3DNEA

Camp-dependent protein kinase pka catalytic subunit with pki-5-24
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
336
Chain Sequence
ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallography-independent determination of ligand binding modes
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 105
structure length 336
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dneA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dneA02
1YXXA 2ZV8A 4DCAA 3HZTA 4GIHA 3CQEA 5AR2A 3ZDIA 5ICPA 1VR2A 3FXWA 5EM8A 4RBLA 4JBQA 4EKKA 5AR8A 2ITVA 2ERZE 3JY9A 3EMGA 3UZPA 3OUNB 4FGRA 2XIZA 3HDMA 5I9ZA 3QRKA 3OVVA 5DG5A 3H9OA 2WOTA 3W32A 3UOHA 4C4IA 4L3PA 5M08A 2B54A 3FPMA 3G9LX 2BPMA 2P2IA 4XG4A 4Y95A 3SA0A 1U46A 3SVVA 3TDVA 3OXZA 5ANDA 3UMXA 2J51A 3ENMA 1REKA 3MYGA 3RAHA 4EOKA 5JEBA 2BDJA 2HK5A 4X6RA 2ESMA 5HNGA 3HUBA 2XIRA 4MTAA 4JT3A 4TN6A 5EOLA 3EFKA 3C0HA 4GCJA 4FKOA 5HCZA 3OP5A 1H26A 4FUXA 4N6YA 5FEQA 2OSCA 2QR7A 3HRBA 3PIYA 3KRRA 4XUFA 3O71A 3RK7A 5AUUA 5ETCA 1GIJA 3A62A 2C69A 4MKCA 4ITIA 1GY3A 2ITOA 4J99A 3R8UA 1PRYA 2B0QA 2IW8A 2GQSA 4NM3A 4EZ7A 3BHUA 3TKIA 2YCRA 3RK9A 2YWPA 3S3IA 1JSTA 3PRFA 3MWUA 2REIA 4RC3A 5H8GA 4FYOA 4X3JA 4EORA 3MH2A 5KNJA 4H39A 2VTHA 4IAYA 3MPTA 2PE0A 5AA8A 3JYAA 3MY0A 3Q2MA 5KZ0A 2OI4X 2RG6A 3IW4A 3OEFX 3KVXA 4KBCA 3CP9A 4LI5A 1LEWA 2E2BA 2WGJA 4FOCA 3OZ6A 4KKHA 4NM5A 4EK5A 4MXZA 5E8TA 2C47A 4C0TA 2I0EA 2PVLA 3U6JA 1MQBA 4ZSGA 3O51A 3LCTA 5HU9A 3DJ7A 3MB6A 2QOFA 4OBOA 2UVXA 3HNGA 4PWNA 1Y6AA 4RVKA 4AZTA 1VYZA 2G15A 5HBJA 3OWKA 4IMYA 3OD6X 3BX5A 4FIIA 5CEOA 3VS0A 3IOPA 3FC1X 3LFEA 1Z57A 2Q0BA 3QX4A 2B1PA 2JBPA 3HA6A 4IAIA 4Y85A 5FXQA 2EXCX 3L8PA 3UVQA 4DCEA 2OH4A 2ZDUA 4FVQA 2JGZA 4NKSA 3ZYAA 3D4QA 3DQXA 3Q4UA 2JKQA 4QMOA 1ZARA 2HWPA 1FQ1B 3UQGA 5CEKA 1ZMWA 2VNYA 1OZ1A 1ZZ2A 1Q8ZA 4FZDB 5E8SA 4H3PA 2VTMA 2PWLA 3R00A 4QTAA 4F70A 1K2PA 1XH8A 3DAJA 4QPMA 3KXHA 3ORMA 3D15A 3R7IA 1YHSA 4YNOA 4J7BA 1Q8UA 3A99A 4FSWA 1JQHA 3R71A 4WO5A 4USEA 5HD7A 5IA1A 3OXIA 4FK3A 3EN4A 5IUHA 3SGCA 4IB1A 5EYMA 4F6WA 1FGIA 3OXTA 3L9NA 2IZSA 2QKWB 4HGTA 4I0RA 4ITJA 3VUIA 3WIGA 1OBGA 2BKKA 3S2PA 1TQPA 1XJDA 4FSYA 5E9EA 2WD1A 1ZWSA 2VX3A 4FBXA 3QL8A 4E5BA 1R0EA 2VRXA 4IVBA 3VNTA 4CFNA 4V01A 5J5SA 1P14A 1A9UA 3ANQA 5I9UA 2G2FA 2O65A 4L7SA 4CSVA 5FLFA 2XNEA 4QOXA 3BGQA 4DTKA 2X9EA 4U97A 4Z55A 4J96A 2RIOA 2NPQA 4FT0A 3BHHA 4WNOA 5IF1A 5D9HA 1BI7A 5K0KA 4OBQA 4BHNA 4PMTA 3OWPA 1PMEA 3GQIA 3PY1A 5KMNA 3HV4A 4W4YA 1FVVA 2ZB0A 4FKJA 1Y8YA 3MTLA 3CIKA 4K6ZA 4X2FA 4ZTHA 3NAXA 3QAME 3QTQA 4FZ7A 4GK3A 4BTKA 2OXXA 2HELA 4E26A 4H3QA 2RG5A 2EWAA 4TW9A 4FL2A 2PPQA 1YWNA 3UZRA 4DTAA 4I0TA 2ERKA 2VTTA 5CU3A 2CJMA 3FYJX 4ZOGA 2EB3A 5AP6A 4WD5A 4CCBA 1F3MC 2ZDTA 3R9OA 1NXKA 3NUXA 3R2YA 4CKIA 3P78A 3BV3A 5GINE 4PPCA 2WMVA 3FJQE 3UO4A 3KQ7A 4NL0A 5D10A 2Q83A 2BVAA 3P23A 1DS5A 3ETAA 4L44A 4O0WA 5CF5A 5F9EA 1UU9A 4G1WA 3LQ5A 1MRUA 5KMKA 4BDCA 3TL8A 1M2RA 4OTWA 3VF9A 1W84A 1W98A 1JOWB 3DA6A 4I5MA 1ZOHA 2CLQA 2W1IA 3D5VA 5BYZA 2XIXA 3QTIA 2YIWA 3E8DA 5E8ZA 3U9CA 3AD6A 3IW6A 3PP0A 3WZJA 5IPJA 3QRIA 4DH3A 3LFBA 3E8CA 3SLSA 4U44A 1QMZA 4LMUA 5F4NA 4O7TA 4CFVA 3P79A 5CF8A 4FV7A 2ITNA 3V8WA 3A4OX 4EWHA 4H1MA 3IW8A 2BHHA 2QONA 2WU7A 4JDIA 3NYNA 4F9AA 4HJOA 5TOZA 3KF7A 4FNWA 3MY1A 4NEUA 4PF4A 3AC3A 4FV9A 1WBPA 2XKCA 3VBVA 3I6UA 2QOIA 1OKZA 2VWVA 3PJ8A 4DGOA 4BY9E 4GVJA 4AOJA 4KB8A 3ROYA 1SNXA 4F9WA 5CT0A 4G3EA 4A4XA 4OGRA 2VTSA 2G9XA 2I0HA 5DEYA 1WMKA 3E5AA 4J8MA 4F7NA 2PSQA 2FUMA 2X1NA 4MHAA 5HG7A 1XH4A 4HYHA 1ZLTA 2XBJA 4FNYA 5HIBA 1OUKA 3S95A 4U7ZA 4M0ZA 2BZJA 4XJ0A 1CMKE 2B7AA 2GTMA 2H9VA 2J50A 3QC4A 4FR4A 4C3PA 5K9IA 3KRWA 2J4ZA 1J3HA 2YZAA 3E88A 3G5DA 3NLBA 5CENA 3TNPC 2ZJWA 3R7OA 5ETIA 4HNFA 4UX9A 3F2NA 3GU4A 3O8PA 5HX6A 3VBQA 4XH6A 5T3QA 4XP3A 4ZTNA 4DG3E 3DFCB 3VBYA 5J1WA 4MXXA 5EK7A 2IVTA 3QFVA 4GUEA 4I6HA 3PLAE 3EQGA 4TXCA 2XEZA 4IZYA 1ERKA 3LVPA 4HNIA 2Z2WA 3TT0A 4BKZA 1ZYDA 4IAFA 4U45A 5H8BA 3WZDA 4X3FC 2OZOA 3RNIA 4BL1A 5C8NA 1Q97A 2C0IA 3DDQA 3HL7A 3LJ0A 4AP7A 4OAUC 4AW1A 2UV2A 1Q61A 3E93A 4M14A 4FA2A 2I1MA 2O2UA 4OR5A 4Y5HA 5EYCA 2JKOA 3QTSA 3WZUA 3COIA 2NRYA 3FWQA 4FYNA 4H36A 4N0SA 4U42A 3DAEA 3QQUA 3I60A 5JQ5A 1PXLA 4Y72A 4EUUA 3NIZA 3CKWA 4DF3A 4ASDA 4AE6A 4YJOA 1Q62A 4BCKA 3DTWA 4AN2A 4FT9A 2R3NA 2X8DA 4HCVA 2CCIA 3UBDA 3V5TA 3WOWA 1KOAA 2R3MA 3R2BA 3TEIA 3UIXA 2Y0AA 3MI9A 4DG2E 1DI8A 2OGVA 3H3CA 1FINA 4NW6A 3MFRA 5IA4A 1QPEA 4G16A 4QTCA 1A48A 2C1BA 4BRXA 4O7LA 2OIQA 4L67A 3LXNA 5CAPA 5IG1A 3GOKA 4Y73A 4JIAA 2HYYA 3ZH8A 4ANSA 2VTJA 5EHYA 5I9XA 4DEAA 4DT8A 3FMDA 3O96A 4FKVA 3OMVA 3RAKA 2OIBA 3BLHA 3V6RA 4AT5A 1UWHA 3MIAA 1U54A 2GNGA 5D7VA 4DFYA 1H1PA 4OTQA 4ZY4A 3FKLA 3IG7A 3PSBA 1STCE 3F5XA 3PG1A 2CMWA 3HRFA 3QWJA 2VTOA 2JDSA 2R9SA 4NUSA 1GJOA 4AA5A 4FKWA 4GKIA 2R3GA 4U8ZA 4IW0A 2YWVA 4Q5HA 5J9ZA 2JDOA 5AA9A 2J0JA 2IWIA 3EQRA 4C62A 5TKDA 4ZAUA 4NW5A 3OY3A 2PMLX 4IANA 1HCLA 1NY3A 2WMBA 3UVRA 3S00A 1JKKA 3F2RA 3VBXA 3D14A 4RFMA 3CJGA 3V8TA 4FTMA 3FE3A 4FTNA 4LRJA 3OT3A 5AUTA 4QTEA 3PXZA 5J1VA 5DT3A 3TV6A 5E7RA 3IDCA 4YR8A 