3DNEA

Camp-dependent protein kinase pka catalytic subunit with pki-5-24
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
336
Chain Sequence
ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallography-independent determination of ligand binding modes
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 105
structure length 336
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dneA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dneA02
5CX9A 3U6JA 3R7YA 4A9YA 4N57A 1A48A 3O96A 4R5YA 5BX0A 4IIRA 5AP1A 4HNFA 3ZH8A 4KIKA 1YI4A 3ELJA 2X6DA 5HBEA 4FKIA 4O21A 5I9YA 4IAZA 5K0XA 2JIVA 2XYUA 3LE6A 3TACA 3R21A 3Q96A 5CXZA 4RC2A 5I9VA 4O0RA 5HIDA 4QMVA 4ANQA 5EFQA 3QKMA 5AM6A 4BDAA 4I22A 2E9PA 4MX9A 2BZHB 3HUCA 3U4WA 1Q97A 3R7IA 4BWPA 4JI9A 3KRJA 3WF9A 2XRWA 4XRJA 2ZM4A 4HGLA 2PTKA 1ZOEA 3JXWA 4PMMA 3SDJA 4E8AA 3QTZA 2UZTA 2JKKA 5LXMA 3PJCA 4J1RA 4XYFA 5HOAA 2EXEA 2WEIA 3ZO3A 4QPAA 5IQIA 2OXYA 3WZEA 2DWBA 5C4LA 4A9UA 4F7SA 4CG8A 3VULA 4D1SA 4AA0A 5HCZA 3F9NA 1MRUA 4YPDA 3HMMA 5H8EA 3ZSIA 3C0IA 3EYGA 2QOQA 4G3GA 1B39A 4IDTA 3O7LB 3Q52A 4NW5A 3VHEA 1FGIA 1OVEA 4KRDA 4FV7A 5T6KA 4EQUA 4CFFA 5F20A 3HAVA 3OY1A 4BDGA 5ANDA 1IRKA 3D5UA 4NSTA 4ZJIA 3SOAA 1OL6A 3L8XA 5L2SA 2BRMA 1OL7A 1JQHA 2CGXA 2IVSA 3OOGA 4E6QA 4AZVA 4HPTE 2PMOX 4U81A 4G17A 3QTWA 1I09A 2R3PA 3G6GA 4NWMA 1OKVA 4O0SA 3VWAA 4E93A 3HUBA 5IQCA 4P7EA 5D1JA 5LCKA 1YOLA 4MHAA 3TV6A 3V6SA 3O2MA 5FDXA 1Q8YA 4ZAUA 2G15A 3C51A 4IM3A 3DOGA 4FKTA 3UIBA 3ZLYA 3HV7A 3C4XA 4UEUA 2B55A 3A2CA 4F08A 1PW2A 3D4QA 4H58A 4IWDA 2UW8A 4EK6A 2GS6A 5AWMA 4E3CA 4O7LA 2C1AA 2OICA 4AU8A 1E1XA 2Z7RA 1H8FA 2PSQA 2ZOQA 3ORZA 5A9UA 4ORKA 5M09A 4FOBA 2F57A 2UVXA 3I1AA 3KC3A 1GIHA 3EL8A 5ACKA 1VZOA 4C2VA 5IA5A 3VRZA 3EFJA 3VS4A 3ZRLA 2R3NA 2JEDA 3OCGA 4LQMA 3C5UA 3PTGA 3QC4A 4V01A 4M84A 3LXPA 2H6DA 3ZLSA 4IC8A 2AUHA 4EH9A 2RKUA 4FSQA 3UOJA 4C8BA 1OL5A 4JQ8A 5HVKA 1F0QA 2WU7A 5I9WA 2OH0E 3Q9YA 4MXXA 3ZHPC 1M2QA 5CU3A 2WIHA 5F95A 2XA4A 2PVLA 4JQ7A 4TRLA 3NR9A 4ZK5A 4JVGA 2X7FA 3CSVA 4RWIA 2GNLA 1FVTA 1KE5A 3K2LA 4YC8A 1H1QA 5F1ZA 3V04A 5A6NA 3OTVA 5KMIA 3GT8A 3QLFA 5M44A 1YQJA 4EH7A 2J50A 3LIJA 4J53A 4AFJA 1UU8A 3IOPA 3BEGA 3RM7A 3OTUA 3R7EA 5IF1A 4U44A 5DG5A 3ZFXA 4EOIA 2C68A 4BCKA 5E8XA 1JNKA 4AW2A 3PZEA 3WZDA 2C1BA 5CQWA 4YR8A 4O83A 4K0YA 2H8HA 5M08A 1TQMA 2F49A 4F0IA 4XBUA 4QP3A 5EQYA 4FVQA 4IAAA 4YO6A 5IH5A 3QYZA 5HIBA 2V7OA 4QP9A 3LLAA 4E1ZA 3ATTA 1PKDA 3DS6A 3QZHA 5DT0A 2JDRA 3LFDA 1DI9A 3BU5A 3MIYA 5DBXA 4KB8A 3W2OA 5C8MA 3QAME 3MH0A 2BRNA 1Q3DA 2F7XE 3EQCA 2XNPA 2R9SA 3KK9A 3UE4A 2BUJA 2ESMA 4QYEA 3WF5A 3OXTA 4G1WA 5M57A 4GK2A 2B4SB 4AE6A 4ZP5A 3IDPA 4JBPA 4F99A 4FNZA 3QTIA 2F2CB 4M13A 3PDTA 4IE9A 3EOCA 2DS1A 3V51A 1XH7A 4UXQA 1YOMA 5JFVA 1P2AA 3TIZA 4M68A 3G0EA 4L3JA 2J9MA 3QCQA 4FMQA 4D5KA 2BRGA 4BTMA 5K3YA 4BIEA 4BTKA 5FUTA 4QT1A 3WZUA 2XK6A 2JDTA 5EI2A 5BVEA 2YA9A 5JZNA 4C59A 3GGFA 1WVXA 2FSOX 3SXFA 3G5DA 5JN2A 4NJ3A 2XNEA 4I21A 4IXPA 1OPLA 4DFUA 5M4UA 4FT5A 5CEPA 4G9RA 4ZLYA 3UPZA 1XBBA 2W1EA 4ANNA 4GS6A 1FMKA 4F9WA 4EJ7A 2HXQA 4RIXA 3RTPA 3N9XA 5AUZA 5HU3A 4O81A 4QMXA 3WOWA 2HAKA 2AC3A 2OFVA 1H25A 2XNNA 5CF4A 4I93A 5AR7A 5FWKK 1X8BA 3DKGA 4JIAA 1KE6A 3BV2A 3REPA 2Y0AA 5EI6A 2JAMA 4G3CA 1AQ1A 2NPQA 4IANA 4O7SA 4ITIA 4PTCA 3W8LA 2HOGA 1ZZLA 3CKWA 3PXKA 4XV3A 4EZ5A 4IAFA 2IG7A 1W0XC 4AA5A 5EK7A 2V0DA 2XZSA 2O8YA 2W4JA 3DJ7A 3OCTA 1R78A 4JL9A 1FBNA 4I23A 2BIYA 2BRBA 3NW6A 5FEDA 4DFYA 2FH9A 4KD1A 5D7AA 4TYHA 3HVCA 5CENA 2ERZE 4DH1A 4E26A 2IW8A 1U5RA 3KF7A 3RP9A 3TDWA 5LMKA 3F2RA 2CLXA 4ZZOA 5FBOA 4YPSA 4AE9A 1EH4A 4GKIA 3A8XA 2BTRA 5D7VA 2VRXA 3SXSA 2VO6A 3U6IA 4MXCA 2XRUA 4WNPA 3DFAA 1NT2A 2VWXA 1XH4A 4JRVA 1GZKA 1PXKA 5DRBA 3TV7A 4YLKA 4BWXA 3TUDA 5DH3A 4RX7A 1Q24A 1OUYA 5HLPA 3VUIA 2I0YA 3SKCA 5KHXA 5H9BA 3M1SA 2XIXA 5GINE 3VF9A 3A7GA 4HPUE 4C4EA 3QRKA 3JPVA 3RGFA 3WF8A 4ERKA 3IGOA 2YM6A 4BCIA 1H07A 3LFAA 4HCTA 4WNMA 1PY5A 5HZNA 2EWAA 3AGLA 3T9IA 2W1FA 3DK3A 4BCJA 3RK5A 4E4MA 1A9UA 1ZLTA 4ANOA 4C4FA 4XLVA 4E4XA 3ITZA 5JK3A 5FTOA 4GU6A 4BN1A 3FI3A 3H10A 3QRTA 4L53A 3OP5A 2X7GA 2VWVA 2V5QA 1P4FA 1PXPA 2QOFA 2RF9A 2XNBA 2ZMDA 3H0ZA 3LJ2A 4YNEA 4EHEA 4HW7A 3P86A 5FTGA 1H24A 1U5QA 3ODYX 2R3FA 4YP8A 1SMHA 1NXKA 3EWHA 3LLTA 5AUXA 5EYKA 1PRYA 5LJJA 3DY7A 4UALA 2P4IA 5K4IA 3QCSA 4G9CA 2XIRA 4IDVA 4RIYB 4FZ6A 4A9TA 1URCA 4DGMA 1PYXA 2V7AA 4CLIA 4LL5A 5L3AA 2JFMA 3QD3A 1JSUA 1KV2A 4TYIA 2NRYA 2QODA 5GJDA 3VQUA 4BI2A 2WOTA 2QR7A 2VTRA 4K2RA 1YXSA 4LOOA 4CLJA 3CJGA 1ZRZA 2I1MA 2R7IA 2UZLA 3V3VA 4I94A 2W1IA 3ZO2A 4BKZA 3TUBA 1AD5A 1PXIA 3OW3A 4E7WA 3FBVA 4I6QA 3ZZEA 4EHZA 3BHUA 4QP8A 5J5TA 2IWIA 2UW7A 3ZC5A 4RT7A 3F69A 4MYGA 4Z7HA 3LXKA 4UWBA 5KMKA 5A54A 4FNXA 3FXWA 2VTIA 2PE0A 5CXHA 3JYAA 1M2RA 3R83A 1OKYA 4CZUA 3RALA 2CHLA 2VO0A 3TI1A 3Q2MA 2W1DA 2I40A 3IW4A 2ZJWA 4WD5A 5E4HA 4ZJJA 4Q5HA 4JT3A 2QKRA 3B2TA 3ZZWA 4TXCA 4IB1A 1Q99A 4BDCA 5CAOA 3DTCA 3L8PA 4G2FA 3A99A 4C4JA 2VTHA 1RJBA 2XH5A 3CGFA 3HP2A 3DQXA 4FTIA 4E4LA 3PXRA 1H1SA 3EKKA 4QQCA 5ETIA 3DDQA 4AFEA 4DFNA 3OT8A 3OT3A 4OTGA 4FTMA 