3LW0A

Igf-1rk in complex with ligand msc1609119a-1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
292
Chain Sequence
AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Insulin-like growth factor 1 receptor
publication title Allosteric IGF-1R Inhibitors
doi rcsb
source organism Homo sapiens
total genus 93
structure length 292
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lw0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lw0A01
2VO3A 3UOKA 1JSTA 4FZ6A 4LOOA 3N4UA 1H1WA 2RF9A 4RJ8A 3OXIA 1UU8A 4Q5HA 2O0UA 3EQBA 4EZ7A 1P5EA 3Q60A 3LJ0A 2XNMA 1Y8GA 4QTAA 1TKIA 2OZOA 3PXQA 4PF4A 3QD2B 4X2JA 3HAVA 4CKIA 5HNIX 4FSYA 2OJIA 5HORA 2P2HA 5KCVA 2P0CA 4QP4A 2B9JA 3W2SA 5DYJA 3QTIA 5FDPA 3NPCA 5H3QA 2QNJA 4L7FA 2XS0A 4QMSA 2BRNA 4EYJA 1NY3A 3GOKA 3ZZEA 3RP9A 3SKCA 2C47A 3GCVA 4AS0A 3CGOA 1YDRE 4XOZA 3TNQB 1NVQA 4FSQA 2IJMA 2VTAA 3BHVA 5HO7A 4KRCA 4UMRA 3HRFA 4EQCA 3LJ1A 3ODYX 3C5UA 3QKKA 5DGZA 3KXMA 3DA6A 3A2CA 3RPVA 4XG9A 4IJ9A 4USEA 5EHOA 3S0OA 4LG4A 3HV3A 4CCBA 3COMA 4AZWA 5AEPA 4QOXA 1Q3DA 3CBLA 1KV2A 2OU7A 3HMNA 3Q6UA 1JVPP 4BDDA 2E9OA 2ZAZA 2Z02A 3ZO1A 3EIDA 5AR5A 4HYSA 2OFUA 1QPCA 2OSCA 2E2BA 2YABA 2QQ7A 3FMEA 3Q4UA 2HY0A 3IKAA 4RX5A 3EN6A 4YMJA 3VHEA 1ERKA 4LFIA 4C0TA 3PWYA 5IPJA 5L4QA 1XHAA 3C7QA 3QQFA 4FYOA 4I20A 4E73A 2ZV9A 2JD5A 2I0YA 3I1AA 4QMMA 3SA0A 4QQTA 1DAYA 3EQFA 3BYUA 4BFMA 3FLWA 5D9HA 3UP2A 2OJFE 1O9UA 2QOHA 4MD7E 2B1PA 4P4CA 4U3YA 3P78A 2B9FA 4BB4A 4TL0A 4AZSA 4F7JA 3O23A 4OTRA 5E8VA 5BUIA 3OWLA 3QZHA 5EDRA 2JDTA 5B0XA 4AFJA 4F1TA 2G1TA 5FBOA 5IQGA 3AC5A 3QTXA 3H30A 3NEWA 4IE9A 2ZVAA 2X1NA 3CSVA 1Q8WA 4G6OA 5C4KA 3OY3A 2F2CB 3U51A 4F0FA 2BIKB 5I9WA 5K4JA 4YC8A 4IC8A 2QO7A 3HVCA 2VTQA 2W1IA 4A9UA 3W8QA 2Q83A 3F5XA 1SNXA 4X21A 5E8ZA 3JVSA 1JKKA 1H0VA 4O83A 4E6AA 3ZU7A 1UV5A 2OZAB 4I4EA 4RG0A 4U44A 5TKDA 3IDCA 2WTWA 3F82A 4XG4A 3ACJA 1XH5A 3RM7A 3VIDA 3PXKA 5AUTA 3NIEA 3OT3A 4GCJA 4G17A 4GFOA 3UODA 4A9RA 4PL5A 2PMLX 5FEQA 3R04A 1XH7A 4L42A 3LQ3A 4KBAA 4B99A 4CQEA 2A0CX 2GQGA 4RBLA 3FSFA 4I23A 4D2VA 4E5BA 4IZ7A 3BHUA 1FVVA 2J9MA 2GTMA 3W1FA 3UO5A 4LM5A 3RHKA 1H8FA 2B54A 4ZSGA 3ZUVA 5DBXA 2CKQA 4WBOA 3Q32A 1OZ1A 4F64A 4YURA 4ZMEA 5H9BA 3R1YA 1V1KA 3FI3A 4HPTE 4L53A 3EN5A 4JX3A 4F08A 5JMSA 4UMPA 4BKYA 4EWQA 5K5XA 4QP2A 1Q99A 4MCVA 1ZYJA 4NIFB 3FWQA 2J2IB 2GHLA 2PE0A 3DFCB 3QQLA 3WARA 4ENYA 5M55A 4FIJA 1OPLA 3D2IA 3MN3A 2BZHB 3O2MA 4U45A 3LXNA 3P1AA 2KTYA 1LP4A 5A6OA 2VTHA 5CASA 4YJVA 4FIGA 5EHYA 1MRUA 3PVWA 2PE2A 4IDVA 1YOMA 4GV1A 4CG8A 3LM0A 3UIXA 5CSHA 3WF7A 4M3QA 4OW8A 4FV7A 4FTLA 4FTNA 4PPAA 4V0GB 3TUDA 4YPDA 4YTHA 4D4VA 5DNRA 3LLAA 4YZMA 3EFWA 4W8DA 4NL0A 3MY1A 3R7GA 3UO4A 3V5PA 4EOMA 3LJ2A 3QQHA 4G16A 3K5UA 2V7OA 1ZY5A 5HNBA 3BLQA 2W5BA 5AADA 4ASEA 4RQKA 3AD5A 3ZOSA 5JSMA 3LCTA 4J71A 5JT2A 4J95A 4GU6A 3O17A 3MVLA 1OIRA 4IADA 1PXMA 4EHGA 3GC7A 3AGLA 3IW6A 4IW0A 4YC3A 3G5DA 5ETIA 2VTRA 4ZY4A 3NVMB 5LWNA 3D5XA 2ACXA 4JRVA 3H4JA 2YM4A 1DI8A 2OIQA 3R02A 2NRYA 4YZCA 5CWZA 4CG9A 1M2RA 4FTKA 4AGWA 5D10A 2W5AA 5AP6A 3N4VA 3A7FA 4FKWA 4EH2A 4D5KA 4XLVA 4PP9A 3ZYAA 5AJQA 5CLPA 3GQLA 3KRWA 3FMDA 4NM0A 1E1XA 2W4KA 4D2RA 4EKLA 4EC8A 5DWRA 2WFYA 2VTTA 2XH5A 2Y9QA 4DG0E 5B7VA 4F1MA 3TUBA 4EH6A 3ALOA 2WHBA 3V8WA 1R0EA 4K8AA 3WZJA 3PPKA 5HO8A 3TN8A 3KCKA 4YJOA 3WZDA 4HGEA 3MWUA 2XYUA 2DYLA 4DC2A 3NWWA 3A60A 4UEUA 1G8AA 3O7LD 3TT0A 3FHRA 5B2LA 5EM6A 3MVMA 3MESA 3QD3A 4ANMA 5GZ8A 4JQ7A 3IGOA 5HEZA 2VGOA 3QXPA 4PX6A 4FX3A 2WTVA 5C26A 2X4FA 3OP5A 1R1WA 4XCUA 5I5ZA 3FY0A 3IW5A 