3DNEA

Camp-dependent protein kinase pka catalytic subunit with pki-5-24
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
336
Chain Sequence
ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Crystallography-independent determination of ligand binding modes
pubmed doi rcsb
source organism Bos taurus
total genus 105
structure length 336
sequence length 338
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3dneA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3dneA02
4O6LA 5BYZA 3I0OA 4DHFA 2IVSA 4PNKA 2YCRA 4CFUA 1Q3DA 2Z7LA 2C0OA 2V7AA 1ZY5A 4BDJA 3UQCA 3K54A 1OL6A 4J52A 1FVRA 4X2FA 4YJSA 4BHZA 5E91A 2O65A 4E1ZA 5LCJA 1Q5KA 1PW2A 4RZWA 4DN5A 4TWOA 5HO7A 4FTOA 3B8RA 3KRJA 2W1IA 3RPYA 1ZZLA 2XA4A 3O96A 3QTIA 5GJGA 3R2YA 3HAVA 2PVMA 3TUBA 2AYPA 2WQMA 3N4VA 3TZ9A 3VUMA 5JRQA 4FE2A 2BTSA 5L2WA 5J1WA 3V3VA 3FV8A 4ITIA 4A7CA 2C30A 3CTQA 5HOAA 3KVWA 3NNUA 1PF8A 4ZJJA 3CJGA 3DAEA 3NVMB 1ZY4A 3VS4A 3FI4A 4CSVA 4LRKA 4S34A 4XRJA 5IISA 4RJ8A 3QRJA 3E3PA 1OL2A 4QNAA 4C0TA 2F7ZE 3MJ1A 1U59A 3QF9A 4I94A 4FGRA 4PNIA 4A9RA 2XP2A 4E73A 3ZBXA 5FP6A 5HZNA 5CEQA 5J9ZA 4S30A 4L01A 4PDPA 3NYVA 2IZRA 4M13A 5DRDA 5H3QA 2Z7SA 2IW8A 3SV0A 3CCNA 3UJGA 2UZLA 3HUBA 4MQ1A 3D7ZA 4L3JA 4RIXA 2VX1A 3MS9A 1PXKA 4FV9A 4J8MA 3V5PA 4R7BA 4HCVA 3TUDA 1W0XC 3W16A 4C59A 5AAFA 2R3KA 3A61A 5E8VA 4CRSA 4F9AA 5A6OA 2CJMA 4WSYA 2DS1A 4JBQA 4BTKA 5J5TA 1EH4A 5M51A 5CU4A 1VEBA 5D9HA 2WMVA 4IX3A 5EYKA 2IN6A 4CTBA 4EOMA 5C8KA 5CENA 5D11A 2B52A 4NW6A 1OI9A 2VGOA 3TV6A 5KCVA 3FDNA 2Q83A 3L8VA 2VTHA 4AG8A 5KMKA 5F4NA 3OS3A 4R1YA 4FKVA 2X8IA 2WMSA 3FYJX 4CQGA 1M2RA 2Z60A 2ZB1A 2CKPA 3F3TA 4FGBA 3VBQA 4UV0A 3V8SA 1U5QA 1OECA 5AUZA 3GCUA 5KE0A 3UVRA 3HYHA 4M14A 2WB8A 4ALVA 4D1SA 5I4NA 2Y7JA 4EJ7A 4AW2A 1BUHA 4PMSA 1WBWA 2B4SB 2XEYA 2CNQA 4RJ7A 2YCQA 4FL2A 3MA3A 3P9JA 5FM2A 5FBOA 3AXWA 2WTJA 1H1WA 4NJDA 2EB2A 2ZB0A 5ETAA 4C36A 5E8UA 4AZTA 5LJJA 5LVOA 3SXFA 5EH0A 5BNJA 1P4FA 4HVGA 3SA0A 3NUSA 4KSPA 1XWSA 1RQQA 4FX3A 5I0BA 2ZM4A 4KA3A 4WG3A 3V6SA 4ACDA 4ANLA 4BBMA 4GL9A 4ASDA 4GH2A 1WBNA 3Q5IA 3BU5A 1S9IA 5AAEA 5DR9A 4FT3A 2WTCA 2XM8A 2YIQA 3BBTB 3RPOA 1BYGA 3UMXA 3ZUUA 4HGTA 5EYCA 2J9MA 3QD2B 3C5IA 4XV3A 2A27A 3BLHA 3PLSA 2C5NA 3F2AA 1H26A 4FNXA 4EH6A 1MQBA 3WBLA 4CV9A 5DNRA 1MP8A 2UUEA 4C2WA 3DLZA 3BYUA 4F0FA 4EL9A 5HLNA 3O50A 4F9WA 4BCFA 4IEBA 1U4DA 1H00A 2C47A 1P5EA 3HECA 3OW4A 3R21A 2B9FA 5CQWA 5LVMA 3PP0A 5AUYA 5HD4A 3NGAA 2YLFA 5JFWA 3P1AA 2VTRA 4D1XA 1OKWA 3WZKA 4BTMA 4F6WA 3UYSA 3GCPA 4EZ3A 2W5AA 3FE3A 4EBWA 4ZSAA 3FWQA 2A0CX 4DFLA 5F95A 2XRWA 3QTZA 3C5UA 3MGYA 2WELA 4AWIA 1P14A 3I0QA 3QXPA 4PL3A 2OO8X 3D14A 2YM8A 3L1SA 4P5ZA 2VWWA 5EDPA 3R7VA 3H9RA 3UBDA 4BDEA 5IH4A 5J95A 1YWRA 4D9UA 5BX0A 1ZAOA 2GFCA 4TT7A 5AR2A 4EUUA 5KKRC 2XYNA 4FTNA 5J7BA 4NM5A 3A60A 4O0WA 3CLYA 4MQ2A 5ETIA 4EOIA 2BRBA 4J53A 2R7BA 4PF4A 4XCUA 2VWIA 3SVVA 5E92A 2PULA 4JJRA 4RVTA 2VO0A 3C4WA 4N70A 3PVGA 3FLWA 4ZTLA 1YXXA 4IZAA 2X8EA 2E9NA 4GFOA 4U8ZA 2X4FA 5J9YA 4ITHA 3GCSA 3E63A 5C8MA 4WRSA 1SVGA 1FVVA 4DG3E 3D7TA 3P7BA 5ANKA 5IDPA 3FC1X 3I6WA 4YGAA 1OKVA 3FZPA 2X6EA 5HIBA 2QURA 2PU8A 2C6LA 5A6NA 5HBHA 3A7IA 5KO1A 5CXHA 4L43A 1BL6A 1P2AA 4OR5A 3MVJA 5KZ0A 4A9SA 3TN8A 4E6DA 1H0VA 4FNYA 2UVYA 5CSPA 2A1AB 2VO3A 5FEDA 2JITA 3KK8A 4AOIA 4BL1A 2PPQA 3HNGA 3LFEA 2B0QA 4DGGA 4HZSA 4WO5A 3G90X 3Q52A 4DEDA 4QMSA 1A9UA 3EN4A 3QLFA 4MCVA 4XNEA 4DITA 2XKCA 4YZ9A 4CV8A 3BWJA 4NM0A 4YU2A 2UZUE 3KXHA 2B9JA 3I6UA 2JFMA 4G6NA 3ATSA 4FL1A 2J5EA 2VWBA 3E92A 3I81A 3GCVA 2F2UA 4M97A 3ZDUA 2XCHA 3CSVA 2WMRA 2WMQA 3WIKA 4BGGA 1BMKA 1W8CA 1Z9XA 2X7FA 5BVEA 2J0LA 1SYKA 3LMGA 3T3VA 3TJDA 3ZU7A 3LXKA 4XOYA 2BVAA 4WG5A 4PP7A 1UKHA 4ZZNA 2F9GA 4K8AA 1DI8A 1J7LA 3UE4A 2BZHB 2XK4A 3MFSA 4P2KA 3QTUA 3BWFA 2Z7QA 3IS5A 5HBEA 3W2OA 5FG8A 2OJJA 3MB7A 3G9NA 5CANA 2QLQA 2VZ6A 5JGBA 2F2CB 2GU8A 2YM6A 3C51A 5L8KA 4WNPA 1AGWA 4EQCA 4AZWA 3Q32A 4EOSA 3MESA 2NRYA 4UX9A 2HOGA 2ITNA 3A62A 4FSMA 3VW8A 3PDTA 3F61A 3M11A 3DAKA 3W55A 2PL0A 4FF8A 4EI4A 1OITA 3QYWA 2Q0BA 4Y5QA 4DG2E 5IEVA 1FOTA 3PSCA 2OG8A 3OTUA 3BZ3A 3VC4A 2XNOA 2XNPA 3OFMA 3Q4ZA 4ANSA 2XH5A 4C3PA 2B9HA 4KKHA 5AIRA 4BF2A 2ACXA 3UVQA 5BVWA 2QCSA 2VTQA 2IG7A 4X6QC 3OCSA 3PFQA 2GS7A 2BALA 3RPVA 4IQ6A 4CYJA 4DTAA 1IA8A 5I5ZA 4JI9A 4B8LA 4TWPA 2B54A 2ZM1A 3ELJA 3EQBA 4F0GA 2ZM3A 2WU6A 4XH6A 4XV9A 4IBMA 3NNVA 5CF5A 1H1PA 4IJPA 1ZRZA 2P55A 2BROA 2QR7A 5EM8A 4DH8A 3V5QA 4YTHA 4XLVA 3UVPA 4GT3A 2YM4A 2PMOX 3E7VA 4QPAA 4BWXA 4L9IA 4PV0A 4C57A 4E4LA 2HENA 2GMXA 3A7JA 3AC3A 5CWZA 3V5TA 4NYEA 3LCSA 1M17A 2YIWA 5D41A 3NS9A 3VBTA 1U5RA 4IAAA 3LAUA 2GQSA 5CVHA 4RA4A 2GCDA 4DFZE 5M44A 3AT4A 4NFMA 4RIXB 2G2HA 2VTLA 1UKIA 3UG2A 3QKLA 4ID7A 4U79A 1F5QA 3BYVA 1YW2A 2PSQA 4ORKA 2C3IB 3MI9A 2J7TA 2F7XE 3NPCA 4L67A 4MNEA 3FZOA 4FYOA 4BCQA 4BHNA 4AZSA 2CCHA 1PXPA 4M8TA 4W4YA 5GIOE 2BILB 5CX9A 5C1QB 4O0YA 1JLUE 4YLLA 4E6QA 2QC6A 3TWJA 2CPKE 4F1TA 3HMNA 4O21A 2VO7A 3JVRA 3IDPA 3FZTA 2QHMA 2UZBA 1KOBA 1HCLA 2GDOA 2WKMA 4HGLA 3FAAA 1PYEA 5JFVA 3LCOA 3N9XA 2XJ0A 4CMTA 2CMWA 2P2HA 5AP4A 3TZMA 4E7WA 