA 2R0UA 4DEGA 1OL2A 3PA3A 5F94A 3FI3A 4IAIA 4RFMA 3K5VA 2B54A 3AC4A 3OBGA 3LFBA 4FSQA 4ZY4A 3K54A 4O0YA 4HNFA 5B2LA 4BDHA 3OWJA 4ZOGA 3IGGA 3MB6A 4FZAB 2RIOA 5F4NA 3V5TA 2JDOA 1GZOA 4YLLA 1YWVA 3ULIA 4XUFA 1RW8A 4BY9E 3D94A 1G3NA 3C5IA 3KKVA 4RLKA 4XH6A 5HORA 1Z5MA 4IAYA 4D2TA 3SRVA 2XK8A 4E5BA 4ANQA 4YBKA 2X4ZA 1URWA 3DKCA 4GEOA 4LV8A 3FSFA 4WIHA 4PDYA 2VTRA 1YI6A 5HG7A 4LG4A 4F0FA 4O7NA 3R2BA 4S2ZA 4IWQA 4RVKA 1M17A 4OAVB 2WMVA 5IUHA 5CQUA 3RNIA 5J7BA 1OL5A 3ZS5A 3F61A 4MAOA 5J9LA 3O17A 5LCJA 3OXTA 2BDWA 2I0HA 3C4WA 4GT5A 1E1VA 3E87A 2PULA 3TMOA 1V0BA 3I60A 4IAAA 3RJCA 2C6TA 3TG1A 3O23A 3L9MA 4R3CA 1OM1A 2W1HA 1G8AA 4L8MA 4ALUA 2DWBA 5HVKA 3EFLA 3MH0A 2EWAA 4Y46A 4C3PA 5BUEA 1H27A 3KRJA 2JFLA 4GJ3A 4TL0A 4PPBA 3R1QA 2KULA 4I5HA 5HHWA 2HZIA 3JY0A 4X2FA 4XV9A 2HAKA 4L53A 5FDXA 2VN9A 2WMTA 2XNGA 3A4PA 3PVUA 4NTTA 2VTSA 4U79A 4ZP5A 1YHWA 5DRBA 5KZ0A 3SC1A 5GZ8A 2C4GA 1H8FA 3QTUA 4X6QC 1CSNA 3UOKA 1ZRZA 2XKFA 5HE0A 3AT3A 3MH1A 3QBNA 4EL9A 2XALA 5EHLA 4QP3A 2A4LA 3UGCA 2HW6A 3BI6A 3DA6A 2YIXA 2QOBA 4CTBA 4KSQA 2BR1A 2J90A 3NVMB 3C4XA 4QNYA 3ZFYA 4BYJA 2JITA 2BAKA 5F9EA 4I41A 4JS8A 3HRCA 1ZARA 4UYAA 3ENHA 3FZPA 3KRWA 5I3RA 2BZJA 2XNEA 5AP7A 4CFXA 3MA3A 5AA9A 2W1CA 4QRCA 5AADA 5C9CA 3DZQA 5J5TA 4R5SA 2CN8A 4B9DA 2A19B 4QMLA 3EL7A 2IVVA 2C3KA 4F7JA 5CNOA 5AUYA 4BKYA 5IH5A 2QOLA 3NIZA 3KMMA 5CVGA 3OW3A 3KC3A 3LW0A 5LJJA 4NSTA 4LI5A 4PL5A 4TYGA 3EB0A 3BQRA 3LFEA 3AKKA 3QD3A 1T45A 3E93A 2UZBA 2WTWA 4XV2A 4ZTHA 2ITUA 4FVQA 2C1BA 4CFWA 1SVEA 3P23A 4RZWA 2QR7A 3GQIA 2P2IA 4APPA 2CMWA 2R64A 4CG9A 1IEPA 3CS9A 3COKA 4CEGA 2AUHA 1U5RA 2J5FA 2YA9A 3QWJA 4OTQA 4TRLA 5GZ9A 4ANLA 2ZFYA 2QO9A 2CSNA 4PTGA 4BR3A 4O0VA 4BGQA 3ZUVA 3VVHA 2XIXA 4HW7A 2X6EA 4GMYA 4FV9A 3RGFA 3EKKA 3FZ1A 4IACA 4R3PA 3FXXA 1HCKA 4FRFA 3MV5A 2B53A 