2J6MA 2XKEA 3V3VA 3EQBA 4FIGA 4YJQA 4ZSJA 4BIBA 5EW3A 3RGFA 5AWMA 2VX1A 4BZOA 1H0WA 4KWPA 4U80A 4D5KA 4C8BA 3PPJA 5AP4A 2C6EA 2QNJA 4RFYA 4EK8A 4KNBA 2XKFA 5A6NA 5BVNA 4K2RA 4YGAA 4YU2A 4PNIA 3FI3A 4YHJA 5J9LA 4EK6A 3OWLA 5HOAA 3LFCA 3NEWA 4M13A 4Z9LA 1H1QA 1IA8A 4TWPA 4YJUA 2C6KA 5EM7A 5IA3A 3EIDA 4ZJVA 4ZIMA 1H01A 4GT5A 4PPBA 5EYDA 4O83A 2C3LA 3TACA 4FODA 5AEPA 3D7ZA 4MAOA 3RZFA 5LVMA 3SW7A 4EOOA 3LE6A 5L4QA 1PF8A 5I9VA 5H8EA 5EM6A 4BBEA 2W1HA 1GOLA 3IO7A 4U3YA 5J87A 5HBEA 5IQDA 3CY3A 1B6CB 3GU6A 1OI9A 2F2UA 1JKSA 4ANLA 5A4EA 4FOBA 2ITTA 1OUYA 4PDOA 4AW2A 4QMQA 4QNYA 5E4HA 4PDPA 5A6OA 1PXJA 4C02A 3LQ3A 3QGWA 3ZZEA 3KCKA 3P5KA 2V5QA 3QZGA 1WBVA 4QPSA 1OIRA 2BFXA 2Y8OA 3C4EA 3A60A 4PPAA 4WHZA 2OXYA 3RCDA 4F0FA 5HZNA 1JSUA 3DGKA 5BUIA 4RX5A 3BU5A 5EDPA 4RIWA 3V5WA 1QPDA 4FEXA 3TG1A 2XYNA 4MEDA 4RZVA 4OT5A 4GW8A 4BTMA 4J71A 5CY3A 3ZCLA 3RWQA 4KRCA 3ZO1A 3FLWA 4EH7A 4RVLA 3NRMA 4EHVA 4YO6A 3F5PA 4HVHA 1PXMA 2P3GX 4Y83A 1GNGA 4F9BA 4YTCA 2W1DA 3MSSA 3SV0A 3C4ZA 3L9LA 3BGPA 2F49A 3HEGA 4GJ2A 5HG5A 4DEGA 2PVKA 3OCBA 4MD7E 3LFAA 3FSFA 5IA5A 4NK9A 4X7QA 1YVJA 2GPHA 3A7HA 4KKEA 4YC3A 5DWRA 4O0YA 4EYMA 4YUQA 3BU3A 2VD5A 4KUJA 2OH0E 4GG5A 3KMMA 4J8NA 2OJ9A 4B8MA 4EI4A 5M4CA 4HZRA 3FZPA 4O96A 4BBMA 4D28A 2BROA 3Q4TA 1V0OA 1RQQA 1XH6A 4ZXTA 5HVYA 4BI0A 1JNKA 4YLLA 2XM9A 4X21A 3CPCA 4CTBA 4PL5A 4Y5QA 1YI3A 4NWMA 5JFWA 5LMAA 3EFLA 2BZIB 3F6XA 4ACDA 4YJTA 3QCYA 3LFSA 2WMWA 4RMZA 4C3FA 2JIIA 2WQNA 3WF8A 3H4JA 5IQBA 5EHOA 4IJPA 2YAKA 4IAKA 4EQMA 4FTCA 3GCQA 1KE6A 3AC5A 2KULA 3P4KA 2UZOA 4WT6A 1T46A 3UNZA 4O86A 4MF0A 2W06A 3VO3A 3ORPA 4PDYA 4FT7A 5H9BA 5T68A 1J7UA 2ZVAA 3IOKA 4JJRA 4ZSEA 2V0DA 2YAAA 1WCCA 3PZHA 3EYHA 3PIZA 3W2SA 4C4GA 3LW0A 2DWBA 3NDMA 1I44A 1ZMVA 5AM6A 3U51A 2OICA 4LV8A 4O0SA 1R1WA 3KU2A 3RPYA 1ZYCA 4IADA 5EQPA 4O0VA 4DGGA 2AC3A 4I4FA 2VU3A 4OTRA 3ZLYA 5IKWA 2C3JA 4FV6A 3G6HA 4V05A 3RHXA 3RBWA 5A14A 5M06A 4YURA 2CKOA 1JVPP 3BPRA 4ARKA 2BRGA 4PRJA 5AAFA 4N57A 4AA4A 2C4GA 3MVHA 4CT2A 1OIYA 3OHTA 1UV5A 4ONAA 4YZ9A 3SXSA 2PL0A 3TZMA 3PXQA 4X2KA 2ONLC 5DLSA 2OXDA 3M1SA 4PL3A 3QRJA 4XOZA 2BRHA 4YSJA 5K4IA 5D1JA 2ETKA 4BGQA 3LCDA 1URCA 3FI8A 3O50A 4YJNA 1UA2A 4GV1A 4JR7A 1JBPE 3UGCA 3BU6A 4FL1A 4MX9A 3TZ9A 3ZLWA 4UMPA 4PNKA 4GK4A 4K18A 3TNWA 4XCUA 4V04A 3RTPA 3VS2A 3BZ3A 3ORTA 4M69A 5EYKA 4O7SA 3LMIA 2WTIA 2YCSA 5AUWA 3ORLA 3FZOA 2GHLA 4JXFA 2YIQA 1J7LA 2OJJA 1OIUA 5DOSA 3QGYA 1WBWA 4H58A 5AUZA 2XH5A 2JC6A 4AZSA 4A9YA 5FRIA 5D12A 4PP9A 5CLPA 3FXZA 3CTJA 2BIYA 2YM8A 1H1SA 4IM2A 3RZBA 3MA6A 2CNQA 3MBLA 4FTTA 4JDHA 1PXPA 2V7AA 2OKRA 1Q8YA 4BIDA 3OOMA 3U54A 3PXFA 3MVJA 2W99B 5BNJA 3KULA 3ZZWA 2A19B 4O21A 5BVOA 1P2AA 4L42A 5AUVA 2QOKA 2QU5A 4KBAA 3T9IA 3ENHA 3FMMA 1KE5A 3H0YA 3GQLA 1WVXA 4FTIA 2W17A 2OWBA 4IDVA 4YJSA 4BBFA 3F66A 4AGUA 3OY1A 2XK3A 3EQIA 4C38A 2GNHA 2EVAA 2VAGA 2WTJA 4PUZA 1H8FA 1Y8GA 4A9UA 4DFZE 4D1XA 4O7VA 3R83A 3FYKX 4QQCA 4XV2A 4CXAA 1PHKA 2IG7A 4IFGA 4D58A 4HYIA 3V04A 2LAVA 2R3HA 5GJGA 3FSKA 4Z3VA 3BYOA 4EONA 4IDTA 4GFMA 4YLKA 4YNEA 1BI8A 2YJRA 4RT7A 2YHVA 4QMNA 2PULA 3GI3A 3QU0A 2CSNA 3BQRA 3EL7A 3QYZA 4KAOA 4O0XA 3NUAA 2GQRA 2GCDA 4JRVA 4U41A 4FTKA 5JT2A 5HO7A 4YPDA 4FEVA 3KF4A 2BRBA 3CLYA 5F20A 5AV3A 3G0EA 4XYFA 2BILB 2OG8A 4BZDA 3PRIA 2UZBA 4CCUA 3BYMA 1APME 2PVFA 3F7ZA 3FKOA 5FTOA 3TDWA 5AIRA 3G9NA 4NJ3A 2WMAA 4Z16A 3EQCA 4ACGA 3LCKA 3TKHA 3TUBA 3AT2A 5GZAA 1DAYA 3R02A 4QMMA 4JG6A 3B8RA 4BDGA 3EWHA 3QKMA 4CMOA 2F2CB 3OFMA 1V0PA 4C3RA 3E64A 3U4WA 2F4JA 3FMEA 5JGAA 2DUVA 3A7IA 4FKLA 4EH8A 3SG8A 3OBGA 3KCFA 1M17A 4FKGA 3KXXA 1YOLA 4G5PA 3EQDA 4OTFA 4QP6A 5M55A 3RWPA 4A9TA 1IA9A 3PJ1A 3F7WA 2QOOA 4WNKA 5HU3A 2X8IA 4QQTA 4TNBA 2VTNA 5AX9A 2WTCA 4HGLA 4AU8A 3QC9A 4EJNA 1Q8WA 2ZV2A 2OU7A 4KS7A 2ITYA 5AUYA 1PXOA 3VUHA 3PLSA 4RGJA 1F0QA 3DAKA 3MS9A 4CZYB 3AD4A 1XH9A 3D7TB 4O6LA 5F94A 4OW8A 3KREA 4TYHA 5LMBA 4FKSA 5KMIA 2WO6A 4BKYA 2C6OA 3JR1A 5I5ZA 3EQFA 3UQFA 3K5UA 2Z7SA 3F9NA 3HGKA 3EZRA 1QCFA 4RQVA 4XHKB 5CSHA 1OMWA 5ANIA 5JFXA 2FH9A 5A4LA 3QCSA 5E1EA 2ZM1A 5TO8A 4B6LA 3OTVA 3F5GA 3MDYA 4L3LA 5LWMA 3OBJA 3NS9A 4G2FA 5LVPA 5EW9A 3QD0A 5EFQA 4AT4A 4TL0A 5LARA 3GC7A 2OJGA 2XCKA 2SRCA 2C6LA 5IA0A 5C8KA 1NW1A 3KVWA 4DFXE 2A1AB 4D0XA 3BRBA 3DK7A 3UNKA 5FBOA 3NCZA 4PTCA 3OOGA 3R7UA 1T45A 3OCSA 5ITAA 4FV5A 4ZY5A 5LQFA 3MVMA 3R63A 4AACA 5AV4A 4LM5A 3T3UA 5AP0A 4EOQA 2XB7A 4EQCA 2R2PA 1W83A 2IJMA 2VV9A 5AP7A 1YOJA 1OGUA 4KBKA 1B39A 4QTDA 1RW8A 5HX8A 2QQ7A 2WMTA 3G0FA 4TZRA 3ULZA 4BWKA 4D2PA 4ZTQA 3LXLA 4NYEA 3ZSGA 2FGIA 4O27B 4M8TA 5L2IA 3VUMA 3LFQA 4ZZOA 5HLPA 4HYSA 4CRLA 4C57A 3DKFA 1PMUA 4JVGA 2H96A 1YXUA 4EWQA 2YLEA 2HZNA 4J53A 3W2CA 1E1VA 3KL8A 3NUPA 4PQNA 4PY1A 5FGKA 4BCQA 3RM7A 4BDDA 3DKGA 3QXOA 3QKLA 4CGAA 2J2IB 3MB7A 3NW6A 3GCVA 3I0OA 2UZUE 2FSOX 4MBLA 4O0UA 3R7EA 1BLXA 3WF9A 3L8SA 4HGSA 3ZMMA 3RMFA 3NR9A 2X9FA 4W4WA 4FI1A 4PMSA 4YJRA 4R1VA 3RNYA 5IU2A 2UW9A 2WKMA 2X2LA 2YIRA 4JOAA 2IW6A 1R3CA 4M3QA 4YTIA 5HE1A 2R64A 4J52A 4GVAA 5C01A 3H0ZA 5HLNA 1JSVA 4KIKB 3EL8A 5DNRA 5BVFA 2DYLA 3GENA 4BDKA 5J95A 3OF0A 