3LW0A

Igf-1rk in complex with ligand msc1609119a-1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
292
Chain Sequence
AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric IGF-1R Inhibitors
doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Insulin-like growth factor 1 receptor
total genus 93
structure length 292
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lw0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lw0A01
3DJ7A 3K54A 4IADA 4R7HA 2XVDA 1PMEA 5DNRA 5FP6A 3VBTA 5HO7A 3R1NA 2BIKB 2W1DA 2QD9A 3BHYA 4A06A 3LQ5A 4FKWA 4DT9A 2IW8A 4FTLA 4HVGA 4XV2A 5KZ0A 2C3IB 2RL5A 4QYEA 2ZM1A 1ERKA 3F5PA 3VW6A 1ZYSA 2JEDA 3MVLA 3EKNA 1SNXA 3PTGA 3QFVA 4Z16A 3FL5A 3LZBA 2GNIA 4F6SA 1XH4A 4RJ4A 3FQSA 3OXZA 5J5TA 3SLSA 3B8RA 4CFFA 4O7NA 1OITA 3NAYA 2R9SA 3AT2A 5AR5A 4IZAA 2R7BA 1TKIA 2PU8A 3LFEA 1M2QA 4IAAA 4IM3A 1YVJA 4M84A 4WRSA 4ZIMA 4CRLA 4D0XA 4M3QA 5EM8A 4D58A 5E8UA 3I60A 4KSQA 4XP0A 1NVQA 3C13A 3OROA 3UOLA 1V0BA 2QQ7A 3LIJA 3R28A 1ZY4A 2C3LA 1HOWA 1U59A 2C0IA 4BIBA 3O8TA 1W0XC 5ACKA 4RFMA 4EOOA 3EQCA 3RPOA 2GQRA 1GIIA 1OBDA 4FGRA 4GFGA 3ZYAA 1JKLA 2WFYA 2X1NA 1W8CA 2B52A 4BCIA 3WILA 2XJ2A 4Z55A 3LCKA 4I0SA 5T3QA 5JEBA 3KY2A 4Y85A 5T6KA 1OL5A 2BIYA 5I4NA 3KXHA 4IAKA 4JXFA 4MWIA 4EONA 4FKIA 5IISA 4CT1A 2XK6A 1OM1A 3SOCA 4HGTA 3DBFA 3CTJA 4LGHA 3A8WA 3AOXA 4TZRA 5BVNA 2PSQA 2GFCA 3N51A 1L8TA 5C8KA 3WARA 3NNVA 2OJIA 4KIKB 5AR8A 3C0IA 3BRBA 3LFQA 3A4OX 4FZ7A 4IAYA 2O64A 4XP3A 4U6RA 5TE0A 4YHFA 4KBKA 5AUWA 4WNPA 1LR4A 2W9FB 1UNHA 4P7EA 1NY3A 4I5MA 4E7WA 3LFNA 3VS7A 2YWVA 1YHSA 4RC2A 3NDMA 1KOBA 2V5QA 2VZ6A 3EL8A 3TNIA 4D2VA 4U5JA 4FEWA 2IG7A 3AGMA 1YQJA 3CGFA 4GT4A 3I0QA 2JFLA 2XB7A 3Q4TA 4K8AA 5A46A 3QTIA 5GINE 3E8DA 4HOKA 3PXFA 1IASA 4Q9SA 1OPJA 4BKJA 4I92A 2DS1A 2XKCA 3LLAA 4FT3A 2XCHA 3QKKA 3PVUA 2EVAA 4JQ8A 4MBLA 1T46A 2YM4A 4FVQA 1OVEA 2HYYA 4ALUA 4E4NA 5M4UA 3R9RA 1ZYCA 4CVAA 4MXOA 2A1AB 2JKOA 4X3FC 2BTRA 3LJ0A 3NYVA 5IA3A 1KUTA 4OBQA 5HE0A 3CPBA 2OLCA 3JYAA 1WFCA 5FXQA 3F3ZA 2PMNX 1QPJA 4X2FA 4EL9A 3LQ8A 1KV1A 3TDVA 3PY1A 2IVVA 5CY3A 1YI3A 3MH3A 3W8QA 4YTHA 5HE2A 3W2SA 1VYWA 3GOKA 3FQEA 1Q8YA 2QOHA 3I5ZA 2VTIA 1RJBA 3U87A 5B2MA 3Q4CA 2GNGA 1IAHA 4YJOA 2WQBA 5BVDA 2B7AA 4FTUA 2QONA 2OSCA 4J8NA 2FO0A 5BUIA 4Q9ZA 5KCVA 2FYSA 5CNOA 4QQCA 4FEUA 4EI4A 3BGPA 3E8EA 5M4IA 3IPHA 4X3FA 3R04A 5LCJA 4DFBA 3D83A 3THBA 4QTBA 4GYIA 1ZMUA 3MFRA 4ZTHA 4EK6A 4J7BA 4KSPA 4B9DA 4O83A 1PHKA 1JQHA 4RMZA 4MBJA 4AFEA 2O0UA 4HCTA 5D10A 3CY2A 1QPEA 3HP5A 5CX9A 3RPYA 4XBUA 4L44A 4FBXA 3TT0A 3ULIA 5HI2A 5KMIA 3GNIB 4IWQA 5CF5A 3P78A 3TV4A 4ZY5A 1Q8WA 4G2FA 5CU3A 3RPVA 3D5XA 4YO4A 4Z7GA 3N4VA 3R7UA 3W32A 1CMKE 4XUFA 1HCLA 3PP1A 3OCBA 4UWCA 5DFPA 5AA9A 2HZ0A 2YIQA 4GVJA 5H3QA 2X7FA 2ZV2A 4CSVA 2QCSA 4USEA 3O96A 1YXXA 3MFUA 2QO7A 3PYYA 4I0RA 4RZWA 4XG8A 1CTPE 4GYGA 1R3CA 4IH8A 3MTLA 4DH8A 5IEXA 3TUBA 3UO4A 1W83A 2IZRA 4ZTQA 5CAUA 5C9CA 5K4JA 3CKWA 1Q41A 4OTQA 2WTVA 3AD5A 3MYGA 4C59A 4U97A 3UOJA 3IGGA 4FZFB 3OY1A 4F1OA 5IPJA 2YCQA 3FMDA 2R3HA 3BX5A 1FINA 3F6XA 4BDEA 1WBVA 4HCUA 4YO6A 4CD0A 2Q0NA 5BPYA 5M4FA 2JDRA 3OTVA 3EYHA 3RVGA 2ZV8A 4I6HA 2VTTA 3FSKA 3PA3A 5LOHA 3ELJA 2UZEA 4CZTA 3ZBFA 4A9RA 4ASZA 2H6DA 2XKFA 1KV2A 4OTWA 5L3AA 1G8AA 2YIXA 4D5HA 2QLQA 2JIUA 5AUVA 3PVWA 2VWIA 2W1FA 3ZFMA 4ACDA 3PG1A 5CVHA 5DN3A 4BI0A 3FLSA 3PUPA 2IW6A 5EHLA 4BY9E 4YTIA 5ITAA 4R77A 4U0IA 4FT0A 3ORNA 5CVGA 3RTPA 5J1VA 3VF9A 4AA4A 1I44A 2UVZA 3P7CA 3LJ2A 3NVKI 3L8XA 4DEHA 3T3VA 2EUFB 4OR5A 5I3OA 5CENA 3U4UA 4YZBA 3SKCA 3HAMA 2VTMA 3FUPA 5HIDA 1SMHA 5ANGA 5CAOA 2IVUA 4CQEA 4G9CA 3CS9A 5AV3A 4BTMA 1BLXA 3O8UA 4O0VA 5JQ8A 2WU6A 4BCOA 5JMSA 5FTOA 2OIQA 3HLLA 2GNLA 2ITTA 3RALA 1AGWA 1WVXA 2J0JA 3PPZA 2EWAA 3DT1A 3ZDUA 4IANA 4BZNA 4RFZA 5HX6A 4DBXA 1M2RA 1WBSA 5LWNA 3DLSA 2X7OA 4YHTA 2ZYBA 5DGZA 3U6JA 3HV5A 1OMWA 3G9LX 3QXPA 3CPCA 5AV1A 5TF9A 4EC8A 5E8VA 5DT4A 3C51A 5D11A 4IAIA 4F65A 1ZOEA 3KEXA 4U44A 4P90A 2A4LA 5JRQA 3VULA 4R1VA 3C0GA 3UVPA 3VS0A 4J98A 4NCTC 2W05A 4QTEA 4FYNA 1WBWA 3D9VA 5KHXA 3QYWA 5A14A 4G6NA 4L45A 4IWDA 1GZKA 3E93A 4NW6A 4RQVA 2ESMA 4FSYA 4TWOA 5KO1A 3JY0A 3UMWA 1JNKA 2YCRA 4BDAA 3EQBA 2VV9A 2BALA 3RWPA 3UC4A 4L8MA 2BTSA 2B9IA 2OZAB 2WNTA 4FKOA 2VX0A 4IX5A 5BVEA 2X4ZA 3F2RA 3PWDA 4R78A 3WF9A 4FG9A 2HK5A 5CS6A 4DYMA 4GK3A 4ITHA 5IDPA 1KE9A 3OW3A 3SOAA 3ORXA 4FKRA 1OUYA 4C4HA 5IUIA 4F08A 3QRKA 2OZAA 5CF4A 4D2SA 4CT2A 2WQNA 1PMUA 3ZLWA 4UN0C 1YWNA 3L8PA 4GT3A 1ZAOA 4EK8A 1MQBA 2FSTX 2ERZE 2HZIA 3KF4A 3QF9A 1YI6A 4YUQA 3UDBA 3C4WA 3FAAA 1ATPE 3GU5A 4F9YA 3TKHA 5DR9A 1MRVA 4D2WA 4DN5A 4FSZA 1T45A 4C57A 3NCGA 2C69A 4HPTE 4L01A 2ZDTA 3MPMA 3UVQA 4D9TA 4MXYA 4YHJA 3F3VA 3N9XA 4QOXA 2XK3A 3MA6A 4O0XA 4CLJA 2WTWA 1WBTA 1E1XA 3ACJA 1REJA 2ZV7A 3ZRMA 3W8LA 2W1ZA 2GU8A 3PXYA 2PVHA 4RIXA 1SVEA 1PF8A 1M7QA 1XH7A 5FDXA 1PXIA 4L00A 3OWPA 3P7AA 5IMEA 2XK4A 3D5VA 3QA0A 1NVRA 3QWKA 4FSMA 5HX8A 2OFVA 3NW5A 2WQOA 3QHWA 4EWQA 5CEPA 4RJ3A 2W0JA 3GEQA 4QT1A 4X3FB 4IE9A 3R83A 4O1PA 3SHEA 3ORKA 4PP9A 4NT4A 2W4OA 2HW7A 3MDYA 5DBXA 3UNZA 4EQUA 4EH9A 2ITPA 3GVUA 3QD2B 