2BAJA 3BYMA 5B2MA 2QO2A 4X3FC 2BPMA 5JH6A 3RCJA 2XP2A 1FQ1B 4YZMA 4YSMA 2XF0A 2FSMX 3RI1A 4O4BB 3EQGA 2VTLA 3EZVA 1WZYA 4YJOA 4YJTA 3E8NA 5EQPA 4NJDA 2C5OA 4EH5A 4OBOA 5HGIA 4IB5A 1J1CA 1H24A 2HY81 4O96A 4FC0A 1L3RE 4GVJA 4G2FA 5A4EA 2OXXA 4BDDA 4TZRA 3OWLA 4Y8DA 2BIYA 2E9VA 2O64A 3DBFA 4WRSA 3RK5A 3UC3A 4FKSA 4ZJVA 4H05A 2NYAA 4BBEA 4EOJA 2VO7A 4KS8A 4J8MA 2WMRA 2ZJWA 4FT3A 5LMBA 4GK4A 4ITJA 1JVPP 1FOTA 1WBOA 4JVGA 5CZIA 2RFEA 4PMTA 4XEYA 3PXKA 2E9NA 4M3QA 3WF6A 2AC3A 2ONLA 3PSDA 4WHZA 1R0EA 5J9ZA 2JKMA 4YNOA 3E5AA 4YC6A 3DFCB 3QQHA 1MQ4A 2GNHA 4J8NA 4YR8A 4EOSA 1XO2B 1UNLA 4AFJA 3PFYA 3P9JA 1BUHA 4A9YA 5K4IA 3R2YA 1U46A 4EUTA 4TYIA 5ETCA 3PSCA 5IQFA 3RZFA 4TWCA 3Q5IA 4W4VA 4WUAA 4AA5A 4F78A 4ZMEA 4H1MA 5DR9A 3O8PA 5CSVA 5K0KA 5JGDA 4D5KA 2HZ4A 4I92A 3RPVA 5KUPA 4FGRA 1L8TA 2ZVAA 4O1PA 2QU6A 4PDPA 3Q4ZA 4HVIA 3DXPA 1XH7A 2R3GA 1ZMVA 3R73A 4AQCA 4ENYA 3QD4A 2ETKA 1YOLA 3OCSA 1CKIA 2XYNA 4L00A 3IKAA 4RC4A 5HD7A 1YXSA 4FTOA 4XG3A 3BQCA 4FKVA 4FV7A 3LE6A 1JKLA 5LCKA 3B8QA 3PP1A 4EK6A 3CJGA 3U9CA 3TNWA 4FGBA 3R6XA 2BTRA 3WZUA 3ORKA 3ERKA 3QLGA 1H00A 4FT0A 1JKTA 2VWVA 3WZEA 4QT1A 4B8MA 3NPCA 1OI9A 2RGPA 2YHVA 3SW4A 1PXMA 4XBUA 3RM7A 4UB7A 5HLPA 3EZRA 5L2IA 2GDOA 3BLRA 3V01A 4AUAA 2R7IA 3ZO1A 1H26A 4FTKA 2FSLX 3ZOSA 2HZNA 4DFLA 2P0CA 3LMIA 2BRBA 2VTAA 4EOLA 5E8WA 4IJ9A 4CZUA 5DA3A 4DN5A 5CQWA 1CM8A 2O5KA 2X6DA 3G33A 5ICPA 4J99A 4CG8A 1XH4A 1Z57A 4R6VA 3VHEA 3IDPA 2OICA 4GT3A 1ZZLA 3ORLA 1H25A 5CEOA 5CAPA 4CZYB 2Q83A 3QXPA 2PYWA 4PL4A 1OMWA 2X81A 4HGSA 3HDNA 3V51A 4YLJA 4ORKA 3ZBFA 4G16A 3K3JA 3IONA 5HIBA 2X7FA 4HCVA 4QQTA 1I44A 3QRTA 4CKIA 4WO5A 5HKMA 2EXEA 4FTQA 3R7IA 4HVSA 2YIYA 2GCDA 1AD5A 4MWHA 3PUFC 5FUTA 2WPAA 4BICA 3DBDA 2J6MA 3PIZA 5JFXA 2JDVA 4G6LA 2WTKB 5M09A 1ZYLA 2UW8A 1WVWA 3ODZX 4TYJA 3TJDA 