3PY0A 5K5XA 1OBDA 5M4IA 4GU9A 4S31A 2YDKA 4WG3A 4GYGA 4RZWA 3QTWA 4BVUA 2BR1A 4TYGA 1H07A 4IIRA 4UZDA 3SKCA 4ANQA 4CG9A 3GNIB 1Q8TA 3SDJA 4EOIA 3SD0A 4J95A 1OPLA 2VNWA 3JXWA 4XMOA 2RFDA 5LVNA 3C4WA 3ET7A 2YM3A 1G5SA 4RQKA 2IZTA 4K1BA 3CQUA 2WNTA 4JNWA 4U81A 5E92A 5EDQA 3VULA 2W1GA 2O8YA 5FXSA 4DBNA 3TIZA 3IECA 2WAJA 3QLGA 2GNIA 5EH0A 3EZVA 3KXGA 4EH4A 4BWPA 2X81A 3UQCA 2QODA 2B53A 2HW6A 3QA0A 3C4FA 4F1OA 3HUCA 2C5NA 4MNEB 5CQWA 3E62A 5G1XA 2PHKA 2UZEA 2JBOA 3M42A 4MXCA 2BTSA 4G6NA 2ITXA 4RIOA 4GSBA 4DG0E 4C2WA 4MQ2A 5CSXA 2RSVA 3HP2A 3RI1A 4EH3A 4G9CA 5EKOA 2VO3A 4YP8A 4EHGA 2C68A 4BWXA 5E8VA 4HYUA 4CZTA 3GB2A 3OS3A 3COMA 4YZBA 3VS3A 5CASA 1BKXA 3ZC5A 2YM5A 4QMUA 3F82A 2OF2A 3PIXA 2BAKA 4ACCA 3MY5A 1Z5MA 4XBRA 4CFMA 4BC6A 4BCIA 1CSNA 3Q4ZA 4FKUA 4JG7A 4LG4A 1P4FA 2XZSA 4FIHA 2A0CX 1KV2A 4E6QA 3VW8A 3BCEA 3FZRA 4FT5A 5F1ZA 2CLXA 1ZYJA 2R3QA 4UY9A 1O6YA 4KSPA 3W2OA 2UW7A 2P0CA 3VS4A 3PA4A 4AF3A 1RDQE 4JBVA 3Q3BA 3Q5ZA 1KOBA 2WTKC 4JS8A 3FHIA 5FM3A 4DEEA 5HE3A 3R8VA 3NVMB 4EHEA 1G8SA 4APPA 5HO6A 2QG5A 4R1YA 4P90A 2W4KA 2ZYBA 3G51A 3FMHA 5DVRA 2GDOA 2R3JA 3ZEPA 5KO1A 3NUNA 1NA7A 2WQMA 3KRLA 2WOUA 2VGOA 4B4LA 4DFUA 5JQ8A 3UPZA 4EH5A 4RJ6A 4WSQA 4QP3A 1OKWA 4ZLOA 3BHVA 4X2JA 2BZHB 2C6TA 2OFUA 3GOPA 3GUBA 3HMNA 1Q4LA 4TNDA 2YABA 4RC2A 3U87A 4AFJA 2JDVA 3DPKA 4JX7A 2QLUA 2W05A 4BICA 4BIEA 1DM2A 4M0YA 4DH1A 1Q3WA 1IEPA 4G9RA 4FVPA 3QD2B 3RM6A 2RFSA 1GIIA 1U54B 2B9JA 2Q0NA 3D83A 4XEYA 2H34A 4BYJA 3C50A 2PMOX 2QO2A 5I3OA 3UMWA 4ERKA 2HOGA 3Q2JA 4FSNA 2ZMCA 1YHVA 5JRSA 3W2QA 4A06A 1WVWA 4UB7A 3ZC6A 4IWOA 2X4FA 3Q6UA 3LOKA 3EFWA 4D9UA 5KMOA 3OROA 4GT3A 4O91A 3BGZA 3R8PA 3FEGA 5IEVA 1CDKA 1JWHA 3FZTA 1IR3A 5FG8A 4KIKA 3AC8A 3DLSA 4USDA 4N70A 5CQUA 4YLJA 3DBDA 5DRBA 3L1SA 5E8WA 3MFSA 5L6OA 2O3PA 4JAJA 1OB3A 3RVGA 1Z9XA 3E7VA 4HZSA 1TQMA 4L3JA 1OL6A 4O2PA 3NNXA 1XBAA 4YPSA 4GRBA 3BKBA 3K3IA 1V0BA 3FMKA 3IONA 3OEZA 3NCGA 3TCPA 4EOJA 4ZP5A 5HCXA 2E9VA 3UC4A 4BDAA 2GMXA 3CBLA 4GS6A 3VWAA 1U5RA 3QTRA 2A27A 3IS5A 4RWJA 3VUDA 3NMUF 4DN5A 4F6SA 4L01A 1QL6A 2GNLA 4WUNA 4MBJA 3EN7A 4MCVA 4M84A 3R73A 2W1ZA 5JSMA 1YQJA 2OBJA 4FV4A 2CGXA 2W7XA 3CTHA 3F3ZA 5J5TA 4BI1A 1E9HA 3GC0A 2R3RA 3QUPA 5B2KA 3ZS5A 5DI1A 5ANOA 4A4OA 2V55A 4I6FA 2CKPA 5M07A 4EZ5A 3C9WA 3G6GA 2R7IA 4IVAA 4ANNA 2X2MA 2R3PA 2RFEA 3R22A 1PYEA 4O0RA 1TVOA 3W2PA 1CM8A 3AD5A 4ZMEA 3F3TA 2QHMA 4I24A 1XH7A 5DA3A 3VUTA 5IQFA 2BUJA 4QP2A 4IC8A 3TXOA 3HMMA 3MPMA 3ATTA 4CKRA 2V62A 3BEGA 5L2QA 3ALNA 1P4OA 2C3IB 4FG9A 3LIJA 4PX6A 3RPSA 4QMPA 4AE9A 2C6IA 3CKXA 4FX3A 4KIQA 2QHNA 2QLQA 3VUGA 4RJ7A 3VAPA 3ZSHA 1CTPE 3TKUA 1OKYA 4IFCA 4U0IA 2C5XA 3RAWA 4D2TA 5IA2A 3ZSIA 4E7WA 3PTGA 4AFEA 3C13A 1OM1A 3DT1A 3LM0A 2PZRA 4E1ZA 4HVSA 3I79A 4IB5A 3RPVA 4U79A 1JKTA 3AMBA 4WNPA 4JBOA 5JGBA 3VRZA 1PY5A 4R5YA 3KEXA 4BTJA 5EG3A 5DGZA 3PXKA 5JFSA 3EKNA 3OUKA 2VN9A 4ANBA 5IEXA 5FUTA 4D4RA 1TKIA 3II5A 3DXQA 3I81A 2RL5A 4O1OA 3UO6A 3C51A 4ACMA 2P33A 4IACA 3DCVA 4XV1A 1YDSE 4MD8E 1KE7A 5FDPA 5K0XA 4U3ZA 2OJFE 4OTPA 4F0GA 1SM2A 5CI7A 4GT4A 3D5XA 5AMNA 4E93A 4AOTA 3UIMA 2NP8A 4DITA 5L2TA 1W8CA 3R21A 4IX3A 5DPVA 3FKNA 1B38A 4IVCA 4RJ4A 3UOLA 3CJFA 4ZTSA 4C34A 4F7SA 2J0LA 4QYGA 4F9YA 3TIYA 4LOOA 3EN9A 4U43A 2X6DA 4HOKA 5CEQA 2BRMA 4GYIA 5LJJA 4OTHA 1R0PA 4XOYA 2JKMA 3S0OA 3FAAA 3G15A 3UZTA 2XM8A 5EDRA 5L8JA 4ZJIA 4TT7A 2FB8A 5TT7A 5A54A 3KRJA 2QOQA 3PSCA 5AM7A 5HKMA 3GC9A 3CQWA 3PDTA 3N9XA 5ETFA 4AA0A 3NYOA 5C4KA 5IQCA 2GTNA 4JDKA 3D94A 3GVUA 3UIUA 4C35A 3DXPA 3EH9A 3DU8A 5J7BA 3BLQA 3JUHA 4NSTA 3W2RA 4AAAA 4BZNA 2CN5A 3NW5A 3NNUA 4JLCA 2BALA 5BQ0A 5FDXA 3U9NA 3RPOA 3PVBA 2ITUA 3PE1A 2YDIA 1WVYA 2BAJA 2PVYA 1WFCA 2X39A 2QCSA 3R28A 4FL3A 3TZ8A 2PUNA 1ZYSA 5DR9A 4L00A 4RWIA 3JVRA 1MP8A 3AGLA 3V01A 3QQJA 1ND4A 3E87A 4RX8A 1LUFA 5I9YA 2BAQA 3HVCA 5J7HA 3U55A 3PWDA 4JL9A 3WE8A 1W82A 5GIPE 2WMSA 4FVRA 1XO2B 4FV3A 4M12A 2F9GA 4FZAB 5DH3A 5EQEA 3QQGA 3ORXA 2GHMA 4G3DA 3U4UA 1UNGA 5E8XA 5GJDA 3LCOA 4E6CA 1S9JA 2GNJA 3CD8A 3FMLA 3VF8A 3G90X 2G1TA 4ZK5A 3AC1A 5LCJA 4AT3A 4D2VA 5EW8A 2Y4PA 3GU7A 1J1CA 3F5UA 1OVEA 1QPCA 2XIKA 4FV2A 5HHWA 3F88A 1XR1A 2DS1A 3MV5A 4J98A 3A7JA 3MN3A 4LGHA 3FBVA 3G2FA 3P7AA 4G31A 4I5PA 2PVRA 2XA4A 2WMQA 4O38A 4WIHA 4FKTA 3AT4A 3GU8A 4YO4A 4BCHA 4OLIA 3P7CA 4R8QA 4KA3A 1URWA 2R3OA 4FUYA 4Q5EA 3DNEA 2VWIA 4U5JA 3NUYA 2W9FB 3POOA 3Q9WA 4MNFA 3RALA 2OFVA 3UTOA 4D2WA 2VTIA 2HIWA 2J7TA 5DBXA 5LVLA 3T3VA 4EJ7A 3AMYA 3IGGA 1H24A 3M2WA 3QALE 5F95A 4BB4A 2YIYA 4UWYA 3CPBA 4L68A 2HZIA 2GFSA 3QTXA 4QYFA 4EOMA 3HV7A 5DR2A 5AR4A 3LHJA 4O7NA 2C1AA 2XK6A 3QHWA 4CRSA 5HNIX 4MWHA 3Q60A 4F7JA 2CN8A 3PG3A 2W1EA 3QD3A 4X2NA 4BCPA 5DYJA 5HQ0A 1GAGA 3SXFA 3VBTA 4BYIA 4EH6A 5KMLA 1LEZA 4YHFA 2JEDA 1Y57A 4Q2AA 4O7YA 5EOBA 3DKOA 5AP5A 5L3AA 4AXAA 3Q6WA 4C4HA 2ZB1A 3Q32A 4LMNA 1PW2A 1KE8A 3D5WA 2XP2A 5KKRB 4MWIA 4BDBA 2UZLA 4XG9A 4CMTA 5CS6A 2H6DA 3H9FA 4O1PA 2W1CA 3ORNA 3ANRA 1SYKA 5ACKA 3SXRA 2YIXA 3CC6A 3I7BA 4FF8A 5TR6A 3L9PA 1ZMUA 4DGLC 4AZWA 3QHRA 4DEBA 1ZY4A 4QP8A 4D4YA 1PMVA 5JN2A 1CKPA 3D7TA 1YKRA 4OAVB 4D4SA 3C4XA 