3OROA 3R02A 4F1MA 1TQIA 2E9OA 3RBWA 3A7GA 4KIQA 2G01A 4XUFA 4DLJA 3D5WA 5EW9A 2C6TA 3I7CA 1Y6BA 4K77A 3R8VA 3W18A 4DGOA 2QONA 4DCEA 1CMKE 1K2PA 2CGUA 5EOLA 5IF1A 1ZOHA 3EQDA 3FPQA 1IRKA 2GNHA 5CALA 3JR1A 4QYYA 3C13A 2JKMA 1NVSA 4ZS0A 4XMOA 4DEEA 4KBAA 3CR0A 4I0RA 2GTNA 3UTOA 3ZRKA 2H8HA 3TKIA 3KB7A 4ZOGA 2XKDA 3GC0A 1PXMA 1SNXA 5A4EA 4R5YA 4H3BA 5ETFA 3VULA 3NMUF 3LPBA 4N6ZA 4F7LA 2B1PA 2R2PA 3OZ6A 4DYMA 4EONA 4GIHA 3A7HA 5CEKA 3Q9ZA 1KSWA 4QP2A 4D2PA 5KMNA 3D83A 4YJPA 3UIBA 3H9FA 2BFXA 2CNVA 4BYIA 2FSOX 4FI1A 3HA8A 4U42A 4CG9A 3ENHA 3O51A 5D1JA 5HX6A 5H8EA 1Y8YA 4G9RA 2GNGA 1NA7A 3R9OA 3U6IA 2DUVA 3LQ8A 4XV1A 2GNFA 1WAKA 4TWCA 3NYNA 4MXCA 2JC6A 4QTCA 3ZZEA 1T46A 4O84A 2XRUA 4CT1A 5TOZA 2JKKA 3P0MA 3UNKA 2ERZE 2XCKA 5IQFA 2XK8A 3PYYA 3FSFA 4GYGA 3WE4A 4LOOA 2QO9A 4TN6A 3L9MA 5BYYA 3RTPA 4YZCA 1H25A 3VW6A 2OICA 4C3FA 4R3CA 3EQPA 5AV0A 2RFSA 4GU9A 3K3IA 3HX4A 4GW8A 2PUUA 4ZLZA 3KEXA 3NIZA 1PXOA 4ZTNA 4LMNA 4J8NA 4O0XA 3UQFA 2OIBA 3CPBA 3RK9A 2WOUA 3JY9A 5HO6A 2G15A 1BKXA 2QU6A 1M52A 3RM7A 4PY1A 2VTAA 5M06A 4FNWA 5H2UA 2YN8A 1OBGA 3WZJA 5KZIA 5H9BA 3U6HA 3CD8A 3SRVB 2C6MA 5EDQA 4JL9A 3EOCA 4ENYA 4HVIA 2Y6OA 1NY3A 3O23A 4X0MA 3FLQA 4XP3A 4RMZA 4Q9SA 2PE0A 2IVTA 3HLLA 2BAJA 5HG5A 4XBRA 2PZYA 1OIUA 3F7WA 3OXTA 3RK5A 2PUIA 2I40A 1MRUA 1SM2A 3C4CA 4C37A 5L2IA 2NP8A 4QMWA 2QKRA 3K5VA 4CVAA 4YTIA 3JY0A 3GT8A 4I0TA 3ZEPA 3AGMA 4AE9A 5KMLA 1PJKA 3O2MA 5G1XA 4YTCA 3LFCA 5HCZA 5J87A 3DTCA 2WGJA 3D7TB 3R9RA 3DKCA 4XYFA 4DEBA 4O91A 4OGRA 3A7FA 5M55A 2RKUA 3BU3A 3BX5A 5AP2A 4K6ZA 2W1EA 2REIA 4UALA 1OL5A 4DGNA 3IGGA 3TG1A 1G5SA 1SVHA 3EFJA 3VN9A 1GOLA 2XNGA 4MNFA 3IG7A 4FIEA 2UZTA 1H07A 2XNBA 5A3XA 5HNBA 4PPAA 5JQ5A 5FRIA 3RP9A 4CZTA 3EL8A 4YBKA 3DFAA 2XJ1A 5L6WL 3CIKA 4QNYA 4RQVA 3BELA 4YJNA 2V22A 4DH5A 3KN5A 1JKKA 2IW9A 4KAOA 3RAIA 4ALWA 4DAWA 5AX3A 5IA3A 1LEZA 3I7BA 3NW7A 3KC3A 4BDBA 4D4YA 4X3FA 5CAOA 2W1HA 2YISA 3WZUA 3C0IA 4FKWA 5CAVA 2GS2A 3TACA 4Y5HA 3R8MA 3QC9A 3TDVA 4PDSA 3QA8A 1OPKA 1Q61A 4YPDA 5DOSA 3G5DA 3D5UA 5DPVA 3UGCA 4G5JA 5L6OA 3Q2JA 2XZSA 3MH0A 2QG5A 3S4QA 3NR9A 4CZYB 3TCPA 2ITPA 2WTIA 3DK7A 3ZONA 5IQIA 2PZRA 4N0SA 3UZRA 2OJGA 2VO6A 2CN8A 2OWBA 5M56A 4QMVA 4YZNA 4WD5A 1W7HA 1ZYLA 3FL4A 1WVYA 4J97A 3DK3A 2ZOQA 4PDOA 3FPMA 3FXWA 1YWNA 2WMWA 4ITJA 4NUSA 4WOVA 2QOCA 3KA0A 3DBEA 3NEWA 3SD0A 3T9IA 3OP5A 2QD9A 3RK7A 4ANQA 2PVFA 2CGXA 3B2WA 4UEUA 5DEYA 3HV5A 4L3PA 4O0UA 5HLPA 4D2WA 3SOCA 1FMKA 4XG7A 3VS5A 4YO4A 1JVPP 3VUHA 3CQEA 2YDIA 4ZSJA 4FKSA 4FTTA 4EQUA 5GINE 2O5KA 5LCKA 4RFZA 2Y9QA 3FMMA 3RHXA 3AC4A 3O7LB 4FOBA 3ERKA 3LFFA 3VQUA 4FYNA 3VF8A 2HZ4A 3TNWA 4RX7A 4WIHA 2JGZA 3OWJA 3FKNA 3V8TA 5BUJA 3V5LA 3NNWA 5DA3A 1GAGA 3CY2A 4CFXA 2B53A 3DY7A 5AR8A 1M14A 3QD4A 5T3QA 5HX8A 3GU5A 1IA9A 3HAMA 5L6PA 3DS6A 5TO8A 5DMZA 3FBVA 4RJ3A 1ZMWA 1WVXA 5JZJA 1OKYA 2X7GA 3BYSA 4LV8A 4NKSA 4RC2A 5C4KA 1PY5A 4AW1A 5EM7A 3W2QA 3RNIA 3M2WA 4E93A 4EKKA 3SG8A 2CGVA 2O2UA 5AJQA 3VBXA 4TXCA 1OL1A 3FLZA 4RX9A 4NTSA 1XBBA 2C68A 4BCNA 1TQPA 4WBOA 2PVJA 4LRJA 3MY0A 4I20A 1XJDA 3GU4A 2OZAA 3ORKA 3PSBA 4XJ0A 3SW7A 4O86A 1JKLA 2OIQA 3CTHA 2UZDA 3KVXA 3KXNA 1REJA 3H0ZA 3OW3A 4UMTA 5CZHA 5DGZA 5J5SA 3E88A 4Q5EA 5CNNA 4RT7A 2FA2A 3HMMA 3REPA 3LLAA 1CDKA 2XNEA 3G2FA 4MNEB 2EXCX 3ZRLA 5A4QA 3WYXA 2W1GA 3TTJA 4DH1A 4CCBA 2FO0A 1VZOA 3EQGA 4PMMA 1YQJA 1O6YA 3D0EA 4K2RA 5DT3A 4DTBA 1WFCA 4L68A 4EK5A 4EOOA 5IQCA 1AQ1A 3AOXA 4GS6A 4L7FA 3OG7A 5DT4A 3PXQA 4BDFA 4F0IA 4FSNA 1BI8A 4YPSA 5M08A 3ZDIA 1IAJA 3TNHA 5KBRA 4J1RA 4GUEA 1KE7A 4GJ3A 4CLJA 3S1HA 5KHWA 3FYKX 4DT9A 5KHXA 4O7WA 3RINA 2B7AA 4EH2A 4IVAA 4AU8A 3BV3A 3PWDA 3OEZA 3EZRA 4G3FA 5CEOA 5K0XA 3FUPA 4MWHA 4YC3A 3FKLA 2JBPA 4EHVA 2GPHA 3R1QA 2FSMX 2C5VA 3HV3A 5EDRA 4OTDA 2C1AA 2WMUA 3BLRA 3FZRA 3LFAA 4FOCA 4S32A 4ALUA 5IMEA 4LFIA 4YHTA 4FZFB 4RVMA 4DFBA 3ZO4A 2RFNA 1DAYA 2RL5A 1YXVA 2GFSA 2RFDA 3MWUA 4BBFA 4FK3A 3V5JA 3E3BX 3ZO1A 4O2PA 2R3JA 4ZTSA 5HU9A 4AT4A 3KU2A 3D15A 4IWPA 4IW0A 3DXNA 4NW5A 3HKOA 4F99A 3VJOA 4DH7A 4FKGA 5AM7A 4K0YA 4EWHA 4H1MA 3QZIA 4J7BA 3W10A 2WTKC 3R9DA 4H39A 3LW0A 1OIYA 3NRMA 2W7XA 4QOXA 5CU0A 3PG1A 2CHLA 4UMRA 3WYYA 3E8CA 3FJQE 4AA5A 3ACKA 4MXXA 3ZLXA 1GNGA 4ZXTA 5AA9A 2JKOA 5AR4A 4QMZA 4W4XA 1MRYA 3MIAA 3MVLA 5EM6A 1BI7A 2XIYA 3RCJA 2QOOA 3SW4A 3PY0A 4QPMA 2PVKA 1G8AA 3PUPA 3VUIA 3BQCA 2CKQA 4QQJA 5K4IA 3OWLA 3KMMA 5JT2A 3NYOA 4CZUA 3IDBA 4ZY5A 5AM6A 1YOMA 4B4LA 5HIEA 1NW1A 1HCKA 3ACJA 4FC0A 4HGSA 5EOBA 4ZMEA 4X2NA 4HVDA 5A9UA 4CT2A 4D1ZA 4FV6A 4OTQA 1M2PA 3TZ8A 5HO8A 4WNMA 3SXSA 3Q3BA 1WBPA 5LVNA 3DKFA 2E9PA 3ETAA 3LFBA 4KINA 4L42A 3UO4A 2ONLA 4IB3A 1XH5A 2W9ZB 4DCAA 4KNBA 2R3GA 4KBCA 1DS5A 3MVHA 4U5JA 5L4QA 4V0GA 2UW6A 5FEQA 3GB2A 3EB0A 1S9JA 5H8BA 3WZDA 2BIKB 4D2TA 3EZVA 2VTMA 2YZLA 4IANA 4A4XA 5FUTA 3W8LA 5JRSA 2R3IA 2J5FA 4CG8A 4I6BA 1GZ8A 4BKJA 5A14A 3LM5A 1E1VA 2PVHA 3LFNA 1O9UA 4JRVA 3POZA 1YXUA 2R7IA 4FA2A 5IH5A 5J9LA 5HEZA 5J79A 3DOGA 2YAAA 3GFWA 4I4EA 5GZ9A 1H8FA 3DK6A 5FD2A 4QMLA 4O22A 3O0GA 4FIGA 4FSQA 4TY1A 4BZOA 4MVFA 4KIPA 1U46A 4TPTA 3UC3A 2YWPA 4C58A 4CFWA 3GEQA 