3ZYAA 3LMIA 4G31A 4TPTA 4F70A 4IWPA 2O3PA 2X2LA 2X4FA 5TE0A 5CEOA 5KMLA 4G3FA 2W1GA 3BE2A 4Y46A 3WZJA 2Y4PA 5TR6A 5AAEA 3A7HA 3R04A 5CAUA 4RFMA 5IQHA 1IAJA 4EK5A 1V1KA 4XG7A 4XJ0A 5LVOA 3LPBA 4LOQA 4RIWB 3UOKA 4AOTA 3VC4A 4BBMA 1H08A 3L8SA 3I81A 3GFEA 1SYKA 1ZYSA 3MJ1A 1SVHA 3PWDA 2J51A 3H3CA 3QBNA 3FLYA 3QGWA 4X2NA 5FGKA 4EC9A 3UYTA 2C6LA 3SOCA 4TNBA 4FKGA 5HGIA 4CRLA 3A4OX 3TZMA 2YIWA 4WUAA 3ULIA 4ZMFA 1P4OA 3QQFA 3P9JA 5CZIA 2VTTA 1VJYA 3FMKA 4RIYA 3FMJA 3WARA 5H3QA 3LCSA 4AZFA 5A46A 2QI8A 5IUIA 4FIFA 5E1SA 3ALNA 2W5AA 4MXZA 3PVGA 3VBQA 3ZXTA 3D7ZA 5AV2A 4IM2A 4FT7A 4CQEA 2KTYA 3VS5A 3KREA 3MYGA 4Z9LA 3NWWA 5I9UA 3CY3A 4DYMA 4AW0A 3W1FA 3R01A 4ZY6A 2B9FA 5HE0A 3FY2A 4U6RA 4KNBA 4F1TA 3WYYA 4J7BA 4EH2A 1P14A 2W1HA 3QX2A 4UYAA 4IWQA 2P2HA 3PVUA 4KSQA 4QNYA 4U9AA 4C36A 5FM3A 3L8VA 5L2QA 4BCQA 3R8PA 3ZLXA 5HU9A 4BDEA 4K1BA 2ITPA 4MEDA 4FC0A 2XNOA 4YU2A 5E8YA 4WG3A 2CGUA 2HZIA 3GCVA 3CQEA 4I1ZA 4TZRA 4O96A 4MBIA 4F65A 5EQEA 3GCPA 3DJ5A 3OCSA 2UW4A 3HECA 4DH8A 1OL2A 5JGBA 3AC2A 3PLAE 4PP9A 3KXZA 2ONLA 3COMA 1SNXA 2PZYA 2YAKA 3P08A 4G3DA 5DT3A 3ZCLA 3MA3A 3FE3A 3BBTB 3AC8A 4U3ZA 4EK8A 4GV1A 4ALWA 4ASEA 3DAEA 2ITYA 2PVHA 1VR2A 1JWHA 1DI8A 3IW6A 3LXNA 3P7AA 4FTQA 4TYGA 3D5XA 3QTSA 2PU8A 2QLQA 3CD3A 2OZOA 3EQPA 4CTCA 4D58A 4O0XA 4AQCA 1Y8GA 3RAIA 3EJ1A 4TW9A 4AT4A 4ZEGA 3UP2A 1AGWA 2XIZA 1U54A 5M06A 2JKMA 3QRJA 4FT9A 2R3JA 3O8TA 2JKQA 3PSDA 4F0FA 4YJSA 2AYPA 3L9MA 1QPDA 5LVLA 4DGLC 3RNYA 3QZFA 4YTIA 1IASA 4ZJVA 2QOCA 2R3GA 4F7NA 3R7UA 4UMPA 5M4CA 5D41A 4ENYA 5BVDA 2YFXA 3EQBA 1O6YA 4GEOA 1JBPE 3UZPA 4CXAA 1PF8A 3E8NA 3UQGA 2ITZA 1ZZ2A 2FGIA 3BGZA 3U87A 2XK7A 3ZLWA 4QTBA 4RVTA 5ETAA 4GU9A 2QOOA 5DLSA 4KBCA 2P2IA 1SVEA 3V8TA 5KKRC 2XS0A 2VO7A 1GIIA 2GS7A 3R8VA 4QTEA 1UU3A 2C6KA 3MV5A 4L42A 3RAKA 4OTWA 3DXPA 3ORLA 5ANIA 4ZTLA 4F63A 4RIXB 4IJ9A 1T45A 3BHVA 4A7CA 4HYIA 4DC2A 2Z7SA 4EYMA 4G5PA 3EFKA 3R00A 3F2NA 2PVJA 1CTPE 2QD9A 2VWZA 4O7TA 2WQBA 4V04A 5I5ZA 2HYYA 1H1RA 4H1JA 1KE9A 4I92A 3RMFA 5AUUA 1WBSA 2ZM3A 3NYOA 3UPXA 5EKNA 3GC7A 4X2GA 4F6UA 2R5TA 1FVVA 2QOLA 2WMUA 4U42A 4IBMA 4OGRA 1PMUA 3SVVA 3S4QA 2WD1A 3BQCA 4FE2A 4M15A 5EW3A 4USDA 4DF3A 3P7CA 4C0TA 3TM0A 4K11A 4LUDA 3AMBA 2WGJA 3GBZA 3LJ0A 4IHPA 3R8ZA 4EHVA 3S1HA 3LMHA 3WILA 4IMYA 3PPJA 5G6VA 3Q2JA 2QO2A 2G9XA 1CKJA 4IADA 5HLWA 2OZAA 4RQVA 3EIDA 4DFZE 3LFNA 3K54A 4QMPA 4ZY4A 4I4FA 3DBCA 4KRCA 5CSXA 2BFYA 3DBDA 3U9NA 5IMXA 4WBOA 4O0VA 3ORNA 3MY1A 4LG4A 4YJPA 1J1CA 3LFQA 5DPVA 1YVJA 2XYNA 2VTJA 2QO7A 3FV8A 5E9EA 5HIEA 1MUOA 4FTTA 2QVSE 5EDPA 1OECA 5DEYA 4X2FA 2QR8A 2C3IB 3ORPA 3BLQA 3TKUA 2HELA 5D11A 2YWVA 4FTUA 4M0YA 5FD2A 3UBDA 4TWCA 3GC0A 3OXZA 3FMEA 4E5AX 4BDBA 4FKRA 5DRDA 3VS1A 1QCFA 2GPHA 5EM7A 4FV8A 3LFFA 3WIGA 2O2UA 3LM5A 2WIPA 2XBJA 5CAQA 4QMSA 3UIXA 5DR2A 4D5HA 3KCKA 5FEQA 1O9UA 2X81A 4YNOA 4X21A 3AC1A 1JOWB 3QRIA 2PUIA 4PMTA 5I3OA 5AM7A 3RZFA 2W9ZB 3P23A 2Q0BA 2VN9A 3PRIA 2W9FB 4WT6A 3K5UA 5LVMA 3QFVA 3QA8A 4RA4A 2P55A 3RCJA 5KUPA 4UV0A 3VS7A 4PL5A 2VD5A 4CV9A 1U4DA 4YZCA 1K3AA 3NMUF 1YHWA 3ZDIA 4EI4A 4I6BA 2W4KA 3VJNA 5IG1A 3CJFA 3TV4A 1DS5A 4ZIMA 4ZZMA 2VTAA 1DAYA 3D0EA 3QA0A 3C0GA 3OWLA 4YZNA 3QUDA 3W2PA 5IPJA 2XUUA 3TEIA 5GJGA 5HNBA 4BDIA 2CSNA 4UMUA 2HWPA 2R3IA 3HDNA 4HGTA 4PNIA 3R9HA 4O86A 4G5JA 5KMJA 2YITA 4IEBA 2C30A 3JUHA 4GJ2A 3BHHA 5FP6A 4ARKA 3U55A 3GU5A 2OJGA 5DE2A 4ITHA 2GNGA 4M69A 4CTBA 3VS2A 4C3PA 2H9VA 2VAGA 3A61A 3KXMA 3UG1A 5HD7A 4K9YA 4PY1A 3F66A 2Z60A 2XP2A 3TNQB 3TZ8A 5IZFA 4QMNA 2J0MB 3A7JA 4A9SA 2ITQA 3AD6A 4DA5A 1OPKA 2XBAA 2XJ2A 3D15A 5EKOA 3VJOA 3ANRA 5CF5A 3LKMA 2ETRA 3C7QA 4V05A 4YLJA 5M56A 4G34A 5J1VA 2OO8X 2QU6A 3BELA 2GCDA 2A19B 1UVRA 4IX3A 4O7YA 4W4XA 5BMMA 4BKJA 3T3VA 5JFWA 1GOLA 2AC5A 3MVMA 2ACXA 5EW8A 5C26A 3UNZA 2EUFB 4R7HA 3GB2A 5KCVA 2SRCA 4IFGA 5IQBA 4O7RA 5M55A 4F6SA 4O82A 2HXLA 2GNJA 4QP1A 5FXQA 4KS7A 3IW7A 3MBLA 4NFMA 4XG6A 1FOTA 5DIAA 3SG9A 1BI7A 4EH6A 4OTPA 4AN2A 5I9XA 2ZMCA 1YWRA 3TIYA 5AUTA 3NPCA 4KIOA 4YZ9A 5HO6A 4FK3A 1R0PA 3UVRA 3OMVA 3D94A 3POOA 5T3QA 1REKA 4P4CA 4I0TA 4P90A 2YHVA 3DQWA 3NGAA 4EOOA 5BNJA 5CEKA 4QTCA 2YM5A 3THBA 3BYMA 3MI9A 4X3FB 2CN8A 5EOBA 4H05A 2PPQA 5ACBC 3MY0A 5AP7A 3VUTA 4QMMA 3MA6A 4HCVA 3CQUA 2Q0NA 3TNPC 3QKLA 5JQ5A 3CR0A 4YJVA 1PYEA 3EB0A 2WFYA 3ZUUA 3IONA 3E5AA 4IVAA 1YWVA 5HG7A 5J8IA 5BYZA 4DTKA 4QTAA 2GS2A 5TOZA 4FKLA 4I41A 3KRWA 4LMNA 4N4SA 5AUWA 5GZ8A 3W33A 4S34A 3I5NA 3DZQA 3V5WA 5LCJA 1M17A 2WMWA 3LQ5A 1WBVA 1QL6A 3QALE 4NCTC 4NU1A 3GC9A 3GCSA 1Q8ZA 4NM5A 5HKMA 4IACA 4CMUA 2CCIA 4L8MA 4R5SA 2C69A 5BVKA 3DJ6A 4U79A 2RSVA 4ASZA 5DR9A 4EZ3A 4PMSA 5BVNA 4JBQA 2R3MA 3QTXA 1U54B 3DNEA 3MJ2A 3TXOA 2BZIB 2QHNA 3BYVA 4U7ZA 4C37A 3WF7A 3O71A 4IB3A 4BIBA 3ACJA 5FEEA 2HW7A 2R3KA 3G0FA 1K2PA 2OLCA 3ZXZA 4BL1A 2OG8A 4RJ7A 4YZDA 3SW7A 3U54A 5EYDA 4XG4A 5HCYA 3NUNA 3UZTA 5JT2A 5AUVA 1VYWA 4I4EA 4ZTHA 1UNHA 4U3YA 3IQ7A 2XM9A 5CNOA 3R73A 4EORA 3D7TA 3BLHA 3NUUA 4FKQA 3EN6A 2BILB 4KSPA 3CY2A 3V5TA 1E1VA 3BX5A 3PPKA 4RLLA 4I20A 3DBQA 4A9RA 4TWOA 2WMXA 2NP8A 3IDBA 3FZSA 5M4IA 3EZRA 2YERA 2ONLC 