3ORKA 4NT4A 3PE2A 3Q9ZA 3WBLA 1YHWA 3W18A 3CR0A 4G3CA 3R1NA 4C4EA 1FBNA 3PSDA 4MXOA 5CYIA 5M56A 3TWJA 2B52A 2VWZA 2PTKA 4WUAA 2WTVA 4K77A 3BYUA 4QD6A 3FY2A 1M14A 2GHGA 4XG7A 4BDIA 2E9NA 1M7NA 1UU3A 1U59A 2XK8A 5J79A 4HCUA 2YA9A 4RIYB 4S32A 2W4OA 4WBBB 4AOIA 3U6IA 3N4UA 1ZOGA 1ZRZA 2UZVA 3FLSA 4OTDA 1LPUA 4FIFA 4XP0A 5FEDA 2Y9QA 4DTBA 3K54A 4JQEA 4P5ZA 4ALVA 4ASXA 3CS9A 4K9YA 3VC4A 2OO8X 3WE4A 4AGCA 5CF4A 4EL9A 3A8WA 1TQIA 3OWJA 3QUDA 4F99A 3TUDA 2H8HA 2X4ZA 3AGMA 4WRGA 4K0YA 4O82A 1UNLA 3Q96A 5DFPA 2QKRA 1L3RE 5IDPA 4BCNA 2OW3A 3GCPA 3PXRA 2ITPA 2XNNA 2XNPA 2QD9A 2Y4IC 5AP2A 4UYAA 2I6LA 2WIHA 3N4VA 3F3VA 3ODYX 2O63A 1FPUA 5FBNC 3EQHA 2CPKE 4FSMA 2ITWA 1XKKA 3EN5A 4EOLA 3WYYA 3NIEA 3DBEA 3QQFA 2RGPA 2EUFB 2PZIA 3BYVA 3F61A 3FUPA 3NAYA 1GIHA 2E9UA 3D5UA 4KIOA 2W0JA 5EI2A 4P2KA 3ZRKA 3A4PA 3QUEA 5IZFA 5KBRA 5DT0A 4DFBA 4TYIA 4E4MA 2JD5A 3DZOA 4IQ6A 2DQ7X 4U40A 1E1XA 5HICA 3I0QA 3MTFA 5CU6A 3KC3A 3VQUA 5BMMA 5IMXA 4P7EA 1VEBA 2W4JA 1XQZA 4EH9A 5HCYA 4B8LA 3HV5A 3R7YA 4OBPA 2R4BA 3ACJA 4J1RA 4D55A 5BUJA 4B9DA 5BYLA 2WQEA 1OL1A 3E3PA 3L8XA 3QCQA 4IWDA 4X3FB 3JY0A 3DBFA 3NNVA 3ODZX 3DFAA 3R1SA 4S30A 3W10A 5K4JA 5IQEA 2QOLA 1NT2A 5HTCA 4UBAA 2HENA 3TUCA 3R9HA 4F1MA 5AFVA 1W7HA 3SHEA 2C5YA 2WEIA 4JRNA 2JIUA 4GEOA 3NSZA 3VJNA 4JBPA 5AR7A 2P4IA 4TKSA 2FA2A 3GFEA 4QMLA 3QWKA 4NZWB 3WF5A 3I7CA 3ZLXA 2I0YA 4RX9A 5CAQA 5BPYA 4QP9A 4ZY6A 3R9NA 5E8YA 3U6HA 3MH0A 4JX3A 3LCSA 3EYGA 4FSUA 3PPKA 2VTLA 4FE2A 3TTJA 2LGCA 4RIYA 4RRVA 2WZJA 1J91A 3PFQA 3PVUA 4NCTC 4QMWA 1FMOE 5CEPA 4K8AA 4LL5A 2WMUA 2JDTA 3AT3A 4MNEA 2XJ1A 3PJCA 2GS2A 2VO6A 2WEVA 2YCFA 4RX7A 5GZ9A 3RHKA 3OCTA 3MFUA 4II5A 3SRVA 3F3UA 2KTYA 4EBVA 5CT7A 3CTQA 4F7LA 3VHKA 4KRDA 4J97A 4EZ3A 3UE4A 5I9WA 2CGWA 4I41A 4C4FA 2R7BA 1U4DA 4QMYA 2WMXA 3LLTA 4IXPA 4LUEA 3FY0A 5HG8A 5LXMA 1PXNA 3KA0A 4A9SA 5C26A 4I5HA 4CV9A 2XMYA 4IZ7A 4MQ1A 1OITA 3C5IA 1UKHA 4H1JA 4B7TA 2IVSA 3O0GA 2PK9A 4NCTA 1I09A 3K5VA 4FMQA 4CQEA 4DAWA 4BCFA 4R3PA 4DFLA 5HVJA 4WSYA 1JPAA 3B8QA 4E5WA 2ONLA 3TN8A 4LOPA 4ZS0A 3U8WA 3FI4A 2WB8A 4ENXA 4D2RA 3RPRA 4NFMA 3BYSA 4UXQA 3CEKA 4YC6A 2ETRA 3OG7A 3GGFA 5M57A 3ITZA 4UMUA 2B55A 3HLLA 5BX0A 2XCHA 2YM7A 1Q24A 4D1SA 3LFFA 2WU6A 1VZOA 3ZEWA 3GBZA 4APCA 4H05A 1HCKA 2F7XE 3DS6A 4RFZA 1JLUE 3VQHA 4RVMA 3M11A 3ZONA 1W0XC 4PP7A 5GIOE 3HV3A 5AR5A 5LMKC 4RLLA 4D1ZA 1LR4A 5EKNA 4QQJA 4BI2A 2AC5A 4BDJA 3Q9YA 5D41A 5KCVA 3OW3A 1U5QA 4CNHA 5LOHA 3CGFA 4KINA 4QPAA 2HW7A 2XNOA 1NVSA 4IX5A 3R30A 3IPHA 3FQHA 4IWPA 2YLFA 4S2ZA 2Z7LA 4I5CA 3ORZA 1BL6A 3LFDA 3W55A 2J9MA 4DINA 4AQCA 4AUAA 1XWSA 2UVZA 3UG2A 1PXKA 1OIQA 5A46A 1H27A 2JLDA 4IM0A 3PPZA 2QURA 2FSTX 4IE9A 3QZIA 3A61A 2CNUA 2BZKB 3CE3A 3MGYA 1YXTA 3Q5IA 3ZO2A 2PZ5A 2WQBA 3BELA 4XV3A 2XK7A 3TJDA 3V51A 4O7ZA 1M2QA 4E8AA 5JZJA 4EQUA 2IW9A 2EXEA 3I4BA 1FMKA 5D11A 3V8SA 2WIPA 4R77A 3SG9A 4G3FA 2R3FA 3ZFYA 5L8KA 1YI6A 2YCQA 4EOSA 1BX6A 1MRYA 1AQ1A 2I0VA 4FSTA 3HP5A 3UOJA 3B2WA 3D2IA 3OW4A 4UZHA 3BE9A 2FSMX 2QOHA 1FOTA 2VWWA 3PWYA 5CNNA 3SOAA 2IVUA 3R7GA 3ELJA 3C4CA 2WPAA 3PXYA 1UNHA 3DY7A 1REJA 4W9XA 5DT4A 2UUEA 3MFTA 4FTRA 4L9IA 2YN8A 3FL5A 3V5PA 3FXXA 3TNQB 4CFWA 4I20A 3BBTB 5CEIA 2J0MB 4R7HA 2BIKB 3D0EA 1Q5KA 2Z8CA 4RA4A 4RIXB 5HE0A 2ACXA 5HLWA 2ZV7A 3OC1A 5C9CA 3WF6A 3DOGA 3QQHA 3Q53A 4UALA 5J9YA 5DIAA 5LVOA 5L8LA 3DZQA 4F64A 3FDNA 2X8EA 3UOKA 1YW2A 4DE4A 3KK8A 4RWKA 4LQMA 2XS0A 4QMXA 5FXRA 3H30A 4RJ3A 3ZU7A 4E3CA 5BMSA 3QRTA 4XG2A 3HRCA 4TWOA 4NFNA 3JPVA 3ZO4A 1UU7A 4C37A 4FKPA 4FIEA 5IQHA 5HG9A 3OCGA 4RJ5A 1SZMA 1WBOA 3LXPA 3RK5A 5I3RA 4D5HA 2UVYA 3DBCA 3DJ5A 3CCNA 1H1RA 3QQLA 4BF2A 4DT9A 4KIPA 5IQIA 4BR3A 4CEGA 3MH1A 4UMQA 4I23A 4F9CA 4WBOA 2PZPA 3IW5A 4FTOA 5E8UA 5FQDC 4AWIA 2JAMA 3LFNA 4EHZA 1ATPE 3IDPA 4FV1A 3SQQA 1YWRA 3E7OA 3A7FA 4WKQA 4ZTMA 1OL7A 4O2ZA 3T9TA 3ZM4A 4C61A 2B9IA 2R5TA 2O0UA 3UP2A 1IG1A 4D9TA 4CLIA 5E1SA 3P9JA 5AJQA 1GZ8A 3KN6A 2XF0A 3DNDA 4FSRA 4LGGA 4MYGA 4M68A 5EM5A 3ALOA 4JIKA 3G33A 3W33A 5C4LA 4RPVA 5BVEA 3WF7A 2OJIA 4FICA 2PZYA 4N4SA 3KMWA 5JKGA 3R8LA 3VS7A 3QZFA 5HTBA 4ANOA 2QVSE 2C5OA 4EYJA 4E4LA 3PZEA 4MXYA 1FVRA 4YSMA 4TYEA 2A4LA 2J5EA 2G2HA 4BCMA 1M7QA 2HCKA 2R3IA 3P1AA 5ETAA 4V0GA 4G17A 3V5JA 4BDFA 3VS6A 2G01A 4FKIA 4R7IA 4I3ZA 5L2WA 5CI6A 4QYEA 3ROCA 3BLRA 4OUCA 4U6RA 3O2MA 2B9HA 3ORIA 4O6EA 3RP9A 3BI6A 3BWJA 4ZJJA 2B4SB 5DN3A 5IQAA 2VX0A 2VWYA 3QQKA 4IX6A 4L52A 4EBWA 4O81A 5AV1A 5FM2A 1YWVA 1H25A 2PVJA 3D9VA 4QMTA 4RIXA 3R8ZA 4FZ6A 3HAMA 4LV5A 5EI8A 4E6AA 3KULB 4M15A 4BKJA 3UC3A 3FL4A 2HXQA 4YMJA 4YHTA 2R3LA 4YTHA 2J90A 5E90A 4ALUA 5CAUA 2I7QA 4GKHA 4RJ8A 4XV9A 3QZHA 4TWCA 5IH6A 4CD0A 4HPUE 3Q04A 3MIYA 2PY3A 2WTKB 3CXWA 2YACA 5DMZA 4FIJA 5A3XA 3TI1A 2P2HA 4W9WA 5KKRC 4CLJA 2X0GA 4FSQA 4WRSA 3ZUTA 4YZNA 4PV0A 5KX8A 4XX9A 3PY3A 5T6KA 5HNBA 4I6QA 4GJ3A 1AD5A 2HAKA 4JQ8A 3CY2A 3P0MA 4QMVA 4Y8DA 3TNHA 3N4TA 4ITHA 4NJDA 1SNUA 5AX3A 2F7EE 3H9RA 4USFA 2XUUA 3OTUA 2NNWB 4D4VA 4MBIA 4EUTA 4RC4A 2UZDA 2VTRA 3NWWA 4NM0A 4ZTRA 4BCOA 3PJ3A 4FV0A 5FTQA 2C0OA 5H2UA 2UW3A 3FZ1A 4IHPA 4QP1A 4E4XA 2XIYA 1OKVA 3FQSA 