3UNKA 1U5QA 2PMOX 4H3BA 3CPBA 4BIBA 5KMOA 1OKZA 2HENA 5I9XA 3QHWA 2ITYA 4PMTA 3AQVA 4DFXE 3QD4A 2JBOA 5KZIA 5EM8A 4J99A 3DT1A 3PSDA 5HE2A 5BVDA 4YGAA 2Y4IC 2XIZA 4I6QA 2UW5A 4ZTSA 5EYMA 4DN5A 2PYWA 3FEGA 4BDAA 4FEQA 3D5UA 5AP2A 3FL5A 3WF5A 2JC6A 3KY2A 1U4DA 3ET7A 4IAYA 3NIZA 4O6EA 3UPZA 3HRCA 3MVHA 1ATPE 1OL1A 4FZFB 3QRIA 3D2KA 2O2UA 3C13A 5JZJA 2JKKA 1QPJA 3NCGA 3MH0A 4ZTMA 5HVYA 4NFNA 3HAMA 3R8UA 3NSZA 3CJGA 3AGMA 4Y5HA 4YLKA 3ORIA 5H8BA 3FZPA 5E90A 3RCDA 2PPQA 4BGQA 3ATSA 2B0QA 3CKWA 2GDOA 3LZBA 4W9WA 2QOLA 4MXZA 4DEBA 1WCCA 3IDPA 3PG1A 1A48A 3KB7A 1H25A 3ZO2A 4PY1A 5ANKA 4AGUA 4FTCA 4WOVA 3R7UA 5HU9A 2J0IA 5C8NA 3QWKA 2CGWA 4CRSA 4TN6A 4TYGA 4RWJA 3TACA 4WNPA 5JFVA 2VD5A 2J5FA 5AX9A 3SGCA 4USDA 2GU8A 3EL7A 2VGPA 5L8LA 3RTPA 1J91A 4ZP5A 4L01A 4ZXTA 1G3NA 2GNFA 3JYAA 4PMSA 1PYEA 5GJDA 5HHWA 2IG7A 5ICPA 5DR6A 4D28A 3WZUA 1YHWA 4EJNA 3FKLA 3PJ8A 5DH3A 4EHEA 3BV3A 4K9YA 2Z7SA 5E8XA 3KU2A 3VS4A 2NNWB 4GK3A 4ACHA 3CXWA 4HNFA 4V01A 3AT2A 1W83A 5DHJA 2WEVA 3VS1A 3OWKA 2I0VA 3KVWA 5FDXA 1FMOE 1UKIA 2WU6A 4QPSA 5L2TA 2YDJA 4DFLA 5HBEA 5EG3A 2R3RA 4LL5A 3DGKA 4MVFA 4DBXA 2CMWA 5FGKA 4M84A 2V62A 2P55A 5I9YA 3ORKA 1Y57A 3CKXA 4EOPA 2OKRA 1XH4A 2SRCA 2R0UA 3R8ZA 4TYEA 1YRPA 5JH6A 4UXQA 3PUPA 1UNGA 4KA3A 4NTSA 5TF9A 3UC4A 4J1RA 2ITVA 3LFNA 2WMQA 2JEDA 4RX8A 5JRQA 4FIEA 4FG8A 3TUCA 5DRDA 1H27A 1R0PA 3KN6A 3PFQA 3D15A 4G3CA 3WE8A 1ZAOA 4DCAA 3P7CA 4ZLZA 5L2IA 3HA8A 4FA2A 3C9WA 4L3LA 3I4BA 1PXIA 1XWSA 4DGGA 4ZAUA 3ATTA 3OBJA 2WMBA 3CJFA 3C4XA 4XP0A 4FNWA 4CV8A 4KIKA 2GS6A 3MH1A 4IX6A 5BMSA 4EOQA 4HVSA 3ANQA 3HMIA 4Q2AA 4EOIA 4FSRA 1JPAA 5I3OA 4BKZA 5J7BA 4QYEA 4CFVA 4JG6A 5ETCA 4HVHA 2R0IA 3JS2A 4IAKA 5BYZA 2A2AA 3WE4A 4FKLA 3NNXA 2YIXA 2JKOA 3PXRA 4GK2A 2XA4A 5D41A 2WQNA 2VTPA 2CN8A 3PIZA 5KMMA 4F65A 1SVHA 3KEXA 4C7TA 2UVYA 4AXAA 2JDVA 4S34A 4BYJA 4XV9A 1WBWA 4FYNA 2VWUA 3ZDUA 1PY5A 2RKUA 4FL1A 5DA3A 4DTAA 4CYIA 4F7SA 4QMXA 2CLQA 4YPSA 4BIEA 1GZNA 4YHJA 4HW7A 1UWHA 2IW9A 5FEDA 4YZ9A 4EK5A 3NVKI 2J50A 1U46A 3MGYA 3NUPA 2FVDA 3AMAA 5G6VA 3R22A 3IQ7A 5CSXA 5IQHA 3CLYA 3ZFYA 2KULA 5H8EA 3C5IA 5CQWA 1VYZA 4DF3A 1OGUA 2AC5A 2W1ZA 2XUUA 2YIYA 4WRGA 2PULA 1PXNA 3KK9A 2J51A 4EJ7A 2GNJA 3QQKA 4C4GA 3PJ3A 3C4CA 4NEUA 1LEZA 4FEWA 4W4VA 3RINA 1YI4A 4E4XA 1PXJA 3NMUF 5C03A 1F5QA 1LUFA 3BWJA 2YIWA 3KVXA 3LOKA 4XG2A 3RPYA 5F9EA 4YZNA 4GS6A 2UZVA 3PSCA 3BPRA 4ZJVA 5DMZA 3HZTA 4HCVA 3SW7A 3LFSA 2PVMA 2R3FA 4OBPA 4WNKA 3ORMA 5H2UA 3LHJA 3TL8A 4ORKA 4ALUA 3ZZWA 3UBDA 4AUAA 4I21A 1H1RA 4FT7A 4MXOA 3UQFA 4FV6A 1YXUA 4E5WA 3BBWA 4UN0C 3UNZA 1RJBA 1Q62A 3QGYA 4UMUA 4L44A 1HCLA 4YZDA 1W82A 5KMNA 4JDHA 3DKOA 3FUPA 1Q8UA 3QRJA 4Z9LA 5HU3A 3P7AA 5DOSA 4H05A 2ZV8A 3OW4A 4DH5A 3A4PA 4MF1A 4YO4A 2HXLA 3I0QA 5FEEA 5KBQA 4F9AA 4FBXA 4XV2A 3V6SA 5KHXA 4FR4A 4FT9A 5M51A 5TO8A 2UUEA 2VO7A 4IM3A 4RLKA 4E5AX 3VF9A 3ZUTA 3QAME 4NWMA 4EZ5A 4JVGA 5EKNA 5EQPA 2R64A 2X81A 3BHYA 3F3ZA 4EH7A 2C0TA 3Q3BA 4GU9A 5HNGA 4BHNA 3M11A 4ENXA 4EH5A 1IASA 1YXSA 3NUNA 4WBBB 5CAVA 3BE2A 4EC9A 4LRJA 1GAGA 2JFLA 3CGFA 4L45A 5DPVA 3QCXA 3NUSA 4I92A 5JEBA 3HUCA 1JLUE 3LFCA 5HTBA 4MKCA 4DH8A 5I9VA 2C6LA 3OS3A 3PZEA 4KUJA 4MBLA 2Q0NA 1APME 4M67A 2I6LA 2R4BA 1CSNA 4I6HA 4J53A 5AP3A 5CANA 4O7ZA 4ZSJA 4JBOA 1M7QA 3H0YA 1PF8A 1XO2B 4YZBA 2O63A 3DKCA 4TNBA 5CSWA 3KXNA 2BTSA 3LM5A 4FKRA 4KBKA 3DPKA 5C1QB 2OIBA 4CV9A 3WF9A 4D2PA 2I0EA 1J7LA 3VUTA 4PL4A 5CF8A 4AP7A 2JFMA 1YWVA 5D12A 5A4TA 3RPSA 2YWVA 2BAKA 3DNDA 4OTDA 4HVIA 3U9NA 4HGTA 4TY1A 1L3RE 4X2NA 2ITPA 3DDQA 5ACKA 