3WZJA 4FF8A 2VGOA 2CGWA 3EIDA 4E3CA 4KAOA 1FBNA 4DAWA 3PVBA 2VTLA 3NS9A 3ZFXA 4EHVA 2XM8A 5A4TA 4ZSEA 1FGKA 3ANQA 2I0HA 2W4KA 3CJGA 4E26A 5JFWA 2NNWB 2X81A 4FVPA 3QL8A 4QYGA 4CXAA 4ERKA 1NXKA 3TTIA 3MIYA 2YACA 4C3RA 4YZ9A 4IC7A 5DI1A 2G15A 3ROCA 4DEIA 1SZMA 4M67A 3VS1A 3E7VA 4RVLA 2JBOA 3NUUA 3VBYA 2X8EA 5FUTA 3CKXA 4MTAA 5C26A 3K3IA 4AT4A 5FGKA 4L53A 4S32A 2WQMA 1H1WA 2X6DA 3FMLA 3RPSA 4ANLA 2JAMA 3UE4A 4YR8A 4W4XA 4ZTMA 3MB6A 4XOZA 5IA0A 2W7XA 3TN8A 2W17A 2G2HA 3QQJA 3VRZA 2B1PA 3D5UA 1IEPA 1Z57A 2O63A 3FZSA 2QI8A 4FV8A 3GC9A 3NLBA 4FK6A 4ZSGA 3TCPA 5LXMA 1R1WA 2R3KA 4FYOA 2QNJA 4QPAA 3VNTA 3SXFA 3LCDA 2VRXA 4JS8A 1BUHA 5AM6A 5M4CA 3VBQA 3VQUA 4E4LA 1NVSA 4LOPA 5ANEA 4FT5A 3IW4A 1Q61A 2OU7A 4FKGA 2GFSA 4FK3A 3O7LB 2BPMA 3GB2A 1OECA 4M0ZA 5LVLA 2X4FA 4Y5QA 5J5SA 4BIDA 5E4HA 2C47A 4D5KA 5E8SA 3U6HA 4FZ6A 3QXOA 3D14A 4Z3VA 5LARA 5IQCA 3O17A 4KIOA 2CGXA 5AP1A 2YFXA 1UA2A 4I0TA 2FUMA 4PL3A 3EN7A 3VBVA 3MFTA 1H1RA 4ZTLA 4F7SA 3ODYX 3Q2MA 4JIKA 4YJPA 4RX9A 3CEKA 3G9NA 4NH1A 4UBAA 4BCJA 4BYIA 4I4EA 3PXRA 3VUIA 3DBCA 4ACCA 2VTNA 3VWAA 4AGDA 5KUPA 1DM2A 3ZTXA 4PTCA 4R6VA 4AE6A 4X3JA 4Z9LA 2YIRA 3R7OA 4R5YA 2PMIA 3PY0A 4I24A 1J1CA 3QTZA 5HD7A 4HCVA 2CMWA 5I9WA 2UW0A 3PWYA 3QCQA 4YPSA 4YBJA 4C58A 3F5UA 4TYEA 5ETCA 1VZOA 4MWHA 4EOIA 1GJOA 1KWPA 3N4TA 4JX7A 2ITUA 4OTDA 2BZJA 4NM3A 2PE2A 3TKUA 2GTNA 4ZZNA 4OT6A 3MBLA 2E9VA 2OZOA 5CU4A 5E1SA 2QOIA 2R3FA 2YITA 4M8TA 1DAWA 2R3PA 4FKSA 5AV2A 4WA9A 3Q6WA 5IA5A 2OXYA 2Z60A 3V5LA 2W96B 2VTRA 3LFFA 1WBOA 4BKZA 1Y6BA 4NJDA 4YTCA 5AIRA 4DEAA 1APME 2Y0AA 2XKEA 5D12A 2Z7LA 1Y8GA 3MVHA 5AUXA 1X8BA 4TXCA 3ZSGA 3IOKA 1OL1A 5EI6A 2OG8A 3IDCA 5C27A 1YXVA 3FPQA 4D4SA 4DFXE 3DBEA 3BU5A 4H1JA 1IA8A 4KBCA 1GZOA 3SDJA 3CD8A 2OI4X 3NVMB 3WZUA 2JDVA 2FSOX 4FIHA 3RBWA 2AC3A 3GFEA 4YMJA 3W18A 4X2GA 2YM7A 3ACKA 3H0YA 1IR3A 1XBBA 1OL6A 4E20A 3H10A 2PVJA 4E1ZA 2YDIA 4KB8A 4QMNA 2ITXA 3P0MA 3JR1A 2HZNA 2PE1A 3ZFYA 5CAPA 5IG1A 4RA4A 3S95A 3FKLA 4EH2A 3GP0A 5CANA 5AP7A 3MV5A 3EWHA 4AN2A 3HV7A 3FEGA 4GL9A 3DB8A 2P4IA 4N4SA 1PY5A 5HNBA 5TOZA 2YABA 1PYEA 4Y73A 4WSQA 3R9DA 2A27A 1UVRA 3HMPA 4EKKA 2Q83A 2ZJWA 3KC3A 5LJJA 2QG5A 2W4JA 3ZLXA 4DBNA 2PY3A 1BMKA 3FKOA 1AQ1A 4LRMA 2CNVA 2O2UA 3EHAA 3ZRKA 2X8DA 3GT8A 5E8WA 3UNKA 5L6PA 5CEIA 1YWVA 4BCHA 3Q96A 4IVDA 1FMOE 1XJDA 3HA6A 5AP2A 2J0MB 4OTGA 5DG5A 4ZJJA 4ZP5A 3QX4A 3DBDA 4FIIA 3R8UA 1B39A 2CLQA 3UTOA 4C2VA 4EJ7A 3G33A 3BCEA 4EZ7A 2AYPA 2Y4IB 4V01A 2WQEA 4JX3A 4E5AX 3KA0A 4IB1A 5EQEA 4TN6A 4DC2A 3FLWA 4F9CA 4ZOGA 5DR6A 5JFXA 4D1XA 4DA5A 1GAGA 2OF4A 5CT7A 4ZK5A 1M2PA 2XK7A 3IW8A 2PTKA 2YERA 4MXZA 3T9IA 1TVOA 3BU6A 4UMPA 3O0GA 5D7VA 4BDJA 4NL0A 4PY1A 5L6OA 5D9HA 5C8NA 5KNJA 1Q3WA 3OC1A 5LCKA 4TYHA 3BYUA 5CEQA 3RCJA 4D55A 4B7TA 5BUJA 5IH6A 1WVWA 2GNJA 3AC4A 4M69A 3R71A 3TV7A 1L3RE 1G8SA 3CTHA 3ZONA 4R8QA 4M7IA 4QYFA 3V6RA 2UZBA 3F82A 4E5WA 3T3UA 4APCA 2C68A 4WUAA 4EH7A 3HGKA 4ITIA 4WT6A 3GC8A 4AAAA 5HIBA 4YLLA 5FWKK 4TYHB 4XX9A 2PWLA 2FSLX 4U45A 5HOAA 2PZIA 3TZ7A 3OWKA 3UOHA 3UO6A 4IVBA 4DFLA 2VNYA 4RX7A 3R8PA 3BYVA 3LJ1A 3UQFA 2NRUA 2YN8A 1WCCA 4ACHA 4IX4A 2QOOA 5GZAA 5DEWA 4G5JA 5IQIA 2O3PA 2X9EA 1H07A 4QP4A 1CDKA 1PXPA 3QZIA 5ETIA 4X21A 2OF2A 4M13A 3ZOSA 1JPAA 2I0VA 3LE6A 1WMKA 4BHZA 2WMUA 4PMSA 5CQWA 3DJ5A 3EQIA 1Z5MA 3L8VA 2BROA 3PJ1A 3UNJA 3EFJA 5EM5A 3ID6C 4KIQA 1JSUA 1KOAA 3OWLA 3IG7A 4BN1A 5IQFA 2PVMA 2R7IA 3EOCA 2B9JA 4PMMA 3LCOA 4X2KA 3U6IA 4FL1A 5M44A 3PPKA 5CQUA 3MTFA 3SAYA 2C5XA 3LHJA 4O84A 4EUUA 4TYJA 5H2UA 4H36A 4O7VA 3VF8A 4OTRA 3EQGA 3V8TA 2R4BA 3MN3A 2JDOA 3II5A 5IDNA 2XNMA 4HW7A 3KRWA 4DFZE 2QG7A 4DH3A 2XH5A 3V8WA 3TL8A 3FXWA 2OO8X 2BZIB 4HZRA 4XG6A 3ZHPC 5DRDA 2G9XA 4QP3A 4DGMA 5CASA 4MXAA 3A7JA 4KA3A 5IMXA 3EQDA 3ZUTA 3QCYA 2XJ0A 3ORTA 4RGJA 2CLXA 3BV3A 3R21A 4GCJA 5F9EA 1J7UA 2R2PA 4BBMA 4FKUA 3QCSA 4TYIA 2VNWA 3W55A 4IJPA 2CKQA 3Q52A 3DBQA 4WKQA 3NZ0A 3HKOA 3NUSA 4C34A 2PL0A 4CYIA 2F4JA 2GNFA 2QHMA 3RZFA 1PXLA 3ZXZA 4NKSA 4IX3A 4BDGA 3OBGA 2YA9A 4PQNA 4LGGA 3PIZA 3RZBA 2PUNA 2VWBA 4XLVA 3MJ2A 2HOGA 3DPKA 4CGAA 3WI6A 5LQFA 5KKRB 4YJNA 3SA0A 5BYYA 3WIGA 2UW4A 3TNPC 4GU6A 1ZMWA 2QOKA 3DK6A 3C4CA 5FXSA 2GQGA 4DEDA 5BQ0A 4GFMA 3TG1A 4AUAA 3KRXA 4C3FA 4DLIA 4PMPA 5BUEA 1H24A 4RPVA 1OGUA 3R2YA 1W82A 5K5NA 3NYXA 3OWJA 1R0PA 3I7BA 4BDBA 4PL4A 3OOMA 5EKOA 5BNJA 4RIOA 4L3LA 1B38A 3R7IA 1XHAA 2QC6A 4BBEA 2UW9A 4AZVA 4YURA 4EOPA 2XRWA 4DF3A 3DXPA 4FKLA 2WMTA 1GIHA 2H8HA 4Y95A 3R1YA 5HO8A 2R0IA 4G31A 2YM8A 2G2IA 3GOPA 3OVVA 4OW8A 5HU9A 4LQMA 3R00A 4Q5EA 4AA5A 2WMRA 3GQLA 3POOA 4M14A 1UU3A 4DFNA 1XH5A 5JQ5A 3IQ7A 2YM5A 3UOKA 5KMMA 4XHKB 2B0QA 4YZCA 3Q6UA 3PXKA 3PLSA 3UVRA 4FR4A 3C5IA 1YXSA 4A4LA 4ZXTA 5FRIA 3A60A 3QUPA 1BI7A 4YJVA 4FNZA 5C4KA 2WIPA 3PY3A 3DK3A 4BTJA 4DH1A 3VUTA 3AXWA 3ZEWA 4QQ5A 2JITA 1OZ1A 3SV0A 4M68A 3FMNA 4J52A 5KMLA 5FTGA 4UZHA 5AP3A 1PJKA 2OFUA 2F49A 3QCXA 4G3DA 1FGIA 4UMUA 4L68A 3OEFX 3FSFA 2WZJA 1PXNA 4IWPA 2LGCA 5E8ZA 2OKRA 4GW8A 4NM0A 3WF8A 5D41A 1BL6A 2BKZA 4O6EA 4BI1A 2XMYA 3R02A 1LP4A 3D0EA 3LMIA 3VBWA 3ZZEA 1Y57A 2SRCA 4K77A 5AV0A 5HNIX 