3DNDA 3GGFA 5A46A 2PUNA 2WEIA 4JS8A 3R7OA 1WBVA 4ARKA 1FVTA 4O0SA 3KMWA 4MHAA 2JLDA 2HW7A 4M67A 3UYTA 5M4IA 3EYGA 4CXAA 4I22A 3P5KA 4OTPA 3DQWA 2C3KA 3LLTA 3U4UA 3NUYA 4JX7A 4MKCA 2RSVA 3R04A 5GHVA 4G17A 3UP2A 3VIDA 1J3HA 2CDZA 3SOAA 4RIYA 4R8QA 4XBUA 2G2IA 2OGVA 5DH3A 3LJ1A 1XKKA 4EWQA 3R7UA 4RIWA 3QQFA 3BHUA 5BVKA 1SMHA 4P7EA 3QTWA 5LMBA 3ZBFA 4ZTMA 4GU6A 4X3FB 3FL5A 3QWJA 4IVBA 4RGJA 4O1OA 3R8PA 3R1YA 3AD6A 2Y8OA 2IVVA 4MWIA 1O6LA 2YIXA 3Q2MA 1ZYDA 4F64A 3CE3A 4CNHA 3EN5A 3IDCA 4IB1A 2F57A 2J2IB 4IDVA 3GC9A 3NVKI 3P79A 2FB8A 5H8GA 5JSMA 2JBOA 4H3QA 4AT5A 2BTRA 4WG4A 4JAJA 4K33A 4DBNA 4FKQA 4EJNA 3F2RA 4IWDA 1JKTA 4IM0A 4ASXA 1V0PA 5HNIX 3G6GA 3P08A 3F5UA 4L6QA 5AV4A 1H4LA 3JXWA 3NUXA 4JDIA 5AP3A 1CTPE 5BVFA 4ANNA 4G5PA 2Z8CA 1FBNA 4YNOA 2YJSA 4NSTA 3UOKA 4IC7A 5I9YA 3L8SA 5HIDA 2DQ7X 1DM2A 3CGFA 3BEGA 2O63A 3R8ZA 3F5XA 5CT7A 3ODZX 1ATPE 3QQJA 3KRWA 4AN9A 2GNIA 5EHOA 4HGEA 2PVNA 3EFWA 3F5PA 1H24A 2NNWB 5GJDA 4K11A 4QMUA 3VS2A 3BCEA 4ENXA 5CAUA 3P86A 4IMYA 3T8OA 1XO2B 3GVUA 4AXAA 1ZOEA 1CM8A 3MA6A 2O8YA 3QBNA 4IDTA 4O0RA 3TIYA 5CZIA 4HNFA 3O8UA 4ZMFA 2XKEA 2R3FA 3DB6A 1RDQE 3TIZA 3W1FA 2JDTA 2J6MA 4BDHA 3ZSGA 2BR1A 4C4GA 2JAVA 2OFVA 3P78A 4QT1A 2PE1A 4MTAA 5B2KA 5AV3A 3R0TA 3QKKA 4EEVA 2I0YA 2ZVAA 3SRVA 3AD4A 3VO3A 5JEBA 1Y8GA 1IG1A 3G33A 4JR7A 3R7GA 3KFAA 3ALOA 2OZAB 4FL3A 3VHKA 4EH9A 4ASEA 4TYJA 4KIOA 1Q99A 4I5HA 2J0MB 3MY5A 2ZV2A 3EWHA 2BUJA 3PPZA 5AFVA 2RFEA 4FKPA 4JQEA 1OVEA 5GNKA 4M3QA 4O7VA 4QTDA 3TV7A 3ZO2A 5ETCA 3E64A 1KV2A 1K9AA 3FHIA 3FHRA 2VV9A 5AV2A 2SRCA 4BVUA 5HTBA 3IOKA 2X9FA 4G3GA 4ZSEA 4CD0A 4J71A 4FODA 5EK7A 3UPZA 5K9IA 3DBFA 3G15A 3LCTA 2FGIA 3FSKA 1SVEA 4ZIMA 4JDJA 3BYOA 4C4IA 5AP5A 2VNYA 1H27A 2J0IA 3H3CA 4YSJA 5L8LA 3RNYA 3SX9A 4M84A 2V5QA 3AC8A 2VTOA 3DB8A 4IFGA 2ITXA 5FM3A 3EJ1A 1BX6A 2UW7A 3Q5ZA 4FIIA 4K9YA 3KF7A 3WILA 3Q9XA 3H0YA 4C61A 4IJ9A 5K5NA 4PQNA 3PJ3A 1SZMA 4QPSA 3TZ7A 2ZV7A 4BDDA 1GIIA 2ITQA 4OTHA 5FTQA 5CQUA 4A06A 3GCQA 3V6RA 3C7QA 3EFLA 4OT5A 3N4UA 2DYLA 4E6AA 4FTRA 3C4ZA 1PXNA 1VR2A 4GSBA 4FSWA 5FGKA 5J8IA 1XH9A 1WCCA 4P4CA 5KMMA 4AGUA 2YFXA 3RAKA 4B6LA 3MH2A 1IEPA 2A4LA 5AAGA 3KCFA 3UO5A 3R71A 2H6DA 3LHJA 3QL8A 4WUNA 4W9WA 5IUGA 3NUPA 3ORLA 4YO6A 1OPLA 2C5XA 2OI4X 4MBJA 5IQBA 2PMIA 4LMUA 1R39A 3ANQA 4FEQA 2WXVA 5DVRA 3E62A 3KRRA 4GCJA 4M69B 4EC9A 2XYUA 2W1DA 3NCGA 3W2CA 4TYHA 1G3NA 1KE6A 3NUNA 4F9YA 2ZV8A 2G1TA 4NKAA 1PMNA 3QGYA 4BZDA 4ZZOA 3CGOA 3SAYA 5M07A 2GHMA 3IPHA 3TTIA 4FKRA 4FTJA 1CKIA 3DLSA 1OBDA 2UW9A 4A9TA 3ULIA 4BI0A 3UQGA 3GOPA 3OCGA 4WSQA 4XG6A 2R3PA 3PZEA 3RWQA 2W1FA 3VUDA 2ETRA 4D2SA 3TI1A 3IW4A 4BZNA 1PXLA 5FP5A 2VU3A 4D4VA 5LMKA 1MRVA 3G9LX 5I9WA 4I6QA 3QU0A 4BICA 2X2LA 2E9VA 1OM1A 2YCFA 2W4JA 3FQHA 4KKGA 3GC7A 4YLKA 4LG4A 4YJVA 3MW1A 4F65A 4MBIA 4V0GB 5HLWA 4OT6A 3ZFXA 2ITZA 2Y0AA 5JN2A 4LYNA 2JFLA 3DQXA 2VX0A 3OUKA 4AUAA 4BI2A 4CTCA 1QPEA 3KMUA 3A2CA 2XBAA 5CVFA 3R9NA 4OTGA 5IH6A 1RW8A 4JT3A 1UU9A 3D5XA 3R8UA 3WF5A 3LFDA 5G6VA 5AA8A 3HDNA 4FZDB 4IM2A 2OIDA 2BPMA 1L8TA 4U45A 5CYIA 5M4CA 4CEGA 4C7TA 1Y91A 2FSTX 3RAWA 4FSYA 4GG5A 5CI6A 5HTIA 5ANIA 2I0HA 4PL4A 4IWQA 5ANOA 3U6JA 4BCPA 1JSUA 4EBVA 4NM3A 1UU3A 2YDKA 3MTLA 3R1NA 2HYYA 5HVYA 3A4PA 3MPTA 4M12A 4HW7A 1QPJA 3F7ZA 3ROYA 1QPDA 3EH9A 4M15A 4R1VA 4ZY6A 4FG8A 4AAAA 2YJRA 1GZNA 1YVJA 2DWBA 4I5CA 4BDGA 3PY3A 2H34A 3QTSA 4E26A 3GUBA 3MVMA 4R6VA 5AR5A 2JD5A 3LFSA 1R78A 4D4SA 2VX3A 2QVSE 5FBNC 4EYMA 2YABA 5EHYA 1J7UA 1Q8UA 3FEGA 2W99B 4YNEA 1G8SA 5EQEA 2Y4IB 1YWVA 4KRDA 2AC3A 3F5GA 3IK3A 4X6RA 1PKGA 4MF1A 4GVAA 2C5OA 4RIYB 3GBZA 5HHWA 3LJ2A 2WOTA 1FGIA 2OU7A 1Q41A 3OWKA 4D0WA 2EVAA 2WHBA 2QLUA 3M1SA 3BU6A 3MB6A 3N51A 4NIFA 4RIWB 5FXSA 4ZTRA 3OT8A 3QWKA 3PPKA 3CXWA 5FTGA 1ZWSA 5I9VA 1UVRA 3C4XA 3QCXA 3TKHA 3BRBA 3PVWA 1V1KA 1ERKA 1LUFA 1WVWA 4MXZA 3BI6A 4AP7A 2IO6A 4HPUE 4GRBA 3AMBA 4JBOA 3UZPA 1Q24A 3GQIA 4BI1A 3TDWA 2CCIA 5BUIA 1H28A 3H30A 5EHLA 3UC4A 1NVQA 4ZLYA 3ITZA 2W9FB 1FPUA 3OBGA 3HV7A 2P3GX 2YM5A 3GENA 4QTBA 1KV1A 3OWPA 4FG7A 3RM6A 3SQQA 3DAJA 4MF0A 3DKGA 4PDYA 3EN6A 2Y4PA 2O0UA 4I1ZA 4YC8A 4D58A 5CASA 5C4LA 4FTLA 2H96A 3DJ6A 5HICA 2W0JA 4GT4A 4YBJA 3FXXA 3OBJA 2JIVA 5B2LA 4RSSA 3TKUA 5DT0A 5B7VA 2YWVA 4RWJA 5DWRA 4NK9A 3QKMA 3OY1A 4S33A 4F08A 2C5YA 3OY3A 4U0IA 4F1OA 4ACMA 2OJIA 2RGPA 4CFMA 4O7NA 4RA5A 2Z02A 3IECA 4QMPA 4ZJIA 3W2SA 4E4NA 1LR4A 1PXJA 2IZTA 5FTOA 4JNWA 2XF0A 3OXIA 5AEPA 5DI1A 3VS6A 4AS0A 4BR3A 2PMNX 3LMIA 2PY3A 1ZYJA 2C6KA 2VTNA 1YRPA 1JPAA 2WAJA 3DJ7A 4QYFA 3OTVA 3MH1A 3GI3A 2WQBA 2HZIA 3PA4A 4IXPA 4IM3A 5EKOA 5FEEA 1XH8A 3F69A 3HEGA 5I3RA 4H05A 2PE2A 3ZM4A 3NW5A 3QCSA 3VBWA 2A2AA 4FV4A 4N4SA 4UWBA 1Q8TA 3CS9A 3RKBA 3DCVA 3U4WA 3UPXA 4AACA 3ZM9A 2XKFA 4PMPA 4JBVA 4LGHA 3CD3A 3R63A 4G34A 5D7AA 2C6IA 2R4BA 2VTJA 4FV3A 4G16A 4IC8A 4K18A 4QYHA 4OAVB 2XIZA 2CKOA 3FMNA 3II5A 5E1EA 2PVYA 3OD6X 3L8XA 4QP1A 4U80A 4GKIA 3R73A 3LQ3A 3SG9A 4FIFA 4UWYA 1ZYCA 2OSCA 2X6DA 4EH7A 4BCKA 3ORTA 2QQ7A 3C4EA 1UNGA 3DU8A 3TT0A 4AQCA 4TRLA 2C69A 3FI8A 3HP2A 3I4BA 3PJ8A 4C4JA 5J1VA 2OH4A 3QX4A 2PMLX 4OBOA 2WO6A 