4MD8E 3EHAA 3QA8A 4WO5A 4XJ0A 4DGNA 4CKJA 4QMZA 5K9IA 3UZTA 4Y8DA 1KOBA 3UIUA 4L67A 4DGLC 3FAAA 4XP2A 3NR9A 4U8ZA 4O0UA 3ULIA 2ERKA 1MQ4A 1R39A 2PU8A 3PVGA 3D5WA 2FO0A 3DBQA 2HXQA 5FP5A 4V04A 4QQCA 4GSBA 4CLIA 5L2QA 4KABA 5LMKC 3O96A 4R3RA 4AW2A 2F57A 3E7OA 2WAJA 2VWIA 4GT5A 2BVAA 4MXYA 5A3XA 4XG7A 3EN7A 4AGCA 2B9IA 1PMVA 2BHHA 4X3FA 4Z7GA 3G2FA 5EYCA 1VZOA 2VTLA 3ZEPA 2XIXA 2XYNA 3R7IA 4Q9ZA 4OLIA 4YC6A 2UW9A 3JY9A 4QT1A 3GFEA 4LOPA 5LJJA 4O7TA 3FKNA 4J96A 3W2CA 1FBNA 2W9ZB 2PTKA 2CPKE 4E4NA 4R7HA 1ZOGA 5DEWA 3PLSA 2I1MA 2XKDA 5LXMA 4D2SA 4O0VA 5IU2A 5JFWA 4AT3A 4IX4A 2JIIA 4CMUA 4LGGA 3OWJA 4CD0A 2X39A 5HCXA 3KMMA 1OBDA 2WMWA 5CSVA 5FBNC 3DAJA 5AM7A 2P2IA 1OL6A 3NUXA 2W9FB 4FMQA 3VWAA 3F5PA 5IF1A 1Q61A 2G9XA 3POOA 4MBJA 2PVFA 2XNBA 1G5SA 2WD1A 3LMIA 3R6XA 1H08A 4JX7A 4DYMA 2VX3A 3PA5A 3ZXZA 4IVBA 4EONA 4TYIA 4S33A 4M97A 1J1BA 3TIYA 3FZOA 3FQEA 3UVPA 4DEEA 2UW3A 3LFBA 2YM3A 4OBQA 4A9YA 2XJ1A 3M2WA 4IAZA 5HIBA 4EK8A 4BDCA 4HOKA 4GJ2A 1OB3A 2XK3A 4IWDA 4F70A 5J7HA 4MNEA 3G9NA 3EZRA 4BTKA 4KIOA 4Z16A 2BCJA 3V6RA 4IB0A 5HX6A 1T46A 3C4ZA 4E6CA 5KKRB 4HCTA 2BIYA 3SRVA 4O7RA 5HVKA 3MB6A 4XLIA 5FRIA 4ARKA 4D2WA 4RZVA 3V5QA 3TNIA 4BDBA 3KRJA 3V5JA 2C3JA 4CZTA 5AUWA 3VBWA 4F7NA 3F7WA 4BHZA 3ENHA 4QTBA 4G5PA 3F5GA 4RVKA 1CTPE 4BDHA 4WIHA 2O8YA 4D9UA 5M06A 4P5QA 4O1PA 4AACA 4CMTA 2HW7A 4FZDB 1M2QA 5CF6A 1XBBA 4D4YA 4AOIA 3VVHA 3W2OA 2XIKA 4EUTA 3JVRA 5M4IA 3NYOA 2PVLA 2W1CA 1CKPA 4FKQA 1LPUA 3I79A 2ZYBA 4G5JA 5CEQA 4BWPA 5IQFA 3QD0A 1WVWA 3BQRA 3QUPA 4DITA 3DFAA 4I5MA 3ZFXA 4QNAA 4Z3VA 5J9LA 2H96A 4DEIA 3JR1A 1OL7A 4H3QA 2V0DA 3DCVA 3U54A 4G3GA 3TZ7A 4YHTA 3ZBXA 4LGDA 5FXSA 4ZMFA 5DT4A 4B9DA 1SM2A 5AUVA 3QF9A 4F63A 3ZTXA 4A07A 5A14A 2XJ0A 3E7VA 1WAKA 2CKEA 3VO3A 3D0EA 3W18A 4U9AA 3FSKA 2YEXA 4IB1A 3UQGA 1IRKA 3MA6A 4IZYA 1FMKA 4O2ZA 5F4NA 2W1FA 4BF2A 3R21A 4W4XA 1Q8YA 1OIQA 2IW6A 4G9CA 5F1ZA 4WNMA 2QG5A 4O7LA 2V22A 3FKOA 3OZ6A 3PJ1A 1ZOHA 4QMYA 2YIQA 3UZRA 4FKVA 4M12A 3V01A 1SMHA 4EBVA 2HAKA 4O7WA 4RWLA 2EXEA 1IA9A 3MPMA 4ANBA 4QP6A 2UZNA 3E88A 3T3UA 3U6HA 3U87A 3W32A 4FTOA 4CXAA 4D0XA 5LOHA 1PRYA 4MHAA 4KAOA 4RJ3A 4FIIA 1Z57A 5EHLA 4C58A 4GIHA 2ETKA 3ROCA 4FZAB 4QMVA 4IX5A 4KINA 1XH6A 1Y91A 4BCFA 4RPVA 2I7QA 2UZLA 3Q9YA 3K3IA 1ZMWA 4LMUA 4NUSA 2HWPA 4P5ZA 3FMJA 4DFYA 2GFSA 2ONLC 3NLBA 2R7BA 4LQMA 1OUKA 3DBEA 2XBJA 1URCA 4YJUA 1NA7A 3D83A 2ZJWA 5CEOA 1VJYA 3HLLA 5HCYA 3QTUA 5C8MA 2FYSA 3LXKA 4JT3A 4YNOA 1PXPA 4JQEA 4B8MA 2IZSA 3MJ1A 4JL9A 3SW4A 3R9NA 3UG2A 3UO6A 1KWPA 4PP7A 1YHSA 2ITOA 3NGAA 4IB5A 4GL9A 1K3AA 3SOAA 3ZLSA 5J9YA 1J7UA 1W84A 1YOLA 2WTDA 2Q0BA 1IG1A 3F3TA 3FQHA 3GT8A 5AUYA 1J7IA 3NS9A 3QHRA 2VWYA 5ANOA 5HICA 1RE8A 2FSMX 2UZOA 3TKUA 3AG9A 3PP1A 1WBVA 4OT5A 3R71A 4KIKB 1STCE 4IZ5A 2VN9A 2DUVA 2YWPA 3SDJA 2PZYA 4X3FC 5LMBA 2QLQA 1I44A 2CHLA 5CU3A 2YJRA 4M13A 4YTFA 2JDSA 3O51A 2J0KA 2C68A 3QC9A 4G34A 3UYTA 5KBRA 4YJSA 3S95A 3C4FA 2IWIA 4U6RA 4NKSA 3WIGA 4F6UA 5L3AA 5HLPA 4KB8A 3EKKA 3MYGA 4AWIA 4JDJA 3FC2A 4FK6A 3GVUA 4EHZA 4EZ3A 1CDKA 2CN5A 3LE6A 3CE3A 5EYKA 3CIKA 3QQGA 3VNTA 3COIA 4UWBA 1OECA 1P4FA 2OJJA 2R7IA 5B2KA 5LVOA 5AV4A 4DTKA 5AV1A 3ACKA 4XBRA 5HIEA 3ZEWA 3HMPA 2XNOA 5FP6A 2V7AA 3R30A 5EDPA 1QL6A 3AOXA 4I22A 4NCTA 2WGJA 5HD4A 2UW7A 1WBSA 4I6BA 3IECA 4LUDA 5E8YA 4XNEA 5M09A 3KULA 3ERKA 1FOTA 1PMNA 4I41A 4IAFA 4C2WA 4L68A 4KKEA 3KXGA 2A19B 2WTIA 3P9JA 4O96A 3ZC5A 3LMHA 3RAWA 3GEQA 3RJCA 3WYYA 5DVRA 4H3PA 2YLFA 4XS2A 5C27A 5E1SA 1Q3WA 3E62A 3L8XA 3F2AA 5EYDA 4F9CA 3U8WA 4O7YA 2XK7A 