3KKVA 2WMRA 3ZBFA 3S1HA 5IQGA 3KXNA 3DK6A 3BQCA 3TV4A 2PMNX 3DK3A 3L8VA 1VYWA 1WBTA 3R01A 3LM5A 3BBWA 5A4TA 5GHVA 2OK1A 4TYHB 4UV0A 2XVDA 3AXWA 4LOQA 1XH5A 1Y6BA 3DQWA 1PKDA 4IC7A 2X2KA 4R6VA 2RF9A 4YC8A 3VN9A 2RKUA 3HMPA 1ZXEA 2C6MA 3ERKA 5IEYA 3LPBA 4LYNA 4DFNA 3F2AA 4KKGA 4ANMA 4TRLA 2CKEA 4FTAA 5HEZA 4I0SA 4I92A 1F5QA 4ZZNA 3Q52A 4AS0A 5A4QA 2VO0A 4HVIA 5CAVA 5HTIA 4W4VA 3DDPA 2C6DA 4XG8A 3IGOA 5DR6A 5K3YA 5IH4A 1G3NA 4FC0A 4B0GA 3HV6A 4P5QA 2C0TA 4F08A 4ZMFA 4S33A 4IB3A 2BDFA 3I5NA 3ZRLA 4HPTE 4ASEA 4CFXA 2VTQA 3O8TA 1L8TA 3VHEA 4DEDA 3NNWA 3BE2A 3RAIA 3QTZA 3VRYA 5M4UA 4DEHA 5L6WL 5CU4A 2F7ZE 2R0IA 2AYPA 4FNZA 4G6LA 1SVEA 3R7VA 1IRKA 4AW0A 4OTIA 4QRCA 3NZ0A 3QRUA 5BVWA 4MXAA 4QP4A 3SAYA 3R0TA 2PVHA 4XBUA 1KWPA 2OZAA 1NVRA 5ANJA 4UWBA 4NTSA 5I0BA 2X7OA 3KK9A 3HMOA 4FEQA 3LJ1A 3VIDA 3E63A 5A4CA 5M44A 1MRVA 3E92A 3NPCA 4ZEGA 5FWKK 4YZDA 2HWOA 4IB0A 4ASZA 4HVDA 5HO8A 2WFYA 4PTGA 5CXZA 2ITZA 5CXHA 1OPJA 4FTJA 2QOBA 2VUWA 2BRNA 2XK4A 3MJ1A 1KUTA 4FG7A 3C1XA 3F3WA 4FZFB 4IWQA 4PMMA 5JMSA 3DJ6A 1BYGA 2P55A 3FV8A 4G5JA 5KUPA 4NIFA 3GXLA 4L53A 4I93A 5JK3A 2W5BA 4GFGA 3DLZA 3HX4A 4JI9A 4EOPA 2QO7A 3AC2A 3ZFXA 3S4QA 2FYSA 4ZZMA 4GMYA 2VTAA 5HD4A 2WTWA 4PMPA 3MJ2A 2IVVA 2VWXA 3TZ7A 3O17A 4LRKA 4BN1A 5HIEA 4KABA 1UVRA 4YZCA 4A07A 2GFCA 5M4FA 4E6DA 4M7IA 1H08A 3PA5A 4EC9A 3BV2A 4FT3A 4F09A 4PTEA 5HI2A 3FLZA 3DTCA 3EHAA 4NKAA 3DB8A 4TY1A 4AZEA 4DBXA 1OPKA 3P08A 4CYIA 2Z02A 4I1ZA 3ZBXA 4ENYA 2OIDA 4XP2A 2PYWA 2X6EA 3QX2A 4LFIA 4PDSA 2J0KA 2Z7RA 3C0IA 4FEUA 3BWFA 3A8XA 1GZNA 3UIBA 2XEYA 4NH1A 5FP5A 4UWCA 3LAUA 3VJOA 5DHJA 2PUIA 4BTFA 5JH6A 2JITA 4W4XA 5AUXA 3R04A 3KFAA 2XBAA 4JAIA 3P86A 3MVLA 4Y46A 4R3CA 3KRXA 1LP4A 4DEIA 3W8QA 3FLNC 4Z7GA 2E9PA 4DH8A 5M09A 4KSQA 5KMJA 2AUHA 4R7BA 1H28A 3WARA 3OT8A 5AIKA 3MH3A 2XK9A 4XLVA 3BIZA 4AX8A 4DGMA 2C30A 3UG1A 4R5SA 3WIKA 4WG5A 2BTRA 5AR3A 4QYYA 5AP1A 4ZSLA 5JFVA 4F6UA 3GC8A 3KXMA 4GUBA 2BFYA 3UPXA 3ZHPC 2JDRA 1YI4A 4Z7HA 4IBMA 1ZY5A 4CKJA 4QMSA 1QPJA 3QXPA 1BUHA 3I5ZA 1R39A 2BDWA 2EU9A 1AGWA 3K2LA 2XNBA 3EFJA 4QP7A 3E3BX 4A4LA 5FD2A 2OLCA 4O0TA 5FTGA 4E4NA 5FEEA 3V5LA 1JKLA 2HY81 2XKDA 4L7FA 4TPTA 4C4JA 2R0UA 3FLQA 3VW6A 4NIFB 3ULIA 3P7BA 4MVFA 5AADA 5HE2A 2VZ6A 1K9AA 2YJSA 3ZM9A 3B2TA 3ACKA 2IN6A 3W8LA 2WQOA 3REPA 4IJ9A 1M2PA 4FNXA 3UYTA 1G8AA 2Y6MA 3ZRMA 2JFMA 3ZFMA 2Y6OA 5HVKA 2W96B 2UW0A 4HGEA 4CV8A 4UN0C 4CT1A 5JRQA 4DH5A 2XNGA 4UYNA 5KHXA 3UJGA 4O22A 2R3KA 3ZXZA 1PKGA 5HORA 2XYUA 1Q99A 2OF4A 3ZTXA 5TF9A 1H00A 5CVHA 2IZRA 4I6BA 4CZUA 1MQ4A 2YFXA 4F4PA 2YM4A 4A7CA 4L46A 2QOCA 4QNAA 1JAMA 3Q4CA 5CU2A 3QBNA 4C7TA 4F1TA 4DYMA 4CG8A 4Q9ZA 4FSZA 4EK3A 3ZLSA 1RE8A 3PP1A 1S9IA 2ZAZA 3GU5A 4UMTA 2GS7A 4AN9A 4YTFA 3WILA 5B7VA 2YZLA 3JVSA 4V0GB 3T8OA 4GH2A 1UWJA 1YXSA 3LXKA 4GU6A 5CSVA 3NYXA 4HW7A 3GEQA 5KZIA 3RCJA 4IAZA 4CMUA 4WA9A 1V1KA 5J8IA 4FEWA 3ATSA 2NRUA 4BDHA 3BEAA 1BMKA 2GSFA 5AAGA 5CU0A 4ZLYA 2YM6A 3L9MA 3K3JA 4DLJA 4NU1A 4CTCA 4E73A 2CCHA 1R78A 4LUDA 1A06A 1MUOA 2XNMA 5JZNA 5BYYA 3COHA 5BVKA 4X6QC 3THBA 3ZOSA 4AGWA 1BL7A 3FMNA 3R6XA 3GT8A 3W16A 3GP0A 5ANKA 4UMRA 3SRVB 3KGAA 3SW4A 1XBBA 2V22A 2EXMA 4O84A 4RLKA 3IDBA 1OL2A 5CTPA 4DLIA 4MH7A 4FKQA 3C7QA 5B0XA 2GNFA 4F0IA 3O23A 4JDJA 2PUPA 3WZKA 3R8MA 5CSWA 3WZEA 3VS1A 1ZYLA 1Q3DA 2ZOQA 2UW5A 4QTBA 4JQ7A 4TTHB 5C1QB 3UODA 4MK0A 4C2VA 3F69A 4I21A 2QG7A 2ETMA 3HDNA 5CALA 5CX9A 3TTIA 4BCGA 3RJCA 4CQGA 2ZMDA 4RIWB 4ZS4A 1YOMA 4EKLA 5CF6A 4R3RA 3W1FA 3IW7A 4EEVA 5IDNA 4AN3A 3I1AA 5B2LA 3FPQA 3KN5A 5CAOA 3A7GA 3EKKA 3EOCA 2QI8A 5HGIA 4XLIA 4BCJA 3ZUVA 2X7FA 4MF1A 4M97A 4QQ5A 2CKQA 3FHRA 4YJPA 2BKZA 4ERWA 3CD3A 1RJBA 4LGDA 5IUGA 2Z60A 2PVMA 3DB6A 3KMUA 1X8BA 4WOVA 3O7LB 4CFFA 4QYHA 2IO6A 2ZM3A 2X7GA 4E20A 3MA3A 4GG7A 2CGVA 1YRPA 3TNIA 2PMIA 5G6VA 3NGAA 3HECA 3IKAA 3QTUA 1KE9A 4K11A 3I6WA 3JS2A 1PMNA 4DH7A 4XS2A 4OT6A 4ZSAA 5EQYA 4AZFA 1O9UA 4RWLA 4AGDA 2UZWE 5HIDA 4QO9A 4FV8A 4IVDA 4EK4A 1YDTE 4M66A 4ORKA 5LMKA 4GK2A 4YZMA 5KE0A 2C5VA 5CWZA 3FQEA 3ZXTA 5LCKA 4W8EA 3UNJA 4L45A 5L6PA 3UO5A 5KHWA 3IQ7A 1XHAA 4EC8A 3R9RA 1ZZLA 3H10A 4QMZA 3R1YA 4DHFA 3WI6A 2QC6A 2VWBA 3O8UA 5L2SA 4O7WA 2CGUA 4CFUA 5CVFA 2HZ4A 2O64A 3ZUUA 3FI2A 4JG8A 4EH2A 3BHYA 2UW6A 2VGPA 1H0VA 3V5QA 1FVTA 3HA8A 4XRJA 3FZSA 1UU8A 5EHLA 5GJFA 4G6OA 4D2SA 1H4LA 3CGOA 1NVQA 3LZBA 3NW7A 4PL4A 3UDBA 5K5NA 2J5FA 3KXZA 2HZ0A 3UVPA 4BFMA 3LMGA 5GNKA 1WBNA 2BCJA 3EJ1A 2QO9A 5DRDA 4XNEA 3LQ8A 3FMJA 3QKKA 4RSSA 3ZO3A 3IK3A 4FTQA 1SVHA 1OL5A 3HKOA 3EB0A 3BHTA 4FG8A 4RA5A 1J7IA 3DV3A 3NVKI 4UEUA 4YJVA 3MESA 4FTLA 1SMHA 4G34A 4C58A 2JKKA 3TV7A 4HVGA 1WBSA 1J1BA 2QR8A 2IZUA 4LRMA 3NYVA 4XRLA 5CZHA 5BVDA 5CSPA 4GFOA 4HCTA 2WHBA 2YDJA 4QT1A 2JIVA 4U9AA 3UP7A 4IX4A 2ZM4A 2W5HA 4M69B 3DXNA 4NTTA 4IAAA 2Y7JA 4IH8A 3EN6A 4DGNA 1SVGA 4NM7A 5TE0A 3AOXA 3VUKA 3LKMA 1ZAOA 1XBCA 3HYHA 5HBHA 4DC2A 5EI6A 5KBQA 2W9ZB 4M67A 5BUEA 2ITQA 4ALWA 1WAKA 1IAJA 4C33A 5I4NA 3WYXA 4I94A 4AW5A 2FSLX 3TJCA 1H1WA 2WELA 3COKA 2PU8A 2O5KA 3C5UA 5ANGA 4YBKA 2VO7A 5DEWA 4X0MA 4AZVA 3E8NA 2Y4IB 3POZA 3PJ2A 5JGDA 4TWNA 5FP6A 