3GCUA 3L9NA 3OCSA 2IPXA 1VJYA 1ZZLA 2F57A 4HYSA 3KL8A 4C4GA 5IQDA 5HHWA 3D7TB 3FC1X 5HG9A 4ACMA 4O86A 3R7EA 2Z7SA 1P14A 1LPUA 3B2WA 4MX9A 4O22A 4XG9A 4UYNA 4BCKA 3CXWA 2ETKA 3QUEA 4UXLA 5ANIA 4ZSLA 5M06A 3EN6A 4USDA 4J53A 3LM0A 3BBWA 3I81A 5TO8A 4BZOA 2Y4IC 3TNWA 2EXCX 1XO2B 2RG5A 2WMSA 2BFXA 1G5SA 3FZOA 4I1ZA 3EN4A 1OL7A 2Y9QA 5GNKA 4DH7A 2BVAA 2ITNA 2QVSE 4LOOA 4M69B 4FNXA 3R6XA 4GMYA 4QD6A 3ET7A 4UEUA 4ZTNA 4AXAA 4BCPA 1Q99A 3KQ7A 3VO3A 4F1TA 3FWQA 2OH4A 1IAJA 4R5SA 3A4PA 5HVYA 4ARKA 1MQ4A 3MWUA 4AF3A 2BRMA 4JOAA 2ZM4A 4M0YA 1JVPP 4FTQA 3H3CA 4ZY4A 1TQMA 3LOKA 4JNWA 4QMVA 2C1BA 4X0MA 3VBXA 4NEUA 5JFSA 3ORLA 1SM2A 4FKTA 2XK9A 2VGPA 5AR3A 4E5BA 5FBNC 3PE2A 5EG3A 3ZO3A 5AX3A 2C6OA 3WF5A 4KRDA 4WBBB 4JDIA 5JZNA 2PVNA 2R3MA 2XS0A 2C6KA 3BEGA 2I0EA 3QHRA 4MYGA 5CYIA 3BHUA 4PRJA 4F7LA 2NO3A 2C5YA 4UZDA 3RHKA 3IKAA 1U54B 2P55A 3DDPA 1MRYA 4QMYA 4E6AA 3QTQA 5GJFA 4TTHB 2B54A 3UC3A 3TUDA 3AQVA 4QMMA 2Z7QA 1PXOA 5HD4A 4M66A 5AUZA 5G1XA 4Q2AA 1ZXEA 5FDPA 2C6LA 3DNEA 4RC3A 3CC6A 3BI6A 3NUXA 4H3PA 3UP2A 3W2RA 3W2PA 1YOMA 5AWMA 3ATSA 3OXIA 3KN6A 3PP0A 4PNKA 4BCQA 3KN5A 3HUBA 3AC8A 5HLWA 1BL7A 5E7RA 2FSMX 2HZ4A 4AW1A 4CNHA 4EORA 4P5QA 5LVPA 3BWJA 3E87A 4BTKA 4D4RA 5I3RA 5FXRA 4KKEA 4GV1A 3GU4A 3LFSA 4ZJIA 5A4CA 5D7AA 1H08A 4BC6A 2Z7RA 3OT3A 4EOLA 2OW3A 1UWHA 4HVDA 3V6SA 4G3GA 4W8EA 4YBKA 4L7FA 5E1EA 5GZ9A 2Q0BA 4ZSAA 2V62A 2PVFA 3AGLA 4FKVA 4F99A 5B0XA 4BBFA 3DOGA 2VTQA 3CQWA 4NIFA 3O23A 3BHHA 4PNIA 5TT7A 5L8KA 4YC3A 5K3YA 3TI1A 1DI9A 3ZBXA 2ITOA 2BHEA 3POZA 4GK4A 2WMWA 1QPDA 3V8SA 4EZ5A 1J7IA 5AIKA 3RNIA 3A99A 4ZY6A 2A19B 3QRJA 1YXUA 4NUSA 4R3PA 4QRCA 3DTCA 5EOLA 2C6MA 3H9RA 3NYNA 2AUHA 3ZC5A 3R01A 3ZM9A 3FMMA 5DLSA 1WAKA 1H25A 2E9UA 3VUMA 3WIKA 3MVJA 3FMKA 3VS5A 3VIDA 4CTBA 1OBGA 4ENYA 3W16A 4A7CA 4PTGA 4UY9A 4JBVA 2BAJA 4LG4A 2BZKB 5CXHA 3O8PA 4HPUE 4ENXA 3AG9A 4YSMA 2CPKE 5H8BA 3KCFA 4XLIA 3VJNA 5LVNA 1H0VA 4MEDA 4O0UA 1NT2A 3UZTA 3MY5A 2XEZA 3COIA 3R8LA 4C62A 2PZ5A 2YZLA 3EQRA 2EB2A 2QKRA 2REIA 4TNDA 2QOFA 2B9FA 1IG1A 3VN9A 2GMXA 3FHRA 4BGGA 4CKIA 1YXTA 3BPRA 3FL4A 3GCSA 4B99A 1W98A 5CU0A 3KXMA 4O82A 3KF7A 2OGVA 3NUPA 2F7EE 4OGRA 3DLZA 1FVRA 2CCIA 4ZTSA 2VO7A 3E8NA 5L2IA 3TTJA 1H4LA 4B0GA 1TQIA 4MNFA 4QP9A 4LL0A 5FP5A 3PXZA 3DU8A 2BAQA 4DFYA 1KSWA 3E7OA 4UB7A 2PMOX 4AACA 2C6TA 3GBZA 2J2IB 3DA6A 3NUNA 3ZEPA 2WMXA 3FZTA 4PX6A 2OJFE 4NKAA 2RIOA 2WMBA 4HGEA 4QQJA 3C50A 5JZJA 5KBRA 3QD4A 3IK3A 5EI8A 3BIZA 2VWUA 3LCSA 1QPCA 4GUEA 5J9ZA 5AMNA 3F3UA 3FZPA 1FQ1B 4AGUA 2V0DA 3G0FA 4RVTA 5CU6A 3PSDA 4C4EA 5HKMA 3L1SA 2O65A 3KMUA 3PPJA 1NA7A 4KWPA 2H34A 4UX9A 4U79A 4S34A 3VHKA 1H8FA 3QGYA 4I5PA 1J1BA 2XYUA 4M12A 1OIYA 3PRFA 4KKHA 3VRYA 3SVVA 4FV7A 4EH8A 4Y83A 4ZLYA 3S1HA 4C35A 5EH0A 2PULA 4J96A 3LXLA 1YDSE 3WE4A 4CEGA 3E8CA 2F9GA 3HMNA 3HEGA 4TW9A 4O1OA 3WF7A 2IZSA 4C61A 3H30A 3MESA 2KULA 5KBQA 1FPUA 1O9UA 4D2PA 2W9ZB 2G2FA 4LRJA 3JY9A 3FC2A 3R7GA 5AUYA 4WNMA 5K0XA 2FH9A 4WO5A 4TY1A 2WGJA 2Z2WA 3OMVA 3FBVA 3PZEA 2JDTA 3COKA 4HVHA 1F3MC 4GG7A 2HW6A 3C4EA 1PYXA 5DYJA 5EQYA 4FA2A 5JRSA 3I7CA 3LFCA 4IM0A 5L2SA 4ONAA 4U42A 3EYGA 3SG9A 3PDTA 4AQCA 5AR2A 5DA3A 3U55A 4E73A 3FMHA 2GHMA 3EQFA 4B8LA 5AJQA 2UW3A 2P2HA 3LXKA 3OUKA 3VS2A 2UV2A 2CSNA 3DKOA 4FIEA 3WZDA 2ZB0A 5AA8A 3KXNA 5E8TA 2WU7A 4RRVA 2PPQA 2IN6A 3RAKA 3FI8A 4JG6A 1QMZA 3ENHA 5HLNA 3TZMA 4Y72A 1U54A 4U7ZA 3VQHA 1A06A 4RLKA 1XH9A 4I6FA 4A9SA 3RM7A 4IM2A 3PJ3A 3ULZA 2R3RA 2JAVA 4ERWA 3LFAA 1JKKA 5JK3A 2W5HA 4RWJA 4DEBA 2VU3A 4RWIA 2GQSA 4U80A 2ERKA 2WKMA 4JBOA 4RQKA 3ZLSA 1JBPE 4L67A 4QP1A 4RZVA 3FY2A 4MF1A 3FZRA 4RLLA 2Z02A 4LI5A 2OIDA 5AR7A 2VX3A 3CLYA 3DKGA 5AR4A 4UMQA 4DEGA 5BVOA 1LUFA 3TZ9A 3GU6A 4G3EA 1OKYA 4APPA 3U54A 4H39A 4IC8A 4AW0A 3QQHA 4Q5HA 4DH5A 4RIXB 1CKJA 4AW2A 2YJSA 4AOTA 2JGZA 5BX0A 4BCMA 3BZ3A 5EHYA 3C7QA 4K9YA 3HRCA 3P4KA 2CHLA 4M97A 3B2TA 4FL3A 2C4GA 4IX6A 3ZS5A 4G1WA 1DAYA 3C1XA 3NNXA 3BEAA 3RKBA 4YNOA 4BCFA 5IA2A 3LMGA 3FE3A 2QOBA 2O5KA 3DY7A 4AN3A 3AMAA 4QTAA 3RPRA 2X6EA 3DQXA 4RJ7A 3MA3A 4CZUA 3QLFA 4U81A 4U41A 5A4QA 2C6EA 4JQ7A 4IAFA 4L7SA 4PF4A 4UWYA 1V0OA 3UIMA 3VS4A 5IH5A 4R7BA 2CKOA 3GENA 1KE6A 1H00A 4ZZOA 1M17A 4YJRA 5F1ZA 3H9OA 2JKQA 4IHPA 4ANQA 1UWJA 2J0KA 5AM7A 2JIIA 3R0TA 4I22A 1URWA 4I5CA 5ANJA 5M53A 4O7YA 4FODA 4V04A 1XR1A 3GXLA 4C37A 1OKVA 1OB3A 3P79A 4K11A 5HEZA 2PVKA 4MKCA 3OXTA 3DXQA 3P86A 4ZMFA 4AOIA 4QMTA 1CKPA 3SXSA 2PYWA 1RE8A 5IQGA 3DGKA 1K2PA 4FSRA 4FNYA 4V0GA 4WNOA 2HXLA 4MCVA 4IMYA 4KBAA 3ERKA 4Y8DA 4F7NA 4ORKA 1A48A 5BVWA 3LXPA 1ZYLA 3GC0A 5E8YA 4USFA 3KGAA 4CMTA 3NYOA 3RM6A 3UIBA 4C36A 2X8IA 2W5BA 3SW4A 4H58A 4EUTA 3G51A 4N57A 3H0ZA 4OTFA 3NAXA 3NX8A 2VAGA 3OUNB 4TPTA 2RFDA 3D7TA 5HCXA 4DLJA 2IO6A 3ALNA 3E3BX 4F09A 1Z9XA 5HNGA 3IONA 4GH2A 3DK7A 4AT5A 1S9JA 1PXKA 4DTKA 4IBMA 3QZFA 2CNQA 2ETMA 3E88A 1XH8A 5FBOA 3QQKA 1XQZA 3ORIA 4I5HA 4FIFA 3PSCA 4LV5A 4FTRA 4FX3A 4AN9A 2YIYA 3R22A 3UGCA 4XG7A 4D9UA 5AUUA 4TNBA 4A4XA 4J1RA 3TDWA 5AADA 4HGSA 4OBPA 5TR6A 4QMLA 5J1WA 5CI7A 4X2NA 3CSVA 5IQHA 4G16A 2YAKA 4KKGA 4W8DA 4AA0A 4RC4A 5D1JA 3TXOA 2QURA 