3I60A 2JLDA 3RVGA 3OC1A 4HVIA 4AT3A 2A4LA 1FMOE 4RWJA 4KKHA 2PE2A 4DINA 1SVGA 3FL5A 4O22A 4Q9ZA 2BDJA 3QQLA 3FI4A 3R22A 2X2MA 5FRIA 4FA2A 3CXWA 3I4BA 2UW5A 1Q61A 3C9WA 3FYKX 1NW1A 3FI8A 5HE2A 2YLEA 4C57A 3AD4A 3W55A 4P5QA 2WMVA 5I4NA 3R1NA 3W32A 2VWBA 4N6ZA 2O64A 4Y73A 2QOKA 5FQDC 3DBEA 4YTHA 1MQBA 4Y83A 4RX9A 3WIKA 4PV0A 3ZC6A 2BHEA 4YJUA 1OIQA 3ZEPA 3ZU7A 3VUDA 2JC6A 5LARA 3OUNB 4Z3VA 2Z2WA 5HESA 4ACMA 3E7VA 4OTQA 1WBOA 2X8IA 4K8AA 4RJ5A 2CGVA 2B54A 2F7EE 3NS9A 4I6HA 3UTOA 4WRGA 5AUYA 5IISA 3P1AA 2ZV2A 5JSMA 3DLSA 4RA5A 5T68A 4FTKA 3NIZA 3FMNA 2FSMX 2BAJA 3QTQA 4YHTA 3MVJA 2FB8A 4ZXTA 1WVWA 3BRBA 3HV6A 4I6FA 4JBVA 2IVTA 3FHRA 4FTCA 2FYSA 2VX1A 3FMHA 4DG3E 1ZXEA 3K3IA 4UZHA 3NCZA 4B0GA 2J0JA 5H8BA 2GHLA 4M3QA 3SC1A 4DE4A 3TTJA 3DLZA 4M66A 2ZVAA 3D7TB 4EH4A 2OW3A 2WPAA 1WAKA 2QLUA 3R8UA 4X0MA 3UP7A 5DMZA 1P5EA 4EOQA 5JRSA 4L43A 5EH0A 2BAKA 4O2ZA 3MVHA 4HVSA 1JPAA 1RDQE 4OUCA 2BROA 4R3CA 4CMOA 4DBNA 2PHKA 2Y7JA 4ERWA 4O7WA 1UU7A 2VU3A 1V0OA 2R3LA 4QMOA 4IVDA 4W8DA 4YHFA 3ZBXA 4BIDA 3MWUA 1I44A 4OT5A 4WO5A 1NA7A 2HIWA 1G8AA 3ZUTA 3TNHA 5IKWA 2CGWA 1ZARA 4AGDA 3ZRKA 5FXRA 2XNMA 2C6MA 5AX9A 3C13A 2YDJA 3MN3A 5CNNA 3PUPA 4FVRA 4IH8A 4JR3A 4S32A 4DGOA 3DT1A 3V5JA 4ALVA 5HHWA 1S9IA 4KS8A 1GZ8A 2JIIA 2XKEA 4IAIA 2A2AA 4L68A 3LCDA 1H1PA 3PXYA 2XKCA 1JSTA 2X1NA 2YIRA 3POZA 4K6ZA 1ZYLA 4H36A 5K4JA 4RQKA 1XQZA 2HZNA 3AG9A 3QUPA 4MQ1A 3D2IA 1NVRA 3HA6A 4E6AA 1CMKE 5L6OA 3QF9A 4RIOA 3NNUA 3BV3A 5J5SA 2EU9A 4RSSA 4QTDA 1R1WA 3PFQA 1K9AA 2ZDTA 2C0TA 3EN4A 5DWRA 5FXSA 4F1MA 1W82A 5LMBA 3FAAA 3IO7A 3E3PA 5DI1A 4FV1A 5AFVA 3L1SA 4JOAA 1IA8A 3S2PA 4NFNA 4O0TA 3PXQA 4OTRA 1Q5KA 3GOPA 2G2FA 4EOJA 4AS0A 5CF8A 1IR3A 3F5GA 5EM8A 4PDOA 1OKWA 2YLFA 3CD8A 4JS8A 2DQ7X 2QCSA 1Q3WA 3Q04A 2JITA 3D83A 4NTSA 2ZB0A 3IW8A 5C27A 4EHGA 4YO4A 3JS2A 2WELA 4L45A 4AW1A 3ETAA 3QC9A 3OFMA 4FTNA 1GY3A 3P79A 3EQFA 2XK9A 5AP2A 2C6TA 3I79A 3A62A 1JKTA 5A4TA 5E8ZA 4MF0A 4C62A 4J96A 5CSWA 4BY9E 2G2IA 4XG9A 3KA0A 3QZIA 4Y5QA 4BGHA 2GQSA 2JKOA 2V55A 3L9LA 4NIFB 4FSMA 2EVAA 2V62A 2YM4A 1JKLA 2W17A 2YM7A 2XK3A 1BYGA 3LW0A 1OITA 4N6YA 4X6QC 2QG5A 5EHYA 3WF6A 3MFSA 2OF4A 5M07A 3IECA 3OWPA 3U9CA 3EMGA 3HEGA 3EQHA 2PVRA 2J7TA 5D9HA 4DH3A 2Z02A 3SRVA 4BDJA 3NCGA 4F64A 4DFBA 4KKEA 4XP2A 2XCHA 2GQRA 3E62A 1KE8A 5CS6A 2XCKA 3NRMA 5AV4A 3FWQA 4KKGA 3HL7A 4IVBA 2QOBA 3H9OA 2HY0A 1UU9A 4X3FA 4R8QA 5HTCA 3MB7A 1G8SA 3UNJA 3QHWA 3NUAA 3SAYA 3BYUA 1DM2A 1ZMWA 3QD4A 4I3ZA 4K33A 4YLLA 5BUJA 4E5WA 3TUCA 2X0GA 4F0GA 3V6RA 4RIWA 5A4LA 4PPBA 4DN5A 4YSMA 3GC8A 3L9NA 2JD5A 3BCEA 3E7OA 1OMWA 2C5OA 1XH9A 1M2PA 3CKXA 3QQJA 3LCKA 5F9EA 3Q4ZA 2OFUA 5A14A 1UNGA 1H4LA 2Z7LA 3CE3A 2CJMA 2BZKB 5AP5A 3G9LX 4C02A 1ZYJA 3MIAA 3FQEA 2X2KA 3HLLA 4EBVA 4FX3A 4FIIA 3EFLA 5IEVA 2YEXA 3LFBA 4QP6A 2UZDA 4YUQA 4ZSLA 2CKQA 2XJ0A 3N4UA 4L7FA 3NZ0A 3DKCA 2VO3A 1OIUA 4ZS4A 3NNVA 4YBJA 3VAPA 3R6XA 2NNWB 1YHSA 2RIOA 2BPMA 3FMLA 4YJNA 1UKHA 4AP7A 5M53A 3PSCA 3ZM4A 4S31A 4D0XA 4IJPA 4XOYA 3UC4A 2FO0A 1JLUE 4MXYA 2PZIA 3RPYA 2B9IA 5HG8A 5LVNA 4W4YA 3COKA 2BDFA 3PXFA 2UZBA 3T8OA 4HOKA 5JFXA 1BX6A 3BHYA 4D9TA 2JDSA 3FXXA 2GQGA 4O91A 4TL0A 4MD9E 4XV1A 1MRYA 3E8DA 3RHXA 4QMZA 4GT4A 4RX8A 3VF8A 4TYEA 4B6LA 4LGGA 4LOPA 2UW9A 5FP5A 3UOLA 3UOHA 1H1WA 1FINA 4F9CA 3SW4A 5EW9A 3TG1A 1A06A 4ACHA 3KF4A 2WQOA 3PIXA 3PE2A 4RPVA 4I5HA 4Y8DA 4YBKA 5IQAA 1YXXA 4MD8E 2XF0A 5C8KA 1Q8TA 3PVWA 2C0IA 4GVAA 3R9RA 2C5NA 2V22A 4DCAA 2ETMA 1HCLA 4FSRA 5E7RA 3AD5A 4JDKA 2YDKA 4O2PA 4DEIA 3DXNA 4JBOA 5KBRA 3TZ7A 4QQTA 2WTKB 2YJSA 3GVUA 4RVKA 2X6EA 4Y95A 4C4GA 3CCNA 1RE8A 1XBCA 3I7BA 2UW0A 3VNTA 5HEZA 4O1OA 4D2SA 4J98A 2XIYA 3GEQA 4F6WA 2CKOA 4YSJA 3VIDA 2R3OA 4ENXA 4CFUA 4RFYA 2CNVA 4O0WA 1ND4A 4YURA 3FSKA 2XJ1A 3GCQA 1WBNA 2UZEA 4BICA 4YC3A 4GUBA 2WQEA 4WHZA 4HCUA 4ANBA 2OSCA 4YMJA 1W83A 3PP0A 4DBXA 4KABA 5HVYA 2UW6A 4L01A 3SV0A 4M97A 3LFCA 3VQHA 3WBLA 4DFXE 4B7TA 4B9DA 3ZOSA 3CTHA 5TO8A 4OAVB 2JBPA 2I0EA 3A60A 2VGOA 4APCA 5E8TA 3KKVA 3FKNA 4M12A 4FL3A 3GU7A 5BVFA 1UA2A 3C0HA 4IB5A 5HO7A 2W05A 3GCUA 4GFOA 1F3MC 2WZJA 3DGKA 4G16A 1H00A 3PG3A 5K5XA 3VW8A 2I6LA 4CEGA 1MRVA 5HNIX 5K5NA 3QWJA 4HGSA 3NW7A 3TNIA 3FC2A 4DT8A 3DU8A 4RJ8A 2J4ZA 1W98A 4IZ5A 3QUEA 4C58A 1B38A 3E3BX 4UB7A 1IG1A 4XBRA 3RK9A 2QO9A 3ODZX 3RPOA 1Q4LA 2WOUA 4D55A 3C5IA 3BGQA 5AMNA 2YM8A 4HJOA 2HZ0A 1Q8UA 3A8WA 2YZLA 2OF2A 3DKFA 3DZOA 4GK4A 4MF1A 2EB3A 4RMZA 4G6OA 3SG8A 5HX8A 3F3UA 3ZO1A 4G6NA 5EHLA 5AR2A 2IZRA 3AMYA 1BI8A 4MBJA 3B8RA 5HG5A 3U51A 1ATPE 2YJRA 3AXWA 3HYHA 2OZAB 4D4VA 3R71A 4EOMA 4JG8A 3SD0A 2FVDA 3H9FA 4AZTA 3NYNA 4V0GB 4UMTA 4R3RA 3NYXA 4GG5A 4WG5A 4CD0A 4NK9A 1URWA 4BHZA 2QG7A 3TL8A 4FTRA 3F61A 3I0QA 3UYSA 2UVYA 2PVNA 3FYJX 4LL0A 2VWIA 3K3JA 3R9DA 4G6LA 2VTPA 2QNJA 3GU4A 4FKOA 1ZWSA 3R63A 3PIYA 4QQ5A 4AN9A 2Y6MA 2OBJA 2X39A 4FVPA 5DFPA 3LM0A 3C4ZA 4WSQA 1V0PA 3RKBA 4II5A 3C1XA 5EI8A 4PPAA 4ZTQA 4FT3A 3MPTA 4NM3A 2J0IA 3A4PA 5F94A 4AACA 4BVUA 5CU6A 4ZSJA 2X7OA 4FSYA 3EQDA 2GNHA 2C6IA 3DXQA 2UV2A 4GYGA 3ROCA 4QNAA 4QMLA 5BMSA 4QP7A 4FEQA 4FUYA 5KHWA 4CFWA 4E4NA 4N70A 