4BHZA 5H8GA 4C8BA 3GCSA 4FIJA 2OJIA 1OECA 1BMKA 3F3ZA 4CRSA 3W2QA 4C36A 2BKZA 3TKIA 3HAVA 4FKGA 5HBJA 4UWCA 4MUQA 3UG2A 1MP8A 3BE9A 4LRJA 4YNEA 3ATSA 3C4EA 3JYAA 4IB3A 1UWJA 1PXJA 3CGOA 5EM6A 4USFA 4BCHA 2W96B 4UEUA 2GMXA 4U8ZA 3LXNA 5DLSA 5L3AA 4L7SA 2OZAA 1CKPA 3LQ5A 1GIIA 1U54A 3O71A 4DTKA 4E73A 4PTEA 5HU9A 1S9JA 4JR3A 3I4BA 1O6YA 3OC1A 1VEBA 4BKJA 3TV7A 3I5ZA 2PMNX 5A4QA 1IRKA 5I5ZA 3PPJA 2C6EA 3BZ3A 5CEPA 4DEAA 3HV5A 5L6PA 2W1ZA 3UE4A 4YU2A 1PW2A 4JL9A 3VQHA 4F09A 4MXAA 5BYLA 2QU5A 2VTIA 2WEIA 3GC9A 5AV4A 4YJUA 3NVKI 1P5EA 4II5A 5I9XA 3MPMA 3RAIA 4BDJA 3L9NA 4H3QA 3FL4A 3FWQA 4KKEA 3FY2A 3H10A 4EHGA 2XNBA 4LL0A 4AQKA 4UN0C 3W10A 2RFNA 2XIZA 3R9NA 3BELA 5TF9A 5HG9A 4JXFA 4U0IA 2PVFA 3MPTA 1XHAA 1ZMUA 1Q97A 3W2CA 5DIAA 3ZHPC 1JOWB 3P86A 4QP6A 3PJ2A 3FY0A 3L8PA 4YTFA 5HO7A 3PRFA 4ASEA 4HYIA 4DHJA 3QQKA 5E92A 1WVYA 4IAKA 2W1DA 3KVXA 2YIWA 4FJVA 4W9XA 4AXEA 2WMSA 4O0SA 3SXFA 2CKOA 4FNZA 3SKCA 4FT9A 4J96A 2FSOX 5CWZA 4J52A 3OT8A 3MVHA 3GCVA 5BUJA 5FM2A 3QQLA 4WBBB 4ACHA 4ZTRA 3OW4A 2HENA 3R21A 4JBOA 3RWQA 1W7HA 3P5KA 2X9EA 3LM5A 3Q9WA 3FQEA 4FSNA 4MYGA 5DEWA 4AOJA 5A4LA 5AP5A 3HNGA 4O27B 3LPBA 2QG5A 2UW0A 2X7OA 4MNFA 5EYCA 3F88A 2XZSA 2AYPA 3FZTA 4MXYA 3RK7A 2BIKB 2X7GA 5IDPA 4OTPA 2BFXA 2F9GA 4KD1A 5L8JA 5IF1A 4UZHA 4RWKA 5KMNA 5M4IA 3ZRLA 4QMYA 4EEVA 2XIYA 4DHZA 4OTGA 1A06A 2JEDA 3AMYA 1Q8ZA 5HBEA 4MBJA 5CTPA 4E6QA 2A1AB 4QP1A 4ZLZA 3V5PA 4D2WA 2VTJA 1OPJA 3M1SA 4BCOA 3ORZA 3N4UA 1ZOHA 4FEWA 1YDTE 4M69A 5HZNA 4U42A 3EN5A 2F2UA 2H96A 4KIKA 3SD0A 4GJ2A 3VJNA 3S3IA 1OBDA 5E1EA 1OKYA 2GFCA 3ATTA 4XG2A 4D1SA 1DI9A 1APME 2VTTA 4FTJA 4KB8A 5HX8A 3BGQA 1ST4A 1SVHA 2VO6A 4IM2A 4M84A 5KE0A 3L1SA 4U3ZA 5E8TA 3ZRMA 1B39A 4G34A 1R0PA 3EKNA 2NNWB 4JX3A 5HOAA 3TTIA 2CKPA 5EW3A 4G6NA 3ZC6A 4GUEA 4ANOA 3L8VA 4DFZE 