2R5TA 4LFIA 3ODZX 3R9NA 3ROYA 3G6HA 3MS9A 3FHIA 3COHA 4F0IA 3DKFA 5EW8A 5AUTA 3S0OA 3TUCA 4MD7E 3U9CA 3QZGA 3SRVB 4S31A 1E1VA 4FSQA 4FTKA 3VUGA 5CEOA 3PJ2A 4LUEA 4O21A 5CAQA 3QRIA 4FTIA 4A9UA 5EW9A 4QMQA 2XUUA 4L43A 1FVTA 4KNBA 2YM6A 4YLJA 5HVJA 1Q8ZA 3UPXA 5CEKA 2ZVAA 4WG4A 3IW6A 3Q4ZA 2CDZA 5C03A 1TQPA 5C8MA 3F5GA 4BDKA 4FZAB 3IDPA 4CLIA 4FUYA 4GKHA 5LVMA 4F6UA 4DG3E 3KK8A 4MAOA 5EYKA 1PXMA 5M51A 5DR2A 5M55A 2OIBA 1H27A 4RJ5A 1B6CB 4MXXA 3G0EA 4RIWA 4W9XA 1OIUA 1ZMVA 1S9IA 3H9FA 4DT8A 3KFAA 3EFLA 4Z7HA 1ZRZA 1M7NA 3ENMA 5A6NA 2XIZA 3MW1A 4RG0A 4ZJVA 3NIZA 3SC1A 5B2LA 3BU3A 2LAVA 3VUHA 4CFNA 1H1PA 2YM3A 3P5KA 3WYXA 4GUBA 3O51A 4GVAA 5I9XA 4CG9A 3UYTA 4AZEA 3LFDA 1F5QA 4RIYB 4ZS4A 2BCJA 4EBVA 4AWIA 1XH6A 2G1TA 2PVRA 2EXEA 2R3NA 4UXQA 2XNNA 5FTQA 3UP7A 2XZSA 4BI2A 3FDNA 5HTIA 3BYMA 1OPKA 4XMOA 3KU2A 3F69A 3FPMA 4HGLA 2J90A 4W4YA 4ASXA 5H8EA 4EQMA 2F2UA 2CGUA 3GCQA 3JUHA 1F0QA 2RFNA 3AD4A 4FV5A 3Q60A 1JLUE 1UU8A 3D7ZA 4RWKA 5ANDA 2XBJA 4YJSA 5DEYA 2JIVA 4O0TA 5J7BA 4G6LA 4GK2A 3TACA 4FTCA 3TNQB 5KMOA 4TL0A 4RA5A 1YOLA 4O0YA 4CMOA 4D2RA 5IEVA 4EOMA 2QKWB 2XYNA 2WELA 2NRYA 4R1YA 3BHTA 4ZLOA 3EL7A 3EFWA 4XBRA 3UIUA 3V5JA 3E3PA 3DS6A 3FMJA 3HV3A 3R9HA 5LVOA 4K18A 3HYHA 3BLQA 4GJ3A 3F7WA 1YRPA 3RHXA 2GS2A 2HXQA 3CTQA 3HDMA 3AMYA 3Q32A 5HTBA 3OY3A 1R39A 3M42A 4RVMA 4ACGA 3UQCA 3TV6A 5EI2A 3VUKA 4X7QA 3LM5A 4BDHA 2BRHA 4O7TA 4DTAA 5I0BA 2R3OA 3QTRA 5IKWA 3VUDA 4GU9A 4OTIA 1VR2A 3AT4A 1YWRA 3VW8A 5CXZA 3QLGA 5IA4A 3TJDA 3KXZA 5DMZA 3NUYA 4R3RA 3DB6A 1GZ8A 3CQEA 3NUAA 1O6YA 5E92A 3LVPA 4EQCA 1Y6AA 2VN9A 3F88A 3CR0A 4AU8A 2VTPA 3RAWA 2W1GA 3ZUUA 4C7TA 4HJOA 4IWOA 1E9HA 2EB3A 5C01A 4O91A 2XIRA 3KULB 4IQ6A 4MBIA 3DCVA 3G15A 4Y5HA 2P0CA 3R63A 3KK9A 4JI9A 4DTBA 4QMWA 5IF1A 2XEYA 1UNLA 2YDJA 1V1KA 3PJCA 4YU2A 1WVYA 4RT7A 4A9TA 1KE7A 5J9YA 5CSWA 5I9ZA 5FQDC 2WXVA 2QR7A 3KXGA 4MK0A 1Q3DA 1M52A 2VTSA 2WTCA 4NK9A 2FGIA 4IFGA 4NZWB 3CP9A 5HG5A 1JSVA 3NPCA 4HNFA 5DOSA 1URCA 3EZVA 2WMVA 3GU7A 1J3HA 2I1MA 4IZ7A 4BF2A 3TM0A 3QQFA 4AZSA 5F4NA 3EN9A 3U8WA 4CMUA 5E90A 3BLRA 4ASEA 2VO0A 3C5UA 4BWXA 2UZVA 2J0LA 1H1SA 3Q5ZA 1ZWSA 4MD8E 2VO6A 3GGFA 4I6QA 4IAZA 4QTCA 4CYJA 4CZYB 5AP4A 4F1MA 4EWHA 2R3JA 5JH6A 3NGAA 2EU9A 2R3GA 4CV9A 3UPZA 4H3BA 1JKSA 4F7JA 2ITVA 1BYGA 4JAIA 4O6LA 4RX8A 2ITWA 2CN8A 4IVAA 1U5QA 4JBPA 3OW4A 4I93A 5L2WA 2YHVA 3OD6X 2F7XE 3Q4UA 4YZDA 4GS6A 2IW9A 3UG2A 4GEOA 3GQIA 4PUZA 2P33A 4WSYA 2VTJA 2Z8CA 2J4ZA 2WIHA 1PMNA 2C5VA 4FZDB 2OWBA 3F5XA 4FOCA 2WB8A 4C33A 5CSPA 3KRJA 2PVYA 1YOJA 3ITZA 4C4JA 3BYOA 1WBPA 3HV6A 1BX6A 4XNEA 5AX9A 4F9AA 4EKLA 4B6LA 4EOKA 4AOJA 3RAIA 1JOWB 4JRVA 3C4ZA 4GFOA 4QO9A 3GC7A 2UZDA 3PLAE 2ACXA 3QAME 5KZIA 3IECA 4BIEA 2V7OA 3KRRA 4LYNA 2WEVA 4FTJA 4XYFA 3Q04A 5HBHA 4O0RA 3WOWA 4FTNA 3N4UA 2DQ7X 3PIXA 3ZO1A 1REKA 3MI9A 4AX8A 3BYSA 2BZHB 1O6KA 2JC6A 5F95A 4CCUA 4KUJA 5IQAA 3WE8A 4RWLA 3QX2A 4DE4A 2BDWA 4YTFA 4DCAA 3I5NA 3EQPA 4TWNA 2BKKA 4OTHA 4OLIA 4XEYA 5EDPA 4CV8A 2PUUA 3P1AA 3ETAA 1GOLA 4BCNA 4FV3A 4DGNA 4FE2A 1H0WA 3D5WA 4JQEA 5DPVA 4ZZMA 2VTHA 4K0YA 2GS7A 1H01A 2XA4A 3I6WA 2VTAA 3KMWA 3COMA 5A3XA 4OAVB 4BR3A 4LUDA 2PZPA 3AC1A 3KXXA 3BGQA 3F9NA 4FVRA 4UMRA 4O2PA 4ITJA 2JBPA 3F2NA 4CFWA 4F6WA 3PJ8A 4XG4A 3Q9YA 4PP7A 2BUJA 3GCPA 3U9NA 2HAKA 5DHJA 3JPVA 4RX5A 4DHFA 3O2MA 3VC4A 4JAJA 5E9EA 2J50A 2WTKC 2XNEA 4ASDA 3KB7A 4C8BA 4D4VA 2EXMA 2ETRA 5HG8A 3W2OA 1UKIA 3EB0A 4TYGA 4E6CA 3R9OA 5C1QB 5CAVA 5AEPA 5FEDA 2R3QA 2VTOA 4GKIA 5F94A 3BGZA 4FGBA 4XRJA 5CZIA 3C4FA 3F3WA 4BGQA 2OK1A 3HMMA 4FTAA 3MGYA 4JDJA 4TT7A 4YC6A 5G6VA 4ANBA 5L8LA 1DI8A 4MNEA 3B8QA 4ANNA 2C6DA 1Q97A 3EMGA 4BCGA 4EH4A 5CSHA 2A0CX 4RJ6A 3WF6A 5JT2A 2I7QA 3LFBA 3QC9A 5EYCA 5LMBA 5L8JA 5KE0A 3F2AA 2WMQA 5CNNA 3BHVA 1KE5A 5L2TA 4QPSA 4FICA 2UVXA 3V04A 4DG0E 5BVKA 3HX4A 4I20A 4D1SA 5L6WL 4EYMA 2BR1A 4MF0A 4FV2A 1CSNA 4G6OA 4XG2A 3S00A 3HRBA 2C0TA 4G34A 4O27B 2W99B 1Q8TA 3AD6A 4JJRA 2QOLA 5A4EA 5M56A 4BWPA 3MH1A 4ZMEA 1XWSA 2ZMCA 5E8XA 4EH3A 3FLZA 2W1HA 2WTIA 4UALA 5JKGA 3S2PA 1Y8YA 3OBJA 3BQRA 2FA2A 1STCE 5DIAA 3OCGA 4IDTA 5BMSA 1Y91A 3WZEA 5ETAA 4BL1A 4EOJA 2BFYA 4EHZA 4V0GB 5L4QA 1H26A 3DAJA 4FNWA 5KKRC 2C1AA 5HESA 3TIYA 4J99A 4MH7A 3LMHA 4U40A 1UNGA 1PXJA 2JD5A 2XM9A 3QALE 3FYJX 4PPAA 5K9IA 3K2LA 2IZTA 3DTWA 4O7SA 3I4BA 4LV8A 2I0YA 4MQ1A 4K1BA 4U3ZA 5IH4A 2W5AA 4JG8A 5CALA 3Q2JA 1OL2A 2O8YA 2W06A 2QU6A 4PDPA 3RMFA 3TWJA 3DZOA 3ORPA 2J9MA 4MQ2A 3FV8A 4OAUC 4ANMA 2UW7A 1H1QA 3CIKA 3K3JA 4I41A 2XNGA 4PPBA 4BHNA 2V7AA 3LQ3A 2GTMA 4MD9E 3RCDA 5HU3A 3QGWA 2J7TA 2PE0A 3LW0A 4KS7A 4QMZA 5GIOE 2YCFA 5DT0A 4EBWA 3ZC6A 3R2BA 1R0EA 4NM7A 4QYYA 4W9WA 3RK7A 2ITQA 3QD0A 4RVKA 4NFMA 1OIRA 4WOVA 2Y6MA 3FLQA 4R7IA 3C0HA 4PMTA 5FM3A 1GNGA 3PRIA 1WZYA 3FI2A 4E4XA 4K6ZA 5BMMA 1YDRE 2RF9A 5EOBA 1AD5A 5ACBC 2YDKA 3R7YA 2YEXA 4L46A 4IB5A 3QQLA 5HIEA 4IEBA 3K5VA 4LL5A 3UBDA 5KMJA 4FV4A 4HZSA 5I5ZA 4GIHA 2KTYA 3MY0A 4GSBA 5AAGA 1A9UA 2WOUA 4YSJA 2C0OA 3UIXA 5HGIA 4O7WA 4L6QA 5A6OA 5FLFA 3FI4A 4X2JA 4D4YA 2XCKA 2E9PA 3AMBA 3A7FA 2XNPA 2X7GA 3NNWA 5IQEA 1VYZA 4IVCA 4FV0A 3SG8A 