4F6SA 3FZSA 2F49A 3EH9A 3GC8A 4K1BA 4L3JA 5E8WA 5GZ9A 2WTKB 5AP5A 1GZOA 2A27A 4A7CA 3R2BA 2NPQA 5CQUA 3G6HA 3LW0A 2ITQA 4M8TA 2HELA 5AAFA 1GNGA 5AP4A 3AC3A 3LCDA 3NZ0A 3E5AA 4FNYA 1B6CB 4FT3A 3TJCA 4RC4A 4D9TA 4E26A 4LOQA 4AZVA 4FICA 4H1MA 5L2WA 1QCFA 3K54A 3QRUA 4ZS0A 4QMQA 4S31A 5E8UA 5FTQA 2GS7A 3DY7A 3I6UA 4D55A 4NK9A 3DK7A 4HGLA 2W96B 5CF4A 2PL0A 3JXWA 1G8SA 2YJSA 5HLWA 1BL6A 2C5OA 4I4FA 2HWOA 4JAIA 4EOLA 4BTMA 5AUZA 1H07A 4RJ5A 5EOLA 2YIRA 3MI9A 3LFQA 3MPTA 5A9UA 4QTEA 1GY3A 4MH7A 3F66A 3WBLA 4BCJA 2J6MA 2O64A 5CSPA 1GIHA 2ZMCA 4GKIA 4L46A 4AT5A 3PY3A 4CMOA 3QXOA 3OFMA 4WRSA 4FTAA 3R1SA 5HQ0A 3FLZA 3QZGA 2W4JA 2QHMA 2R3LA 5BVFA 1FGIA 1OI9A 4XMOA 2WEIA 3HEGA 5M57A 2OXXA 3BE9A 1Q8TA 5ANJA 3RCJA 1OBGA 3LCKA 2CNUA 2PHKA 3E63A 4FNZA 3R9RA 5GIPE 3QX2A 4BDGA 4ZTQA 3R8PA 4E1ZA 2PUNA 4BGGA 4A4XA 4ALWA 5IA4A 4O82A 4GT3A 4ASDA 4QRCA 1UU3A 4IC7A 5C4LA 4C33A 4HYHA 5HD7A 4II5A 2UZWE 5G1XA 4ASZA 5JFSA 4RQVA 2GNGA 4E8AA 2JKMA 3ZO4A 2QVSE 4FIHA 2HY81 3SOCA 5ETFA 5AR8A 3MDYA 3LCSA 2WB8A 5BVKA 3PDTA 4JNWA 3MIAA 5HG8A 4ANOA 3GBZA 1OPJA 1W7HA 3P4KA 4YNEA 5CEIA 4HZSA 3UMXA 4AZFA 4QPAA 2R3OA 3BV2A 3QQJA 5EI8A 5L6PA 5HE1A 4ERKA 4MF0A 5M4FA 5T68A 1YQJA 5LARA 5IA0A 3TEIA 3C1XA 1QPEA 4IWQA 5CU6A 4FL2A 4EKKA 2YM5A 4O7NA 3MH2A 3C0HA 2ZDTA 2QONA 1ZLTA 4Y73A 5HCZA 3OWPA 3W33A 5TOZA 3EYGA 2BFYA 1FINA 1CKJA 1PMEA 3DB8A 5C8KA 3ORZA 3DK3A 4CNHA 3T9IA 2XNPA 3MBLA 4K11A 4FIFA 4PTCA 2I40A 2YITA 3PIXA 3PXZA 2NP8A 1Q4LA 1Y6AA 2XF0A 3QKMA 4J52A 4U40A 4X3FB 2OO8X 4EK4A 2XM9A 4RIYA 3NW6A 1ZYCA 4BCKA 3KCFA 5FUTA 5HG5A 5EFQA 3EQPA 2YERA 5FTOA 4LRKA 3PE1A 4BRXA 1H1SA 1WZYA 4D4RA 4NT4A 2PUPA 4NM5A 2Z60A 4MYGA 4XV1A 5CT7A 4AE6A 3V8SA 3F9NA 3BU3A 3GNIB 2BKKA 3CEKA 3IS5A 1X8BA 5FM3A 3V5TA 4EQUA 5CY3A 4DFUA 4EEVA 2B53A 4BYIA 2GTNA 3I60A 3II5A 2BAJA 3NNVA 4NH1A 4AQCA 3KF4A 2QOFA 4G6NA 4O1OA 4KD1A 3G51A 4DINA 3Q2JA 4UV0A 4G3DA 2Y6OA 4A4OA 1PHKA 2OG8A 3MFTA 4FSNA 1SVGA 2P3GX 3R0TA 5DT0A 2C4GA 5H8GA 4C61A 5CEKA 4PTGA 3BLRA 3OCSA 4A9SA 3AC2A 4CFXA 4CCUA 5I0BA 3HX4A 4EK6A 2GNIA 1R3CA 3RAHA 3TZ9A 5K5NA 2XK9A 5GINE 4W8EA 3CQUA 3V8TA 2FUMA 4O2PA 5AR3A 2QD9A 1FVTA 4HNIA 2NO3A 4E4MA 2FGIA 2UVXA 4AW0A 2HZIA 1V0BA 3G33A 3U9CA 4MBIA 3MIYA 2IVSA 4JAJA 2LAVA 3VS7A 3VUMA 4AT4A 4CZUA 5KHWA 4J97A 1HCKA 2G2IA 2ZB0A 4GH2A 4MNEB 3ZRLA 2X7GA 4ERWA 3Q5ZA 3ZUUA 5BPYA 2FA2A 2E9VA 3JPVA 5LVMA 4AW1A 3W2QA 4ANSA 4BZDA 5ACBC 3F3VA 3SRVB 1V0PA 3ZO3A 1GZKA 2G2FA 5A6NA 3CY3A 2R3MA 1XKKA 3BGQA 4X0MA 1PYXA 3QZFA 3Q9WA 1EH4A 4JDIA 4NM7A 5IH6A 4UB7A 4AU8A 2G15A 2ZMDA 3K3JA 5AP0A 2OK1A 4ACMA 3VS6A 2WZJA 2X9FA 3WZEA 4P7EA 5GZAA 2YM8A 3UQCA 4M15A 4CFMA 4GUBA 1ZYDA 5DG5A 2C0IA 3IW4A 2QU5A 1KOAA 2HIWA 2YZAA 3NYNA 1M52A 3OHTA 3OUKA 4RSSA 5EDQA 3QUEA 2OJGA 3GC0A 2BZIB 4DFNA 1UKHA 2IO6A 4IQ6A 4F4PA 3I5NA 1BMKA 4ONAA 3QCSA 1BLXA 4QYGA 3DQWA 4DEGA 3RK5A 3ORXA 4O38A 3FZTA 3NAYA 4PNKA 5CS6A 5AA8A 3RWPA 3MB7A 5HO6A 1FGKA 4LRMA 1A9UA 3MW1A 5IEVA 4O0WA 2CLXA 3OOGA 3O50A 3UMWA 4G9RA 2PVNA 4MXXA 4AZEA 5BNJA 4D2TA 2FSTX 4EYMA 3OUNB 3Q5IA 3GXLA 4J8MA 2GS2A 3KGAA 3P08A 2VWBA 4GEOA 4WNOA 2HZ0A 5TE0A 4F9WA 1FVRA 4AGDA 2ETRA 5K3YA 5KUPA 5EK7A 4QMPA 4APPA 2HZNA 4RX9A 1OMWA 4DCEA 1OITA 3IW8A 4I24A 3PG3A 4O7SA 3GU4A 4WG3A 3LXLA 3NNUA 4PWNA 3UDBA 3ZLWA 1UWJA 3AT4A 4U81A 4FKPA 2XRWA 4FKSA 5AAEA 3C4WA 3JUHA 3MVJA 3AMYA 4YLJA 5AP7A 2CKPA 5CYIA 2LGCA 4FKIA 3E87A 4TWOA 5HI2A 4D58A 2BMCA 3FC1X 4ALVA 4WA9A 2WMXA 3EN9A 3L8VA 3T9TA 2UVZA 4MXCA 4GW8A 5LVNA 4XG6A 2WKMA 3R28A 3MTLA 1YWRA 3I7CA 3FLQA 4I5CA 