3UODA 3EL7A 2IZUA 5DN3A 2OIDA 3GENA 3GU6A 3NUPA 3R1SA 4DTAA 5B2LA 4XMOA 5LMKC 2PZ5A 3LXLA 1M7QA 3ZM9A 3IG7A 3EZVA 4WG4A 3ZRMA 4D4YA 2C5VA 2CKEA 5DA3A 5BUEA 1W84A 5AIRA 1J1BA 1J3HA 4OBQA 5DOSA 4OR5A 4XP0A 3Q9WA 4NKAA 5K0KA 3ORXA 2WKMA 5HG9A 3UJGA 4AG8A 3C4EA 3V5LA 5GZAA 2UW3A 5JRQA 4BI0A 3RNIA 3C4WA 1R39A 4JIKA 1YHVA 4FZFB 4X7QA 5IDNA 1XH5A 4FL2A 2F2UA 3GU8A 2VWWA 4Z16A 3LCTA 3OCBA 4NUSA 3DB8A 3KULA 3IDCA 3N4VA 2JBOA 3R7GA 5KMOA 4NT4A 4Q2AA 3WE8A 3R0TA 2YIQA 2W0JA 5C01A 3Q60A 3DA6A 2ETKA 4QMWA 1Z57A 4FTOA 3UIUA 5C1QB 2ZYBA 3CS9A 3KRLA 5IH6A 4NEUA 4EL9A 3BE9A 3PG1A 4PL4A 3NVMB 4L3LA 3I6UA 4CKIA 3FKLA 3F82A 2OK1A 4M69B 4JAJA 3CLYA 2PMNX 2QURA 3KRXA 4AW5A 5C9CA 3FZ1A 3ZS5A 5IUHA 3V8WA 4W4WA 2QOHA 4FTLA 3KK8A 4D2TA 2YN8A 3EQGA 3OHTA 4U40A 4EWHA 5J7HA 3QXPA 4FV3A 4CT1A 4FG8A 5E1EA 5HO8A 1IA9A 1OGUA 3I6WA 2BCJA 1NVSA 2A27A 5AP6A 3Q9ZA 4I5PA 2OJJA 2OXDA 4MAOA 5D10A 3TTIA 2BAQA 1H26A 5CZHA 5JKGA 3O7LD 4BCOA 4FV6A 3II5A 4QPMA 1B6CB 3DTWA 4XG8A 1KUTA 4CFNA 3O17A 2GHMA 3TDVA 5CVFA 4D2VA 3G6HA 3BWFA 5EM5A 2ZM1A 2C6OA 3TJCA 1XO2B 4BCPA 3H30A 2PVFA 4QO9A 3ET7A 2VX0A 4RZWA 2O63A 4E5BA 2BIKB 3U8WA 4MVFA 3COIA 3MESA 2RFSA 2XIKA 4EUTA 3RAWA 4IAKA 3EYHA 3D9VA 4N0SA 5IH4A 3M42A 5KO1A 3I0OA 1UNLA 3MFRA 3KXXA 3TJDA 1KOBA 1PXOA 4ZY5A 5E8SA 1JVPP 4NZWB 1ZY4A 3C4FA 3MH1A 2JDVA 5IA3A 4CG9A 5EM6A 2REIA 2E9VA 4FKUA 5BYLA 3OVVA 5AR3A 3RPSA 4CKJA 3Q5IA 4OTHA 4TWNA 5FDPA 3PY3A 3D5WA 4OTFA 2WHBA 4RJ3A 4GIIA 5AR4A 1LPUA 1RQQA 5H2UA 4FTJA 2IZSA 4FEWA 2ZV9A 4AZSA 1MQ4A 2J90A 4FV5A 3HRBA 3MGYA 4BCGA 5HQ0A 2ITNA 3EFWA 3IOKA 2PMLX 4DT9A 3MSSA 3FZTA 2C5XA 3M11A 4NW6A 4QMTA 4ACDA 5TF9A 4DEAA 4CZYB 2PK9A 3AC5A 4EC8A 4WBBB 5CF6A 3ORMA 4BGGA 3DPKA 2GTNA 3ROYA 4J71A 2ITWA 4JNWA 3NSZA 3FMDA 2GSFA 4QP2A 4FIGA 3KXNA 4JX7A 4P5ZA 3O8UA 2EXMA 3C50A 2PUPA 2C5YA 3TKIA 3UIMA 2GFCA 5H8GA 5LOHA 5DT4A 1L3RE 4XLIA 3VUKA 4L9IA 1QMZA 2ITUA 3E8CA 5DHJA 3HRFA 3D2KA 4XS2A 4F1OA 3VBXA 2I7QA 3OF0A 4TN6A 2HCKA 2E9UA 4C2WA 4DHFA 3EN9A 3HRCA 3MFTA 3NW5A 4NH1A 1REJA 3MH2A 3T3UA 4BDHA 2XNGA 1Y6AA 3EN7A 4MD7E 4FSZA 3GOKA 4EUUA 4KBKA 2GU8A 1Y6BA 2PY3A 3BLRA 5LWMA 1R3CA 4RJ4A 1YKRA 3FUPA 1J7IA 1FQ1B 3GQIA 3U6HA 2RFNA 2VWYA 1WBTA 4B4LA 4FEVA 4FNYA 3HV3A 5CSHA 5CSPA 2IJMA 5CU2A 3MTLA 4XX9A 5DEWA 3QQUA 4DEBA 3KVWA 5BVWA 2ERKA 3OOMA 4LRJA 2WEVA 2O0UA 4KA3A 4TKSA 3D5VA 5IEXA 4BZOA 3NX8A 5HLNA 1CM8A 1APME 1PXJA 2VX3A 2WTCA 4NM0A 5CU4A 3UDBA 5JZJA 5AAGA 4DH7A 3PXZA 3R2BA 5L2TA 1PMNA 4DFLA 1XH6A 3SXRA 2J0KA 3I7CA 4C38A 1W7HA 2GNIA 4BF2A 3V5PA 3WYXA 2Q83A 4IZ7A 3EQRA 3GNIB 3BI6A 2G1TA 4F9BA 3UVQA 3VBYA 4EK3A 4FT0A 4CNHA 3FY0A 3Q6UA 4PDYA 5CT7A 4EH5A 3TN8A 3O8PA 3CEKA 3PJ8A 2ITVA 3FI2A 2IN6A 4QMQA 5EOLA 5IQGA 4BDKA 3AC4A 2ZB1A 4XCUA 3FLWA 4D2WA 5A4EA 1TKIA 3FDNA 4A4OA 5L2WA 5J9YA 4J99A 4I5MA 3NAXA 3O23A 4LM5A 4AZEA 3ERKA 1FVRA 4CRSA 3HMPA 3LAUA 3VS0A 3EN5A 3PRFA 1ZMUA 2IW9A 4CYIA 4D2RA 4DGGA 1OBDA 2YWPA 5A4QA 4UXLA 2BALA 2R64A 3F7ZA 4DEHA 5J9ZA 4PDPA 4CFMA 3G33A 4GVJA 4R7IA 4BBFA 2B52A 3ENHA 4G3EA 1KWPA 4X2KA 2XB7A 4DG0E 5HTIA 2HY81 3SLSA 5CLPA 2R4BA 4FKJA 4M67A 3BWJA 3RPVA 3QX4A 2PVKA 1IEPA 4KAOA 4O6LA 4BCFA 1TVOA 4U41A 1OPJA 3AMAA 2W5HA 4R1VA 3ZONA 3OW4A 4FV2A 1DAWA 2ZDUA 3BHTA 1OIRA 3L9PA 3R7OA 1YRPA 4MXAA 4ALUA 3E63A 5L8LA 2OJIA 2CLQA 2WTVA 2QONA 3G90X 4FF8A 2E9OA 3MFUA 4FIEA 5FTQA 1Q41A 2WAJA 2YISA 4ACGA 3QCXA 5AR5A 2RG5A 4W8EA 3VN9A 5CEMA 4JQEA 5GNKA 4C4IA 5EQPA 3OBJA 5F4NA 4BR3A 4D1XA 2P3GX 4GKHA 5CWZA 4NIFA 5L8KA 3ACKA 5J7BA 4KUJA 2BZJA 3VW6A 4ID7A 2OH4A 4F7LA 3RINA 1OZ1A 2PWLA 4FSNA 4E6CA 4GH2A 3W16A 1KE7A 2WMTA 3ALOA 2IVUA 4H3BA 3KB7A 3MDYA 3IPHA 2ZAZA 3KMWA 3SRVB 4A07A 4AOIA 4BFMA 3G15A 4R7BA 4O7NA 1KSWA 2X4ZA 3BQRA 3NLBA 5E8VA 4A06A 5ICPA 5A4CA 2B7AA 4E20A 1XKKA 3R7VA 2YCRA 4XG3A 5C4KA 4DCEA 4USFA 2LGCA 3KMUA 4O27B 2FSTX 3EHAA 5CI7A 2OJFE 5IEYA 2XK4A 2OU7A 4RVLA 4EKKA 2GMXA 3OUKA 1GZOA 2ITOA 3R28A 3P4KA 4JG6A 4AUAA 4UZDA 5HD4A 4H3PA 2ZV8A 4U45A 2F9GA 3F3ZA 4GMYA 4JDHA 3TKHA 3ZUVA 1GNGA 5CYIA 1XBAA 2VTOA 4B8MA 3OROA 4QYFA 5I0BA 5KNJA 3CC6A 2ZV7A 2VTQA 3AGMA 3KMMA 3RBWA 3CIKA 3GI3A 2J2IB 4PNKA 4XV9A 2C3LA 4F9YA 5CEIA 4XOZA 3BPRA 1QPJA 3P7BA 5CAPA 4CMTA 4R77A 3LOKA 3CTQA 4IX4A 4ZOGA 5AP0A 3PVBA 3P0MA 2F4JA 2R3RA 4H1MA 3FZRA 4IFCA 3UMXA 4HYSA 4CGAA 3FLSA 4FG9A 4FTAA 4TY1A 1BMKA 3W18A 1YXVA 2E9NA 4RC4A 4FKPA 4ASDA 4PP7A 4Z55A 3F5XA 1VYZA 5LMAA 4PRJA 5A6OA 5IA0A 3QHRA 3KXGA 3KEXA 4DGNA 4GUEA 3VUGA 5JQ8A 1ZAOA 3BEAA 5I9ZA 3MTFA 3NNXA 3BGPA 4W4VA 3RWQA 3ZMMA 4XNEA 5IQDA 4IW0A 3FEGA 4DEDA 3JVRA 2YABA 3E8EA 3F7WA 2FSLX 3OY3A 4H3QA 4EYJA 4FICA 3P78A 4GSBA 4ANSA 4D4RA 4AZWA 5AV3A 4EJNA 2UZWE 1CKIA 3UVPA 3LCOA 4L46A 4FUXA 4D1ZA 1J7LA 1ERKA 3QD2B 3PZHA 4O38A 4EH3A 5IU2A 2R3HA 2NO3A 3TZ9A 5JMSA 3G9NA 2PYWA 5CASA 2DYLA 4BCHA 3NUYA 4CYJA 5ANEA 3JVSA 4ZTMA 2O65A 3HZTA 2PL0A 4Q5EA 3F2AA 1O6LA 4BZDA 3Q3BA 2IPXA 1OKZA 3HMNA 4JXFA 4LUEA 2RGPA 3K5VA 3QZGA 4AA4A 4AOJA 4F7JA 1T46A 1QPEA 4ZSAA 3SA0A 3FLQA 3QU0A 4UMRA 4PTEA 3AT3A 4RJ6A 2CKPA 3ZSGA 5AEPA 4GJ3A 3V8SA 5HE1A 4TT7A 4B99A 4QMUA 4XUFA 2R3QA 3D14A 2UZOA 