3GU8A 2R64A 3PVGA 2WO6A 3KREA 4S30A 4QNYA 4E6QA 1FMKA 3S3IA 4DEEA 5KMKA 2WTJA 3R1SA 4BDCA 2C3KA 2XJ1A 3NCZA 2ZM3A 5KMNA 2OJ9A 4U3YA 3D4QA 3RI1A 3KCKA 4C2WA 4QYHA 4EHEA 3ZLYA 2XP2A 4IW0A 5EKNA 3V5PA 3OCTA 5B2KA 1Q4LA 5H9BA 1H28A 4YJUA 2HWOA 2XKDA 1KE8A 4OBOA 5AAFA 5IEYA 1GY3A 2OXXA 5EQPA 1R78A 4F70A 3CBLA 4G5PA 5J87A 3KRLA 3BELA 2JKKA 4N70A 1G3NA 2XRUA 4BVUA 3F61A 3VJOA 4AZWA 4C02A 2YCSA 2OICA 2HY0A 4X6RA 3DQWA 3LPBA 3QZHA 5LMAA 4H05A 4WHZA 4NIFB 5M57A 3R8ZA 4NJ3A 1IA9A 1YDTE 4S2ZA 4JRNA 2J5FA 1O6LA 2PVLA 3AT3A 2E9OA 4KS8A 3ZXTA 4CQGA 3GFWA 2QODA 4XP2A 3DAEA 3ZO4A 2QLUA 3IO7A 5CF8A 5DE2A 5JN2A 3TIZA 2OJGA 2G01A 2UZLA 2I40A 2HCKA 4EK3A 3Q9WA 4ZEGA 2QOCA 3R8MA 4AZFA 2X2LA 3MH0A 4MVFA 4RJ8A 5HVKA 2VD5A 3QQGA 2DYLA 3MB7A 4F0FA 4J71A 3DKCA 4FSUA 3SXRA 3ORMA 2E9NA 4FC0A 5FEQA 4IZ5A 3QKLA 3NW7A 3DNDA 1QCFA 5EK7A 2UUEA 5IA1A 4O81A 2UZWE 3NMUF 3KVWA 4W4WA 3DDQA 1EH4A 2X0GA 1UKHA 2PHKA 3MPAA 2CCHA 2XK8A 3CY3A 3P9JA 3PZHA 3PXQA 3RGFA 3V3VA 4J97A 4F9WA 2P2IA 3ZRLA 2VWXA 2ZOQA 2CKEA 2JFMA 3A8XA 4FKJA 1OKZA 4YC8A 4MNEB 5J7HA 1PMVA 3KKVA 3L8SA 4K33A 4DINA 2RGPA 3D2KA 4YP8A 1FOTA 4R3CA 5ANKA 4CRSA 1SVGA 3FMEA 1PKDA 1JWHA 2OXDA 3PFQA 3TJCA 3UMXA 4AZTA 4BZDA 3UZRA 4QP6A 4XCUA 4B4LA 1P5EA 2UZNA 2HY81 2OJJA 5J8IA 5HCYA 5CTPA 2W1IA 3GCVA 4I23A 1LEZA 1P4FA 2R3LA 2YAAA 5C4LA 1QL6A 4O7ZA 4LM5A 3EN5A 3OS3A 3NR9A 1ZOGA 1I09A 2CGVA 1DS5A 3I1AA 5K5XA 2XNOA 4C3PA 4NYEA 4DGOA 1ZOHA 2R0UA 1PW2A 3W1FA 1CKIA 4EOSA 2AC5A 3MVMA 4FT7A 3QRTA 3T8OA 5GIPE 4BTFA 4QP8A 3UQGA 3E63A 4AT3A 4I94A 4U9AA 5A4LA 4I6BA 3C9WA 4IJ9A 4TWPA 2RG6A 5IUHA 1W7HA 5HICA 5HG7A 3FY0A 2FVDA 2YZAA 3BE2A 5BYZA 3ZMMA 5DT3A 3WBLA 2ONLA 1ZY5A 2HWPA 4BDFA 4F4PA 1ND4A 4KD1A 5EM7A 2WOTA 1PKGA 5FEEA 4AP7A 2WPAA 4J8MA 3HZTA 4FKQA 3E64A 2V22A 2V55A 4YLKA 4O38A 3A7IA 4EOQA 3L9LA 3I79A 3GI3A 3LAUA 3HECA 1JSTA 1M14A 3MJ1A 5JFVA 1Q8UA 2VUWA 3G6GA 2ZDUA 3ORZA 3OFMA 4JL9A 5CLPA 4ZAUA 4PWNA 4JR7A 3EFKA 5FD2A 4CTCA 3HMOA 4HNIA 2A2AA 2C30A 1ZLTA 3NNUA 4EHGA 3ZZWA 2YLEA 4G17A 5HE1A 4RSSA 3IDBA 1Q24A 3OTUA 4E6DA 5A9UA 3PA4A 4PL5A 2BRBA 4HYUA 3M11A 2B4SB 3HUCA 4WNKA 4CFVA 2C5NA 4QNAA 2GSFA 4FIGA 3UO5A 3NRMA 4GG5A 4LOQA 2ZB1A 3DV3A 3QBNA 4JLCA 5DH3A 5BVFA 3D15A 5K4IA 3QRUA 2UZOA 5CVFA 3VS6A 2XIYA 3CGOA 3HP2A 2B9HA 3VS3A 3WYYA 2QOQA 3EH9A 4FIJA 3QTXA 3W10A 1VEBA 3ANRA 3BE9A 3ZCLA 3V01A 4ANSA 3G90X 5HORA 1V0PA 4YZMA 3JS2A 3KMMA 3OOGA 4YJQA 5CT0A 3BWFA 3OEZA 1ZARA 4LMNA 5I9VA 2FB8A 2WTDA 3ZDIA 3T9TA 3C4XA 4WG3A 3P23A 5T68A 4TRLA 4BRXA 4E8AA 4I4FA 1P4OA 3BV2A 3U51A 3ZH8A 4FEQA 4IACA 4QMUA 4O2ZA 4BDDA 1SVHA 4CFXA 4CCBA 4YZNA 3ZO2A 3R8VA 4MHAA 4FEVA 3P08A 4NTSA 4F63A 3AC2A 4HYHA 3UJGA 2VO3A 2PZRA 4L9IA 4FG8A 2NPQA 4N6ZA 4NU1A 2QO2A 5EYDA 3AC3A 5EM6A 4JT3A 2WTKB 3ZU7A 2X2MA 4ID7A 5I9YA 2GS6A 3O71A 4LRKA 2CKPA 3ZM4A 1HCKA 4J95A 2R3IA 4ZSJA 3CJFA 5CF6A 3NIEA 2BDFA 4GJ2A 4FUXA 4O7RA 1J91A 2GPHA 5E91A 2XIKA 3AC5A 5EYMA 4JG7A 4UV0A 4H3QA 3CE3A 3LXNA 4II5A 2J51A 1RW8A 3IOPA 2X9FA 3EKKA 5HQ0A 4IXPA 4U43A 1YI4A 3A2CA 2ZV9A 3IW7A 2I6LA 3NEWA 2IVSA 4PTEA 1YHWA 2UVYA 3E92A 2OBJA 3EZRA 1MP8A 3R1QA 4BYJA 4CFUA 4EEVA 3JXWA 2IZUA 3FXZA 2XF0A 3G5DA 3F66A 3BLHA 3R73A 3SRVA 3QWJA 4FTOA 2VWVA 2VWZA 1NW1A 2PMLX 4F64A 5F20A 5TKDA 1OPLA 3I6UA 2QU5A 3NW6A 4CKJA 3HAVA 4WBOA 1UU7A 3A7HA 4NM5A 2BAKA 3QTWA 3BQCA 4L3JA 3V5QA 2VX1A 4MXCA 4A4OA 4EH5A 5ETFA 3Q9ZA 4NSTA 5CWZA 2RFSA 5EHOA 4HVIA 4A07A 3RK9A 5JGAA 3E5AA 4UYAA 1UV5A 4I21A 3RINA 3RJCA 3HA8A 3MIAA 2QO9A 5M07A 4NFNA 3FJQE 3RP9A 4EYJA 3U4WA 3UODA 3M2WA 2GHLA 4WD5A 4O0WA 4ZLZA 4D1ZA 4ANOA 1OKWA 4O0SA 5HBEA 5HZNA 3UZPA 1GZNA 1JKTA 4N6YA 4BDIA 4DITA 3QYZA 2YISA 4RBLA 2GCDA 2CN5A 2YJRA 1U46A 3O7LD 3DFCB 3ZSHA 2CJMA 3SW7A 3GUBA 4W4VA 2BILB 3IW5A 4QTDA 4CFMA 4EH6A 3F7ZA 3I0OA 1SNUA 4O96A 3MH2A 3JVSA 2UZUE 3MY1A 1Q62A 4WIHA 3ZUVA 3OT8A 5K0KA 3NWWA 3ATTA 2GNHA 3DXNA 3O50A 2PZYA 2PUIA 2E2BA 2ITYA 3LCTA 4FSTA 4XJ0A 1BKXA 5L2QA 4ALVA 2BHHA 2DWBA 3HV4A 4YGAA 4JDHA 3IGOA 3HRFA 4EJNA 3QTSA 1YHVA 4AGWA 3OG7A 2JKMA 4TWCA 2BRNA 3L9MA 4D28A 4DG2E 4JBQA 4FI1A 4GRBA 1BI8A 5FG8A 2UW5A 1OIQA 2ITZA 3HL7A 1K9AA 3TZ8A 3CQUA 4FV1A 4P2KA 3DFAA 3CD3A 5ANOA 2CNUA 3HDNA 2Y4PA 2Y7JA 3L9PA 3QUDA 4JVGA 3HMIA 5FM2A 3TKIA 4XS2A 5AP5A 4FSWA 2IVTA 2ONLC 4YPDA 4AE9A 5JSMA 2QHNA 3R30A 3W2QA 1RQQA 2YLFA 3ALOA 4RFYA 3MPTA 3P7BA 3VHEA 4C38A 4EK5A 3HVCA 2Y6OA 4CKRA 3UG1A 3RK5A 2HIWA 3FXXA 4NCTA 4CG8A 4N0SA 4QPMA 2X2KA 1YKRA 4F9BA 2UW6A 2ZAZA 4FOBA 4PV0A 5HE3A 3FLNC 4BKYA 4EK4A 5AP0A 1UU9A 3NSZA 3QKMA 3F3TA 3FQHA 4XRLA 4DFUA 3BKBA 4RIWB 4WG5A 1Q5KA 2YWPA 5B7VA 3V5WA 1ZYJA 4AG8A 4YJTA 5AP6A 3UYSA 5H8GA 1ZYDA 4ALWA 4DGLC 2P3GX 5J95A 2WAJA 4XV3A 1MUOA 2RKUA 2BDJA 3KVXA 4S33A 5DWRA 5DVRA 4QP7A 5HO6A 4E93A 4IZYA 4BGHA 5EFQA 4FKPA 5LWMA 4IDVA 5GJGA 3R7VA 3DAKA 4QP2A 4DCEA 1P2AA 4E4MA 4RIYA 3ZSIA 4XH6A 3RWQA 1K3AA 4M15A 4P4CA 3V5TA 5DRBA 5HLPA 1PRYA 3Q9XA 5M08A 3DJ6A 1FVVA 2WEIA 4OTPA 3SQQA 2VWWA 3D2IA 5IZFA 4DGGA 5GZ8A 1MRUA 4BFMA 4D0WA 3D94A 4FMQA 4GIIA 4IFCA 4LMUA 3QTUA 4QMPA 5J79A 5CSVA 4ZS0A 2XNBA 5LMKC 2F2CB 4KRCA 4G3FA 4QMOA 5CU2A 