3VS2A 2VTSA 4O91A 4HYUA 3MTFA 5CVGA 2WMAA 4FTIA 5IKWA 4BI2A 5A4EA 5E91A 4IX3A 3A99A 3QTRA 3ZFMA 3LLTA 4BZOA 3F3WA 4EH4A 5CAUA 2BHEA 3IW7A 4Y46A 2QR8A 4RVLA 3SXFA 3FV8A 4Q9SA 4P2KA 4TYJA 5GJFA 3C0IA 3WIKA 4FOBA 2EB2A 3F3UA 2AUHA 3E8EA 4CFNA 3FMLA 4ZK5A 1ZARA 5ANDA 1ZZ2A 4R3PA 3OC1A 5KMKA 5L6OA 3GP0A 4B4LA 5C9CA 4EOJA 2QR7A 5KMJA 4JIAA 4YHFA 5K0XA 4O86A 3O8UA 3FJQE 2JITA 3D4QA 4IFGA 4JG8A 4R5YA 4X2GA 5CVHA 1H1PA 5HE0A 2VTMA 4BWXA 4OAVB 3BEGA 1UU9A 4FOCA 3D14A 3FI4A 4JJRA 4OTWA 5JN2A 5KKRC 3F6XA 4U97A 3DAEA 2A1AB 4JI9A 2E9NA 1H26A 3FLNC 4RC2A 4ZTHA 4BBFA 1OUYA 1P4OA 2J90A 3CS9A 3GU6A 3NYVA 3VRZA 2HW6A 3N9XA 2WPAA 2R3QA 2Y6MA 5J5TA 5I9ZA 3JY0A 3EQRA 4FV3A 4UX9A 5CENA 2QOQA 2WMSA 3KULB 3BRBA 3RAKA 2C1AA 3KXXA 5AR4A 2V5QA 4BICA 4M14A 4TPTA 3W10A 2F2UA 1MUOA 5HG7A 3G0EA 3KF7A 3PWDA 3W16A 4ZZNA 1GOLA 4FTMA 4LI5A 3S4QA 2XKFA 2IZTA 3TNWA 3FLYA 3PXFA 5AM6A 3ZDIA 4C37A 4YR8A 3HV7A 5LCKA 2GCDA 1JSVA 4YTCA 3QRTA 4L00A 5LVLA 2VU3A 4F99A 4KKHA 1PXKA 2EXMA 2XEYA 4QQ5A 4QMWA 3ZSHA 4AFEA 3E92A 3DJ6A 3RM6A 2UZDA 2P33A 2C6KA 2VTOA 3SC1A 1JBPE 2BR1A 3VQHA 4C35A 3VUGA 2CGXA 5AV3A 3D7ZA 4FG7A 5HTCA 2C6OA 4O84A 5AFVA 2OLCA 4CKRA 2R2PA 5AV2A 4HVGA 2Z7RA 5E7RA 5BVWA 3TXOA 3V5WA 2X2KA 3HDMA 4E6QA 3HECA 5K4IA 5KO1A 4FT5A 4MD9E 3KA0A 2HK5A 5TR6A 3TWJA 2R3JA 2XB7A 4P90A 1BL7A 3R9OA 4JXFA 3CCNA 2UZBA 3TTJA 3R8MA 2Z7LA 3FZ1A 4ANLA 3VW6A 2OJ9A 5LVPA 3IOPA 3QL8A 4DT8A 5I3RA 5CXZA 4ZSAA 3LQ8A 3R7YA 5BYLA 3GFWA 3O7LB 4QQJA 2BPMA 2C3LA 3A8WA 1XQZA 2RG6A 4TWCA 5DT3A 3OBGA 4QYFA 4O21A 3HP2A 1PKGA 1SNUA 4GYGA 4R6VA 3ZRMA 2ZV7A 4JBVA 3VS5A 5IA2A 2VNWA 2VX1A 3THBA 4Y85A 4U5JA 3ALNA 2GNLA 5AA9A 4RVTA 4CGAA 3BU6A 2J0MB 3OEZA 3ANRA 3BLHA 4FV9A 1Q97A 2XKEA 2BDJA 3DXPA 5L8JA 1T45A 2F9GA 2GSFA 3AD4A 4Y95A 3BKBA 3VC4A 4F0IA 2JDOA 3QCQA 3NW5A 3SG8A 3Q04A 3F61A 4GMYA 4E4LA 4CQGA 2PVKA 1E9HA 5AAGA 3DXNA 1DS5A 4EI4A 2GPHA 4MK0A 2QC6A 4M66A 2AC3A 1H1QA 4QP3A 3QLFA 2PUUA 1M14A 2VNYA 3D7TA 3LXPA 3SLSA 2C3KA 3PY1A 2X4ZA 4DFZE 2R3HA 4ZSEA 2RGPA 3RI1A 4D4SA 3VBTA 4IVDA 1PXOA 3BI6A 4EUUA 3GCQA 4UYAA 4GUEA 4M69A 4LUEA 1YXTA 2IZRA 2JGZA 4F1OA 3Q4TA 2JLDA 2XMYA 3MS9A 4KIQA 1OKWA 2YA9A 3OTVA 4BN1A 1M2PA 2CCIA 1YOJA 2BAQA 4XYFA 2OFVA 3DU8A 4DHFA 5IQDA 1REKA 3PLAE 1A06A 3PVUA 1UU7A 1Q24A 2B55A 4E6DA 2IVTA 5IISA 3DS6A 3T3VA 2VWZA 2Y0AA 3E64A 3FBVA 4IJPA 4MWHA 3UNJA 3WZKA 2WNTA 3ZS5A 3C0GA 3REPA 4F9YA 3QKLA 5AR7A 4W9XA 1WMKA 3HV6A 3IDBA 4IFCA 3B8QA 3OVVA 3ZONA 4AN3A 3COKA 4FEXA 1GIJA 3IPHA 2RFDA 3I0OA 4RIYB 4XEYA 3P0MA 4GT4A 4ITHA 4UWYA 4WSQA 4YJRA 3VHKA 2W1EA 3G0FA 3QWJA 4BR3A 1O6LA 4G1WA 5A54A 3CTHA 4DT9A 2FSOX 2WQMA 4FEVA 4RZWA 4C36A 1DAWA 5K0KA 1CM8A 4PMPA 5IDNA 2XRUA 4XX9A 2YAKA 4AAAA 4DEDA 2R3NA 5LWMA 3PA4A 4ITJA 4RFMA 2GFCA 5HESA 5CI7A 3HMOA 3FI8A 5BQ0A 2HOGA 4V05A 5CT0A 3GQIA 2ZB1A 4ZIMA 2C5VA 4BIDA 3PYYA 2IN6A 4C3FA 5J9ZA 3D94A 2IW8A 4YJTA 2QKWB 3TKHA 3AMBA 3TNPC 2WTKC 2CJMA 3EFKA 4ZTNA 1IAHA 4JDKA 3RNYA 2QCSA 5CZIA 5CU2A 4R1YA 5E8SA 4I0RA 2DS1A 5BMMA 1YVJA 4LYNA 4CTCA 3POZA 4N6ZA 4JRNA 4BDFA 2WTCA 3OEFX 3QTZA 3GI3A 1OL5A 4HPUE 2YM7A 4I0TA 5E4HA 4EOOA 3LFDA 5ANGA 4DE4A 5CVFA 5A4LA 1BI7A 3HV4A 4PMMA 3ZBFA 3VUIA 3QYZA 3CP9A 4FC0A 3VRYA 2W17A 3R9HA 3FYJX 1PXLA 5DN3A 3FXZA 4ZZMA 2OXDA 2QOKA 4X6QC 5IQEA 3ZM4A 5CTPA 4MWIA 2WELA 3OMVA 4S2ZA 4QTDA 4U43A 3QZIA 4RWIA 2RG5A 2X9EA 2R5TA 3E93A 3EQCA 3F69A 3VULA 3LFEA 3V51A 2GQRA 3A7IA 3WYXA 3FXXA 3A61A 3DAKA 3PP0A 5A4QA 4NYEA 4ZEGA 3G15A 3CPCA 3KRXA 1MQBA 3TV4A 3GCSA 3BQCA 3KMUA 2YCQA 3R1NA 5IA5A 1UNLA 5HX8A 