5LWNA 2F57A 3HAVA 4XG3A 2V7OA 1DI9A 4RVTA 1P5EA 1KV1A 3VBWA 3ID6C 3AG9A 2BHEA 2W1FA 5ANEA 3MW1A 5D7AA 4BHZA 3RINA 2BMCA 4C36A 2YERA 3TM0A 3GCUA 1WZYA 5AP3A 2XRUA 5M51A 2E9OA 4FKRA 5H3QA 1YDRE 2GQGA 4CYJA 2PUUA 4GIIA 1DAWA 3C0GA 5CVGA 5CANA 1M52A 4KS8A 4RG0A 4X2GA 1HOWA 2RFNA 5ACBC 4G3GA 4ZLZA 1FGKA 3R1QA 3FLYA 2C3KA 3VS5A 4F63A 2J0IA 4WG4A 4IM3A 4XG6A 4L43A 2A2AA 3DBQA 1O6KA 4UXLA 4A9RA 4ACHA 4AG8A 5AAEA 2FO0A 5IMEA 4I22A 1ZOEA 2B9FA 4IZAA 3GFWA 3QF9A 2GU8A 2UZNA 2WTDA 3A2CA 3NX8A 3SOCA 4D0WA 3LMHA 4L8MA 4W8DA 4L6QA 2PE2A 2WXVA 3UYSA 1Q41A 3QCXA 3SX9A 4DA5A 3PUPA 4C59A 5E91A 2UW4A 2PE1A 2G2IA 2VWUA 4X3FA 5GZ8A 2UZTA 1IAHA 3LJ2A 3N51A 2CNVA 3PA3A 4O7RA 2HXLA 4S34A 1GZOA 3EQPA 5CEMA 4ID7A 2UW8A 4P4CA 2XRWA 3R9DA 1OECA 4OTGA 2JFLA 5C27A 4F65A 1UKIA 1K3AA 2YEXA 3PVGA 5AV2A 2PVNA 1O6LA 3QYWA 3DKCA 4Q9SA 4ZTLA 3QA8A 2I40A 3PVWA 3Q9XA 3LLAA 2ZV9A 4I4EA 4BGHA 3NUUA 4B99A 1VJYA 3QD4A 2XJ0A 1IASA 2YITA 1KSWA 1PJKA 2NO3A 4FK6A 4KD1A 4TYJA 4K33A 3VVHA 3O7LD 5A9UA 4R78A 3AC4A 2YISA 1PXIA 2HY0A 3QLFA 3PYYA 1GZKA 4IEBA 5B2MA 2CDZA 1PYXA 3AQVA 5C03A 2FVDA 3MPAA 4LL0A 2CHLA 5HESA 5C8MA 1CKJA 2EB2A 2JAVA 4WNMA 5IH5A 3GCSA 4H3BA 3D2KA 3KB7A 4IZ5A 3E8EA 4YBJA 3ZDUA 4FGBA 3RKBA 5IISA 3V6SA 4FTUA 3SC1A 2IPXA 1Y91A 5CZIA 3NUSA 5DE2A 5IUIA 3CSVA 3HMIA 4BGGA 2Z7QA 5AV0A 4CVAA 5M53A 2GS6A 1EH4A 4E5AX 4N6ZA 1YXVA 2VTPA 4JR3A 4GL9A 5KMMA 3FC2A 4BDEA 3AMAA 2XJ2A 4MD9E 3KY2A 2W5AA 1CKIA 2OZAB 2QU6A 5CNOA
chains in the Genus database with same CATH superfamily
1YXXA 2ZV8A 4DCAA 3HZTA 4GIHA 3CQEA 5AR2A 3ZDIA 5ICPA 1VR2A 3FXWA 3PFYA 5EM8A 4RBLA 4JBQA 4EKKA 1W2CA 5AR8A 2ITVA 2ERZE 3JY9A 3EMGA 3UZPA 3OUNB 4FGRA 2XIZA 3HDMA 5I9ZA 3QRKA 3OVVA 5DG5A 3H9OA 2WOTA 3W32A 3UOHA 4C4IA 4L3PA 5M08A 2B54A 3FPMA 3G9LX 2BPMA 2P2IA 4XG4A 4Y95A 3SA0A 1U46A 3SVVA 3TDVA 3OXZA 5ANDA 3UMXA 2J51A 3ENMA 1REKA 3MYGA 3RAHA 4EOKA 5JEBA 2BDJA 2HK5A 4X6RA 2ESMA 5HNGA 3HUBA 2XIRA 4MTAA 4JT3A 4TN6A 5EOLA 3EFKA 3C0HA 4GCJA 4FKOA 5HCZA 3OP5A 1H26A 4FUXA 4N6YA 5FEQA 2OSCA 2QR7A 3HRBA 3PIYA 3KRRA 4XUFA 3O71A 3RK7A 5AUUA 5ETCA 1GIJA 3A62A 2C69A 4MKCA 4ITIA 1GY3A 2ITOA 4J99A 3R8UA 1PRYA 2B0QA 2IW8A 2GQSA 4NM3A 4EZ7A 3BHUA 3TKIA 2YCRA 3RK9A 2YWPA 3S3IA 1JSTA 3PRFA 3MWUA 2REIA 4RC3A 5H8GA 4FYOA 4X3JA 4EORA 3MH2A 5KNJA 4H39A 2VTHA 4IAYA 3MPTA 2PE0A 5AA8A 3JYAA 3MY0A 3Q2MA 5KZ0A 2OI4X 2RG6A 3IW4A 3OEFX 3KVXA 4KBCA 3CP9A 4LI5A 1LEWA 2E2BA 2WGJA 4FOCA 3OZ6A 4KKHA 4NM5A 4EK5A 4MXZA 5E8TA 2C47A 4C0TA 2I0EA 2PVLA 3U6JA 1MQBA 4ZSGA 3O51A 3LCTA 5HU9A 3DJ7A 3MB6A 2QOFA 4OBOA 2UVXA 3HNGA 4PWNA 1Y6AA 4RVKA 4AZTA 1VYZA 2G15A 5HBJA 3OWKA 4IMYA 3OD6X 3BX5A 4FIIA 5CEOA 3VS0A 3IOPA 3FC1X 3LFEA 1Z57A 2NYAA 2Q0BA 3QX4A 2B1PA 2JBPA 3HA6A 4IAIA 2A98A 4Y85A 2EXCX 5FXQA 3L8PA 3UVQA 4DCEA 2OH4A 2ZDUA 4FVQA 2JGZA 4NKSA 3ZYAA 3D4QA 3DQXA 3Q4UA 2JKQA 4QMOA 1ZARA 2HWPA 1FQ1B 3UQGA 5CEKA 1ZMWA 2VNYA 1OZ1A 1ZZ2A 1Q8ZA 4FZDB 5E8SA 4H3PA 3UDSA 2VTMA 2PWLA 3R00A 4QTAA 4F70A 1K2PA 1XH8A 3DAJA 4QPMA 3KXHA 3ORMA 3D15A 3R7IA 1YHSA 2XARA 4YNOA 4J7BA 1Q8UA 3A99A 4FSWA 1JQHA 3R71A 4WO5A 4USEA 5HD7A 5IA1A 3OXIA 4FK3A 3EN4A 5IUHA 3SGCA 4IB1A 5EYMA 4F6WA 1FGIA 3OXTA 3L9NA 2IZSA 2QKWB 4HGTA 4I0RA 4ITJA 3VUIA 3WIGA 1OBGA 2BKKA 3S2PA 1TQPA 1XJDA 4FSYA 5E9EA 2WD1A 1ZWSA 2VX3A 4FBXA 3QL8A 4E5BA 1R0EA 2VRXA 4IVBA 3VNTA 4CFNA 4V01A 5J5SA 1P14A 1A9UA 4AQKA 3ANQA 5I9UA 2G2FA 2O65A 4L7SA 4CSVA 5FLFA 2XNEA 4QOXA 3BGQA 4DTKA 2X9EA 4U97A 4Z55A 4J96A 2RIOA 2NPQA 4FT0A 3BHHA 4WNOA 5IF1A 5D9HA 1BI7A 5K0KA 4OBQA 4BHNA 4PMTA 3OWPA 1PMEA 3GQIA 3PY1A 5KMNA 3HV4A 4W4YA 1FVVA 2ZB0A 4FKJA 1Y8YA 3MTLA 3CIKA 4K6ZA 4X2FA 4ZTHA 3NAXA 3QAME 3QTQA 4FZ7A 4GK3A 4BTKA 2OXXA 2HELA 4E26A 4H3QA 2RG5A 2EWAA 4TW9A 4FL2A 2PPQA 1YWNA 3UZRA 4DTAA 4I0TA 2ERKA 2VTTA 5CU3A 2CJMA 3FYJX 4ZOGA 2EB3A 5AP6A 4WD5A 4CCBA 1F3MC 2ZDTA 3R9OA 1NXKA 3NUXA 3R2YA 4CKIA 3P78A 3BV3A 5GINE 4PPCA 2WMVA 3FJQE 3UO4A 3KQ7A 4NL0A 5D10A 2Q83A 2BVAA 3P23A 1DS5A 3ETAA 4L44A 4O0WA 5CF5A 5F9EA 1UU9A 4G1WA 3LQ5A 1MRUA 5KMKA 4BDCA 3TL8A 1M2RA 4OTWA 3VF9A 1W84A 1W98A 1JOWB 3DA6A 4I5MA 1ZOHA 2CLQA 2W1IA 3D5VA 5BYZA 2XIXA 3QTIA 2YIWA 3E8DA 5E8ZA 3U9CA 3AD6A 3IW6A 3PP0A 3WZJA 5IPJA 3QRIA 4DH3A 3LFBA 3E8CA 3SLSA 4U44A 1QMZA 4LMUA 5F4NA 4O7TA 4CFVA 3P79A 5CF8A 4FV7A 2ITNA 3V8WA 3A4OX 4EWHA 4H1MA 3IW8A 2BHHA 2QONA 2WU7A 4JDIA 3NYNA 4F9AA 4HJOA 5TOZA 3KF7A 4FNWA 3MY1A 4NEUA 4PF4A 3AC3A 4FV9A 1WBPA 2XKCA 3VBVA 3I6UA 2QOIA 1OKZA 2VWVA 3PJ8A 4DGOA 4BY9E 4GVJA 4AOJA 4KB8A 3ROYA 1SNXA 4F9WA 5CT0A 4G3EA 4A4XA 4OGRA 2VTSA 2G9XA 2I0HA 5DEYA 1WMKA 3E5AA 4J8MA 4F7NA 2PSQA 2FUMA 2X1NA 4MHAA 5HG7A 1XH4A 4HYHA 1ZLTA 2XBJA 4FNYA 5HIBA 1OUKA 3S95A 4U7ZA 4M0ZA 2BZJA 4XJ0A 1CMKE 2B7AA 2GTMA 2H9VA 2J50A 3QC4A 4FR4A 4C3PA 5K9IA 3KRWA 2J4ZA 1J3HA 2YZAA 3E88A 3G5DA 3NLBA 5CENA 3TNPC 2ZJWA 3R7OA 5ETIA 4HNFA 4UX9A 3F2NA 3GU4A 3O8PA 5HX6A 3VBQA 4XH6A 5T3QA 4XP3A 4ZTNA 4DG3E 3DFCB 3VBYA 5J1WA 4MXXA 5EK7A 2IVTA 3QFVA 4GUEA 4I6HA 3PLAE 3EQGA 4TXCA 2XEZA 4IZYA 1G8JA 1ERKA 3LVPA 4HNIA 2Z2WA 3TT0A 4BKZA 1ZYDA 4IAFA 4U45A 5H8BA 3WZDA 