3EJ1A 3LLTA 4L42A 4AW5A 5HCZA 4GT5A 4H1MA 5CI6A 4JIAA 3Q3BA 2XBAA 2RSVA 3Q5IA 5EW3A 2PUPA 2C3JA 3JVRA 4UWBA 1CM8A 4ZTRA 3SX9A 4AGCA 2F7ZE 4KABA 2PK9A 2H9VA 3OHTA 2WMAA 4KINA 4C4FA 1J7LA 4C4IA 2J6MA 3TNHA 4PDYA 3Q53A 4V05A 3DZQA 2NP8A 4B8MA 2BRGA 4XOYA 4IIRA 3FI3A 4PPCA 4X6QC 2DUVA 4NWMA 4TKSA 3MSSA 2VWYA 4FTTA 2B53A 5I9UA 4EC9A 5HTCA 5IQBA 5LMKA 3OF0A 2ZMDA 5EDQA 4QQTA 4AS0A 2IWIA 3LKMA 4L52A 5BYLA 2XIXA 4Y46A 1OUKA 4FEXA 3CCNA 3HNGA 3EQHA 1XBCA 3PE1A 4FSNA 2UW8A 3WZKA 4FT9A 4YNEA 3PG3A 4FL2A 4BB4A 2HELA 4PDSA 2J0IA 5ICPA 4IB0A 1XBAA 4OT5A 3QU0A 2H96A 2HENA 4IB3A 4WRGA 4C0TA 4NW5A 4BICA 4A9YA 5M09A 3IS5A 4L3PA 2JLDA 3SD0A 4AFJA 3QA8A 3PSBA 1OI9A 1W84A 3OP5A 3QC4A 2JDSA 1IRKA 4P5ZA 1U5RA 3RAHA 4QMXA 2UZTA 4K2RA 5A54A 5JGBA 5AFVA 5CZHA 4FV6A 2B55A 3RNYA 2WD1A 2W1EA 4JR3A 4UMTA 5CSXA 4G9RA 4QMSA 4LGDA 3PIYA 4KIPA 3W2CA 4FG7A 2WHBA 4D2TA 5KHWA 1ZZ2A 1RDQE 2YIWA 3A61A 4JDKA 1JAMA 4I3ZA 3S4QA 2W1CA 3TEIA 2X39A 3H4JA 5HBJA 4XV9A 4U8ZA 4KIKA 4HVSA 4XG3A 5CEMA 2RFEA 1GIJA 5JGDA 5EDRA 4FTMA 5J9LA 5IUGA 3FYKX 1WBNA 3MFSA 3SGCA 5IU2A 4WUNA 5KX8A 1LEWA 3FZ1A 2OH0E 3PA5A 4F0GA 3A7GA 3KULA 3G2FA 3VVHA 3QQUA 3OZ6A 1XKKA 4G3CA 1YW2A 2GDOA 2IJMA 4FV9A 5GHVA 5AAEA 3M1SA 4OUCA 5AV4A 3VAPA 3QD3A 4EZ3A 3FLYA 1U4DA 3E62A 3FKNA 3W33A 2BMCA 4PDOA 3V51A 2GHGA 5GJDA 2QR8A 3K5UA 4HYIA 3A62A 2C6IA 4NTTA 4BWKA 4O7LA 3REPA 2Y8OA 2J5EA 4XV1A 2C5OA 3BBTB 1SYKA
chains in the Genus database with same CATH superfamily
3DJ7A 3K54A 4IADA 4R7HA 2XVDA 1PMEA 5DNRA 5FP6A 3VBTA 5HO7A 3R1NA 2BIKB 2W1DA 2QD9A 3BHYA 4A06A 3LQ5A 4FKWA 2XARA 2IW8A 4FTLA 4HVGA 4XV2A 5KZ0A 2C3IB 2RL5A 4QYEA 2ZM1A 1ERKA 3F5PA 3VW6A 1ZYSA 2JEDA 3MVLA 3EKNA 1SNXA 3PTGA 3QFVA 4Z16A 3FL5A 3LZBA 2GNIA 4F6SA 1XH4A 4RJ4A 3FQSA 3OXZA 5J5TA 3SLSA 3B8RA 4CFFA 4O7NA 1OITA 3NAYA 2R9SA 3AT2A 5AR5A 4IZAA 2R7BA 1TKIA 2PU8A 3LFEA 1M2QA 4IAAA 4IM3A 1YVJA 4M84A 4WRSA 4ZIMA 4CRLA 4D0XA 4M3QA 5EM8A 4D58A 5E8UA 3I60A 4KSQA 4XP0A 1NVQA 3C13A 3OROA 3UOLA 1V0BA 2QQ7A 3LIJA 3R28A 1ZY4A 2C3LA 1HOWA 1U59A 2C0IA 4BIBA 3O8TA 1W0XC 5ACKA 4RFMA 4MUQA 4EOOA 3EQCA 3RPOA 2GQRA 1GIIA 1OBDA 4FGRA 4GFGA 3ZYAA 1JKLA 2WFYA 2X1NA 1W8CA 2B52A 4BCIA 3WILA 2XJ2A 4Z55A 3LCKA 4I0SA 5T3QA 5JEBA 3KY2A 4Y85A 5T6KA 1OL5A 2BIYA 5I4NA 3KXHA 4IAKA 4JXFA 4MWIA 4EONA 1W2CA 4FKIA 5IISA 4CT1A 2XK6A 1OM1A 3SOCA 4HGTA 3DBFA 3CTJA 4LGHA 3A8WA 3AOXA 4TZRA 5BVNA 2PSQA 2GFCA 3N51A 1L8TA 5C8KA 3WARA 3NNVA 2OJIA 4KIKB 5AR8A 3C0IA 1XMLA 3BRBA 3LFQA 3A4OX 4FZ7A 4IAYA 2O64A 4XP3A 4U6RA 5TE0A 4YHFA 4KBKA 5AUWA 4WNPA 1LR4A 2W9FB 1UNHA 4P7EA 1G8KA 1NY3A 4I5MA 4E7WA 3LFNA 3VS7A 2YWVA 1YHSA 4RC2A 3NDMA 1KOBA 2V5QA 2VZ6A 3EL8A 3TNIA 4D2VA 4U5JA 4FEWA 2IG7A 3AGMA 1YQJA 3CGFA 4GT4A 3I0QA 2JFLA 2XB7A 3Q4TA 4K8AA 5A46A 3QTIA 5GINE 3E8DA 4HOKA 3PXFA 1IASA 4Q9SA 1OPJA 4BKJA 4I92A 2DS1A 2XKCA 3LLAA 4FT3A 2XCHA 3QKKA 3PVUA 2EVAA 4JQ8A 4MBLA 1T46A 2YM4A 4FVQA 1OVEA 2HYYA 4ALUA 4E4NA 5M4UA 3R9RA 1ZYCA 4CVAA 4MXOA 2A1AB 2JKOA 4X3FC 2BTRA 3LJ0A 3NYVA 5IA3A 1KUTA 4OBQA 5HE0A 3KIOC 3CPBA 2OLCA 3JYAA 1WFCA 5FXQA 3F3ZA 2PMNX 1QPJA 4X2FA 4EL9A 3LQ8A 1KV1A 3TDVA 3PY1A 2IVVA 5CY3A 1YI3A 3MH3A 3W8QA 4YTHA 5HE2A 3W2SA 1VYWA 3GOKA 3FQEA 1Q8YA 2QOHA 3I5ZA 2VTIA 1RJBA 3U87A 5B2MA 3Q4CA 2GNGA 1IAHA 4YJOA 2WQBA 5BVDA 2B7AA 4FTUA 2QONA 2OSCA 4J8NA 2FO0A 5BUIA 4Q9ZA 5KCVA 2FYSA 5CNOA 4QQCA 4FEUA 4EI4A 3BGPA 3E8EA 5M4IA 3IPHA 4X3FA 3R04A 5LCJA 4DFBA 3ML1A 3D83A 3THBA 4QTBA 4GYIA 1ZMUA 3MFRA 4ZTHA 4EK6A 4J7BA 4KSPA 4B9DA 4O83A 1PHKA 1JQHA 4RMZA 4MBJA 4AFEA 2O0UA 4HCTA 5D10A 3CY2A 1QPEA 3HP5A 5CX9A 3RPYA 4XBUA 4L44A 4FBXA 3TT0A 3ULIA 5HI2A 5KMIA 3GNIB 4IWQA 5CF5A 3P78A 3TV4A 4ZY5A 1Q8WA 4G2FA 5CU3A 3RPVA 3D5XA 4YO4A 4Z7GA 3N4VA 3R7UA 3W32A 1CMKE 4XUFA 1HCLA 3PP1A 3OCBA 4UWCA 5DFPA 5AA9A 2HZ0A 2YIQA 4GVJA 5H3QA 2X7FA 2ZV2A 4CSVA 2QCSA 4USEA 3O96A 1YXXA 3MFUA 2QO7A 3PYYA 4I0RA 4RZWA 4XG8A 1CTPE 4GYGA 1R3CA 4IH8A 3MTLA 4DH8A 5IEXA 3TUBA 3UO4A 1W83A 2IZRA 4ZTQA 4DHIB 5CAUA 5C9CA 5K4JA 3CKWA 1Q41A 4BJJB 4OTQA 2WTVA 3AD5A 3MYGA 4C59A 4U97A 3UOJA 3IGGA 4FZFB 3OY1A 4F1OA 5IPJA 2YCQA 3FMDA 2R3HA 3BX5A 1FINA 3F6XA 4BDEA 1WBVA 4HCUA 4YO6A 4CD0A 2Q0NA 5BPYA 5M4FA 2JDRA 3OTVA 3EYHA 3RVGA 2ZV8A 4I6HA 2VTTA 3FSKA 3PA3A 5LOHA 3ELJA 2AQXA 2UZEA 4CZTA 3ZBFA 4A9RA 4ASZA 2H6DA 2XKFA 1KV2A 4OTWA 5L3AA 1G8AA 2YIXA 4D5HA 2QLQA 2JIUA 5AUVA 3W0SA 3PVWA 2VWIA 2W1FA 3ZFMA 4ACDA 3BL7A 3PG1A 5CVHA 5DN3A 4BI0A 3FLSA 3PUPA 2IW6A 5EHLA 4BY9E 4YTIA 5ITAA 4R77A 4U0IA 4FT0A 3ORNA 4O4CA 5CVGA 3RTPA 5J1VA 3VF9A 4AA4A 1I44A 2UVZA 3P7CA 3LJ2A 3NVKI 3L8XA 4DEHA 3T3VA 2EUFB 4OR5A 5I3OA 5CENA 3U4UA 4YZBA 3SKCA 3HAMA 2VTMA 3FUPA 5HIDA 1SMHA 5ANGA 5CAOA 2IVUA 4CQEA 4G9CA 3CS9A 5AV3A 4BTMA 1BLXA 3O8UA 4O0VA 5JQ8A 2WU6A 4BCOA 5JMSA 5FTOA 2OIQA 3HLLA 2GNLA 2ITTA 3RALA 1AGWA 1WVXA 2J0JA 3PPZA 2EWAA 3DT1A 3ZDUA 4IANA 4BZNA 4RFZA 5HX6A 4DBXA 1M2RA 1WBSA 5LWNA 3DLSA 2X7OA 4YHTA 2ZYBA 5DGZA 3U6JA 3HV5A 1OMWA 3G9LX 3QXPA 3CPCA 5AV1A 5TF9A 4EC8A 5E8VA 5DT4A 3C51A 5D11A 4IAIA 4F65A 1ZOEA 3KEXA 4U44A 4P90A 2A4LA 5JRQA 3VULA 4R1VA 3C0GA 3UVPA 3VS0A 