4UWCA 4CSVA 4FT0A 3KREA 4LV8A 3R7EA 3ZCLA 3RPRA 2ITWA 4NJDA 4QPMA 4FE2A 5B2MA 4I6FA 4AA4A 3A7JA 4ITIA 1OVEA 3TIZA 1KE8A 5DR2A 2DQ7X 2XIYA 2IVVA 4WKQA 1VYWA 3R7OA 3CQEA 4KSQA 2PVHA 3NUUA 3UG1A 3I81A 1P14A 5F94A 4ANQA 4D1SA 3F5UA 2PMNX 4PPBA 3BYSA 3K5VA 2JIUA 3FPMA 4JR7A 5HG9A 4PUZA 2C6EA 3I6WA 3R8VA 2V55A 4FTQA 2XIRA 2PMIA 4JS8A 2F7ZE 5BVNA 2W4OA 4DH3A 5M4UA 4D1XA 5F20A 5JRSA 1H28A 2BKZA 2UV2A 4BDJA 2XKCA 3IGGA 2JIVA 5DIAA 2B52A 2OH4A 2PZ5A 3ETAA 2QHNA 5KE0A 2YCFA 2XNGA 2Y4PA 3EKNA 1JAMA 2OIDA 1Z5MA 4FTJA 4YJPA 5T6KA 4BBEA 5EW9A 3KQ7A 2VTJA 1NW1A 4DFBA 2PVYA 4I94A 3SXRA 3TKIA 5IQIA 4DTBA 1YKRA 2UW0A 3QQUA 4OTQA 4DLJA 3W55A 1Y6BA 1JQHA 2QODA 2BTRA 2XEZA 5DEYA 3QTSA 4U41A 1UNHA 3OT8A 1L8TA 3EN4A 3OXTA 4FVRA 1BKXA 4XH6A 4FGBA 4DH1A 4AOTA 3UVRA 3DXQA 2W06A 4L3PA 3TNHA 4ZZOA 4N0SA 4YJNA 1KUTA 5CXHA 3K2LA 1R78A 2QG7A 2JAVA 2YM6A 1NXKA 4APCA 4BDIA 1JWHA 4YJQA 1RW8A 4RIWA 5BVEA 4JOAA 3O8TA 4TKSA 3RKBA 3N51A 4EK3A 2PK9A 5IQCA 1PKDA 5CEMA 3I5ZA 4B7TA 3TI1A 3KMWA 2QOIA 1ZMVA 3BWFA 3UZPA 5AP1A 4MAOA 3MJ2A 3R83A 2C6TA 5TT7A 3RNIA 3E3BX 3GU7A 1MP8A 2IPXA 3HGKA 5J87A 3RBWA 4O0XA 3LQ5A 2W5HA 1M17A 1Q41A 5F95A 4IIRA 5JQ5A 1TQIA 5M4CA 1TQPA 4ACCA 1VEBA 1AD5A 3WI6A 4KSPA 5FLFA 3RVGA 5EI6A 3BHTA 2F7EE 2ZM1A 4FSMA 4IM2A 3OY1A 1O6YA 3QTWA 4TRLA 5EQEA 3UOLA 3PRIA 4BZNA 1FPUA 2WTJA 4QYHA 4MX9A 4QMUA 2E9UA 3W8LA 3H9RA 1V0OA 1WVYA 2J0JA 2WO6A 4ZLYA 2VUWA 3IO7A 1IEPA 3EYHA 4USFA 5FTGA 2UW6A 4TYHA 5L2SA 1VR2A 4C4FA 4FI1A 4O6LA 3UP7A 3RWQA 2QO2A 5J79A 3DBDA 3VS0A 3G6GA 5E1EA 3CY2A 3A4OX 4C2VA 3EZVA 2BDWA 5IEXA 3ZM9A 4DAWA 4DGOA 2F4JA 3E8CA 3VN9A 4BTJA 3S3IA 2CGVA 1KSWA 1RDQE 3PJ2A 5J1VA 4EORA 5JZNA 4UYNA 3HV5A 3MFSA 4ZOGA 3VBYA 2Z7QA 3E3PA 2UZTA 1F0QA 2EVAA 1ZZLA 2PSQA 3ENMA 3OCGA 1F3MC 1DM2A 3UGCA 4LV5A 4TWNA 5HVJA 3VBVA 3FE3A 3CQWA 1K9AA 2H8HA 3F2NA 4OAUC 2ZV2A 3ZXTA 3AD6A 2J0LA 4E20A 4YTIA 1OKVA 1YHVA 2C69A 5IMEA 5EI2A 2XP2A 3QYWA 5AUXA 2X2MA 3V04A 3UYSA 3Q4CA 4KBCA 1JOWB 1J1CA 2FH9A 4QO9A 4X7QA 2BRGA 2XVDA 3LKMA 4I3ZA 3DKFA 4IXPA 4BCOA 4QMNA 4R3CA 4BBMA 5FXRA 5D11A 2QO9A 2W7XA 3MSSA 4F09A 2F7XE 1BYGA 4BTFA 5CEPA 5EW8A 1QMZA 5BYYA 2OF2A 3OOMA 2X6EA 4H58A 4MEDA 5FXQA 1B38A 2WIPA 5A46A 2X8DA 4ZJIA 5DR9A 4RWKA 5BX0A 2XBAA 4DA5A 3WILA 5AMNA 1GIIA 4XOYA 4YLLA 3U4WA 4FTRA 4A4LA 5KMIA 3FI2A 2OBJA 3OXZA 2C6MA 4UXLA 2EXCX 2CGUA 2VWVA 2WMRA 4O7VA 4FV2A 4FVPA 3KXZA 3RK9A 2XCKA 5DLSA 3ELJA 2YAAA 3GCUA 3HUBA 3Q53A 4WG4A 4X3JA 2Z2WA 4ZS4A 4CT2A 5BUEA 4DEAA 2ERZE 4FKTA 3VBXA 4RC3A 3I7BA 5AIKA 4H36A 4FTTA 4A9TA 3G90X 2XM8A 3A7GA 2C30A 4BCHA 4RX7A 3DTCA 5D1JA 1PJKA 4ZY5A 2R3GA 2X7OA 3DQXA 3IOKA 4FL3A 4FVQA 4NW6A 4AA5A 5EOBA 4FKOA 4BI0A 2RFEA 1GZ8A 4L7SA 4NU1A 4FKUA 4K18A 3MV5A 4K33A 4NKAA 3FPQA 1Q5KA 4M0ZA 2X8IA 2QLUA 4R77A 4I1ZA 4RMZA 3DNEA 2YISA 2J4ZA 4C4EA 1WBTA 5LMAA 5AUUA 3SHEA 2CDZA 5KMLA 3D5VA 5IQAA 5IUHA 4NJ3A 3SAYA 4Z55A 4QP7A 1ZXEA 4PDYA 2G2HA 3NRMA 4B0GA 1J3HA 4XBUA 4DLIA 5CALA 4ACDA 1HOWA 4U80A 3R73A 3LPBA 4TTHB 3QTQA 4FSTA 2WXVA 1ZYSA 4HCUA 4IWOA 5CU4A 1U54A 4FNXA 4C57A 3LFAA 1SYKA 3KL8A 4EL9A 3TM0A 4FSWA 4OTPA 2QKRA 3D7TB 3FXWA 5EM7A 2WQOA 3HL7A 3AC8A 4KRDA 3TZMA 5M56A 4JLCA 1OPKA 3R9DA 3HKOA 2YHVA 4MXAA 2BFXA 2VAGA 5A4CA 5M08A 5HKMA 4M69B 2IVUA 5KZ0A 4UY9A 3QUDA 4I93A 3EQIA 5JKGA 5T3QA 5GNKA 4DBNA 2BZKB 1KE9A 5GJGA 3RK7A 4QMTA 4BCIA 4E93A 2X6DA 4GJ3A 3S00A 1WFCA 4KS7A 3TCPA 4K2RA 4NW5A 5E8TA 4RVMA 3PPJA 3DTWA 1Y8YA 5HBHA 4IHPA 4IAAA 4J98A 1LR4A 2W05A 2XK8A 4PQNA 5IUIA 3ITZA 4BDEA 4RIXA 4UMQA 4IBMA 3SD0A 2RSVA 