4FYOA 2CMWA 3S0OA 4L00A 3E93A 4MNEA 2VTLA 1LEWA 1OUKA 1LP4A 2OIBA 3KVXA 4RC3A 1LUFA 3A7FA 1LR4A 3QL8A 5CT0A 2GNFA 4IC7A 5CY3A 3ZTXA 4PQNA 3DCVA 3MVLA 2Z7QA 4BDDA 3W2CA 4X3JA 4AWIA 4XP3A 2EB2A 3EQIA 3IK3A 3COHA 5EDRA 3JY9A 1KOAA 4NKSA 5L4QA 4YZMA 2XEYA 4P2KA 3UC3A 1CSNA 4O7VA 1MP8A 1HOWA 3CQWA 3V01A 4X3FC 1CKPA 4UYNA 4OTDA 3RWPA 5AP4A 1H0VA 3LQ3A 3ENMA 4EOLA 5EG3A 1S9JA 5HI2A 1JKSA 4LYNA 4PF4A 5M51A 4U8ZA 3FQHA 2HK5A 2VNYA 4MTAA 2PVYA 5J1WA 3KN6A 3SGCA 3NIEA 4YZBA 4BC6A 4UN0C 4JG7A 4PL3A 3HA8A 2BRHA 5ETCA 2C6EA 4DG2E 3PSBA 4CKRA 4USEA 3N51A 1XH8A 3CGOA 2P0CA 4HZRA 3T9TA 3ORTA 3A7IA 4FZDB 5E8UA 4ZTRA 4PMPA 3Q4UA 3DKOA 4LI5A 5ANOA 2WO6A 3FC1X 1WBPA 2QOIA 4RX5A 3MW1A 3O0GA 2YZAA 4K18A 5ANKA 3TCPA 1Q8WA 3AT2A 2C6DA 3UO4A 4CVAA 3PA4A 4FBXA 4OLIA 4KIPA 4C3FA 4EKLA 3QRUA 2JGZA 2C3KA 3DB6A 3QYWA 4RGJA 2J0LA 5GIOE 1SZMA 4FIHA 4I0RA 1F5QA 2UZVA 3ZFMA 5EHOA 4LRKA 4ZTSA 3HP5A 2C0OA 5HVJA 4GL9A 3WI6A 1J91A 1H28A 1YXUA 5AAFA 4RFZA 5BPYA 2Y6OA 4QMYA 3UQFA 3PIZA 3VHKA 3RJCA 3VBTA 4HZSA 3RHKA 4EOPA 4ACCA 3R9NA 1XR1A 2IZTA 2F7ZE 2YAAA 3NUXA 3QKKA 4D0WA 5IQFA 1NVQA 4YJTA 1LEZA 5BQ0A 4CSVA 3ZBFA 3PLSA 3UQCA 2R2PA 4FKWA 4AN3A 3LFEA 4FZAB 3H4JA 4KIKB 3OBGA 1JKKA 4W9WA 4DTBA 3PWYA 4PTGA 3PJ3A 1YXTA 2VNWA 2EXCX 2J6MA 3O50A 3TNWA 4EQCA 2XMYA 4HYUA 5HORA 4R3PA 3B8QA 2OI4X 4TYHB 2HENA 3TT0A 4C35A 2UUEA 3FKOA 5AX3A 5DR6A 5B2KA 3R1YA 5JEBA 5HBHA 2R0UA 1BUHA 2HZ4A 2XM8A 3PJ1A 4DH5A 3QCYA 2WTWA 1FGKA 1ZYDA 4GT3A 4F09A 4BCNA 3JY0A 3BU6A 4YJQA 1CDKA 5CSVA 4BRXA 2YM3A 4LV8A 4CCBA 4M7IA 3UG2A 5IUGA 1BLXA 3HV4A 4RWKA 3MH3A 1HCKA 2OXXA 5LWNA 4XRLA 3CBLA 2W99B 3FHIA 4RZVA 2CDZA 2OWBA 4WIHA 5KBQA 2JDOA 3NNWA 3F5UA 4JJRA 1ZYCA 4I5CA 4QOXA 4FGRA 3ATSA 3ID6C 2VUWA 5FG8A 1OBGA 2CN5A 4PUZA 4WA9A 1ZMVA 5LQFA 1Q62A 4YC6A 3ANQA 4GCJA 2B1PA 4J52A 3RM6A 3AT4A 3LZBA 3U4UA 2I0HA 3I5ZA 4MWIA 2IVVA 5GZ9A 3VS3A 4WNOA 5GIPE 1PKGA 3FZPA 2GDOA 5IA2A 2JFLA 4AGUA 4WSYA 3PA3A 2WMSA 3QGYA 5E8WA 3RI1A 5KMNA 3PE1A 4RG0A 2Y4IB 4E73A 2Y8OA 3DK6A 4JDIA 2Z8CA 3OD6X 4OBOA 3BYSA 4EZ7A 5C03A 3AOXA 4C61A 3FLZA 1R0EA 1YWNA 2BMCA 2R0IA 3F6XA 4JRNA 5L8JA 3BYOA 4C33A 2W5BA 5TT7A 4S33A 2G01A 3GQLA 1PXNA 2BR1A 4FV4A 4LV5A 3KULB 5IA4A 3IKAA 4ZLOA 4GW8A 4YTFA 4WOVA 4TYJA 1BL7A 2WU6A 4BCMA 5AIKA 5AA8A 3KCFA 4GG7A 2VZ6A 4IWOA 3N4TA 4CFVA 4CQGA 4ANMA 2NRUA 1YI3A 2J5FA 4ZLZA 3NAYA 3GFWA 5HX6A 3VVHA 4UWCA 4TNDA 4RVMA 4JR7A 1U59A 4WKQA 4GYIA 4IQ6A 3WZKA 1PMVA 3HGKA 2A0CX 4MBLA 3AC3A 4YJRA 1YDRE 2QU5A 2ITXA 3QLGA 2XKFA 5KMMA 2UZNA 3KL8A 3S00A 1L8TA 2IW6A 2X9FA 4IX5A 4EOKA 4FG7A 4FKVA 4WNKA 3ZDUA 2P33A 4CT2A 4HYHA 2X9EA 5ETFA 4DLJA 4A4LA 4IVCA 3Q5ZA 2PE1A 2X8DA 3ZEWA 2XK8A 4AT5A 3FSFA 4XG2A 4BWKA 3PYYA 3Q6WA 4UMQA 1IAHA 1E9HA 3KGAA 5KE0A 5B7VA 3LFSA 4EEVA 3BBWA 3NUSA 4I0SA 2BKKA 3HDMA 1PXLA 5ITAA 5JFSA 3DAJA 4FSTA 5CVHA 4NTTA 1WZYA 3DV3A 3HMOA 1M7NA 4XHKB 5HTBA 1JAMA 3B2WA 3OXIA 2KULA 1Y8YA 5HICA 1Y91A 3BKBA 1TQPA 5D12A 3VBWA 5DGZA 5AP3A 2VTMA 1Z5MA 3CPCA 3LHJA 4O6EA 3QWKA 3UO5A 3W10A 5J95A 2LAVA 2WTIA 1OIYA 3PJ2A 2WTDA 2PMIA 4GFMA 1H01A 2BVAA 3DK7A 4DLIA 3ZO4A 2HW6A 3QTRA 4DEGA 5B2MA 4Q9SA 3S3IA 2YIYA 1M14A 3MS9A 4RWLA 3IS5A 2XVDA 2G2HA 4L44A 2O5KA 2VV9A 4FODA 4XEYA 5CANA 4MXOA 4U5JA 2OGVA 4BHNA 3KFAA 4ASXA 3F3VA 4M14A 5CU0A 1SM2A 1U46A 2VTNA 3FL4A 3NEWA 1OM1A 4B8LA 3VS6A 4OBPA 5J87A 1XWSA 4MKCA 2C47A 4EBWA 4MQ2A 3VBVA 4CZTA 3FMMA 4L67A 2WQMA 2QC6A 4QQJA 2FA2A 3MPAA 4J95A 4KINA 4LGHA 3R30A 3Q4CA 4ZZNA 3SQQA 3Q32A 5ANGA 4U0IA 4E6DA 5EDQA 4Y72A 4AXAA 3DBFA 2RFEA 4ZSEA 3UNKA 1H27A 4F4PA 3F3TA 3R1QA 2H96A 2JAVA 2WMQA 4NM7A 4BBEA 5BYYA 5AADA 3R8MA 3C4CA 4TTHB 4D2PA 2XKDA 4X6RA 4AGWA 3Q53A 4KIQA 1UWHA 2B0QA 3RCDA 2BFXA 3V5QA 4R78A 3NDMA 5AR8A 2W7XA 2VWUA 4EH8A 4GFGA 3PP1A 3VUHA 4LRMA 4TWPA 1V0BA 4QYYA 2H34A 4UY9A 3F88A 2WB8A 3OG7A 1OI9A 1FPUA 4XH6A 3HAMA 3E88A 2YIXA 4MK0A 2YDIA 4FOCA 1M52A 4Y85A 4X2JA 4DAWA 4RLKA 4OT6A 5L6WL 3OWKA 4HNIA 1WCCA 4K77A 4LGDA 5AJQA 5TKDA 3S95A 3AQVA 2A1AB 4H39A 4DITA 3NVKI 1ZY5A 2WNTA 2UZUE 4O0UA 4ONAA 1GJOA 3HMIA 2CCHA 5C8NA 2W1ZA 1YDTE 4FGBA 4IB0A 4NJDA 2BTSA 2QKWB 3CP9A 4WUNA 2RFDA 3KY2A 3R9OA 1PHKA 4JAIA 4BGQA 1H0WA 4UX9A 3BIZA 3KN5A 5E91A 5ANJA 4ZSGA 5B0XA 5AV0A 5HE3A 3DDPA 4W9XA 2ITTA 3PPZA 3QQKA 4QD6A 4YTCA 4CV8A 4UBAA 4LFIA 1PMEA 3LMGA 4RRVA 2WQNA 4BYJA 4MNFA 5CTPA 2QHMA 3EKNA 4MCVA 1W8CA 4NYEA 2R7BA 3MY5A 5J79A 2RG6A 3HX4A 3HKOA 4NCTA 5IDPA 2PZPA 3PY1A 4XV2A 4QYHA 2GHGA 5LVPA 4J8MA 3HNGA 3GUBA 2GFSA 5HNGA 1BKXA 4QP4A 5A3XA 4JDJA 3QD0A 4IX6A 2VTSA 4GRBA 1GIJA 2YCSA 3P5KA 4EONA 1QPCA 4HVHA 3MB6A 2PVMA 4FSWA 1WMKA 4L52A 3RZBA 3H0YA 4IM0A 4J97A 4IAYA 2W96B 4FR4A 4OTIA 4C34A 5L6PA 1Z9XA 4BI1A 3FZOA 3R8LA 4EQMA 5M4FA 4HGEA 3E87A 5KKRB 1OB3A 5DNRA 4R6VA 1KV1A 2QQ7A 3DFCB 4FL1A 3M2WA 4PDSA 2OJ9A 4KWPA 3FLNC 4Y5HA 5KZ0A 4AF3A 4CCUA 3UMWA 4QRCA 4D4SA 5IA1A 3W2RA 3RPRA 4IZAA 5BUIA 3FXZA 1PXMA 3LJ1A 3WE4A 4A4XA 2CNUA 4FEUA 2E2BA 2FUMA 2JIUA 3DNDA 4QPSA 3ZSHA 4CFXA 4D28A 5BVOA 3PY0A 2XEZA 4FI1A 4O7ZA 2B9HA 4MH7A 2WMBA 3F3WA 3ORIA 5GJFA 3Q4TA 5KX8A 3OZ6A 4FKSA 5GHVA 4APPA 2PUUA 4KBAA 