4J98A 4NCTC 2W05A 4QTEA 4FYNA 1WBWA 3D9VA 5KHXA 3QYWA 5A14A 4G6NA 4L45A 4IWDA 4LDTA 1GZKA 3E93A 4NW6A 4RQVA 2ESMA 4FSYA 4TWOA 5KO1A 3JY0A 3UMWA 1JNKA 2YCRA 4FRFA 4BDAA 3EQBA 2VV9A 2BALA 3RWPA 3UC4A 4L8MA 2BTSA 2B9IA 2OZAB 4O4FA 2WNTA 4FKOA 2VX0A 4IX5A 5BVEA 2X4ZA 3F2RA 3PWDA 4R78A 3WF9A 4FG9A 2HK5A 5CS6A 4DYMA 4GK3A 4ITHA 5IDPA 1KE9A 3OW3A 3SOAA 1W2FA 3ORXA 4FKRA 1OUYA 4C4HA 5IUIA 4F08A 3QRKA 2OZAA 5CF4A 4D2SA 4CT2A 2WQNA 1PMUA 3ZLWA 4UN0C 1YWNA 4AAYA 3L8PA 4GT3A 1ZAOA 4EK8A 1MQBA 2FSTX 2ERZE 2HZIA 3KF4A 3QF9A 4QEBA 1YI6A 4YUQA 3UDBA 3C4WA 3FAAA 1ATPE 3GU5A 4F9YA 3TKHA 5DR9A 1MRVA 4D2WA 4DN5A 4FSZA 1T45A 4C57A 3NCGA 2C69A 4HPTE 4L01A 2ZDTA 3MPMA 3UVQA 4D9TA 4MXYA 4YHJA 3F3VA 3N9XA 4QOXA 2XK3A 3MA6A 4O0XA 4CLJA 2WTWA 1WBTA 1E1XA 3ACJA 1REJA 2ZV7A 3ZRMA 3W8LA 2W1ZA 2GU8A 3PXYA 2PVHA 4RIXA 1SVEA 1PF8A 1M7QA 1XH7A 5FDXA 1PXIA 4L00A 3OWPA 3P7AA 5IMEA 2XK4A 3D5VA 3QA0A 1NVRA 3QWKA 4FSMA 5HX8A 2OFVA 3NW5A 2WQOA 3QHWA 4EWQA 5CEPA 4RJ3A 2W0JA 3GEQA 4QT1A 4X3FB 4IE9A 3R83A 4O1PA 3SHEA 3ORKA 4PP9A 4NT4A 2W4OA 2HW7A 3MDYA 5DBXA 3UNZA 4EQUA 4EH9A 2ITPA 3GVUA 3QD2B 3WZJA 4FF8A 2VGOA 2CGWA 3EIDA 4E3CA 4KAOA 1FBNA 4DAWA 3PVBA 2VTLA 3NS9A 3ZFXA 4EHVA 1TFFA 2XM8A 5A4TA 4ZSEA 1FGKA 3ANQA 2I0HA 2W4KA 3CJGA 4E26A 5JFWA 2NNWB 2X81A 4FVPA 3QL8A 4QYGA 4CXAA 4ERKA 1NXKA 3TTIA 3MIYA 2YACA 4C3RA 4YZ9A 4IC7A 5DI1A 2G15A 3ROCA 4DEIA 1SZMA 4M67A 3VS1A 3E7VA 4RVLA 2JBOA 3NUUA 3VBYA 2X8EA 5FUTA 3CKXA 4MTAA 5C26A 3K3IA 4AT4A 5FGKA 4L53A 4S32A 2WQMA 1H1WA 2X6DA 3FMLA 3RPSA 4ANLA 2JAMA 3UE4A 4YR8A 4W4XA 4ZTMA 3MB6A 4XOZA 5IA0A 2W7XA 3TN8A 2W17A 2G2HA 3QQJA 3VRZA 2B1PA 3D5UA 1IEPA 1Z57A 2O63A 3FZSA 2QI8A 4FV8A 3GC9A 3NLBA 4FK6A 4ZSGA 3TCPA 5LXMA 1R1WA 2R3KA 4FYOA 2QNJA 4QPAA 3VNTA 3SXFA 3LCDA 2VRXA 4JS8A 1BUHA 5AM6A 5M4CA 3VBQA 3VQUA 4E4LA 1NVSA 4LOPA 5ANEA 4FT5A 3IW4A 1Q61A 2OU7A 4FKGA 4DT9A 2GFSA 4FK3A 3O7LB 2BPMA 3GB2A 1OECA 4M0ZA 5LVLA 2X4FA 4Y5QA 5J5SA 4BIDA 5E4HA 2C47A 4D5KA 5E8SA 3U6HA 4FZ6A 3QXOA 3D14A 4Z3VA 5LARA 5IQCA 3O17A 4KIOA 2CGXA 5AP1A 2YFXA 1UA2A 4I0TA 2FUMA 4PL3A 3EN7A 3VBVA 3MFTA 1H1RA 4ZTLA 4F7SA 3ODYX 3Q2MA 4JIKA 4YJPA 2NYAA 4RX9A 3CEKA 3G9NA 4NH1A 4UBAA 4BCJA 4BYIA 4I4EA 3PXRA 3VUIA 3DBCA 4ACCA 2VTNA 3VWAA 4AGDA 5KUPA 1DM2A 3ZTXA 4PTCA 4R6VA 4AE6A 4X3JA 4Z9LA 2YIRA 3R7OA 4R5YA 2PMIA 3PY0A 4I24A 1J1CA 3QTZA 5HD7A 4HCVA 2CMWA 5I9WA 2UW0A 3PWYA 3QCQA 4YPSA 4YBJA 4C58A 3F5UA 4TYEA 5ETCA 1VZOA 4MWHA 4EOIA 1GJOA 1KWPA 3N4TA 4JX7A 2ITUA 4OTDA 2BZJA 4NM3A 2PE2A 3TKUA 2GTNA 4ZZNA 4OT6A 3MBLA 2E9VA 2OZOA 5CU4A 5E1SA 2QOIA 2R3FA 2YITA 4M8TA 1DAWA 2R3PA 4FKSA 5AV2A 4WA9A 3Q6WA 5IA5A 2OXYA 2Z60A 3V5LA 2W96B 2VTRA 3LFFA 1WBOA 4BKZA 1Y6BA 4NJDA 4YTCA 5AIRA 4DEAA 1APME 2Y0AA 2XKEA 5D12A 2Z7LA 1Y8GA 3MVHA 5AUXA 4QDEA 1X8BA 4TXCA 3ZSGA 3IOKA 1OL1A 5EI6A 2OG8A 3IDCA 5C27A 1YXVA 3FPQA 4D4SA 4DFXE 3DBEA 3BU5A 4H1JA 1IA8A 4KBCA 1GZOA 3SDJA 3CD8A 2OI4X 3NVMB 3WZUA 2JDVA 2FSOX 4FIHA 3RBWA 2AC3A 3GFEA 4YMJA 3W18A 4X2GA 2YM7A 3ACKA 3H0YA 1IR3A 1XBBA 1OL6A 4E20A 3H10A 2PVJA 4E1ZA 2YDIA 4KB8A 4QMNA 2ITXA 3P0MA 3JR1A 2HZNA 2PE1A 3ZFYA 5CAPA 5IG1A 4RA4A 3S95A 3FKLA 4EH2A 3GP0A 5CANA 5AP7A 3MV5A 3EWHA 4AN2A 3HV7A 2XAOA 3FEGA 4GL9A 3DB8A 2P4IA 4N4SA 1PY5A 5HNBA 5TOZA 2YABA 1PYEA 4Y73A 4WSQA 3R9DA 2A27A 1UVRA 3HMPA 4EKKA 2Q83A 2ZJWA 3KC3A 5LJJA 2QG5A 2W4JA 3ZLXA 4DBNA 4AXCA 2PY3A 1BMKA 3FKOA 1AQ1A 4LRMA 2CNVA 2O2UA 3EHAA 3ZRKA 2X8DA 3GT8A 5E8WA 3UNKA 5L6PA 4AXFA 5CEIA 1YWVA 4BCHA 3Q96A 4IVDA 1FMOE 1XJDA 3HA6A 5AP2A 2J0MB 4OTGA 5DG5A 4ZJJA 4ZP5A 3QX4A 3DBDA 4FIIA 3R8UA 1B39A 2CLQA 3UTOA 4C2VA 4EJ7A 3G33A 3BCEA 4EZ7A 2AYPA 2Y4IB 4V01A 2WQEA 4JX3A 4E5AX 3KA0A 4IB1A 5EQEA 4TN6A 4DC2A 3FLWA 4F9CA 4ZOGA 5DR6A 5JFXA 4D1XA 4DA5A 1GAGA 2OF4A 5CT7A 4ZK5A 1M2PA 2XK7A 3IW8A 2PTKA 2YERA 4MXZA 3T9IA 1TVOA 3BU6A 4UMPA 3O0GA 5D7VA 4BDJA 4NL0A 4PY1A 5L6OA 5D9HA 5C8NA 5KNJA 1Q3WA 3OC1A 5LCKA 4TYHA 3BYUA 5CEQA 3RCJA 4D55A 4B7TA 5BUJA 5IH6A 1WVWA 2GNJA 3AC4A 4M69A 3R71A 3TV7A 1L3RE 1G8SA 3CTHA 3ZONA 4R8QA 4M7IA 4QYFA 3V6RA 2UZBA 3F82A 4E5WA 3T3UA 4APCA 2C68A 4WUAA 4EH7A 3HGKA 4ITIA 4WT6A 3GC8A 4AAAA 5HIBA 4YLLA 5FWKK 4TYHB 4XX9A 2PWLA 2FSLX 4U45A 5HOAA 2PZIA 3TZ7A 3OWKA 3UOHA 3UO6A 4IVBA 4DFLA 2VNYA 4RX7A 3R8PA 3BYVA 3LJ1A 3UQFA 2NRUA 2YN8A 1WCCA 4ACHA 4IX4A 2QOOA 5GZAA 5DEWA 4G5JA 5IQIA 2O3PA 2X9EA 2A98A 1H07A 4QP4A 1CDKA 1PXPA 3QZIA 5ETIA 4X21A 2OF2A 4M13A 3ZOSA 1JPAA 2I0VA 3LE6A 1WMKA 4BHZA 2WMUA 4PMSA 5CQWA 3DJ5A 3EQIA 1Z5MA 3L8VA 2BROA 3PJ1A 3UNJA 3EFJA 5EM5A 3ID6C 4KIQA 1JSUA 1KOAA 3OWLA 3IG7A 4BN1A 5IQFA 2PVMA 2R7IA 3EOCA 2B9JA 4PMMA 3LCOA 3W0NA 4X2KA 3U6IA 4FL1A 5M44A 3W0RA 3PPKA 5CQUA 3MTFA 3SAYA 2C5XA 3LHJA 4O84A 4EUUA 4TYJA 5H2UA 4H36A 4O7VA 4DHZA 3VF8A 4OTRA 3EQGA 3V8TA 2R4BA 3MN3A 2JDOA 3II5A 5IDNA 2XNMA 4HW7A 3KRWA 4DFZE 2QG7A 4DH3A 2XH5A 3V8WA 3TL8A 3FXWA 2OO8X 2BZIB 4HZRA 4XG6A 3ZHPC 5DRDA 2G9XA 4QP3A 4DGMA 5CASA 4MXAA 3A7JA 4KA3A 5IMXA 3EQDA 3ZUTA 3QCYA 3BLAA 2XJ0A 3ORTA 4RGJA 2CLXA 3BV3A 3R21A 4GCJA 5F9EA 1J7UA 2R2PA 4BBMA 4FKUA 3QCSA 4TYIA 2VNWA 3W55A 4IJPA 2CKQA 3Q52A 