2BUJA 1JKSA 3V3VA 3N4TA 5E9EA 1JNKA 2Y8OA 4G31A 5EW3A 1IR3A 3CR0A 4QP9A 3FLSA 2GHMA 2O65A 4NCTC 3AT3A 3KRLA 3LMGA 1CMKE 3EQDA 3L8SA 4G2FA 3QALE 4KS8A 4PDOA 4XUFA 3BGZA 2C5XA 3DV3A 4HVDA 4FV0A 5CZHA 5ANEA 3PXYA 3A8XA 4QYYA 1H01A 3R00A 4IWPA 4PNIA 4XHKB 5JQ8A 2C0OA 2B7AA 4GG5A 1OIUA 4HJOA 4IEBA 4TT7A 3ZH8A 5HE3A 4MQ1A 3ZLXA 2YFXA 4C8BA 4G3EA 5IA1A 2A4LA 3KFAA 1K2PA 1ZY4A 3KRRA 3PRFA 3T8OA 2DWBA 2YDKA 2J5EA 3GCPA 3P79A 1XJDA 3SVVA 4FSUA 4L9IA 4A06A 3S2PA 2QI8A 4RFZA 4YSMA 4CYJA 5M44A 2W1HA 1W0XC 2ZM3A 3SV0A 4WD5A 1XH8A 1H24A 3Q9XA 2WOTA 3VJOA 4CFWA 4QMOA 2BDFA 4ZY6A 4KKGA 5EKOA 2O3PA 2EUFB 1ND4A 1AGWA 4PTEA 4ZJJA 3ODZX 4S30A 1YXVA 3BYMA 4AN9A 3HP5A 2WOUA 4FV8A 3VAPA 3PPZA 5IEYA 4DEHA 3TZ8A 4R78A 1DI9A 3EL8A 4BC6A 3NAXA 4GKHA 2OWBA 1YDTE 2BZJA 3R1QA 3O71A 4FTUA 4Y72A 4FEUA 5HBJA 3DDPA 4EWHA 3PIYA 4NFMA 4MTAA 1OKYA 3HDNA 4AZTA 2WQEA 2ITXA 2E9PA 1UA2A 4OTIA 1OIYA 3SQQA 2QURA 2H34A 3A7HA 4GG7A 4UBAA 4X6RA 5HTIA 4N6YA 1Q8ZA 4PPCA 4BCMA 1E1VA 4X2FA 4BKJA 2R3KA 3RAIA 2PWLA 3FMNA 3OROA 4WT6A 3ORTA 4RRVA 3PTGA 2WMUA 4MNFA 3MPAA 1IA8A 4FKJA 3TG1A 4CT1A 3Q52A 3BELA 4OTGA 2C5YA 4K6ZA 3UIMA 4JG7A 2B9HA 4N70A 1BX6A 5LMKA 2G01A 3VS3A 3A62A 4FODA 2OGVA 1P2AA 5CAPA 4RJ6A 5IA3A 3PE2A 3ZSIA 3UPXA 3CTQA 3TDWA 2QU6A 4GK4A 4RA5A 2C1BA 3H3CA 3ORPA 4F6WA 4FZ7A 4DG2E 4BCNA 1U5RA 3LIJA 4R8QA 3TJDA 1H4LA 5L8KA 5JFXA 5C01A 4IVCA 2R3PA 1FQ1B 3NX8A 4AX8A 3H0ZA 3SX9A 4QP1A 4DGMA 5AX3A 3QU0A 4NM3A 1YWNA 2YCRA 3FMKA 4UMTA 4MQ2A 4I0SA 4C62A 3U6JA 3PJCA 2ITUA 3COHA 2PVJA 5HOAA 3VW8A 4U79A 3EJ1A 3ZHPC 2QOBA 4AN2A 3E8NA 1OM1A 2VV9A 4UZDA 5HGIA 3SG9A 4GYIA 3DBCA 4XG3A 4D5HA 2EU9A 3QLGA 4CFUA 2WMVA 1XH9A 3DJ7A 2H6DA 5DRBA 1NVRA 4OBOA 4UZHA 5I9UA 3GGFA 2QOOA 3L9PA 3FMHA 4L43A 3RGFA 2OH0E 1YI6A 4JBPA 5ETAA 4OR5A 3W2RA 1KV1A 4XG8A 4HGSA 3VF8A 5HZNA 4RIWB 4OGRA 4C4JA 1WBPA 5IH5A 4ANNA 2OI4X 4AF3A 3BIZA 5AR2A 3V5LA 4IANA 3HA6A 3BYVA 3BZ3A 2HYYA 4EBWA 2W1GA 3U55A 3UOHA 4B6LA 2JKQA 4X2KA 3AXWA 3FHIA 4EQMA 3OCTA 4U0IA 4EH8A 3RMFA 5CU0A 3BCEA 1ZOEA 4R7BA 3TTIA 2BILB 1ZYLA 4FUXA 2YN8A 2J7TA 4ASXA 3E8DA 4M0YA 4M68A 4CLJA 5IH4A 5JGBA 5CAQA 4BY9E 4QP8A 4E3CA 3IG7A 2RFSA 4C02A 1O6KA 4BCPA 3QBNA 3GOPA 1PMUA 2GHGA 2ESMA 2Y4IB 3BGPA 4TXCA 1GJOA 5J5SA 4QMLA 1I09A 2H9VA 2JBPA 2PZIA 5M53A 2OZAA 3QC4A 4CTBA 3L1SA 4RGJA 1WBOA 4AA0A 1LEWA 2NRUA 3EFJA 4J7BA 2X0GA 3ZRKA 3P86A 2ITNA 2PZPA 3LVPA 4CVAA 4CRLA 2W99B 4OTFA 4TYHB 4I5HA 3VUHA 4YUQA 4ZTLA 3R8LA 5CF5A 5DE2A 4R5SA 5HIDA 4E7WA 4TWPA 4GVAA 3GU8A 4XP3A 3WOWA 4FUYA 3L9NA 4WG5A 4GVJA 1MRYA 4JQ8A 3ULZA 3QFVA 4NTTA 4D1ZA 2AYPA 1OL2A 3DJ5A 1WBNA 1CKIA 3L8PA 4AE9A 3UTOA 2VX0A 2VRXA 3GB2A 3M1SA 3MFRA 4S32A 3UC3A 1YDSE 2OF4A 3OTUA 3KN5A 4IMYA 2PZRA 1XR1A 4W4YA 3RALA 1NT2A 1MRVA 4IACA 1TVOA 1Z9XA 4FV5A 2VO0A 3OD6X 2RIOA 2O5KA 4XRJA 3IONA 4NIFA 5DFPA 4BVUA 2ETMA 1PW2A 3U4UA 2FSLX 2WU7A 3FMMA 5LQFA 3H9OA 4PDPA 4ZTRA 4UALA 4Q5EA 3ZMMA 1W98A 3ZSGA 3HYHA 4FV4A 1REJA 4RLLA 5EH0A 3VJNA 4C3PA 3P23A 2B4SB 3MY5A 4TZRA 3FDNA 4ACGA 3GENA 4V0GA 4CZYB 2ZM4A 3RPOA 5FM2A 5I4NA 3D9VA 1B39A 4FSZA 4IB3A 4RIOA 3LFFA 4CFFA 4RT7A 4L6QA 2OW3A 2REIA 4PV0A 4O0YA 2VTIA 2ITZA 3HRBA 3WF8A 3U6IA 3VUDA 5JK3A 2QOCA 3OG7A 2I0HA 3B8RA 4N4SA 2WIHA 3FY2A 1YW2A 4FGRA 3FL4A 5AV0A 3DOGA 2YZLA 2ONLA 4RJ7A 2FB8A 3HNGA 4GRBA 4KWPA 2VTNA 5ANIA 4EH9A 3KK8A 3EFLA 1UVRA 3VBQA 3C51A 3HMMA 4ID7A 4Y83A 4G6LA 4BDKA 4JBQA 4WSYA 2XK6A 2YACA 3MA3A 4U7ZA 1H0WA 2X2LA 2R9SA 2UW4A 4FV1A 2OXYA 3TV7A 3IK3A 3F88A 3P7BA 2VWWA 3VUKA 4J8NA 3BHHA 5CAOA 4C38A 3CD3A 4L8MA 