5CY3A 4ZP5A 5FXQA 3DTWA 4E5WA 4FIJA 2OBJA 4MXAA 5E8WA 2PZIA 5AV1A 3FY2A 4U3YA 3SC1A 3W2PA 4IAKA 1W98A 2JDVA 1T45A 1KWPA 3JVSA 3QTQA 3PTGA 4JXFA 4NWMA 3PG3A 4WKQA 4RX5A 4O82A 4BY9E 5LWNA 4IB5A 3F3WA 1ZZ2A 4AN2A 3QA0A 4AFEA 5I3OA 5J7HA 4JX3A 3UOHA 3PE1A 5L3AA 5HG7A 2G9XA 2JAMA 3U9NA 1M2QA 5HE2A 4LL5A 3RHKA 3ZLSA 3Q04A 1XR1A 2C0TA 3G0EA 4E5BA 2UW0A 3FMDA 4M0ZA 3F66A 4X3JA 5IQHA 4D0XA 2XIXA 4NFNA 3EIDA 2VN9A 3FKOA 4IWOA 3QFVA 1RE8A 3IKAA 2BKZA 4FV0A 4D2VA 2W96B 4G31A 2R3RA 3O17A 1PXIA 3FZ1A 3R7IA 2W17A 2WU7A 2PVLA 5BYLA 4PTEA 5LVLA 3F3UA 4QMYA 4IE9A 4FEVA 3P4KA 4GK4A 4FUYA 3HZTA 5DEWA 4ZK5A 1FMOE 3QUDA 4IACA 4ZS4A 2ZDTA 4A9UA 4DC2A 3VWAA 2Y6MA 2PUPA 3ALNA 4L45A 2BDFA 2C4GA 2QOIA 1STCE 3BV2A 2YM7A 3CBLA 1OPJA 5M09A 4ZY4A 3NDMA 4U7ZA 4BCMA 5A4CA 4FUXA 5E8SA 2CKEA 3DV3A 4AZEA 2CGWA 3SXRA 4TYHB 3RVGA 5TF9A 4EK8A 1TVOA 5IQDA 3OEFX 5K0KA 2XK7A 5HVJA 2YA9A 3DA6A 4B9DA 3RPRA 3ZFYA 2VWZA 5C26A 4WBBB 2X8DA 3DT1A 5AADA 1QMZA 3IW5A 1OUKA 3JUHA 3MPMA 5LMKC 4E8AA 2EB3A 4JQ7A 3DDQA 3C0GA 4LUDA 4YHFA 4BKZA 2R9SA 4DG0E 2UVZA 1H1QA 3D2KA 1Q8WA 1W84A 2KULA 4FTCA 4RVLA 4C4EA 4EH4A 3EKKA 1L3RE 3KN6A 4MAOA 3UNJA 3ZEWA 4HPTE 3SLSA 4BDKA 1Q4LA 3VS3A 2EUFB 1YHVA 2CLQA 1CKJA 4QYEA 4UMQA 3KRLA 4EOLA 3TEIA 3KGAA 1XH7A 3G0FA 4U81A 3CEKA 4FT9A 4WUAA 3ZH8A 5LVPA 4ZLOA 3QX2A 2R3HA 1VYWA 5CTPA 4AOJA 1J91A 3D5VA 4EYJA 5LWMA 1FQ1B 3R28A 4I93A 3B8QA 4DE4A 4YJRA 2QOKA 4OTIA 4O7RA 5I9ZA 4FR4A 4B0GA 4XHKB 4F09A 5AUUA 4L52A 2YLEA 2Z2WA 2IPXA 2X7OA 3QCYA 4HZRA 3NWWA 3ZCLA 1A48A 4Z3VA 5AMNA 2QG7A 4DH3A 4RFYA 3MFUA 3NSZA 4FVQA 3FQEA 3TL8A 3LXLA 4V05A 5CU3A 1B6CB 4MYGA 4A4LA 2R0UA 1OMWA 3NLBA 3Q53A 4YZDA 3BIZA 4H58A 4AT3A 2QI8A 4TL0A 1PRYA 4WT6A 4GK2A 3LIJA 4D55A 2ZMDA 2QR8A 4XS2A 3MY1A 3ZFMA 5JFXA 4LGDA 4IB0A 5KMOA 3KL8A 4XX9A 4G1WA 4CKRA 4XLIA 5DLSA 3LXNA 3Q4UA 3GP0A 3MBLA 4GKHA 5EW3A 4ANOA 3WF9A 3OCTA 4D5HA 2QOHA 5FDPA 3OUNB 5KMIA 3SHEA 3IQ7A 4FV2A 5AR3A 3QYZA 4EORA 3UDBA 5HTCA 2OW3A 5HE0A 2QOBA 4TW9A 4YLJA 3E5AA 3DNEA 4CFFA 2C6OA 1VJYA 4FKLA 4UY9A 3VBVA 4E3CA 4EH3A 3R00A 3U87A 5CSXA 3NYXA 4YZMA 1QL6A 4I3ZA 5AP7A 3A99A 3EYHA 4NIFB 3EQRA 2LAVA 3WOWA 4TZRA 4Y72A 2R3LA 4H1JA 3VRZA 3E87A 4QRCA 1Q3WA 3C4FA 1JKSA 4M68A 1TQMA 2WMAA 4AX8A 1Q97A 3O8TA 4J95A 4C62A 3IONA 4LOQA 3NIEA 4PUZA 4D9TA 4BGQA 5K4JA 4CFNA 3K2LA 2AUHA 3FI3A 4DBXA 3ULZA 4X2GA 4XEYA 1YKRA 4YC6A 4ERWA 1GZOA 2HXLA 2PTKA 1LPUA 4O96A 2W06A 2R64A 1UA2A 5B0XA 4O0TA 2ITVA 1J1CA 3Q9YA 2ERKA 2OF4A 2XNMA 4S31A 5E4HA 2BHHA 4XG3A 2AC5A 2GHLA 3BGQA 4CRLA 4R3RA 2XK3A 4YJOA 4YJUA 2I7QA 4G6LA 3NX8A 3CPCA 4D2RA 1XQZA 2OXXA 4QO9A 3ZMMA 4EUTA 1APME 3COKA 4ACHA 3BHVA 2FH9A 1JOWB 4FT0A 5KNJA 4M69A 4BCGA 4F63A 5DFPA 4AE6A 4C33A 5HORA 3LXPA 5HKMA 1ZMVA 3QD3A 2XJ2A 3IOPA 4MXYA 4BCJA 3QTRA 5M4UA 2V7OA 3IW8A 1YOLA 2C3LA 3C0HA 5F94A 4E4MA 2B55A 3E7OA 3KF4A 4ZJVA 5IMXA 3W33A 4O7YA 1DI9A 4DEHA 5DBXA 1I44A 3KULA 5ANDA 4RZVA 5EM5A 1KE9A 4C4HA 4Z16A 4FEXA 2ZJWA 3Q6WA 3F88A 4BB4A 4LGGA 1Z57A 5BVOA 2XM9A 4WNOA 2HIWA 4RJ4A 4FKOA 5A4TA 3EMGA 1JSVA 4KS8A 5I9UA 4YR8A 4JIAA 2PK9A 5DIAA 2HZNA 5EI8A 2YIYA 5ACBC 2BKKA 2C1BA 3ZHPC 1CSNA 1ZXEA 2VWYA 3M42A 1GIJA 5IUHA 2CN5A 3BYMA 1ZLTA 5GIPE 3F3ZA 5AUTA 3IGOA 4BBEA 2P2IA 3IO7A 4NM7A 5LQFA 4I0SA 3BLQA 4G3EA 3AQVA 4RC3A 4IZYA 4EHGA 3U55A 3H9OA 4W9XA 5CS6A 4L00A 4GK3A 3E8NA 5HE3A 3I79A 5FXRA 4IVCA 4JAIA 4V01A 2EXMA 2IJMA 3BE9A 5HE1A 2YDJA 3R2BA 3COHA 3AMYA 4Z55A 1UU8A 3C50A 3MYGA 4QMTA 4RWKA 4E6CA 5CEPA 3F3VA 1YHSA 4L46A 5D10A 5HESA 3Q60A 3JS2A 1JBPE 4K1BA 4CMOA 4O7ZA 4AOTA 5E9EA 1UWHA 2X0GA 3SKCA 4YUQA 3VAPA 2RG5A 1ND4A 3BHHA 4OBPA 4FICA 2F7EE 4C3RA 3V01A 4XG8A 5ICPA 4EOPA 2FVDA 4QD6A 3NUAA 3PJ2A 4RJ5A 2JDSA 4EHEA 2YHVA 2R0IA 4QP8A 5GJFA 2O64A 3MIYA 2WMXA 5JMSA 5BMMA 2BFYA 3BGPA 3VS7A 3CP9A 4RFMA 4D4RA 3ZXZA 2VWVA 1JAMA 4F7JA 5LXMA 2GHGA 1OZ1A 1RJBA 1YI3A 3EQHA 3C9WA 5GZAA 4TYGA 4JDKA 2UW4A 3F9NA 3PIXA 3CQWA 4X3FC 4O7TA 2QO7A 4L44A 2WD1A 2W1CA 4DGLC 2UZVA 4O81A 1J1BA 1URWA 3QQGA 3V8WA 3FMLA 4AN3A 4DEIA 2BAKA 3D4QA 4ZTQA 4Q5HA 1LP4A 3NNXA 4DLIA 3KQ7A 5AIKA 1H1SA 1I09A 1U54A 5E8TA 4IAYA 3NAYA 4FSTA 3PJCA 5CF4A 4QTEA 1PYXA 4QMMA 4UMUA 3VUTA 4AW5A 3VS0A 4XRLA 1PMUA 2V55A 4EOQA 3EQIA 1YDSE 4HJOA 4MD7E 2UZOA 4Y73A 3UOLA 5LARA 4KUJA 4RG0A 3R30A 5K3YA 1OB3A 3MPAA 2ETMA 3ORXA 1IASA 5DN3A 3ZTXA 4RJ6A 5IA5A 3K5UA 5CF6A 5DE2A 4NTTA 1A06A 4JR3A 3A4OX 3R9HA 3VUGA 5HQ0A 4UXQA 4CGAA 2XEZA 1QPCA 2R3MA 3S00A 4KWPA 5AWMA 3BE2A 1YHWA 3RCDA 3R22A 4F9CA 2WMBA 3KXZA 5DR6A 3UO6A 4R3PA 2C6EA 1GIHA 4GEOA 2J4ZA 3FLSA 4O1PA 2BRNA 3FI2A 5D12A 4EH8A 5M57A 2BZJA 4I21A 3L9LA 5IU2A 2PVRA 4WA9A 5AUVA 3RJCA 2HK5A 4ZSGA 5CU6A 4NL0A 1P4OA 2IZUA 4W4WA 2X2MA 3EN9A 3VHEA 4QMQA 4O2ZA 4IIRA 3VBYA 2X1NA 3AC1A 4BDAA 4EC8A 4F7NA 4DT8A 5IA2A 3DJ5A 3GOKA 4ZSLA 3FLNC 3I60A 2NPQA 3QGWA 2VTIA 3GXLA 3PXYA 4TWNA 3LMHA 1WZYA 2G2FA 3DGKA 5KX8A 2JEDA 3KK9A 5FWKK 4UB7A 3I1AA 4FV1A 4AA0A 4U43A 1UV5A 5EQPA 4KBKA 4GFGA 4IX4A 4RIOA 2HXQA 3PY1A 4GUBA 5IA4A 4R7HA 4JLCA 4FTKA 5TR6A 5DYJA 3NCZA 3RGFA 2ZMCA 4UYNA 2GQRA 4AGWA 2V0DA 3TM0A 4DFNA 4FTIA 3O8PA 5L2SA 