4X3FC 2OZOA 3RNIA 4BL1A 5C8NA 1Q97A 2C0IA 3DDQA 3HL7A 3LJ0A 4AP7A 4OAUC 4AW1A 2UV2A 1Q61A 3E93A 4M14A 4FA2A 2I1MA 2O2UA 4OR5A 4Y5HA 5EYCA 2JKOA 3QTSA 3WZUA 3COIA 2NRYA 3FWQA 4FYNA 4H36A 4N0SA 4U42A 1OGYA 3DAEA 3QQUA 3I60A 5JQ5A 1PXLA 4Y72A 4EUUA 3NIZA 3CKWA 4DF3A 4ASDA 4AE6A 4YJOA 1Q62A 4BCKA 3DTWA 4AN2A 4FT9A 2R3NA 2X8DA 4HCVA 2CCIA 3UBDA 3V5TA 3WOWA 1KOAA 2R3MA 3R2BA 3TEIA 3UIXA 2Y0AA 3MI9A 4DG2E 1DI8A 2OGVA 3H3CA 1FINA 4NW6A 3MFRA 5IA4A 1QPEA 4G16A 4QTCA 1A48A 2C1BA 4BRXA 4O7LA 2OIQA 4L67A 3LXNA 5CAPA 2XAOA 5IG1A 3GOKA 4Y73A 4JIAA 2HYYA 3ZH8A 4ANSA 2VTJA 5EHYA 5I9XA 4DEAA 4DT8A 3FMDA 3O96A 4FKVA 3OMVA 3RAKA 2OIBA 3BLHA 3V6RA 4AT5A 1UWHA 3MIAA 1U54A 2GNGA 5D7VA 4DFYA 1H1PA 4OTQA 4ZY4A 3FKLA 3IG7A 3PSBA 1STCE 3F5XA 3PG1A 2CMWA 3HRFA 3QWJA 2VTOA 2JDSA 2R9SA 4NUSA 1GJOA 4AA5A 4FKWA 1XMLA 4I6LA 4GKIA 2R3GA 4U8ZA 4IW0A 2YWVA 4Q5HA 1G8KA 5J9ZA 2JDOA 5AA9A 2J0JA 2IWIA 3EQRA 4C62A 5TKDA 4ZAUA 4NW5A 3OY3A 2PMLX 4IANA 1HCLA 1NY3A 2WMBA 3UVRA 3S00A 1JKKA 3F2RA 3VBXA 3D14A 4RFMA 3CJGA 3V8TA 4FTMA 3FE3A 4FTNA 4LRJA 3OT3A 5AUTA 4O4DA 4QTEA 3PXZA 5J1VA 5DT3A 3TV6A 5E7RA 3IDCA 4YR8A 2J6MA 2XKEA 3V3VA 3EQBA 4FIGA 4YJQA 4ZSJA 4BIBA 5EW3A 3RGFA 5AWMA 2VX1A 4BZOA 1H0WA 4KWPA 4U80A 4D5KA 4C8BA 3PPJA 5AP4A 2C6EA 2QNJA 4RFYA 4EK8A 4KNBA 2XKFA 5A6NA 5BVNA 4K2RA 4YGAA 4YU2A 4PNIA 3FI3A 4YHJA 5J9LA 4EK6A 3OWLA 5HOAA 3LFCA 3NEWA 4M13A 4Z9LA 1H1QA 1IA8A 4TWPA 4YJUA 2C6KA 5EM7A 5IA3A 3EIDA 4ZJVA 4ZIMA 1H01A 4GT5A 4PPBA 5EYDA 4O83A 2C3LA 3TACA 4FODA 5AEPA 3D7ZA 4MAOA 3RZFA 5LVMA 3SW7A 4EOOA 3LE6A 5L4QA 1PF8A 5I9VA 5H8EA 5EM6A 4BBEA 2W1HA 1GOLA 3IO7A 4U3YA 5J87A 5HBEA 4AXCA 5IQDA 3CY3A 1B6CB 3GU6A 1OI9A 2F2UA 1JKSA 4ANLA 5A4EA 4FOBA 2ITTA 1OUYA 4PDOA 4AW2A 4QMQA 4QNYA 5E4HA 4PDPA 5A6OA 1PXJA 4C02A 3LQ3A 3QGWA 3ZZEA 3KCKA 3W0QA 1TZDA 3P5KA 2V5QA 3QZGA 1WBVA 4QPSA 1OIRA 2BFXA 2Y8OA 3C4EA 3A60A 4PPAA 4WHZA 2OXYA 3RCDA 4F0FA 5HZNA 4LV7A 1JSUA 3DGKA 5BUIA 4RX5A 3BU5A 5EDPA 4RIWA 3V5WA 1QPDA 4FEXA 3TG1A 2XYNA 4MEDA 4RZVA 4OT5A 4GW8A 4BTMA 4J71A 5CY3A 3ZCLA 3RWQA 4KRCA 3ZO1A 3FLWA 4EH7A 4RVLA 3NRMA 4EHVA 4YO6A 3F5PA 4HVHA 1PXMA 2P3GX 4Y83A 1GNGA 4F9BA 4YTCA 2W1DA 3MSSA 3SV0A 3C4ZA 3L9LA 3BGPA 2F49A 3HEGA 4GJ2A 5HG5A 4DEGA 2PVKA 3OCBA 4MD7E 3LFAA 3FSFA 5IA5A 4NK9A 4X7QA 1YVJA 2GPHA 3A7HA 4KKEA 4YC3A 5DWRA 4O0YA 4EYMA 4YUQA 3BU3A 2VD5A 4KUJA 2OH0E 4GG5A 3KMMA 4J8NA 2OJ9A 4B8MA 4EI4A 5M4CA 4HZRA 3FZPA 4O96A 4BBMA 4D28A 2BROA 3Q4TA 1V0OA 1RQQA 1XH6A 4ZXTA 5HVYA 4BI0A 1JNKA 4YLLA 2XM9A 4X21A 3CPCA 4CTBA 4PL5A 4Y5QA 1YI3A 4NWMA 5JFWA 5LMAA 3EFLA 2BZIB 3F6XA 4ACDA 4YJTA 3QCYA 3LFSA 2WMWA 4RMZA 4C3FA 2JIIA 2WQNA 3WF8A 3H4JA 5IQBA 5EHOA 4IJPA 2YAKA 4IAKA 4EQMA 4FTCA 3GCQA 1KE6A 3AC5A 2KULA 3P4KA 2UZOA 4WT6A 1T46A 3UNZA 4O86A 4MF0A 2W06A 3VO3A 2X0PA 3ORPA 4PDYA 4FT7A 5H9BA 5T68A 1J7UA 2ZVAA 3IOKA 4JJRA 4ZSEA 2V0DA 2YAAA 1WCCA 3PZHA 3EYHA 3PIZA 3W2SA 4C4GA 3LW0A 2DWBA 3NDMA 1I44A 1ZMVA 5AM6A 3U51A 2OICA 4LV8A 4O0SA 1R1WA 3KU2A 3RPYA 1ZYCA 4IADA 5EQPA 4O0VA 4DGGA 2AC3A 4I4FA 2VU3A 4OTRA 3ZLYA 5IKWA 2C3JA 4FV6A 3G6HA 4V05A 3RHXA 3RBWA 5A14A 5M06A 4YURA 2CKOA 1JVPP 3KIOC 3BPRA 4ARKA 2BRGA 4PRJA 5AAFA 4N57A 4AA4A 2C4GA 3MVHA 4CT2A 1OIYA 3OHTA 1UV5A 4ONAA 4YZ9A 3SXSA 2PL0A 3TZMA 3PXQA 4X2KA 2ONLC 5DLSA 2OXDA 3M1SA 4PL3A 3QRJA 4XOZA 2BRHA 4YSJA 5K4IA 5D1JA 2ETKA 4BGQA 3LCDA 1URCA 3FI8A 3O50A 4YJNA 1UA2A 4GV1A 4JR7A 1JBPE 3UGCA 3BU6A 4FL1A 4MX9A 3TZ9A 3ZLWA 4UMPA 4PNKA 4GK4A 4K18A 3TNWA 1W2FA 4XCUA 4V04A 3RTPA 3VS2A 3BZ3A 3ORTA 4M69A 5EYKA 4O7SA 3BL9A 3LMIA 2WTIA 2YCSA 5AUWA 3ORLA 3FZOA 2GHLA 4JXFA 2YIQA 1J7LA 2OJJA 1OIUA 5DOSA 3QGYA 1WBWA 4H58A 5AUZA 2XH5A 2JC6A 4AZSA 4A9YA 5FRIA 5D12A 4PP9A 5CLPA 3FXZA 3CTJA 2BIYA 2YM8A 1H1SA 4IM2A 3RZBA 3MA6A 2CNQA 3MBLA 4FTTA 4JDHA 1PXPA 2V7AA 2OKRA 1Q8YA 4BIDA 3OOMA 3NFFB 4QDVA 3PXFA 3U54A 3MVJA 2W99B 5BNJA 3KULA 3ZZWA 2A19B 4O21A 5BVOA 1P2AA 4L42A 5AUVA 2QOKA 2QU5A 4KBAA 3T9IA 3ENHA 3FMMA 1KE5A 3H0YA 3GQLA 1WVXA 4FTIA 2W17A 2OWBA 4IDVA 4YJSA 4BBFA 3F66A 4AGUA 3OY1A 2XK3A 3EQIA 1VLRA 4C38A 2GNHA 2EVAA 2VAGA 2WTJA 4PUZA 1H8FA 1Y8GA 4A9UA 4DFZE 4D1XA 4O7VA 3R83A 3FYKX 4QQCA 4XV2A 4CXAA 1PHKA 2IG7A 4IFGA 4D58A 4HYIA 3V04A 2LAVA 2R3HA 5GJGA 3FSKA 4Z3VA 3BYOA 4EONA 4IDTA 4GFMA 4YLKA 4YNEA 1BI8A 2YJRA 4RT7A 2YHVA 4QMNA 2PULA 3GI3A 3QU0A 2CSNA 3BQRA 3EL7A 3QYZA 4KAOA 4O0XA 1ST4A 3NUAA 2GQRA 2GCDA 4JRVA 4U41A 4FTKA 5JT2A 5HO7A 4YPDA 4FEVA 3KF4A 4DHJA 4F78A 2BRBA 3CLYA 5F20A 5AV3A 3G0EA 4XYFA 2BILB 2OG8A 4BZDA 3PRIA 3W0OA 2UZBA 4CCUA 3BYMA 1APME 2PVFA 3F7ZA 3FKOA 5FTOA 3TDWA 5AIRA 3G9NA 4NJ3A 2WMAA 4Z16A 3EQCA 4LDTA 4ACGA 3LCKA 3TKHA 3TUBA 3AT2A 5GZAA 1DAYA 3R02A 4QMMA 4JG6A 3B8RA 4BDGA 3EWHA 3QKMA 4CMOA 2F2CB 3OFMA 1V0PA 4C3RA 3E64A 3U4WA 2F4JA 3FMEA 5JGAA 2DUVA 3A7IA 4FKLA 4EH8A 3SG8A 3OBGA 3KCFA 1M17A 4FKGA 3KXXA 1YOLA 4G5PA 3EQDA 4OTFA 4QP6A 5M55A 3RWPA 4A9TA 1IA9A 3PJ1A 3F7WA 2QOOA 4WNKA 5HU3A 2X8IA 4QQTA 4TNBA 2VTNA 5AX9A 2WTCA 4HGLA 4O4FA 4AU8A 3QC9A 4EJNA 1Q8WA 2ZV2A 2OU7A 4KS7A 2ITYA 5AUYA 1PXOA 3VUHA 3PLSA 4RGJA 1F0QA 3DAKA 3MS9A 