2PVKA 4GU6A 5JSMA 3EQCA 2YEXA 3FQHA 5AR7A 4AZFA 4EJNA 5AV1A 3FMMA 5FD2A 3UVRA 3AOXA 1YW2A 3I1AA 3QTSA 4Y95A 4IZ5A 2XIKA 5AA8A 5JEBA 3UZPA 4U40A 5CU0A 4EH6A 5BMSA 4GT4A 4X3FB 1M2PA 2F7XE 4G3FA 2ITXA 3QKMA 3HDMA 1BX6A 3AD6A 1W8CA 3JR1A 5K0XA 4DE4A 4W4YA 2Y6MA 3NRMA 3QCSA 2QLQA 4BCKA 4V04A 2R3FA 4C34A 4G3GA 3IW6A 4YTCA 5JT2A 5KMLA 4ZJIA 2JAVA 2IW9A 4FOBA 2QCSA 4XHKB 3OCBA 5FBOA 2GS2A 2YERA 4YP8A 4HOKA 5E8YA 2R2PA 1Q8UA 2IN6A 3GUBA 4GVAA 1STCE 1ZYDA 3W33A 1YWRA 2Z7QA 4QYFA 3PZHA 4GYIA 3S1HA 1RDQE 1UV5A 3II5A 4BZDA 2PK9A 4X6RA 2KTYA 3A8XA 3A8WA 4DG2E 3A7IA 1W2DA 4BCJA 1OL1A 2VWXA 4NT4A 4OGRA 4MF1A 2PL0A 1QPDA 4FTRA 2BTSA 2OO8X 4QQJA 2REIA 4I0SA 3R1NA 4AOIA 3CPCA 3KGAA 4X3JA 5BVWA 4O4DA 3CKWA 3DOGA 4MD7E 1LP4A 5FEEA 3A7FA 1OKZA 3KMWA 4N6YA 4BTJA 2WOUA 4XLIA 4IHPA 3NUYA 3CJFA 2PUUA 3DBCA 4RJ5A 3VS1A 4I22A 2X9FA 4JNWA 2DYLA 4GW8A 5AAFA 4G31A 4MNEB 3VW8A 4BCQA 2ZM4A 2UW3A 2C47A 5EW9A 2WTJA 3UO6A 4UMQA 5CEMA 3GFEA 1XBBA 4F1OA 5CAQA 4RLLA 5ANGA 4RQKA 4WNPA 4FG7A 2BZHB 3GGFA 5IPJA 3FMJA 4Y85A 3PFQA 1SVGA 4I5CA 4NFMA 4L67A 4UYNA 4FL3A 4U45A 3CPBA 3PYYA 3H9RA 2WU7A 1U5QA 3QALE 2JAMA 4CCBA 4KA3A 3T3UA 4HNIA 3F5PA 4FNWA 4K77A 3QZGA 4DFBA 5FEDA 3HV6A 2R3HA 3ULZA 2JDSA 3F6XA 4RJ6A 1LUFA 3QUPA 2OSCA 4I3ZA 4IVDA 2R7BA 3AC2A 2V22A 1H28A 3HECA 4WG3A 2JKOA 4OBQA 1EH4A 2VO0A 4ZIMA 4AGUA 2Y4IB 4ZZOA 4RPVA 3MY5A 3GCPA 4Q5HA 3R9HA 2XEZA 4MXOA 3FEGA 2P2HA 4R3RA 4RIXB 3TV6A 3KXMA 1OKWA 4JX7A 4QTBA 3PJ8A 5C03A 4HGEA 3SW7A 4YC8A 3UODA 4RQVA 5JGAA 3FMEA 4XX9A 5CANA 3KQ7A 3G0FA 2PWLA 3DKGA 3LLTA 4JJRA 4NKAA 3C4CA 5KCVA 3OCGA 4KINA 3LOKA 4QNAA 3TI1A 4JQ7A 1M52A 2YDJA 3A7GA 2OXDA 3QF9A 3UQFA 3A60A 3AG9A 3MIAA 4HYSA 3ET7A 2YFXA 3DLZA 4BKZA 5DT4A 3NWWA 3MY0A 4IWOA 4QP9A 4FKIA 3P7CA 2EUFB 1Q99A 1PJKA 2W1EA 4LFIA 3BU5A 5HO6A 4I20A 2OG8A 