4GT5A 4B8MA 4QQCA 3S0OA 5AUWA 3TV4A 3T3UA 1Y57A 2Z7RA 3EHAA 4U40A 2R3OA 4I6HA 3KY2A 3LZBA 4BCIA 3T9TA 1XBCA 2JKQA 4KRCA 4PMTA 4QMXA 2UW5A 4RWIA 3LFQA 5BUEA 3AT3A 4NCTA 4BRXA 5IPJA 1WBTA 4OBQA 4C35A 1IAHA 4F9BA 3NW6A 3VS1A 1NXKA 4Y46A 4FZ7A 3ZS5A 2XMYA 5KKRB 4XG2A 4OUCA 5C03A 4IAZA 3ORPA 3QUEA 3VJNA 2BMCA 3LM0A 3GU8A 3U51A 3PJ1A 4U9AA 2HY81 3SDJA 3HUCA 2QNJA 3S2PA 3LE6A 2ZYBA 3GU6A 1YI4A 1XH4A 4XOZA 2O3PA 3JYAA 3LVPA 4BDCA 3QAME 1VYZA 4HCUA 3Q9WA 5TE0A 3HL7A 1UWJA 4FMQA 4G6OA 5HGIA 3RAHA 3WZEA 1LEWA 4BKYA 4M66A 1V0BA 3OXZA 3ZC6A 2WZJA 3W8QA 3ZSHA 2HWPA 3DDPA 4BN1A 2EWAA 5DG5A 2QHNA 4C8BA 3DPKA 3QZGA 5HVKA 4D5KA 3K3JA 4R78A 4FBXA 2OXDA 4NZWB 2W05A 2QOFA 2WTDA 3TXOA 3WI6A 4FNZA 4IX6A 4RVKA 4D28A 3WARA 1J7IA 2C3JA 2VNWA 3HMPA 2UVXA 3QHRA 5DR2A 2ZDUA 3WE8A 4I5MA 3L9PA 4O7LA 4LOPA 4QTAA 3BEAA 4O83A 2GNJA 4L53A 3VVHA 3QQUA 5CAPA 4L3LA 4N57A 2J0KA 4OTRA 5HG9A 3WF6A 3ROCA 3PE2A 4KABA 2E9UA 4QP3A 4ACGA 3RI1A 2RG6A 1Q8ZA 1UNLA 3FLYA 3ORMA 4BWKA 3AMAA 3KULB 3PIZA 4BGHA 2H9VA 4I24A 3DXQA 4U41A 1HOWA 4TNBA 4EK6A 3KKVA 4I23A 4RWLA 2VUWA 4FSZA 1Q8YA 2ONLC 3KXXA 3MN3A 5EG3A 5E8ZA 2NRUA 4F7SA 4IAFA 4F6UA 3FY0A 4XV2A 3EFKA 1W82A 5LMAA 3DZOA 3PRFA 5JH6A 3MH3A 3PLAE 4KS7A 4QQ5A 3QQKA 1CKPA 3F82A 4FT5A 1WMKA 2GQGA 3R1SA 5CLPA 1E9HA 4YJTA 5F1ZA 2QOQA 3OVVA 4II5A 4AGCA 4KB8A 3OCBA 3COMA 4ZZMA 3NUUA 4PTGA 4RLKA 2OLCA 3FQSA 4GYIA 2J51A 3PPJA 2WIPA 3FC2A 3FXZA 1URCA 2ITTA 4AZVA 2WTWA 3ID6C 2FUMA 1TKIA 3KXGA 3E8DA 1ZOGA 1GY3A 4X21A 3ZSIA 4EH5A 4ONAA 1H0WA 2I1MA 4OTFA 4ZAUA 5B2MA 2OJ9A 3PA5A 2WNTA 2WTVA 1ZARA 3Q4TA 5FQDC 3CJFA 2EXEA 3UODA 2PHKA 2WEVA 5FLFA 3CC6A 3QRTA 3TJCA 2GTMA 3OOGA 3RPSA 4EK4A 1YDTE 3EKNA 4Z9LA 4J99A 4IFCA 2BRMA 3WIGA 4BTFA 3FMEA 4E5AX 1JNKA 4YP8A 4RBLA 4HYSA 2W4KA 3HP5A 4I6FA 4ACCA 1KE5A 5CEMA 2Y4IC 2XNNA 2YAKA 2B9IA 2BRGA 3H4JA 4XP2A 4USEA 1JWHA 3MTFA 4FSRA 4RRVA 5D7VA 2XBJA 5IQGA 1OGUA 5IDNA 2R3NA 3OOMA 5ANGA 2XS0A 5HCYA 2VGPA 1YI6A 3AC5A 2E2BA 3PXZA 4G2FA 2OFUA 4UBAA 5AX9A 4PTCA 3R83A 3ET7A 2I0EA 2NO3A 4WHZA 3AC2A 3AT2A 4IAIA 1V0OA 2XB7A 4BIDA 4DGMA 3E93A 4MD9E 4IVDA 1OKZA 5JKGA 1FGKA 2BRHA 2FYSA 1U54B 4HYIA 2GS6A 3QC4A 2CNUA 5E7RA 1H1RA 4W8DA 3PA3A 4ANBA 2OZOA 4BTJA 4IZ5A 3N4TA 4X2JA 1AD5A 2BAQA 4DINA 4N6YA 3HRCA 4W8EA 2J0JA 3ZYAA 4A9YA 3R7YA 4JDHA 1M7NA 3PIYA 1KOAA 2A19B 3ORIA 4GMYA 2XIRA 5C9CA 2OXYA 4ANMA 4LV5A 3QD0A 5EQYA 3ZXTA 3PVUA 5TKDA 5IA0A 3QRUA 2I0VA 1YXSA 2JIUA 3GC8A 3P7CA 1O6KA 4FV5A 5CEIA 4O7SA 2UZWE 4USDA 4U3ZA 4YSMA 2XK9A 4A07A 4C2VA 2IVUA 4EZ7A 3LCDA 4YMJA 5A4LA 1SNUA 5M53A 4BIBA 2OK1A 4IZ7A 4UYAA 4KIKA 5GZ8A 3BQRA 1XBAA 4PRJA 4QP9A 4UXLA 5L8JA 5K5XA 2JIIA 3EQFA 3HMIA 1W83A 4DA5A 5EI2A 2BZIB 3GQLA 2UW3A 4APCA 2P0CA 3MFTA 3HVCA 1H08A 4CCUA 3CKXA 5HG8A 4OAUC 1YOJA 2HAKA 4P5QA 3R01A 1QCFA 4FKJA 3FMKA 3ANRA 4TYIA 4XG4A 2F49A 4AF3A 4UZDA 3I5ZA 5HNGA 2XVDA 3ZRMA 2VTPA 1WBOA 1B38A 3L8PA 2XIKA 4XG9A 5ANJA 2UW8A 2WIHA 4G9CA 4GIIA 4FK6A 2ITWA 3U54A 3GU7A 3OHTA 3PXKA 4JIKA 5DRBA 3LQ5A 5ANEA 3E8EA 4FV7A 4CQEA 2CSNA 5CF8A 2X2KA 3HGKA 3VRYA 5EKNA 2YM3A 1M7QA 3QZFA 4J98A 5IQAA 3HRFA 2OKRA 3R6XA 4AW0A 4TNDA 5C01A 3W32A 4C02A 4CKIA 3VQHA 3QTXA 1R0EA 3ATTA 1JSTA 3B2TA 3WF8A 4QP7A 4FV8A 5IUIA 4F4PA 2GSFA 4DTKA 1Y6AA 3QQLA 4AFJA 4IADA 3S95A 4RQKA 1H01A 1XH6A 2HWOA 3BHTA 3F6XA 4F70A 3KXMA 3RZBA 3P7AA 4HYHA 3D94A 2ITOA 5AUXA 3KRXA 4X2KA 4YHJA 3C1XA 1F3MC 2WQNA 2VRXA 3Q6UA 1PMEA 3PRIA 4GVJA 4I4FA 4BWPA 4GV1A 4NCTC 4AGDA 5L2TA 2JDRA 4HNIA 2X4ZA 4HCTA 3HMOA 3GFEA 5JZNA 3GNIB 4M7IA 5E90A 2QODA 3UIXA 3VNTA 5BPYA 4U6RA 2W5BA 1DAWA 3ZUVA 4O6EA 5AR7A 3TUCA 2YIRA 3ZLYA 1X8BA 2PZPA 3I5NA 3PSDA 4E20A 4PX6A 2YITA 4YURA 1R1WA 3IW6A 4LQMA 4XP0A 4AA4A 5ITAA 4JG8A 3QRIA 4BIEA 3CTJA 4W4VA 2XK6A 1PKDA 4Y8DA 5IEYA 4QMOA 4UMPA 4BC6A 4PPBA 3UZTA 4FEWA 3PXFA 1MQ4A 2VWXA 3MFRA 2PWLA 3V5WA 3POOA 4NU1A 4ZTHA 3DBQA 3KCKA 3NZ0A 4DFYA 4EK3A 5IA1A 2WMTA 3WF7A 3FZSA 1REKA 4CYIA 4A4OA 3BPRA 4O27B 3VF9A 1OIRA 2I6LA 4TKSA 3EQCA 4QP4A 3UG1A 5IKWA 4BDIA 1PHKA 5HCXA 4EQMA 4PL5A 2QOLA 4FTMA 5KMJA 2QO2A 2WFYA 2ZAZA 2QU5A 3G6HA 3EN7A 4FKIA 3V51A 4WNKA 2C0IA 4FIHA 3ZOSA 3NAXA 2W5HA 5F20A 3W2RA 5CSHA 4F6SA 4EOJA 3TNIA 2OH0E 3QZHA 4PP9A 4B7TA 1F0QA 3COIA 4UWCA 1E1XA 3LCKA 3G51A 4J96A 5E8XA 4BFMA 4OTWA 3PP1A 3ENMA 5I9XA 4S2ZA 5E1SA 2QKWB 4GFMA 4L7SA 2ITYA 4FSUA 3ZUTA 4U97A 3V04A 2BHEA 4IH8A 4O0VA 1OIQA 3PVBA 2WPAA 4DEGA 3DBCA 4G3CA 3AGLA 3L9NA 5JQ8A 3FMHA 3QQHA 5F9EA 5CXZA 3OC1A 1OUYA 3A8XA 2IZSA 4QYGA 5A54A 1NT2A 3IW7A 4FVRA 3HDMA 5JK3A 1R3CA 2ITUA 3PWYA 2FSLX 2VAGA 3ORNA 4RC4A 3TNPC 3ZO3A 5CSWA 3Q96A 1MUOA 3A8WA 5JGAA 3HV6A 2BZKB 5HD7A 5IZFA 4FZAB 2J50A 3AD5A 2P4IA 3HA6A 3ODYX 4BCOA 4Z7GA 2W4OA 5IG1A 2UZEA 2YZAA 4L8MA 2IWIA 4FTQA 3UIMA 3UMWA 3MSSA 3QLGA 3THBA 3R8LA 1GJOA 1OL7A 3D9VA 3DFCB 2J90A 3U8WA 5C8NA 1PMVA 4MX9A 5EYMA 3U9CA 4DFXE 4JG6A 2W1ZA 5DHJA 2ESMA 3F2NA 3BHYA 2C6DA 1Z5MA 3MJ2A 4FTUA 4NH1A 4PPCA 2ZV9A 1JQHA 4JRNA 4FT7A 4KD1A 5IQEA 2YEXA 5CI7A 3QHWA 5EW8A 4LI5A 4PWNA 5C27A 3UNZA 4EHZA 1K3AA 3D2IA 4MEDA 4Y95A 4BCHA 1IR3A 2YACA 3O7LD 3DBDA 3HV4A 4R7IA 4MD8E 