2IO6A 3CPBA 2PUNA 1YOJA 4R1YA 2YACA 4EWQA 2WTJA 3GP0A 4MNEB 4O0YA 4L6QA 1J7UA 2WXVA 1TQIA 2BHHA 4QYGA 5KZIA 3TWJA 4D9UA 4PWNA 1NY3A 2B9JA 2BDWA 4V0GA 3UZRA 3E64A 4UWYA 3LQ8A 4FV9A 4FEXA 2YCFA 2Y9QA 4U97A 4BTJA 4GK3A 4WRSA 4M8TA 5EYMA 5EYCA 5JGDA 5DYJA 3ZFYA 2Y4IC 1WBWA 2PZRA 3W2QA 4OW8A 1YI6A 1XJDA 3PA5A 4L7SA 2W1CA 3R2YA 2C4GA 3QQGA 1UWJA 4M0ZA 4ZTNA 3FQSA 2CPKE 2WTKC 5CI6A 4BKYA 3HV5A 2PULA 3R02A 1SNUA 1Y57A 4EOSA 3OEZA 4YGAA 2YCQA 2W06A 1YDSE 5FLFA 3VRYA 4C7TA 3KRRA 2HWOA 1WVYA 2B53A 4C3RA 4GIHA 1YW2A 4L3PA 4FNWA 3RAHA 5I3RA 2X8EA 4YJOA 5DVRA 4BYIA 1OL1A 4AGCA 5CALA 4HVGA 2J5EA 5HCXA 2WMRA 3Q9XA 2W4OA 3G2FA 4U80A 4ANLA 3SHEA 3LVPA 1GAGA 1WFCA 5E90A 5FM2A 3DAKA 4BB4A 3GXLA 4PX6A 2UVZA 4I24A 1ZOGA 3NYVA 4JLCA 4FIJA 4O1PA 2I0VA 4AX8A 5CAVA 4PPCA 3FPMA 1G5SA 4S2ZA 3VUMA 2RL5A 3FJQE 2GTMA 4AAAA 5G1XA 5L2IA 3E92A 5J9LA 1GZNA 4RBLA 3ORKA 3MPMA 2DUVA 4Z7GA 4U43A 3CTJA 1XHAA 5E92A 3BZ3A 2BKZA 2WMAA 2OKRA 3O51A 3QXOA 1O6KA 5FBNC 3OS3A 3UO6A 4BDFA 4MWHA 4FV0A 3W2SA 5AA9A 3SX9A 1UV5A 4F9AA 5HBJA 1BL6A 5CQUA 5CVGA 4GT5A 5JH6A 1ZOHA 3KQ7A 4OAUC 3OEFX 1JSVA 1G3NA 3UGCA 3F5PA 5JGAA 3EH9A 3JR1A 3H9RA 4LMUA 4EK4A 3QQHA 3VO3A 2C3JA 2CNQA 1PJKA 3QTUA 4FZ7A 5AV1A 5IQEA 4BTFA 5K9IA 2VGPA 4YHJA 1VEBA 3OWJA 3RK7A 4FYNA 4O84A 4ZS0A 1STCE 4IZYA 4FSUA 4NL0A 4ITJA 1RW8A 3BU3A 3IGGA 3FPQA 4S30A 3G51A 3W8QA 4ZMEA 4JX3A 1UKIA 3KXHA 3ULZA 5IMEA 4J8NA 4BZNA 4C4HA 4DEEA 4HVDA 5CEQA 3IW5A 3KU2A 4FK6A 2OIQA
chains in the Genus database with same CATH superfamily
4JMQA 5CX9A 3U6JA 3R7YA 4A9YA 4N57A 4AQKA 1A48A 3O96A 4R5YA 5BX0A 4IIRA 5AP1A 4HNFA 3ZH8A 4KIKA 1YI4A 3ELJA 2X6DA 5HBEA 4FKIA 4O21A 5I9YA 4IAZA 5K0XA 2JIVA 2XYUA 3LE6A 3TACA 3R21A 3Q96A 5CXZA 4RC2A 5I9VA 4O0RA 5HIDA 4QMVA 4ANQA 5EFQA 3QKMA 5AM6A 4BDAA 4I22A 2E9PA 4MX9A 2BZHB 3HUCA 3U4WA 1Q97A 3R7IA 4BWPA 4JI9A 3KRJA 3WF9A 2XRWA 4XRJA 2ZM4A 4HGLA 2PTKA 1ZOEA 3JXWA 4PMMA 3SDJA 4E8AA 3QTZA 2UZTA 2JKKA 5LXMA 3PJCA 4J1RA 4XYFA 5HOAA 2EXEA 2WEIA 3ZO3A 4QPAA 5IQIA 2OXYA 3WZEA 2DWBA 5C4LA 4A9UA 4F7SA 4CG8A 3VULA 4D1SA 4AA0A 5HCZA 3F9NA 1MRUA 4YPDA 3HMMA 5H8EA 3ZSIA 3C0IA 3EYGA 2QOQA 4G3GA 1B39A 4IDTA 3O7LB 3Q52A 4NW5A 3VHEA 1FGIA 1OVEA 4KRDA 4FV7A 5T6KA 4EQUA 4CFFA 5F20A 3HAVA 3OY1A 4BDGA 5ANDA 1IRKA 3D5UA 4NSTA 4ZJIA 3SOAA 1OL6A 3L8XA 5L2SA 2BRMA 1OL7A 1JQHA 2CGXA 2IVSA 3OOGA 4E6QA 4AZVA 4HPTE 2PMOX 4U81A 4G17A 3QTWA 1I09A 2R3PA 3G6GA 4NWMA 1OKVA 4O0SA 2X0OA 3VWAA 3HUBA 4E93A 5IQCA 4P7EA 5D1JA 5LCKA 1YOLA 4MHAA 3TV6A 3V6SA 3O2MA 5FDXA 1Q8YA 4ZAUA 2G15A 3C51A 4IM3A 3DOGA 4FKTA 3UIBA 3ZLYA 3HV7A 3C4XA 4UEUA 2B55A 3A2CA 4F08A 1PW2A 3D4QA 4H58A 4IWDA 2UW8A 4O4CA 2GS6A 4EK6A 5AWMA 4E3CA 4O7LA 2C1AA 2OICA 4AU8A 1E1XA 2Z7RA 1H8FA 2PSQA 2ZOQA 3ORZA 5A9UA 4ORKA 5M09A 4FOBA 2F57A 2UVXA 3I1AA 3KC3A 1GIHA 3EL8A 5ACKA 1VZOA 4C2VA 5IA5A 3VRZA 3EFJA 3VS4A 3ZRLA 2R3NA 2JEDA 3OCGA 4LQMA 3C5UA 3PTGA 3QC4A 4V01A 4M84A 1XMLA 3LXPA 2H6DA 3ZLSA 4IC8A 2AUHA 4EH9A 2RKUA 4FSQA 3UOJA 4C8BA 1OL5A 4JQ8A 5HVKA 1F0QA 2WU7A 5I9WA 2OH0E 3Q9YA 4MXXA 3ZHPC 1M2QA 5CU3A 2WIHA 5F95A 2XA4A 2PVLA 4JQ7A 4TRLA 3NR9A 4ZK5A 4JVGA 2X7FA 3CSVA 4RWIA 2GNLA 1FVTA 1KE5A 3K2LA 4YC8A 1H1QA 5F1ZA 3V04A 5A6NA 3OTVA 5KMIA 3GT8A 3QLFA 5M44A 1YQJA 4EH7A 2J50A 3LIJA 4J53A 4AFJA 4AAYA 1UU8A 3IOPA 3BEGA 3RM7A 3OTUA 3R7EA 5IF1A 4U44A 5DG5A 3ZFXA 4EOIA 2C68A 4BCKA 5E8XA 1JNKA 4AW2A 3PZEA 3WZDA 2C1BA 5CQWA 4YR8A 4O83A 4K0YA 2H8HA 5M08A 1TQMA 2F49A 4F0IA 4XBUA 4QP3A 5EQYA 4FVQA 4IAAA 4YO6A 5IH5A 3QYZA 5HIBA 2V7OA 4QP9A 3LLAA 4E1ZA 3ATTA 1PKDA 3DS6A 3QZHA 5DT0A 2JDRA 3LFDA 1DI9A 3BU5A 3MIYA 5DBXA 4KB8A 1W2FA 5C8MA 3W2OA 3QAME 3MH0A 2BRNA 1Q3DA 2F7XE 3EQCA 2XNPA 2R9SA 3KK9A 1VLRA 3UE4A 2BUJA 2ESMA 4QYEA 3WF5A 3OXTA 4G1WA 5M57A 4GK2A 2B4SB 4AE6A 4ZP5A 3IDPA 4JBPA 4F99A 4FNZA 3QTIA 2F2CB 4M13A 3PDTA 3W0SA 4IE9A 3EOCA 2DS1A 3V51A 1XH7A 4UXQA 1YOMA 5JFVA 3VONA 1P2AA 3TIZA 4M68A 3G0EA 4L3JA 2J9MA 3QCQA 4FMQA 4D5KA 2BRGA 4BTMA 5K3YA 4BIEA 3BL9A 4BTKA 5FUTA 4QT1A 3WZUA 2XK6A 1OGYA 2JDTA 5EI2A 5BVEA 2YA9A 5JZNA 4C59A 3GGFA 1WVXA 2FSOX 3SXFA 3G5DA 5JN2A 4NJ3A 2XNEA 4I21A 4IXPA 1OPLA 2AEGA 4DFUA 5M4UA 4FT5A 5CEPA 4G9RA 4ZLYA 3UPZA 1XBBA 2W1EA 4ANNA 4GS6A 1FMKA 4F9WA 4EJ7A 2HXQA 4RIXA 3RTPA 3N9XA 5AUZA 5HU3A 4O81A 4QMXA 3WOWA 2HAKA 2AC3A 2OFVA 1H25A 2XNNA 5CF4A 4I93A 5AR7A 5FWKK 1X8BA 3DKGA 4JIAA 1KE6A 3BV2A 3REPA 2Y0AA 5EI6A 2JAMA 4G3CA 1AQ1A 2NPQA 4IANA 4O7SA 4ITIA 4PTCA 3W8LA 2HOGA 1ZZLA 3CKWA 3PXKA 4XV3A 4EZ5A 4IAFA 2IG7A 1W0XC 4AA5A 5EK7A 2V0DA 2XZSA 2O8YA 2W4JA 3DJ7A 3OCTA 1R78A 4JL9A 1FBNA 4I23A 2BIYA 2BRBA 3NW6A 5FEDA 4BJJB 4DFYA 2FH9A 4KD1A 5D7AA 4TYHA 3HVCA 5CENA 2ERZE 4DH1A 4E26A 2IW8A 1U5RA 3KF7A 3RP9A 3TDWA 5LMKA 3F2RA 2CLXA 4ZZOA 5FBOA 4YPSA 4AE9A 1EH4A 4GKIA 3A8XA 2BTRA 5D7VA 2VRXA 3SXSA 2VO6A 3U6IA 4MXCA 2XRUA 4WNPA 3DFAA 1NT2A 2VWXA 1XH4A 4JRVA 1GZKA 1PXKA 5DRBA 3TV7A 4YLKA 4BWXA 3TUDA 5DH3A 4RX7A 1Q24A 1OUYA 5HLPA 3VUIA 2I0YA 3SKCA 5KHXA 5H9BA 3M1SA 2XIXA 5GINE 3VF9A 3A7GA 4HPUE 4C4EA 3QRKA 3JPVA 3RGFA 3WF8A 4ERKA 3IGOA 2YM6A 4BCIA 1H07A 3LFAA 4HCTA 