3MVMA 4BGGA 1HCLA 4CKRA 2BZIB 4AOTA 2J9MA 3W2SA 2F4JA 3CTQA 3RALA 4FIHA 2O2UA 3MH3A 5FLFA 4MWIA 3EQHA 3U51A 4AW2A 3PTGA 4G6OA 4JAIA 5FG8A 1LPUA 5E8SA 1BI7A 3DZOA 4IH8A 1YDSE 4E6AA 4BIDA 4PV0A 2W9FB 3IPHA 4C3FA 3AXWA 4N57A 4DA5A 4NM7A 4AE9A 5BVFA 3OROA 5CXZA 2PY3A 3N9XA 3FMHA 3BRBA 3NUSA 4IJPA 1UU7A 4GS6A 2H6DA 2W99B 1DS5A 2OF2A 4HGLA 1W83A 2C69A 1FGIA 3DDQA 3QCQA 3AT4A 1YXTA 3MJ1A 3COHA 4AXCA 4NK9A 3OUNB 4CV8A 3MBLA 3D7ZA 3FC1X 3SQQA 2CCIA 3FLYA 3ZEPA 3SV0A 2ZV7A 3BIZA 1FINA 4ASXA 2R0IA 4CFNA 3MIYA 4CKJA 1OPKA 2W5BA 4U80A 3E92A 3Q32A 3A7JA 1FVTA 4KIOA 4XLVA 4HCTA 1WBVA 3FSKA 2GPHA 3DNEA 1RE8A 2YIQA 3UDSA 3GVUA 1SYKA 2O8YA 3NUNA 5EM5A 4JDJA 1MRYA 2HOGA 3KF4A 3W0SA 3DAJA 5IG1A 3NSZA 3QD0A 5J9YA 2PZPA 4OTHA 2H34A 4DTBA 3OVVA 4X2JA 3EWHA 3JPVA 2OIQA 1XMLA 5FGKA 2I0EA 3GU8A 4E20A 1OITA 1REJA 2HXQA 3ZXTA 4CMOA 4EQCA 5M56A 4CFMA 5FXRA 3OS3A 4IBMA 2GTMA 4XRJA 4NM5A 5JKGA 1G8SA 4QP7A 5IA2A 4UV0A 1JWHA 2GNGA 4O38A 5CALA 3G5DA 3D5XA 2JKQA 4RC2A 4KIPA 4WG5A 4BI2A 2VTNA 2IZSA 5HICA 2BUJA 5LQFA 3DJ6A 4BTFA 1CDKA 3N4TA 3IOPA 2OKRA 3OTVA 2VTOA 3BYOA 1BKXA 1M7QA 3VJOA 1SNXA 2OIDA 4RX5A 4ZJJA 2X8IA 2XM8A 4BCNA 5M4CA 2WMAA 4O4CA 5AR5A 5IA1A 4JMQA 4DH5A 3VF8A 4RVLA 4L68A 3TDVA 4NIFB 5IA5A 4I6HA 3MFTA 2GNJA 5M06A 3DCVA 3PXRA 4XP2A 3WOWA 3BWJA 2O3PA 1XKKA 3U4UA 5F95A 3VUGA 3VWAA 4BC6A 3W32A 4FKTA 4YJVA 3REPA 2R4BA 4DH8A 4ERKA 4F6SA 3DTCA 2C6IA 3BHUA 3JVSA 5CYIA 4FSRA 3PRIA 4RSSA 4IQ6A 2I6LA 4O4EA 4CQEA 1TZDA 4RMZA 3DT1A 4ALVA 3UP2A 3IECA 2PVRA 3LFDA 2Z7LA 2X0GA 4GG5A 3D5VA 3R8PA 2B1PA 3LFNA 5IMXA 5L8KA 2CNVA 2HW7A 4GKIA 5DPVA 4AFEA 4YO4A 4FZDB 3VBYA 1O9UA 3LMHA 4MEDA 3ZSGA 1G8KA 4FV3A 2PVHA 5ETAA 5JQ5A 4W8DA 5AR4A 3IW4A 4D2SA 2X39A 4EZ3A 2UW9A 3C0HA 3UBDA 1REKA 1OZ1A 4IFGA 4BHNA 2XBJA 3EH9A 2R3NA 2ERZE 3MS9A 1Q3DA 2UW4A 