1ZYSA 3QXOA 5JGDA 3ZC5A 4RPVA 3R7EA 3ORZA 1B39A 3OMVA 4YZBA 5BQ0A 4DEAA 5HBJA 3O71A 1FINA 4X7QA 3P23A 5BMSA 4HOKA 3QUPA 4CLIA 2X39A 3MV5A 2RIOA 4NEUA 5AP0A 4ASZA 4CMUA 5CSVA 3OT3A 4MXOA 2WQEA 5EYDA 4MBLA 2HW6A 4EZ5A 5KUPA 2R5TA 4FKUA 3S3IA 4RLLA 5FDXA 2F4JA 5AP6A 4YTFA 4TTHB 3DZQA 3LKMA 3EL7A 4UN0C 3PXRA 2PYWA 4RX8A 3DXPA 1BL7A 3VUKA 4E4XA 4UZHA 2Q0NA 2XUUA 4JBPA 4JQ8A 1Q62A 4FKTA 4M0YA 2CLXA 2EU9A 4IHPA 1R0PA 4C34A 3LJ0A 1UU7A 1XHAA 3BKBA 2HELA 5E8YA 4HYUA 2VTSA 2OF2A 4G3DA 3RALA 4B99A 4DFUA 3ZZWA 2HCKA 5EI6A 4LM5A 5T68A 2BIYA 4MK0A 4HVSA 4QMNA 4DF3A 3DKOA 3CY3A 2GNLA 3HRBA 4WRGA 4GJ2A 5BVDA 4OLIA 2VWUA 3JPVA 3RWPA 3RZFA 3UIUA 5CAQA 2BCJA 4FZ6A 4BYJA 1KUTA 2PZ5A 4O38A 3BGZA 3TNQB 3OF0A 4GG7A 4QP6A 1KE8A 4Y85A 4JOAA 4Q2AA 5AP1A 4V04A 5LOHA 3QRKA 5L2QA 3H10A 5TT7A 5KBQA 1ZMUA 2HY0A 4NT4A 3KREA 4USFA 5CT0A 5JFSA 4FTAA 2ETKA 2HZ0A 3FMJA 4IX5A 2BDJA 3UP7A 2LGCA 2IW6A 2RF9A 4ZEGA 4Z7HA 2BDWA 4P90A 1UNHA 3RMFA 5HU3A 2VTTA 4U44A 2P33A 4JG7A 4I41A 4HVHA 3CKWA 5HI2A 3QALE 2WQOA 2OJFE 1BLXA 4Y83A 4H36A 4KIKB 4LUEA 5CVGA 4AZFA 3LOKA 4ERKA 4APPA 4Q9ZA 4QQTA 4LL0A 1WBSA 4I92A 1GZKA 2X81A 3AG9A 2UZNA 2YCSA 5CNOA 5CU2A 3BBWA 4EOKA 4EKLA 4MH7A 3Q4CA 4CFVA 3SGCA 4R5SA 2V62A 4C38A 4CKJA 1YDRE 3MDYA 3PZHA 4I5PA 4OW8A 4JVGA 4TYEA 5IEXA 2X9EA 4H3PA 4C4FA 3CQUA 3UOJA 4YJQA 2KTYA 4FEUA 4KSQA 5EFQA 2VD5A 4FVPA 3ZLWA 5ACKA 2JDOA 2UV2A 4NJ3A 5T6KA 2WTKB 1NVRA 5M4FA 3QCQA 1YXTA 4FG9A 4KKEA 4R77A 2YERA 2R3QA 4LRMA 5BVNA
chains in the Genus database with same CATH superfamily
4O6LA 5BYZA 3I0OA 4DHFA 2IVSA 4PNKA 4DHIB 2YCRA 4CFUA 1Q3DA 2Z7LA 2C0OA 2V7AA 1ZY5A 4BDJA 2IF8A 3K54A 1OL6A 4J52A 1FVRA 4X2FA 4YJSA 4BHZA 3UQCA 5E91A 2O65A 4E1ZA 5LCJA 1Q5KA 1PW2A 4RZWA 4DN5A 4TWOA 5HO7A 4FTOA 3B8RA 3KRJA 2W1IA 3RPYA 1ZZLA 2XA4A 3O96A 3QTIA 5GJGA 3R2YA 3HAVA 2PVMA 3TUBA 2AYPA 2WQMA 3N4VA 3TZ9A 3VUMA 5JRQA 4FE2A 2BTSA 5L2WA 5J1WA 3V3VA 3FV8A 4ITIA 4A7CA 2C30A 3CTQA 5HOAA 3KVWA 3NNUA 1PF8A 4ZJJA 3CJGA 3DAEA 3NVMB 1ZY4A 3VS4A 3FI4A 4CSVA 3PUFC 4LRKA 4S34A 4XRJA 5IISA 4RJ8A 3QRJA 3E3PA 1OL2A 4QNAA 4C0TA 2F7ZE 3MJ1A 1U59A 3QF9A 4I94A 4FGRA 4PNIA 4A9RA 2XP2A 4E73A 3ZBXA 5FP6A 5HZNA 5CEQA 5J9ZA 4S30A 4L01A 4PDPA 3NYVA 2IZRA 4M13A 5DRDA 5H3QA 2Z7SA 2IW8A 3SV0A 3CCNA 3UJGA 2UZLA 3HUBA 4MQ1A 3D7ZA 4L3JA 4RIXA 2VX1A 3MS9A 1PXKA 4FV9A 4J8MA 3V5PA 4R7BA 4HCVA 3TUDA 1W0XC 3W16A 4C59A 5AAFA 2R3KA 3A61A 5E8VA 4CRSA 4F9AA 5A6OA 2CJMA 4WSYA 2DS1A 4JBQA 4BTKA 5J5TA 1EH4A 5M51A 5CU4A 1VEBA 5D9HA 2WMVA 4IX3A 5EYKA 2IN6A 4CTBA 4EOMA 5C8KA 5CENA 5D11A 2B52A 4NW6A 1OI9A 2VGOA 3TV6A 5KCVA 3FDNA 2Q83A 3L8VA 2VTHA 4AG8A 5KMKA 5F4NA 3OS3A 4R1YA 4FKVA 2X8IA 2WMSA 3FYJX 4CQGA 1M2RA 2Z60A 2ZB1A 2CKPA 3F3TA 4FGBA 3VBQA 4UV0A 3V8SA 1U5QA 1OECA 5AUZA 2XANA 3GCUA 5KE0A 3UVRA 3HYHA 4M14A 2WB8A 4ALVA 4D1SA 5I4NA 2Y7JA 4EJ7A 4AW2A 1BUHA 4PMSA 1WBWA 2B4SB 2XEYA 2CNQA 4RJ7A 2YCQA 4FL2A 3MA3A 3P9JA 5FM2A 5FBOA 3AXWA 2WTJA 1H1WA 4NJDA 2EB2A 2ZB0A 5ETAA 4C36A 5E8UA 4AZTA 5LJJA 5LVOA 3SXFA 5EH0A 5BNJA 1P4FA 4HVGA 3SA0A 3NUSA 4KSPA 1XWSA 1RQQA 4FX3A 5I0BA 2ZM4A 4KA3A 4WG3A 3V6SA 4ACDA 4ANLA 4BBMA 4GL9A 4ASDA 4GH2A 1WBNA 3Q5IA 3BU5A 1S9IA 5AAEA 3BL9A 5DR9A 4FT3A 2WTCA 2XM8A 2YIQA 3BBTB 3RPOA 1BYGA 3UMXA 3ZUUA 4HGTA 5EYCA 2J9MA 3QD2B 3C5IA 4XV3A 2A27A 3BLHA 3PLSA 2C5NA 3F2AA 1H26A 4FNXA 4EH6A 1MQBA 3WBLA 4CV9A 5DNRA 1MP8A 2UUEA 4C2WA 3DLZA 3BYUA 4F0FA 4EL9A 5HLNA 3O50A 4F9WA 4BCFA 1XMLA 4IEBA 1U4DA 1H00A 2C47A 1P5EA 3HECA 3OW4A 3R21A 2B9FA 5CQWA 5LVMA 3PP0A 5AUYA 5HD4A 3NGAA 2YLFA 5JFWA 3P1AA 2VTRA 4D1XA 1OKWA 3WZKA 4BTMA 4F6WA 3UYSA 3GCPA 4EZ3A 2W5AA 3FE3A 4EBWA 4ZSAA 3FWQA 2A0CX 4DFLA 5F95A 2XRWA 3QTZA 3C5UA 3MGYA 2WELA 4AWIA 1P14A 3I0QA 3QXPA 4PL3A 2OO8X 3D14A 2YM8A 3L1SA 4P5ZA 2VWWA 5EDPA 3R7VA 3H9RA 3UBDA 4BDEA 5IH4A 5J95A 1YWRA 4D9UA 5BX0A 1ZAOA 2GFCA 4TT7A 5AR2A 4EUUA 5KKRC 2XYNA 4FTNA 5J7BA 4NM5A 3A60A 4O0WA 3CLYA 4FJVA 4MQ2A 5ETIA 4EOIA 2BRBA 4J53A 2R7BA 4PF4A 4XCUA 2VWIA 3SVVA 5E92A 2PULA 4JJRA 4RVTA 2VO0A 3C4WA 4N70A 3PVGA 3FLWA 4ZTLA 1YXXA 4IZAA 2X8EA 2E9NA 4GFOA 4U8ZA 2X4FA 5J9YA 4ITHA 3GCSA 3E63A 5C8MA 4WRSA 1SVGA 1FVVA 4DG3E 3D7TA 3P7BA 5ANKA 5IDPA 3FC1X 3I6WA 4YGAA 1OKVA 3FZPA 2X6EA 5HIBA 2QURA 2PU8A 2C6LA 5A6NA 5HBHA 3A7IA 5KO1A 5CXHA 4L43A 1BL6A 1P2AA 4OR5A 3MVJA 5KZ0A 4A9SA 3TN8A 4E6DA 1H0VA 4FNYA 2UVYA 5CSPA 2A1AB 2VO3A 5FEDA 2JITA 3KK8A 4AOIA 4BL1A 2PPQA 3HNGA 3LFEA 2B0QA 4DGGA 4HZSA 4WO5A 3G90X 3Q52A 1VLRA 4DEDA 4QMSA 1A9UA 3EN4A 3QLFA 4MCVA 4XNEA 4DITA 2XKCA 4YZ9A 4CV8A 3BWJA 4NM0A 4YU2A 2UZUE 3KXHA 2B9JA 3I6UA 2JFMA 4G6NA 3ATSA 4FL1A 2J5EA 2VWBA 3E92A 3I81A 3GCVA 2F2UA 4M97A 3ZDUA 2XCHA 3CSVA 2WMRA 2WMQA 3WIKA 4BGGA 1BMKA 1W8CA 1Z9XA 2X7FA 5BVEA 2J0LA 1SYKA 3LMGA 3T3VA 3TJDA 3ZU7A 3LXKA 4XOYA 2BVAA 4WG5A 4PP7A 1UKHA 4ZZNA 2F9GA 4K8AA 1DI8A 1J7LA 3UE4A 2BZHB 2XK4A 3MFSA 4P2KA 3QTUA 3BWFA 2Z7QA 3IS5A 5HBEA 3W2OA 5FG8A 2OJJA 3MB7A 3G9NA 5CANA 2QLQA 2VZ6A 5JGBA 2F2CB 2GU8A 2YM6A 3C51A 5L8KA 4WNPA 1AGWA 4EQCA 4AZWA 3Q32A 4EOSA 3MESA 2NRYA 4UX9A 2HOGA 2ITNA 3A62A 4FSMA 3VW8A 3PDTA 3F61A 