4WNMA 1PY5A 5HZNA 2EWAA 3AGLA 3T9IA 2W1FA 3DK3A 4BCJA 3RK5A 4E4MA 1A9UA 1ZLTA 4ANOA 4C4FA 4XLVA 4E4XA 3ITZA 5JK3A 5FTOA 4GU6A 4BN1A 3FI3A 3H10A 3QRTA 4L53A 3OP5A 2X7GA 2VWVA 2V5QA 1P4FA 1PXPA 2QOFA 2RF9A 2XNBA 2ZMDA 3H0ZA 3LJ2A 4YNEA 4EHEA 4HW7A 3P86A 5FTGA 3BL7A 1H24A 1U5QA 3ODYX 2R3FA 4YP8A 1SMHA 1NXKA 3EWHA 3LLTA 3TMOA 5AUXA 5EYKA 1PRYA 5LJJA 3DY7A 4UALA 2P4IA 5K4IA 3QCSA 4G9CA 2XIRA 4IDVA 4RIYB 4FZ6A 4A9TA 1URCA 4DGMA 1PYXA 2V7AA 4CLIA 4LL5A 5L3AA 2JFMA 3QD3A 1JSUA 1KV2A 4TYIA 2NRYA 2QODA 5GJDA 3VQUA 4BI2A 2XAOA 2WOTA 2QR7A 2VTRA 4K2RA 1YXSA 4LOOA 4CLJA 3CJGA 1ZRZA 2I1MA 2R7IA 2UZLA 3V3VA 4I94A 2W1IA 3ZO2A 4BKZA 3TUBA 1AD5A 1PXIA 3OW3A 4E7WA 3FBVA 4I6QA 3ZZEA 4EHZA 3BHUA 4QP8A 5J5TA 2IWIA 2UW7A 3ZC5A 4BJJA 4RT7A 3F69A 4MYGA 4Z7HA 3LXKA 4UWBA 5KMKA 5A54A 4FNXA 3FXWA 2VTIA 2PE0A 5CXHA 3JYAA 1M2RA 3R83A 1OKYA 4CZUA 3RALA 3NFGB 2CHLA 2VO0A 3TI1A 3Q2MA 2W1DA 2I40A 3IW4A 2ZJWA 4WD5A 5E4HA 4ZJJA 4Q5HA 4JT3A 2QKRA 3B2TA 3ZZWA 4TXCA 4IB1A 1Q99A 4BDCA 5CAOA 3DTCA 3L8PA 4G2FA 3A99A 4C4JA 2VTHA 1RJBA 2XH5A 3CGFA 3HP2A 3DQXA 4FTIA 4E4LA 3PXRA 1H1SA 3EKKA 4QQCA 5ETIA 3DDQA 4AFEA 4DFNA 3OT8A 3OT3A 4OTGA 4FTMA 3ZYAA 3LMIA 4G31A 4TPTA 4F70A 4IWPA 2O3PA 2X2LA 2X4FA 5TE0A 5CEOA 5KMLA 4G3FA 2W1GA 3BE2A 4Y46A 3WZJA 2Y4PA 5TR6A 5AAEA 3A7HA 3R04A 5CAUA 4RFMA 5IQHA 1IAJA 4EK5A 1V1KA 4XG7A 4XJ0A 5LVOA 3LPBA 4LOQA 4RIWB 3UOKA 4AOTA 3VC4A 4BBMA 1H08A 3L8SA 3I81A 3GFEA 1SYKA 1ZYSA 3MJ1A 1SVHA 3PWDA 2J51A 3H3CA 3QBNA 3FLYA 3QGWA 4X2NA 5FGKA 4EC9A 3UYTA 2C6LA 3SOCA 4TNBA 4FKGA 5HGIA 4CRLA 3A4OX 3TZMA 2YIWA 4WUAA 3ULIA 4ZMFA 1P4OA 3QQFA 3P9JA 5CZIA 2VTTA 1VJYA 3FMKA 4RIYA 3FMJA 3WARA 5H3QA 3LCSA 4AZFA 5A46A 2QI8A 5IUIA 4FIFA 5E1SA 3ALNA 2W5AA 4MXZA 3PVGA 3VBQA 3ZXTA 3D7ZA 5AV2A 4IM2A 4FT7A 4CQEA 2KTYA 3VS5A 3KREA 3MYGA 4Z9LA 3NWWA 5I9UA 3CY3A 4DYMA 4AW0A 3W1FA 3R01A 4ZY6A 2XAMA 2B9FA 5HE0A 3FY2A 4U6RA 4KNBA 4F1TA 3WYYA 4J7BA 4EH2A 1P14A 2W1HA 3QX2A 4UYAA 4IWQA 2P2HA 3PVUA 4KSQA 4QNYA 4U9AA 4C36A 5FM3A 3L8VA 5L2QA 4BCQA 3R8PA 3ZLXA 5HU9A 4BDEA 4K1BA 2ITPA 4MEDA 4FC0A 2XNOA 4YU2A 3NFFB 1ST4A 5E8YA 4WG3A 2CGUA 2HZIA 3GCVA 3CQEA 4I1ZA 4TZRA 4O96A 4MBIA 4F65A 5EQEA 3GCPA 3DJ5A 3OCSA 2UW4A 3HECA 4DH8A 1OL2A 5JGBA 3AC2A 3PLAE 4PP9A 3KXZA 2ONLA 3COMA 1SNXA 2PZYA 2YAKA 3P08A 4G3DA 5DT3A 3ZCLA 3MA3A 3FE3A 3BBTB 3AC8A 4U3ZA 4EK8A 2IEWA 4GV1A 4ALWA 3DAEA 2ITYA 2PVHA 1VR2A 1JWHA 1DI8A 3IW6A 3LXNA 3P7AA 4FTQA 4TYGA 3D5XA 3QTSA 2PU8A 2QLQA 3CD3A 2OZOA 3EQPA 4CTCA 4D58A 4O0XA 4AQCA 1Y8GA 3RAIA 3EJ1A 4TW9A 4AT4A 4ZEGA 3UP2A 1AGWA 2XIZA 1U54A 5M06A 2JKMA 3QRJA 4FT9A 2R3JA 3O8TA 2JKQA 3PSDA 4F0FA 4YJSA 2AYPA 3L9MA 1QPDA 5LVLA 4DGLC 3RNYA 3QZFA 4YTIA 1IASA 4ZJVA 2QOCA 2R3GA 4F7NA 3R7UA 4UMPA 5M4CA 5D41A 4ENYA 5BVDA 2YFXA 3EQBA 1O6YA 4GEOA 1JBPE 3UZPA 4CXAA 1PF8A 3E8NA 3UQGA 2ITZA 1ZZ2A 2FGIA 3BGZA 3U87A 2XK7A 3ZLWA 4QTBA 4RVTA 5ETAA 4GU9A 2QOOA 5DLSA 4KBCA 2P2IA 1SVEA 3V8TA 5KKRC 2XS0A 2VO7A 1GIIA 2GS7A 3R8VA 4QTEA 1UU3A 2C6KA 3MV5A 4L42A 3RAKA 4OTWA 3DXPA 3ORLA 5ANIA 4ZTLA 4F63A 4RIXB 4IJ9A 1T45A 3BHVA 4A7CA 4HYIA 4DC2A 1TFFA 2Z7SA 4EYMA 4G5PA 3EFKA 3R00A 3F2NA 2PVJA 1CTPE 2QD9A 2VWZA 4O7TA 2WQBA 4V04A 5I5ZA 2HYYA 1H1RA 4H1JA 1KE9A 4I92A 3RMFA 5AUUA 1WBSA 2ZM3A 3NYOA 3UPXA 5EKNA 3GC7A 4X2GA 4F6UA 2R5TA 1FVVA 2QOLA 2WMUA 4U42A 4IBMA 4OGRA 1PMUA 4O4FA 3S4QA 3SVVA 2WD1A 3BQCA 4FE2A 4M15A 5EW3A 4USDA 4DF3A 3P7CA 4C0TA 3TM0A 4K11A 4LUDA 3AMBA 2WGJA 3GBZA 3LJ0A 4IHPA 3R8ZA 4EHVA 3S1HA 4LV7A 3LMHA 3WILA 4IMYA 3PPJA 5G6VA 3Q2JA 2QO2A 2G9XA 1CKJA 4IADA 5HLWA 2OZAA 4RQVA 3EIDA 4DFZE 3LFNA 3K54A 4QMPA 4ZY4A 4I4FA 3DBCA 4KRCA 5CSXA 2BFYA 3DBDA 3U9NA 5IMXA 4WBOA 4O0VA 3ORNA 3MY1A 4LG4A 4YJPA 1J1CA 3LFQA 5DPVA 1YVJA 2XYNA 2VTJA 2QO7A 3FV8A 5E9EA 5HIEA 1MUOA 4FTTA 2QVSE 5EDPA 1OECA 5DEYA 4X2FA 2QR8A 2C3IB 3ORPA 3BLQA 3TKUA 2HELA 5D11A 2YWVA 4FTUA 4M0YA 5FD2A 3UBDA 4TWCA 3GC0A 3OXZA 3FMEA 4E5AX 4BDBA 4FKRA 5DRDA 3VS1A 1QCFA 2GPHA 5EM7A 4FV8A 3LFFA 3WIGA 2O2UA 3LM5A 2WIPA 2XBJA 5CAQA 4QMSA 3UIXA 5DR2A 4D5HA 3KCKA 5FEQA 1O9UA 2X81A 4YNOA 4X21A 3AC1A 1JOWB 3QRIA 2PUIA 4PMTA 5I3OA 5AM7A 3RZFA 2W9ZB 3P23A 2Q0BA 2VN9A 3PRIA 2W9FB 4WT6A 3K5UA 5LVMA 3QFVA 3QA8A 4RA4A 2P55A 3RCJA 5KUPA 4UV0A 3VS7A 4PL5A 2VD5A 4CV9A 1U4DA 4YZCA 1K3AA 3NMUF 1YHWA 3ZDIA 4EI4A 4I6BA 2W4KA 3VJNA 5IG1A 3CJFA 3TV4A 1DS5A 4ZIMA 4ZZMA 2VTAA 1DAYA 3D0EA 3QA0A 3C0GA 3OWLA 4YZNA 3QUDA 3W2PA 5IPJA 2XUUA 3TEIA 5GJGA 5HNBA 4BDIA 2CSNA 4UMUA 2HWPA 2R3IA 3HDNA 4HGTA 4PNIA 3R9HA 4O86A 4G5JA 5KMJA 2YITA 4IEBA 2C30A 3JUHA 4GJ2A 3BHHA 5FP6A 4ARKA 3U55A 3GU5A 2OJGA 5DE2A 4ITHA 2GNGA 4M69A 4I6LA 4CTBA 3VS2A 4C3PA 3UDSA 2H9VA 2VAGA 3A61A 3KXMA 3UG1A 5HD7A 4K9YA 4PY1A 2Z60A 2XP2A 3F66A 3TNQB 3TZ8A 5IZFA 4QMNA 2J0MB 3A7JA 4A9SA 3BLAA 2ITQA 3AD6A 4DA5A 1OPKA 2XBAA 2XJ2A 3D15A 5EKOA 3VJOA 3ANRA 5CF5A 3LKMA 4AXDA 2ETRA 3C7QA 4V05A 4YLJA 5M56A 4G34A 5J1VA 2OO8X 2QU6A 3BELA 2GCDA 2A19B 1UVRA 4IX3A 4O7YA 3UDZA 4W4XA 5BMMA 4BKJA 3T3VA 5JFWA 1GOLA 2AC5A 3MVMA 2ACXA 5EW8A 5C26A 3UNZA 2EUFB 4R7HA 3GB2A 5KCVA 2SRCA 4IFGA 5IQBA 4O7RA 5M55A 