4ACGA 4YPDA 4RX9A 2VX3A 3G51A 3UIMA 4MQ2A 3E7VA 1K2PA 1U59A 3NFFB 4LM5A 5B0XA 4FT7A 2QC6A 4I4EA 3GU7A 2ITVA 3VUMA 4F7NA 2WZJA 3JVRA 5HX6A 5EI2A 2WD1A 3U87A 3P7AA 2R9SA 1UU9A 4IANA 3JUHA 3G9NA 5L2SA 3QZHA 4K6ZA 3SRVB 3NX8A 3FMDA 2XB7A 1NXKA 4FL2A 4NKSA 3SVVA 4J98A 1OGYA 2W1IA 1J7LA 5AJQA 3EHAA 4DG3E 1YOMA 4YJSA 3DFAA 2XJ2A 1ZOEA 2PZ5A 4C4IA 3SGCA 3CIKA 5JMSA 3SX9A 4EH2A 3MH2A 3FPMA 3NS9A 2OBJA 5GJGA 4FBXA 4WKQA 3FZSA 3QRKA 4DGGA 3ZUUA 4DLIA 3ZEWA 2F2CB 3HV3A 3OD6X 3LCKA 4I23A 2I1MA 1CKJA 5L8LA 3IO7A 4JLCA 3R22A 3NUXA 2LAVA 4LMUA 2NP8A 2RSVA 1JSTA 3LXPA 1ZZ2A 2QOHA 4AZTA 4O7ZA 5EH0A 1YWNA 3EQRA 2XK9A 3NGAA 4QMXA 4C38A 2UZDA 2XMYA 3F82A 4S34A 1Q62A 3VS7A 4KNBA 4XBRA 2OXYA 4YBJA 4Q9SA 4F9WA 3R1YA 4I6BA 4ZTLA 5J87A 4JQEA 1WFCA 4LOQA 4RWJA 2C6LA 4U7ZA 4TYHA 2UZWE 3RHXA 2BAQA 3FLQA 3DK3A 1PMNA 2UZUE 4J7BA 3HUBA 4XP3A 3C7QA 3TEIA 4AS0A 3F69A 4C62A 3RMFA 4BTMA 4CYJA 2ITZA 4FKWA 3U6IA 1M7NA 4Q2AA 3EN7A 2C6OA 3IS5A 4UWBA 4DDIA 1ZWSA 4E8AA 3QTXA 2SRCA 3KN6A 4R1VA 2OLCA 3C9WA 5CVHA 1R3CA 4FTNA 4JBPA 5KBQA 5AP2A 3EYGA 3H0ZA 3HL7A 4O7LA 4ID7A 4BIEA 1T46A 4ITHA 3UPXA 1H1QA 4K9YA 1OVEA 5BVDA 3FPQA 2GHGA 3S00A 5M07A 2YM8A 4EYJA 3OHTA 1OKVA 1H1PA 4U97A 3WZDA 4AACA 4F99A 5JN2A 3V6SA 2G2HA 5DT0A 5HLWA 1GIHA 3HUCA 3UO5A 3HGKA 5CU2A 3VHKA 4BDEA 2WKMA 3PY3A 3BV2A 4MK0A 2J0KA 4O86A 4O0TA 5D7VA 4CD0A 5K3YA 4KABA 4FTMA 4K2RA 4L42A 3LFSA 4P5QA 3HMPA 2YWVA 4E6DA 2X0QA 3BEAA 4RJ4A 4D2VA 4BDAA 5F1ZA 4DEHA 2XA4A 4BRXA 1V0OA 3FKNA 5AV3A 3DQWA 3UDBA 4UMUA 4W9WA 1Q61A 5IH6A 4CFUA 3AC3A 4QYHA 2YAAA 3BHTA 2H8HA 5KMIA 1OIYA 4QMWA 4X2KA 4I0RA 3FZRA 4BYIA 4M7IA 3EN4A 3LZBA 3CEKA 4BDCA 2GSFA 2YCFA 4K11A 2ZDUA 2VTPA 3EN9A 2GHMA 4XG9A 5CSHA 3FXZA 4BDGA 1GJOA 3FYKX 1Q24A 3KF7A 4EC9A 4RT7A 3OP5A 4NUSA 5HE2A 3G9LX 4AN3A 2VX0A 5EDRA 4OT5A 3F7ZA