3M11A 3DAKA 3W55A 2PL0A 4FF8A 4EI4A 1OITA 3QYWA 2Q0BA 4Y5QA 4DG2E 5IEVA 1FOTA 3PSCA 2OG8A 3OTUA 3BZ3A 3VC4A 2XNOA 2XNPA 3P5JC 3OFMA 3Q4ZA 4ANSA 2XH5A 4C3PA 2B9HA 4KKHA 5AIRA 4BF2A 2ACXA 3UVQA 5BVWA 2QCSA 2VTQA 2IG7A 4X6QC 3OCSA 3PFQA 3O5AA 2GS7A 2BALA 3RPVA 4IQ6A 4CYJA 1ST0A 1IA8A 4DTAA 5I5ZA 4JI9A 4B8LA 4TWPA 2B54A 2ZM1A 3ELJA 3EQBA 4F0GA 2ZM3A 2WU6A 4XH6A 4XV9A 4IBMA 3NNVA 5CF5A 1H1PA 4IJPA 1ZRZA 4AXDA 2P55A 2BROA 2QR7A 4I6LA 5EM8A 4DH8A 3V5QA 4YTHA 4XLVA 3UVPA 4GT3A 2YM4A 2PMOX 3E7VA 4QPAA 4BWXA 4L9IA 4PV0A 4C57A 4E4LA 2HENA 2GMXA 3A7JA 3AC3A 5CWZA 3V5TA 4NYEA 3LCSA 1M17A 2YIWA 5D41A 3NS9A 3VBTA 3W0QA 1U5RA 4IAAA 3LAUA 2GQSA 5CVHA 3VONA 4RA4A 2GCDA 4DFZE 5M44A 3AT4A 4NFMA 4RIXB 2G2HA 2VTLA 1UKIA 3UG2A 3QKLA 4ID7A 4U79A 1F5QA 3BYVA 1YW2A 2PSQA 4ORKA 2C3IB 3MI9A 2J7TA 2F7XE 3NPCA 4L67A 4MNEA 3FZOA 4FYOA 4BCQA 4BHNA 4AZSA 2CCHA 1PXPA 4M8TA 4W4YA 5GIOE 2BILB 5CX9A 5C1QB 4O0YA 1JLUE 4YLLA 4E6QA 2QC6A 3TWJA 2CPKE 4DDIA 4F1TA 3HMNA 4O21A 2VO7A 3JVRA 3IDPA 3FZTA 2QHMA 2UZBA 2X0OA 1KOBA 1HCLA 2GDOA 2WKMA 4HGLA 3FAAA 1PYEA 5JFVA 3LCOA 3N9XA 4QDEA 2XJ0A 4CMTA 2CMWA 2P2HA 5AP4A 3TZMA 4E7WA 3OROA 3R02A 4F1MA 1TQIA 2E9OA 3RBWA 3A7GA 4KIQA 2G01A 4XUFA 4DLJA 3D5WA 5EW9A 2C6TA 3I7CA 1Y6BA 4K77A 3R8VA 3W18A 4DGOA 2QONA 3BLAA 4DCEA 1CMKE 1K2PA 2CGUA 5EOLA 5IF1A 1ZOHA 3EQDA 3FPQA 1IRKA 2GNHA 5CALA 3JR1A 4QYYA 3C13A 2JKMA 1NVSA 4ZS0A 4XMOA 4DEEA 4KBAA 3CR0A 4I0RA 2GTNA 3UTOA 3ZRKA 2H8HA 3TKIA 3KB7A 4ZOGA 2XKDA 3GC0A 1PXMA 1SNXA 5A4EA 4R5YA 4H3BA 5ETFA 3VULA 3NMUF 3LPBA 4N6ZA 4F7LA 2B1PA 2R2PA 3OZ6A 4DYMA 4EONA 4GIHA 3A7HA 5CEKA 3Q9ZA 1KSWA 4QP2A 4D2PA 5KMNA 3D83A 4YJPA 3UIBA 3H9FA 2BFXA 2AEGA 2CNVA 4BYIA 2FSOX 4FI1A 3HA8A 4U42A 1ST4A 4CG9A 3ENHA 3O51A 5D1JA 5HX6A 5H8EA 1Y8YA 4G9RA 2GNGA 1NA7A 3R9OA 3U6IA 2DUVA 3LQ8A 4XV1A 2GNFA 1WAKA 4TWCA 3NYNA 4MXCA 2JC6A 4QTCA 3ZZEA 1T46A 4O84A 2XRUA 4CT1A 5TOZA 2JKKA 3P0MA 3UNKA 2ERZE 2XCKA 5IQFA 2XK8A 3PYYA 3FSFA 4GYGA 3WE4A 4LOOA 2QO9A 4TN6A 3L9MA 5BYYA 3RTPA 4YZCA 1H25A 3VW6A 2OICA 4C3FA 4R3CA 4DHJA 3EQPA 5AV0A 2RFSA 4GU9A 3K3IA 3HX4A 4GW8A 2PUUA 4ZLZA 3KEXA 3NIZA 1PXOA 4ZTNA 4LMNA 4J8NA 4O0XA 3UQFA 2OIBA 3CPBA 3RK9A 2WOUA 3JY9A 5HO6A 2G15A 1BKXA 2QU6A 1M52A 3RM7A 4PY1A 2VTAA 5M06A 4FNWA 5H2UA 2YN8A 1OBGA 3WZJA 5KZIA 5H9BA 3U6HA 3CD8A 3SRVB 2C6MA 5EDQA 4JL9A 3EOCA 4ENYA 4HVIA 2Y6OA 1NY3A 3O23A 4X0MA 3FLQA 4XP3A 4RMZA 4Q9SA 2PE0A 2IVTA 3HLLA 2BAJA 5HG5A 4XBRA 2PZYA 1OIUA 3F7WA 3OXTA 3RK5A 2PUIA 2I40A 1MRUA 1SM2A 3C4CA 4C37A 5L2IA 2NP8A 4QMWA 2QKRA 3K5VA 4CVAA 4YTIA 3JY0A 3GT8A 4I0TA 3ZEPA 3AGMA 4AE9A 5KMLA 1PJKA 3O2MA 5G1XA 4YTCA 3LFCA 5HCZA 5J87A 3DTCA 2WGJA 3D7TB 3R9RA 3DKCA 4XYFA 4DEBA 4O91A 4OGRA 3A7FA 5M55A 2RKUA 3BU3A 3BX5A 5AP2A 4K6ZA 2W1EA 2REIA 4UALA 1OL5A 4DGNA 3IGGA 3TG1A 1G5SA 1SVHA 3EFJA 3VN9A 1GOLA 2XNGA 4MNFA 3IG7A 4FIEA 2UZTA 1H07A 2XNBA 5A3XA 5HNBA 4PPAA 5JQ5A 5FRIA 3RP9A 4CZTA 3EL8A 4YBKA 3DFAA 2XJ1A 5L6WL 3CIKA 4QNYA 4RQVA 3BELA 4YJNA 2V22A 4DH5A 3KN5A 1JKKA 2IW9A 4KAOA 3RAIA 4ALWA 4DAWA 5AX3A 5IA3A 1LEZA 3I7BA 3NW7A 3KC3A 4BJJA 4BDBA 4D4YA 4X3FA 5CAOA 2W1HA 2YISA 3WZUA 3C0IA 4FKWA 5CAVA 2GS2A 3TACA 4Y5HA 3R8MA 3QC9A 3TDVA 4PDSA 3QA8A 1OPKA 1Q61A 4YPDA 5DOSA 3G5DA 3D5UA 5DPVA 3UGCA 4G5JA 5L6OA 3Q2JA 2XZSA 3MH0A 2QG5A 3S4QA 3NR9A 4CZYB 3TCPA 2ITPA 2WTIA 3DK7A 3ZONA 5IQIA 2PZRA 4N0SA 3UZRA 2OJGA 2VO6A 2CN8A 2OWBA 5M56A 4QMVA 4YZNA 4WD5A 1W7HA 1ZYLA 3FL4A 1WVYA 4J97A 3DK3A 2ZOQA 4PDOA 3FPMA 3FXWA 1YWNA 2WMWA 4ITJA 4NUSA 4WOVA 2QOCA 3KA0A 3DBEA 3NEWA 3SD0A 3T9IA 3OP5A 2QD9A 3RK7A 4ANQA 2PVFA 2CGXA 3B2WA 4UEUA 5DEYA 3HV5A 4L3PA 4O0UA 5HLPA 4D2WA 3SOCA 1FMKA 4XG7A 3VS5A 4YO4A 1JVPP 3VUHA 3CQEA 2YDIA 4ZSJA 4QDVA 4FKSA 4FTTA 4EQUA 5GINE 2O5KA 5LCKA 4RFZA 2Y9QA 3FMMA 3RHXA 3AC4A 3O7LB 4FOBA 3ERKA 3LFFA 3VQUA 4FYNA 3VF8A 4MUQA 2HZ4A 3TNWA 4RX7A 4WIHA 2JGZA 3OWJA 4LDTA 3FKNA 3V8TA 5BUJA 3V5LA 3NNWA 5DA3A 1GAGA 3CY2A 4CFXA 2B53A 3DY7A 5AR8A 1M14A 3QD4A 5T3QA 5HX8A 3GU5A 1IA9A 1OGYA 5L6PA 3DS6A 5TO8A 3HAMA 5DMZA 3FBVA 4RJ3A 1ZMWA 1WVXA 5JZJA 1OKYA 2X7GA 3BYSA 4LV8A 4NKSA 4RC2A 5C4KA 1PY5A 4AW1A 5EM7A 3W2QA 3RNIA 3M2WA 4E93A 4EKKA 3SG8A 2CGVA 2O2UA 5AJQA 3VBXA 4TXCA 1OL1A 3FLZA 4RX9A 4NTSA 1XBBA 2C68A 4BCNA 1TQPA 4WBOA 2PVJA 4LRJA 3MY0A 4I20A 1XJDA 3GU4A 2OZAA 3ORKA 3PSBA 4XJ0A 3SW7A 4O86A 1JKLA 2OIQA 3CTHA 2UZDA 3KVXA 3KXNA 1REJA 3H0ZA 3OW3A 4UMTA 5CZHA 5DGZA 5J5SA 3E88A 4Q5EA 5CNNA 1G8KA 4RT7A 2FA2A 3HMMA 3REPA 3LLAA 1CDKA 2XNEA 3G2FA 4MNEB 1TZDA 2EXCX 3ZRLA 5A4QA 3WYXA 2W1GA 3TTJA 4DH1A 4CCBA 2FO0A 4QEBA 1VZOA 3EQGA 4PMMA 1YQJA 1O6YA 3D0EA 4K2RA 5DT3A 4DTBA 1WFCA 4L68A 4EK5A 4EOOA 5IQCA 1AQ1A 3AOXA 4GS6A 4L7FA 3OG7A 5DT4A 3PXQA 4BDFA 4F0IA 4FSNA 1BI8A 4YPSA 5M08A 3ZDIA 1IAJA 3TNHA 5KBRA 4J1RA 4GUEA 1KE7A 4GJ3A 4CLJA 3S1HA 5KHWA 3FYKX 4DT9A 5KHXA 4O7WA 3RINA 2B7AA 4EH2A 4IVAA 4AU8A 3BV3A 3PWDA 3OEZA 3EZRA 4G3FA 5CEOA 5K0XA 3FUPA 4MWHA 4YC3A 3FKLA 2JBPA 4EHVA 2GPHA 3R1QA 2FSMX 2C5VA 3HV3A 5EDRA 4OTDA 2C1AA 2WMUA 3BLRA 3FZRA 3LFAA 4FOCA 4S32A 4ALUA 5IMEA 4LFIA 4YHTA 4FZFB 4RVMA 4DFBA 3ZO4A 2RFNA 