4F6SA 4O82A 2HXLA 2GNJA 4QP1A 5FXQA 4KS7A 3IW7A 3MBLA 4NFMA 4XG6A 1FOTA 5DIAA 3SG9A 1BI7A 4EH6A 4OTPA 4AN2A 5I9XA 2ZMCA 1YWRA 3TIYA 5AUTA 3NPCA 4KIOA 4YZ9A 5HO6A 4FK3A 1R0PA 3UVRA 3OMVA 3D94A 3POOA 5T3QA 1REKA 4P4CA 5BV3A 4I0TA 4P90A 2YHVA 3DQWA 3NGAA 4EOOA 5BNJA 5CEKA 4QTCA 2YM5A 3THBA 3BYMA 3MI9A 4X3FB 4AXFA 2CN8A 5EOBA 4H05A 2PPQA 5ACBC 3MY0A 5AP7A 3VUTA 4QMMA 3MA6A 4HCVA 3CQUA 2Q0NA 3TNPC 3QKLA 5JQ5A 3CR0A 4YJVA 1PYEA 3EB0A 2WFYA 3ZUUA 3IONA 3E5AA 4IVAA 1YWVA 5HG7A 5J8IA 5BYZA 4DTKA 4QTAA 2GS2A 5TOZA 4FKLA 4I41A 3KRWA 4LMNA 4N4SA 5AUWA 5GZ8A 3W33A 4S34A 3I5NA 3DZQA 3V5WA 5LCJA 1M17A 2WMWA 3LQ5A 1WBVA 1QL6A 3QALE 4NCTC 4NU1A 3PFYA 3GC9A 3GCSA 1Q8ZA 4NM5A 5HKMA 4IACA 4CMUA 2CCIA 4L8MA 4R5SA 2C69A 5BVKA 3DJ6A 4U79A 2RSVA 4ASZA 3W0PA 5DR9A 4EZ3A 4PMSA 5BVNA 4JBQA 2R3MA 3QTXA 1U54B 3DNEA 3MJ2A 3TXOA 2BZIB 2QHNA 3BYVA 4U7ZA 4C37A 3WF7A 3O71A 4IB3A 4BIBA 3ACJA 5FEEA 2HW7A 2R3KA 3G0FA 1K2PA 2OLCA 3ZXZA 4BL1A 2OG8A 4RJ7A 4YZDA 3SW7A 3U54A 5EYDA 4XG4A 5HCYA 3NUNA 3UZTA 5JT2A 5AUVA 1VYWA 4I4EA 4ZTHA 1UNHA 4U3YA 3IQ7A 2XM9A 5CNOA 3R73A 4EORA 3D7TA 3BLHA 3NUUA 4FKQA 3EN6A 2BILB 4KSPA 3CY2A 3V5TA 1E1VA 3BX5A 3PPKA 4RLLA 4I20A 3DBQA 4A9RA 4TWOA 3W0OA 2WMXA 2NP8A 3IDBA 3FZSA 5M4IA 3EZRA 2YERA 2ONLC 3I60A 2JLDA 3RVGA 3OC1A 4HVIA 4AT3A 2A4LA 1FMOE 4RWJA 4KKHA 2PE2A 4DINA 1SVGA 3FL5A 4O22A 4Q9ZA 2BDJA 3QQLA 3FI4A 3R22A 2X2MA 5FRIA 4FA2A 3CXWA 3I4BA 2UW5A 1Q61A 3C9WA 3FYKX 1NW1A 3FI8A 5HE2A 2YLEA 4C57A 3AD4A 3W55A 4P5QA 2WMVA 5I4NA 3R1NA 3W32A 2VWBA 4N6ZA 2O64A 4Y73A 2QOKA 5FQDC 3DBEA 4YTHA 1MQBA 4Y83A 4RX9A 3WIKA 4PV0A 3ZC6A 2BHEA 4YJUA 1OIQA 3ZEPA 3ZU7A 3VUDA 2JC6A 5LARA 3OUNB 4Z3VA 2Z2WA 5HESA 4ACMA 3E7VA 4OTQA 1WBOA 2X8IA 4K8AA 4RJ5A 2CGVA 2B54A 2F7EE 3NS9A 4I6HA 3UTOA 4WRGA 5AUYA 5IISA 3P1AA 4MUQA 2ZV2A 5JSMA 3DLSA 4RA5A 5T68A 4FTKA 3NIZA 3FMNA 2FSMX 2BAJA 3QTQA 4YHTA 3MVJA 2FB8A 4ZXTA 1WVWA 3BRBA 3HV6A 4I6FA 4JBVA 2IVTA 3FHRA 4FTCA 2FYSA 2VX1A 3FMHA 4DG3E 1ZXEA 3K3IA 4UZHA 3NCZA 4ASEA 2J0JA 5H8BA 4B0GA 2GHLA 4M3QA 3SC1A 4DE4A 3TTJA 3DLZA 4M66A 2ZVAA 3D7TB 4EH4A 2OW3A 2WPAA 1WAKA 2QLUA 3R8UA 4X0MA 3UP7A 5DMZA 1P5EA 4EOQA 5JRSA 4L43A 5EH0A 2BAKA 4O2ZA 3MVHA 4HVSA 1JPAA 1RDQE 4OUCA 2BROA 4R3CA 4CMOA 4DBNA 2PHKA 2Y7JA 4ERWA 4O7WA 1UU7A 2VU3A 1V0OA 2R3LA 4QMOA 4IVDA 4W8DA 4YHFA 3ZBXA 4BIDA 3MWUA 1I44A 4OT5A 4WO5A 1NA7A 2HIWA 1G8AA 3ZUTA 3TNHA 5IKWA 2CGWA 1ZARA 4AGDA 3ZRKA 5FXRA 2XNMA 2C6MA 5AX9A 3C13A 2YDJA 3MN3A 5CNNA 3PUPA 4FVRA 4IH8A 4JR3A 4S32A 4DGOA 3DT1A 3V5JA 4ALVA 5HHWA 1S9IA 4KS8A 1GZ8A 2JIIA 2XKEA 4IAIA 2A2AA 4L68A 3LCDA 1H1PA 3PXYA 2XKCA 1JSTA 2X1NA 2YIRA 3POZA 4K6ZA 1ZYLA 4H36A 5K4JA 4RQKA 1XQZA 2HZNA 3AG9A 3QUPA 4MQ1A 3D2IA 1NVRA 3HA6A 4E6AA 1CMKE 5L6OA 3QF9A 4RIOA 3NNUA 3BV3A 5J5SA 2EU9A 4RSSA 4QTDA 1R1WA 3PFQA 1K9AA 2ZDTA 2C0TA 3EN4A 5DWRA 5FXSA 4F1MA 1W82A 5LMBA 3FAAA 3IO7A 3E3PA 5DI1A 4FV1A 5AFVA 3L1SA 4JOAA 1IA8A 3S2PA 4NFNA 4O0TA 4F78A 3PXQA 4OTRA 1Q5KA 3GOPA 2G2FA 4EOJA 4AS0A 5CF8A 1IR3A 3F5GA 5EM8A 4PDOA 1OKWA 2YLFA 3CD8A 4JS8A 2DQ7X 2QCSA 1Q3WA 3Q04A 2JITA 3D83A 4NTSA 2ZB0A 3IW8A 5C27A 4EHGA 4YO4A 3JS2A 2WELA 4L45A 4AW1A 3ETAA 3QC9A 3OFMA 4FTNA 1GY3A 3P79A 3EQFA 2XK9A 5AP2A 2C6TA 3I79A 3A62A 1JKTA 5A4TA 5E8ZA 4MF0A 4C62A 4J96A 5CSWA 4BY9E 2G2IA 4XG9A 3KA0A 3QZIA 4Y5QA 4BGHA 2GQSA 2JKOA 2V55A 3L9LA 4NIFB 4DHIB 1W2DA 4FSMA 2EVAA 2V62A 2YM4A 1JKLA 2W17A 2YM7A 2XK3A 1BYGA 3LW0A 1OITA 4N6YA 4X6QC 2QG5A 5EHYA 3WF6A 3MFSA 2OF4A 5M07A 3IECA 3OWPA 3U9CA 3EMGA 3HEGA 3EQHA 2PVRA 2J7TA 5D9HA 4DH3A 2Z02A 3SRVA 4BDJA 3NCGA 4F64A 4DFBA 4KKEA 4XP2A 2XCHA 2GQRA 3E62A 1KE8A 5CS6A 2XCKA 3NRMA 5AV4A 3FWQA 4KKGA 3HL7A 4IVBA 2QOBA 3H9OA 2HY0A 1UU9A 4X3FA 4R8QA 5HTCA 3MB7A 1G8SA 3UNJA 3QHWA 3NUAA 3SAYA 3BYUA 1DM2A 1ZMWA 3QD4A 4I3ZA 4K33A 4YLLA 5BUJA 4E5WA 3TUCA 2X0GA 4F0GA 3V6RA 4RIWA 5A4LA 4PPBA 4DN5A 4YSMA 3GC8A 3L9NA 2JD5A 3BCEA 3E7OA 1OMWA 2C5OA 1XH9A 1M2PA 3CKXA 3QQJA 3LCKA 5F9EA 3Q4ZA 2OFUA 5A14A 1UNGA 1H4LA 2Z7LA 3CE3A 2CJMA 2BZKB 5AP5A 3G9LX 4C02A 1ZYJA 3MIAA 3FQEA 2X2KA 3HLLA 4EBVA 4FX3A 4FIIA 3EFLA 5IEVA 2YEXA 3LFBA 4QP6A 2UZDA 4YUQA 4ZSLA 2CKQA 2XJ0A 3N4UA 4L7FA 3NZ0A 3DKCA 4DDGA 2VO3A 1OIUA 4ZS4A 3NNVA 4YBJA 3VAPA 3R6XA 2NNWB 1YHSA 2RIOA 2BPMA 3FMLA 4YJNA 1UKHA 4AP7A 5M53A 3PSCA 3ZM4A 4S31A 4D0XA 4IJPA 4XOYA 3UC4A 2FO0A 1JLUE 4MXYA 2PZIA 3RPYA 2B9IA 5HG8A 5LVNA 4W4YA 3COKA 2BDFA 3PXFA 2UZBA 3T8OA 4HOKA 5JFXA 1BX6A 3BHYA 4D9TA 2JDSA 3FXXA 2GQGA 4O91A 4TL0A 4MD9E 4XV1A 1MRYA 3E8DA 3RHXA 4QMZA 4GT4A 4RX8A 3VF8A 4TYEA 4B6LA 4LGGA 4LOPA 2UW9A 5FP5A 3UOLA 3UOHA 1H1WA 1FINA 4F9CA 3SW4A 5EW9A 3TG1A 1A06A 4ACHA 3KF4A 2WQOA 3PIXA 3PE2A 4RPVA 4I5HA 4Y8DA 4YBKA 5IQAA 1YXXA 4MD8E 2XF0A 5C8KA 1Q8TA 3PVWA 2C0IA 4GVAA 3R9RA 2C5NA 4QEBA 2V22A 4DCAA 2ETMA 1HCLA 4FSRA 5E7RA 3AD5A 4JDKA 2YDKA 4O2PA 4DEIA 3DXNA 4JBOA 5KBRA 3TZ7A 4QQTA 2WTKB 2YJSA 3GVUA 4RVKA 2X6EA 4Y95A 4C4GA 3CCNA 1RE8A 1XBCA 3I7BA 2UW0A 3VNTA 5HEZA 4O1OA 4D2SA 4J98A 2XIYA 3GEQA 4F6WA 2CKOA 4YSJA 3VIDA 2R3OA 4ENXA 4CFUA 4RFYA 2CNVA 4O0WA 1ND4A 3W0RA 4YURA 3FSKA 2XJ1A 3GCQ