4CZYB 3AD4A 1XH9A 3D7TB 4O6LA 5F94A 4OW8A 3KREA 4TYHA 5LMBA 4FKSA 5KMIA 2WO6A 4BKYA 2C6OA 3JR1A 5I5ZA 3EQFA 3UQFA 3K5UA 2Z7SA 3F9NA 3HGKA 3EZRA 1QCFA 4RQVA 4XHKB 5CSHA 1OMWA 5ANIA 5JFXA 2FH9A 5A4LA 3QCSA 5E1EA 2ZM1A 5TO8A 4B6LA 3OTVA 3F5GA 3MDYA 4L3LA 5LWMA 3P5JC 3OBJA 3NS9A 4G2FA 5LVPA 4FJVA 5EW9A 3QD0A 5EFQA 4AT4A 4TL0A 5LARA 3GC7A 2OJGA 2XCKA 2SRCA 2C6LA 5IA0A 5C8KA 1NW1A 3KVWA 4DFXE 2A1AB 4D0XA 3BRBA 3DK7A 3UNKA 5FBOA 3NCZA 4PTCA 3OOGA 3R7UA 1T45A 3OCSA 5ITAA 4FV5A 4ZY5A 5LQFA 3MVMA 3R63A 4AACA 5AV4A 4LM5A 3T3UA 5AP0A 4EOQA 2XB7A 4EQCA 2R2PA 1W83A 2IJMA 2VV9A 5AP7A 1YOJA 1OGUA 4KBKA 1B39A 4QTDA 1RW8A 5HX8A 2QQ7A 2WMTA 3G0FA 4TZRA 3ULZA 4BWKA 4D2PA 4ZTQA 4DHIB 3LXLA 4NYEA 3ZSGA 2FGIA 4O27B 4M8TA 1TFFA 5L2IA 3VUMA 3LFQA 4ZZOA 5HLPA 4HYSA 4CRLA 4C57A 3DKFA 1PMUA 2AQXA 4JVGA 3VONA 2H96A 1YXUA 4EWQA 2YLEA 2HZNA 4J53A 3W2CA 1E1VA 3KL8A 3NUPA 4PQNA 4PY1A 5FGKA 4BCQA 3RM7A 4BDDA 3DKGA 3QXOA 3QKLA 4CGAA 2J2IB 3MB7A 3NW6A 3GCVA 3I0OA 2UZUE 2FSOX 4MBLA 4O0UA 3R7EA 1BLXA 3WF9A 3L8SA 4HGSA 3ZMMA 3RMFA 3NR9A 2X9FA 4W4WA 4FI1A 4PMSA 4YJRA 4R1VA 3RNYA 4AXEA 5IU2A 2UW9A 2WKMA 2X2LA 2YIRA 4JOAA 2IW6A 1R3CA 4M3QA 4YTIA 5HE1A 2R64A 4J52A 4GVAA 5C01A 3H0ZA 5HLNA 1JSVA 4KIKB 3EL8A 5DNRA 5BVFA 2DYLA 3GENA 4BDKA 5J95A 3OF0A 3PY0A 5K5XA 1OBDA 5M4IA 4GU9A 4S31A 2YDKA 4WG3A 4GYGA 4RZWA 3QTWA 4BVUA 2BR1A 4TYGA 1H07A 4IIRA 4UZDA 3SKCA 4ANQA 4CG9A 3GNIB 1Q8TA 3SDJA 4EOIA 3SD0A 4J95A 1OPLA 2VNWA 3JXWA 4XMOA 2RFDA 5LVNA 3C4WA 3ET7A 2YM3A 1G5SA 4RQKA 2IZTA 4K1BA 3CQUA 2WNTA 4JNWA 4U81A 5E92A 5EDQA 3VULA 2W1GA 2O8YA 5FXSA 4QDEA 4DBNA 3TIZA 3IECA 2WAJA 3QLGA 2GNIA 5EH0A 3EZVA 3KXGA 4EH4A 4BWPA 2X81A 3UQCA 2QODA 2B53A 2HW6A 3QA0A 3C4FA 4F1OA 3HUCA 2C5NA 4MNEB 5CQWA 3E62A 5G1XA 2PHKA 2UZEA 2JBOA 3M42A 4MXCA 2BTSA 4G6NA 2ITXA 4RIOA 4GSBA 4DG0E 4C2WA 4MQ2A 5CSXA 2RSVA 3HP2A 3RI1A 4EH3A 4FRFA 4G9CA 5EKOA 2VO3A 4YP8A 4EHGA 2C68A 4BWXA 5E8VA 4HYUA 4CZTA 3GB2A 3OS3A 3COMA 4YZBA 3VS3A 5CASA 1BKXA 3ZC5A 2YM5A 4QMUA 3F82A 2OF2A 3PIXA 2BAKA 4ACCA 3MY5A 1Z5MA 4XBRA 4CFMA 4BC6A 4BCIA 1CSNA 3Q4ZA 4FKUA 4JG7A 4LG4A 1P4FA 2XZSA 4FIHA 2A0CX 1KV2A 4E6QA 3VW8A 3BCEA 3FZRA 4FT5A 5F1ZA 2CLXA 1ZYJA 2R3QA 4UY9A 1O6YA 4KSPA 3W2OA 2UW7A 2P0CA 3VS4A 3PA4A 4AF3A 1RDQE 4JBVA 3Q3BA 3Q5ZA 1KOBA 2WTKC 4JS8A 3FHIA 5FM3A 4DEEA 5HE3A 3R8VA 3NVMB 4EHEA 1G8SA 4APPA 5HO6A 2QG5A 4R1YA 4P90A 2W4KA 2ZYBA 3G51A 3FMHA 5DVRA 2GDOA 2R3JA 3ZEPA 5KO1A 3NUNA 1NA7A 2WQMA 3KRLA 2WOUA 2VGOA 4B4LA 4DFUA 5JQ8A 3UPZA 4EH5A 4RJ6A 4WSQA 4QP3A 1OKWA 4ZLOA 3BHVA 4X2JA 2BZHB 2C6TA 2OFUA 3GOPA 3GUBA 3HMNA 1Q4LA 4TNDA 2YABA 4RC2A 3U87A 4AFJA 2JDVA 3DPKA 4JX7A 2QLUA 2W05A 4BICA 4BIEA 1DM2A 4M0YA 4DH1A 1Q3WA 1IEPA 4G9RA 4FVPA 3QD2B 3RM6A 4DDGA 2RFSA 1GIIA 1U54B 2B9JA 2Q0NA 3D83A 4XEYA 2H34A 4BYJA 3C50A 2PMOX 2QO2A 5I3OA 3UMWA 4ERKA 2HOGA 3Q2JA 4FSNA 2ZMCA 1YHVA 5JRSA 3W2QA 4A06A 1WVWA 4UB7A 3ZC6A 4IWOA 3UDZA 2X4FA 3Q6UA 3LOKA 3EFWA 4D9UA 5KMOA 3OROA 4GT3A 4O91A 3BGZA 3R8PA 4DDIA 3FEGA 5IEVA 1CDKA 1JWHA 3FZTA 1IR3A 2XAMA 5FG8A 4KIKA 3AC8A 3DLSA 4USDA 4N70A 5CQUA 4JMQA 4YLJA 3DBDA 5DRBA 3L1SA 5E8WA 3MFSA 5L6OA 2O3PA 4JAJA 1OB3A 3RVGA 1Z9XA 3E7VA 4HZSA 1TQMA 4L3JA 1OL6A 4O2PA 3NNXA 1XBAA 4YPSA 4GRBA 3BKBA 3K3IA 1V0BA 3FMKA 3IONA 3OEZA 3NCGA 3W0MA 3TCPA 4EOJA 4ZP5A 5HCXA 2E9VA 3UC4A 4BDAA 2GMXA 3CBLA 4GS6A 3VWAA 1U5RA 3QTRA 2A27A 3IS5A 4RWJA 3VUDA 3NMUF 4DN5A 3NFGB 4F6SA 4L01A 1QL6A 2GNLA 4WUNA 4MBJA 3EN7A 4MCVA 4M84A 3R73A 2W1ZA 5JSMA 1YQJA 2OBJA 4FV4A 2CGXA 2W7XA 3CTHA 3F3ZA 5J5TA 4BI1A 1E9HA 3GC0A 2R3RA 3QUPA 5B2KA 3ZS5A 5DI1A 5ANOA 4A4OA 2V55A 4I6FA 2CKPA 5M07A 4EZ5A 3C9WA 3G6GA 2R7IA 4IVAA 4ANNA 2X2MA 2R3PA 2RFEA 3R22A 1PYEA 4O0RA 1TVOA 3W2PA 1CM8A 3AD5A 4ZMEA 3F3TA 2QHMA 4I24A 1XH7A 5DA3A 3VUTA 5IQFA 2BUJA 4QP2A 4IC8A 3TXOA 3HMMA 3MPMA 3ATTA 4CKRA 2V62A 3BEGA 5L2QA 3ALNA 1P4OA 2C3IB 4FG9A 3LIJA 4PX6A 3RPSA 4QMPA 4AE9A 2C6IA 3CKXA 4FX3A 4KIQA 2QHNA 2QLQA 3VUGA 4RJ7A 3VAPA 3ZSHA 1CTPE 3TKUA 1OKYA 4IFCA 4U0IA 2C5XA 3RAWA 4D2TA 5IA2A 4O4CA 3ZSIA 4E7WA 3PTGA 4AFEA 3C13A 1OM1A 3DT1A 3LM0A 2PZRA 2X0QA 4E1ZA 3I79A 4IB5A 3RPVA 4U79A 4HVSA 1JKTA 3AMBA 4WNPA 4JBOA 5JGBA 3VRZA 1PY5A 4R5YA 3KEXA 4BTJA 5EG3A 5DGZA 3PXKA 5JFSA 3EKNA 3OUKA 2VN9A 4ANBA 5IEXA 5FUTA 4D4RA 2X0OA 1TKIA 3ML1A 3II5A 3DXQA 3I81A 2RL5A 4O1OA 3UO6A 3C51A 4ACMA 2P33A 4IACA 3DCVA 4XV1A 1YDSE 4MD8E 1KE7A 5FDPA 5K0XA 4U3ZA 2OJFE 4OTPA 4F0GA 1SM2A 5CI7A 4GT4A 3D5XA 5AMNA 4E93A 4AOTA 3UIMA 2NP8A 4DITA 5L2TA 1W8CA 3R21A 4IX3A 5DPVA 3FKNA 1B38A 4IVCA 4RJ4A 3UOLA 3CJFA 4ZTSA 4C34A 4F7SA 2J0LA 4QYGA 4F9YA 3TIYA 4LOOA 3EN9A 4U43A 2X6DA 4HOKA 5CEQA 2BRMA 4GYIA 5LJJA 4OTHA 1R0PA 4XOYA 2JKMA 3S0OA 3FAAA 3G15A 3UZTA 2XM8A 5EDRA 5L8JA 4ZJIA 4TT7A 2FB8A 5TT7A 5A54A 3KRJA 2QOQA 3PSCA 5AM7A 5HKMA 3GC9A 3CQWA 3PDTA 3N9XA 5ETFA 4AA0A 3NYOA 4BJJB 5C4KA 2GTNA 5IQCA 4JDKA 3D94A 3GVUA 3UIUA 4C35A 3DXPA 3EH9A 3DU8A 5J7BA 3BLQA 3JUHA 4NSTA 3W2RA 4AAAA 4BZNA 2CN5A 3NW5A 3NNUA 1XMMA 4JLCA 2BALA 5BQ0A 5FDXA 3U9NA 3RPOA 3PVBA 2ITUA 3PE1A 2YDIA 1WVYA 2BAJA 2PVYA 1WFCA 2X39A 2QCS