3DBQA 4WKQA 3NZ0A 3HKOA 3NUSA 4C34A 2PL0A 4CYIA 2F4JA 2GNFA 2QHMA 3RZFA 1XMMA 1PXLA 3ZXZA 4NKSA 4IX3A 4BDGA 3OBGA 2YA9A 4PQNA 4LGGA 3PIZA 3RZBA 2PUNA 2VWBA 4XLVA 3MJ2A 2HOGA 3DPKA 4CGAA 3WI6A 5LQFA 5KKRB 4YJNA 3SA0A 5BYYA 3WIGA 2UW4A 3TNPC 4GU6A 1ZMWA 2QOKA 3DK6A 3C4CA 5FXSA 2GQGA 4DEDA 5BQ0A 4GFMA 3TG1A 4AUAA 3KRXA 4C3FA 4DLIA 4PMPA 5BUEA 1H24A 4RPVA 1OGUA 3R2YA 1W82A 5K5NA 3NYXA 3OWJA 1R0PA 3I7BA 2IF8A 4BDBA 4PL4A 3OOMA 5EKOA 5BNJA 4RIOA 4L3LA 1B38A 3R7IA 1XHAA 2QC6A 4BBEA 2UW9A 4AZVA 4YURA 4EOPA 2XRWA 4DF3A 3DXPA 4FKLA 2WMTA 1GIHA 2H8HA 4Y95A 3R1YA 5HO8A 2R0IA 4G31A 2YM8A 2G2IA 3GOPA 3OVVA 4OW8A 5HU9A 4LQMA 3R00A 4Q5EA 4AA5A 2WMRA 3GQLA 3POOA 4M14A 1UU3A 4DFNA 1XH5A 5JQ5A 3IQ7A 2YM5A 3UOKA 5KMMA 4XHKB 2B0QA 4YZCA 2IEWA 3Q6UA 3PXKA 3PLSA 3UVRA 4FR4A 3C5IA 1YXSA 4A4LA 4ZXTA 5FRIA 3A60A 3QUPA 1BI7A 4YJVA 2ZFYA 4FNZA 5C4KA 2WIPA 3PY3A 3DK3A 4BTJA 4DH1A 3VUTA 3AXWA 3ZEWA 4QQ5A 2JITA 1OZ1A 3SV0A 4M68A 3FMNA 4J52A 5KMLA 5FTGA 4UZHA 5AP3A 1PJKA 2OFUA 2F49A 3QCXA 4G3DA 1FGIA 4UMUA 4L68A 3OEFX 3FSFA 2WZJA 1PXNA 4IWPA 2LGCA 5E8ZA 2OKRA 4GW8A 4NM0A 3WF8A 5D41A 1BL6A 2BKZA 4O6EA 4BI1A 2XMYA 3R02A 1LP4A 3D0EA 3LMIA 3VBWA 3ZZEA 1Y57A 2SRCA 4K77A 5AV0A 5HNIX 3GCUA 3L9NA 3OCSA 2IPXA 3AKLA 1VJYA 1ZZLA 2F57A 4HYSA 3KL8A 4C4GA 5IQDA 5HHWA 3D7TB 3FC1X 5HG9A 4ACMA 4O86A 3R7EA 3VONA 2Z7SA 1P14A 1LPUA 3B2WA 4MX9A 4O22A 4XG9A 4UYNA 4BCKA 3CXWA 2ETKA 3QUEA 4UXLA 5ANIA 4ZSLA 5M06A 3EN6A 4USDA 4J53A 3LM0A 1OGYA 3BBWA 3I81A 5TO8A 4BZOA 2Y4IC 4O4EA 4DHJA 3TNWA 2EXCX 1XO2B 2RG5A 2WMSA 2BFXA 1G5SA 3FZOA 4I1ZA 3EN4A 1OL7A 2Y9QA 5GNKA 4DH7A 2BVAA 2ITNA 2QVSE 4LOOA 4M69B 4FNXA 3R6XA 4GMYA 4QD6A 3ET7A 4UEUA 4ZTNA 4AXAA 4BCPA 1Q99A 3KQ7A 3VO3A 4F1TA 3FWQA 2OH4A 2X0QA 1IAJA 4R5SA 3A4PA 5HVYA 4ARKA 1MQ4A 3MWUA 4AF3A 2BRMA 4JOAA 2ZM4A 4M0YA 1JVPP 4FTQA 3H3CA 4ZY4A 1TQMA 3LOKA 4JNWA 4QMVA 2C1BA 4X0MA 3VBXA 4NEUA 5JFSA 3ORLA 1SM2A 4FKTA 2XK9A 2VGPA 5AR3A 4E5BA 5FBNC 3PE2A 5EG3A 3ZO3A 5AX3A 2C6OA 3WF5A 4KRDA 4WBBB 4JDIA 5JZNA 2PVNA 2R3MA 2XS0A 2C6KA 3BEGA 2I0EA 3QHRA 4MYGA 5CYIA 3BHUA 4PRJA 4F7LA 2NO3A 2C5YA 4UZDA 3RHKA 3IKAA 1U54B 2P55A 3DDPA 1MRYA 4QMYA 4E6AA 3QTQA 5GJFA 4TTHB 2B54A 3UC3A 3TUDA 3AQVA 4QMMA 2Z7QA 1PXOA 5HD4A 4M66A 5AUZA 5G1XA 4Q2AA 1ZXEA 5FDPA 2C6LA 3DNEA 4RC3A 3CC6A 3BI6A 3NUXA 4H3PA 3UP2A 3W2RA 3W2PA 2XANA 1YOMA 5AWMA 3ATSA 3OXIA 3KN6A 3PP0A 4PNKA 4BCQA 3KN5A 3HUBA 3AC8A 5HLWA 1BL7A 5E7RA 2FSMX 2HZ4A 4AW1A 4CNHA 4EORA 4P5QA 5LVPA 3BWJA 3E87A 4BTKA 4D4RA 5I3RA 5FXRA 4KKEA 4GV1A 3GU4A 3LFSA 4ZJIA 5A4CA 5D7AA 1H08A 4BC6A 2Z7RA 3OT3A 4EOLA 2OW3A 1UWHA 4HVDA 3V6SA 4G3GA 4W8EA 4YBKA 4L7FA 5E1EA 5GZ9A 2Q0BA 4ZSAA 2V62A 2PVFA 3AGLA 4FKVA 4F99A 5B0XA 4BBFA 3DOGA 2VTQA 3CQWA 4NIFA 3O23A 3BHHA 4PNIA 5TT7A 5L8KA 4YC3A 5K3YA 3TI1A 1DI9A 3ZBXA 2ITOA 2BHEA 3POZA 4GK4A 2WMWA 1QPDA 3V8SA 4EZ5A 1J7IA 5AIKA 3RNIA 3A99A 4ZY6A 2A19B 3QRJA 1YXUA 4NUSA 4R3PA 4QRCA 3DTCA 5EOLA 2C6MA 3H9RA 3NYNA 2AUHA 3ZC5A 3R01A 3ZM9A 3FMMA 5DLSA 4F78A 1WAKA 1H25A 2E9UA 3VUMA 3WIKA 3MVJA 3FMKA 3VS5A 3VIDA 4CTBA 1OBGA 4ENYA 3W16A 4A7CA 4PTGA 4UY9A 4JBVA 2BAJA 4LG4A 2BZKB 5CXHA 3O8PA 4HPUE 4ENXA 3AG9A 4YSMA 2CPKE 5H8BA 3KCFA 4XLIA 3VJNA 5LVNA 1H0VA 4MEDA 4O0UA 1NT2A 3UZTA 3MY5A 2XEZA 3COIA 3R8LA 4C62A 2PZ5A 2YZLA 3EQRA 2EB2A 2QKRA 2REIA 4TNDA 2QOFA 2B9FA 1IG1A 3VN9A 2GMXA 3FHRA 4BGGA 4CKIA 1YXTA 3BPRA 3FL4A 3GCSA 4B99A 1W98A 5CU0A 3KXMA 4O82A 3KF7A 2OGVA 3NUPA 2F7EE 4OGRA 3DLZA 1FVRA 2CCIA 4ZTSA 2VO7A 3E8NA 5L2IA 3TTJA 1H4LA 4B0GA 1TQIA 4MNFA 4QP9A 4LL0A 5FP5A 4JMQA 3PXZA 3TMOA 3DU8A 2BAQA 4DFYA 1KSWA 3E7OA 4UB7A 2PMOX 4AACA 2C6TA 3GBZA 2J2IB 3DA6A 3NUNA 3ZEPA 2WMXA 3FZTA 4PX6A 2OJFE 4NKAA 2RIOA 2WMBA 4HGEA 4QQJA 3C50A 5JZJA 5KBRA 3QD4A 3IK3A 5EI8A 3BIZA 2VWUA 3LCSA 1QPCA 4GUEA 5J9ZA 3AKJA 5AMNA 3F3UA 3FZPA 1FQ1B 4AGUA 2V0DA 3G0FA 4RVTA 5CU6A 3PSDA 4C4EA 5HKMA 3L1SA 2O65A 3KMUA 3PPJA 1NA7A 4KWPA 3PUFC 2H34A 4UX9A 4U79A 4S34A 3VHKA 1H8FA 3QGYA 4I5PA 1J1BA 2XYUA 4M12A 1OIYA 3PRFA 4KKHA 3VRYA 3SVVA 4FV7A 4EH8A 4Y83A 4ZLYA 3S1HA 4O4BB 4C35A 5EH0A 2PULA 4J96A 3LXLA 1YDSE 3WE4A 4CEGA 3E8CA 2F9GA 3HMNA 3HEGA 4TW9A 4O1OA 3WF7A 2IZSA 4C61A 3H30A 3MESA 2KULA 5KBQA 1FPUA 1O9UA 4D2PA 2W9ZB 2G2FA 4LRJA 3JY9A 3FC2A 3R7GA 5AUYA 4WNMA 5K0XA 2FH9A 2X0OA 4WO5A 4TY1A 2WGJA 2Z2WA 3OMVA 3FBVA 3PZEA 2JDTA 3COKA 4HVHA 1F3MC 4GG7A 2HW6A 3C4EA 1PYXA 5DYJA 5EQYA 4FA2A 5JRSA 3I7CA 3LFCA 4IM0A 5L2SA 4ONAA 4U42A 3EYGA 3SG9A 3PFYA 3PDTA 4AQCA 5AR2A 5DA3A 3U55A 4E73A 3FMHA 2GHMA 3EQFA 4B8LA 5AJQA 2UW3A 2P2HA 3LXKA 3OUKA 3VS2A 4BJJA 2UV2A 2CSNA 3DKOA 4FIEA 3WZDA 2ZB0A 5AA8A 3KXNA 5E8TA 2WU7A 4RRVA 2PPQA 2IN6A 3RAKA 3FI8A 4JG6A 1QMZA 3ENHA 5HLNA 3TZMA 4Y72A 1U54A 4U7ZA 3VQHA 1A06A 4RLKA 1XH9A 4I6FA 4A9SA 3RM7A 4IM2A 3PJ3A 3ULZA 2R3RA 2JAVA 4ERWA 3LFAA 1JKKA 5JK3A 2W5HA 4RWJA 4DEBA 2VU3A 4RWIA 2GQSA 4U80A 2ERKA 2WKMA 4JBOA 4RQKA 3ZLSA 1JBPE 4L67A 4QP1A 4RZVA 3FY2A 4MF1A 3FZRA 4RLLA 2Z02A 4LI5A 2OIDA 5AR7A 2VX3A 3CLYA 3DKGA 5AR4A 4UMQA 4DEGA 5BVOA 1LUFA 3TZ9A 3GU6A 4G3EA 1OKYA 4APPA 3U54A 4H39A 4IC8A 4AW0A 3QQHA 4Q5HA