1DAYA 2RL5A 1YXVA 2GFSA 2RFDA 3MWUA 4BBFA 4FK3A 3V5JA 3AKLA 3E3BX 3ZO1A 4O2PA 2R3JA 4ZTSA 5HU9A 4AT4A 3KU2A 3D15A 4IWPA 4IW0A 3DXNA 4NW5A 3HKOA 4F99A 3VJOA 4DH7A 4FKGA 5AM7A 4K0YA 4EWHA 4H1MA 3QZIA 4J7BA 3W10A 2WTKC 3R9DA 4H39A 3LW0A 1OIYA 3NRMA 2W7XA 4QOXA 5CU0A 3PG1A 2CHLA 4UMRA 3WYYA 3E8CA 3FJQE 4AA5A 3ACKA 4MXXA 3ZLXA 1GNGA 4ZXTA 5AA9A 2JKOA 5AR4A 4QMZA 4W4XA 1MRYA 3MIAA 3MVLA 5EM6A 3TYKA 1BI7A 2XIYA 3RCJA 2QOOA 3SW4A 3PY0A 4QPMA 2PVKA 1G8AA 3PUPA 3VUIA 3BQCA 2CKQA 4QQJA 5K4IA 3OWLA 3KMMA 5JT2A 3NYOA 4CZUA 3IDBA 4ZY5A 5AM6A 1YOMA 4B4LA 5HIEA 1NW1A 1HCKA 3ACJA 4FC0A 4HGSA 5EOBA 4ZMEA 4X2NA 4HVDA 5A9UA 4CT2A 4D1ZA 4FV6A 4OTQA 1M2PA 3TZ8A 5HO8A 4WNMA 3SXSA 3Q3BA 1WBPA 5LVNA 3DKFA 2E9PA 3ETAA 3LFBA 4KINA 4L42A 3UO4A 2ONLA 4IB3A 1XH5A 2W9ZB 4DCAA 4KNBA 2R3GA 4KBCA 1DS5A 3MVHA 4U5JA 5L4QA 4V0GA 2UW6A 5FEQA 3GB2A 3EB0A 1S9JA 5H8BA 3WZDA 2BIKB 4D2TA 3EZVA 2VTMA 2YZLA 4IANA 4A4XA 5FUTA 3W8LA 5JRSA 2R3IA 2J5FA 4CG8A 4I6BA 1GZ8A 4BKJA 5A14A 3LM5A 1E1VA 2PVHA 3LFNA 1O9UA 4JRVA 3POZA 1YXUA 2R7IA 4FA2A 5IH5A 5J9LA 5HEZA 5J79A 3DOGA 2YAAA 3GFWA 4I4EA 5GZ9A 1H8FA 3DK6A 5FD2A 4QMLA 4O22A 3O0GA 4FIGA 4FSQA 4TY1A 4BZOA 4MVFA 4KIPA 1U46A 4TPTA 3UC3A 2YWPA 4C58A 4CFWA 4LV7A 3GEQA 3DNDA 3GGFA 5A46A 2PUNA 2WEIA 4JS8A 3R7OA 1WBVA 4ARKA 1FVTA 4O0SA 3KMWA 4MHAA 2JLDA 2HW7A 4M67A 3UYTA 5M4IA 3EYGA 4CXAA 4I22A 3W0OA 3P5KA 4OTPA 3DQWA 2C3KA 3LLTA 3U4UA 3NUYA 4JX7A 4MKCA 2RSVA 3R04A 5GHVA 4G17A 3UP2A 3VIDA 1J3HA 1XMMA 2CDZA 3SOAA 4RIYA 4R8QA 4XBUA 2G2IA 2OGVA 5DH3A 3LJ1A 1XKKA 4EWQA 3R7UA 4RIWA 3QQFA 3BHUA 5BVKA 1SMHA 4P7EA 3QTWA 4BJJB 5LMBA 3ZBFA 4ZTMA 4GU6A 4X3FB 3FL5A 3QWJA 4IVBA 4RGJA 4O1OA 3R8PA 3R1YA 3AD6A 2Y8OA 2IVVA 4MWIA 1O6LA 2YIXA 3Q2MA 1ZYDA 4F64A 3CE3A 4CNHA 3EN5A 3IDCA 4IB1A 2F57A 2J2IB 4IDVA 3GC9A 3NVKI 3P79A 2FB8A 5H8GA 5JSMA 2JBOA 4H3QA 4AT5A 2BTRA 4WG4A 4JAJA 4K33A 4DBNA 4FKQA 4EJNA 3F2RA 4IWDA 1JKTA 4IM0A 4ASXA 1V0PA 5HNIX 3G6GA 3P08A 3F5UA 4L6QA 5AV4A 1H4LA 3JXWA 3NUXA 4JDIA 5AP3A 1CTPE 5BVFA 4ANNA 4G5PA 2Z8CA 1FBNA 4YNOA 2YJSA 4NSTA 3UOKA 1W2DA 4IC7A 5I9YA 3L8SA 5HIDA 2DQ7X 1DM2A 3CGFA 1W2CA 3BEGA 2O63A 3R8ZA 3F5XA 5CT7A 3ODZX 1ATPE 3QQJA 3KRWA 4AN9A 2GNIA 5EHOA 4HGEA 2PVNA 3EFWA 3F5PA 1H24A 2NNWB 5GJDA 4K11A 4QMUA 3VS2A 3BCEA 4ENXA 5CAUA 3P86A 4IMYA 3T8OA 1XO2B 3GVUA 4AXAA 1ZOEA 1CM8A 3MA6A 2O8YA 3QBNA 4IDTA 4O0RA 3TIYA 5CZIA 4HNFA 3O8UA 4ZMFA 2XKEA 2R3FA 3DB6A 1RDQE 3TIZA 3W1FA 2JDTA 2J6MA 4BDHA 3ZSGA 2BR1A 4C4GA 4O4DA 2JAVA 2OFVA 3P78A 4QT1A 2PE1A 4MTAA 5B2KA 5AV3A 3R0TA 3QKKA 4EEVA 2I0YA 2ZVAA 3SRVA 3AD4A 3VO3A 5JEBA 1Y8GA 1IG1A 3G33A 4JR7A 3R7GA 3KFAA 3ALOA 2OZAB 4FL3A 3VHKA 4EH9A 4ASEA 4TYJA 4KIOA 1Q99A 4I5HA 2J0MB 3MY5A 2ZV2A 3EWHA 4AXEA 2BUJA 3PPZA 5AFVA 2RFEA 4FKPA 4JQEA 1OVEA 5GNKA 4M3QA 4O7VA 4QTDA 3TV7A 3ZO2A 5ETCA 3E64A 1KV2A 1K9AA 3FHIA 3FHRA 2VV9A 5AV2A 2SRCA 4BVUA 5HTBA 3IOKA 2X9FA 4G3GA 4ZSEA 4CD0A 4J71A 4FODA 5EK7A 3UPZA 5K9IA 3DBFA 3G15A 3LCTA 2FGIA 3FSKA 3PFYA 1SVEA 4ZIMA 4JDJA 3BYOA 4C4IA 5AP5A 2VNYA 1H27A 2J0IA 3H3CA 4YSJA 5L8LA 3RNYA 3SX9A 4M84A 2V5QA 3AC8A 2VTOA 3DB8A 4IFGA 2ITXA 5FM3A 3EJ1A 1BX6A 2UW7A 3Q5ZA 4FIIA 4K9YA 3KF7A 3WILA 3Q9XA 3H0YA 4C61A 4IJ9A 5K5NA 4PQNA 3PJ3A 1SZMA 4QPSA 3TZ7A 2ZV7A 4BDDA 1GIIA 2ITQA 4OTHA 5FTQA 5CQUA 4A06A 3GCQA 3V6RA 3C7QA 3EFLA 4OT5A 3N4UA 2DYLA 4E6AA 4FTRA 3C4ZA 1PXNA 1VR2A 4GSBA 4FSWA 5FGKA 5J8IA 1XH9A 1WCCA 4P4CA 5KMMA 4AGUA 2YFXA 3RAKA 4B6LA 3MH2A 1IEPA 2A4LA 5AAGA 3KCFA 3UO5A 3R71A 2H6DA 3LHJA 3QL8A 4WUNA 4W9WA 5IUGA 3NUPA 3ORLA 4YO6A 1OPLA 2C5XA 2OI4X 4MBJA 5IQBA 2PMIA 4LMUA 1R39A 3ANQA 4FEQA 2WXVA 5DVRA 3W0SA 3E62A 3KRRA 4GCJA 4M69B 4EC9A 2XYUA 2W1DA 3NCGA 3W2CA 4TYHA 1G3NA 1KE6A 3NUNA 4F9YA 2ZV8A 2G1TA 4NKAA 1PMNA 3QGYA 4BZDA 4ZZOA 3CGOA 3SAYA 5M07A 2GHMA 3IPHA 3TTIA 4FKRA 4FTJA 1CKIA 3DLSA 1OBDA 2UW9A 4A9TA 3ULIA 4BI0A 3UQGA 3GOPA 3OCGA 4WSQA 4XG6A 2R3PA 3PZEA 3RWQA 2W1FA 3VUDA 2ETRA 4D2SA 3TI1A 3IW4A 4BZNA 1PXLA 5FP5A 2VU3A 4D4VA 5LMKA 1MRVA 3G9LX 5I9WA 4I6QA 3QU0A 4BICA 2X2LA 2E9VA 2YCFA 1OM1A 2W4JA 2X0QA 3FQHA 4KKGA 3GC7A 4YLKA 4LG4A 4YJVA 3MW1A 4F65A 4MBIA 4V0GB 5HLWA 4OT6A 3ZFXA 2ITZA 2Y0AA 5JN2A 4LYNA 2JFLA 3DQXA 2VX0A 3OUKA 4AUAA 4BI2A 4CTCA 1QPEA 3KMUA 3A2CA 2XBAA 5CVFA 3R9NA 4OTGA 5IH6A 1RW8A 4JT3A 1UU9A 3D5XA 3R8UA 3WF5A 3LFDA 5G6VA 5AA8A 3HDNA 4FZDB 4IM2A 2OIDA 2BPMA 3TMOA 1L8TA 4U45A 5CYIA 5M4CA 4CEGA 4C7TA 1Y91A 2FSTX 3RAWA 4FSYA 4GG5A 5CI6A 5HTIA 5ANIA 2I0HA 4PL4A 4IWQA 5ANOA 3U6JA 4BCPA 1JSUA 4EBVA 4NM3A 1UU3A 2YDKA 3MTLA 3R1NA 2HYYA 5HVYA 3A4PA 3MPTA 4M12A 4HW7A 1QPJA 3F7ZA 3ROYA 1QPDA 3EH9A 4M15A 4R1VA 4ZY6A 4FG8A 4AAAA 2YJRA 1GZNA 1YVJA 2DWBA 4I5CA 4BDGA 3PY3A 2H34A 3QTSA 4E26A 3GUBA 3MVMA 4R6VA 5AR5A 2JD5A 3LFSA 1R78A 4D4SA 2VX3A 2QVSE 5FBNC 4EYMA 2YABA 5EHYA 1J7UA 1Q8UA 3FEGA 2W99B 4YNEA 1G8SA 5EQEA 2Y4IB 1YWVA 4KRDA 2AC3A 3F5GA 3IK3A 4X6RA 1PKGA 4MF1A 4GVAA 2C5OA 4RIYB 3GBZA 5HHWA 3LJ2A 2WOTA 1FGIA 2OU7A 1Q41A 3OWKA 4D0WA 2EVAA 2WHBA 2QLUA 3M1SA 3BU6A 3MB6A 3N51A 4NIFA 4RIWB 5FXSA 4ZTRA 3OT8A 3QWKA 3PPKA 3CXWA 5FTGA 1ZWSA 5I9VA 1UVRA