3PSBA 3KKVA 5JGAA 4BWKA 3NW7A 4AOJA 4RA4A 4RFYA 4N57A 3BEAA 3EWHA 3NUYA 4LL0A 2YLEA 3ID6C 4JR3A 2OICA 4M7IA 4TNDA 1SVEA 4L52A 3DZQA 4O0RA 3EB0A 3LAUA 4F9BA 3F7ZA 3NUAA 3O0GA 4GFMA 4IZAA 2BROA 2CKOA 3MY0A 3EMGA 3P5KA 3PA3A 2UZEA 2WQBA 4GIIA 4IVAA 3NYXA 5J95A 5L6WL 5IUGA 4H1JA 2XJ2A 4YBJA 3B2TA 5HLNA 2PY3A 2XZSA 4O81A 3R2YA 4YP8A 2XCHA 3MH3A 5GIOE 5EM5A 5LCJA 5IMXA 3ROYA 3DBFA 4XV3A 4U3ZA 3F2RA 2X7FA 4NZWB 4QD6A 1ZMUA 5CX9A 3AC4A 3L9LA 5FWKK 2VWXA 4I5PA 3Q9ZA 4FK3A 4QTCA 4F0GA 4C59A 3UOJA 3KC3A 2BRMA 3UIBA 3PY0A 2CNVA 2RFNA 4WUNA 5J1WA 4O22A 3GC9A 1JSUA 3M42A 2CNQA 3CD8A 4BI1A 1U54B 4R7IA 3DKGA 4CEGA 5J8IA 1BI8A 3QRKA 5E92A 4W4WA 3L9MA 4B8LA 5EQYA 3DZOA 3OF0A 4AG8A 3O8PA 2GMXA 4OUCA 4PL3A 5IDPA 2ZDUA 3AC1A 5IQBA 1SZMA 3NCZA 5CI6A 4IH8A 3EOCA 3VQUA 1W8CA 3ZLYA 2C3IB 4HZRA 3DK6A 4NSTA 4QNYA 2PUIA 3ORNA 4IM0A 1ZRZA 3TV6A 4Z7HA 3FZRA 4F7LA 2YCSA 2X8EA 5FD2A 2Y7JA 4GFGA 4BCGA 5AIRA 3R7VA 3RHXA 2C6DA 4EHVA 2XNNA 4PDSA 5CNNA 1YXXA 1WVXA 2HCKA 3UJGA 2UW8A 3Q2MA 1AQ1A 3BU5A 2EWAA 5BUJA 2BRBA 2YDIA 4KNBA 4O27B 3EQHA 1S9JA 5KX8A 2C6IA 2R3IA 2P4IA 3Q4ZA 4KIPA 4C4IA 4DH7A 5KNJA 3FQSA 2C5NA 1URWA 1IAJA 3ORLA 4RIXB 4LGHA 3ZC6A 1YI3A 3C50A 4K77A 3C4EA 2PVRA 1QPDA 3Q6WA 5IG1A 5AWMA 5BVOA 3GU5A 5D7AA 2UZUE 1H00A 3NDMA 1BUHA 3UE4A 3RZBA 2BRHA 3QCYA 4EOKA 1KE7A 4XRLA 1XBCA 3QA0A 4IAIA 4ZLOA 5IZFA 4H39A 4RJ4A 1U59A 2WMTA 4K0YA 3B2WA 4PRJA 2PE1A 2Z8CA 4YU2A 3LCOA 4JIKA 4WHZA 4C34A 4EOSA 1KE5A 3FYKX 3DB6A 4U42A 4LMNA 1JKTA 2CCHA 2JDRA 3OCBA 1RQQA 3MFUA 2CSNA 3UVQA 4OTHA 2XK4A 3QX4A 4G3FA 4C3RA 3Q96A 3TDVA 2EB3A 3EQGA 3PZHA 3R63A 3CTJA 1TQMA 2ZOQA 3H10A 4IDTA 4BL1A 3OW3A 5CNOA 1JKLA 5ITAA 3G9LX 3SXSA 4TW9A 3CC6A 3NNWA 5FQDC 3W2PA 3WF6A 3QGWA 5JGDA 1XBAA 2HZ4A 3BX5A 4ZSLA 4D0WA 3PVBA 4BCQA 3GUBA 3KXHA 2XNEA 2W0JA 4FKGA 4DG3E 2GNHA 4YBKA 3DLZA 3RZFA 2W1DA 4C4HA 2ITTA 4EH3A 1M7NA 2VZ6A 3H9FA 3R01A 4HYIA 4Y5QA 4O0TA 5D7VA 1KE6A 2RL5A 4AW5A 4O0SA 3S1HA 4WUAA 4OT6A 5DI1A 3DLSA 4YO6A 2JAMA 2IZUA 1ZWSA 4YSJA 5M07A 3BYOA 4FG9A 5FG8A 2BALA 1NVSA 4BGHA 2VO6A 4FF8A 4R1VA 1S9IA 2GQSA 5GHVA 3BBTB
chains in the Genus database with same CATH superfamily
2VO3A 3UOKA 1JSTA 4FZ6A 4LOOA 3N4UA 1H1WA 2RF9A 4RJ8A 3OXIA 1UU8A 4Q5HA 2O0UA 3EQBA 4EZ7A 1P5EA 3Q60A 3LJ0A 2XNMA 1Y8GA 4QTAA 1TKIA 2OZOA 3PXQA 4PF4A 3QD2B 4X2JA 3HAVA 4CKIA 5HNIX 4FSYA 2OJIA 5HORA 2P2HA 5KCVA 2P0CA 4QP4A 2B9JA 3W2SA 5DYJA 3QTIA 5FDPA 3NPCA 5H3QA 2QNJA 4L7FA 2XS0A 4QMSA 2BRNA 4EYJA 1NY3A 3GOKA 3ZZEA 3RP9A 3SKCA 2C47A 3GCVA 4AS0A 3CGOA 1YDRE 4XOZA 3TNQB 1NVQA 4FSQA 2IJMA 2VTAA 3BHVA 5HO7A 1XMMA 4KRCA 4UMRA 3HRFA 4FJVA 4EQCA 3LJ1A 3ODYX 3C5UA 3QKKA 5DGZA 3KXMA 3DA6A 3A2CA 3RPVA 4XG9A 4IJ9A 4USEA 5EHOA 3S0OA 4LG4A 3HV3A 4CCBA 3COMA 4AZWA 5AEPA 4QOXA 1Q3DA 3CBLA 1KV2A 2OU7A 3HMNA 3Q6UA 1JVPP 4BDDA 2E9OA 2ZAZA 2Z02A 3ZO1A 3EIDA 5AR5A 4HYSA 2OFUA 1QPCA 2OSCA 2E2BA 2YABA 2QQ7A 3FMEA 3Q4UA 2HY0A 3IKAA 4RX5A 3EN6A 4YMJA 3VHEA 1ERKA 4LFIA 4C0TA 3PWYA 5IPJA 5L4QA 1XHAA 3C7QA 3QQFA 4FYOA 4I20A 4E73A 2ZV9A 2JD5A 2I0YA 3I1AA 4QMMA 3SA0A 4QQTA 1DAYA 3EQFA 3BYUA 4BFMA 3FLWA 5D9HA 3UP2A 2OJFE 1O9UA 2QOHA 4MD7E 2B1PA 4P4CA 4U3YA 3P78A 2B9FA 4BB4A 4TL0A 4AZSA 4F7JA 3O23A 4OTRA 5E8VA 5BUIA 3OWLA 3QZHA 5EDRA 2JDTA 5B0XA 4AFJA 4F1TA 2G1TA 5FBOA 5IQGA 3AC5A 3QTXA 3H30A 3NEWA 4IE9A 2ZVAA 2X1NA 3CSVA 1Q8WA 4G6OA 5C4KA 3OY3A 2F2CB 3U51A 4F0FA 2BIKB 5I9WA 5K4JA 4YC8A 4IC8A 1ST0A 2QO7A 3HVCA 2VTQA 2W1IA 4A9UA 3W8QA 2Q83A 3F5XA 1SNXA 4X21A 5E8ZA 3JVSA 1JKKA 1H0VA 4O83A 4E6AA 3ZU7A 1UV5A 2OZAB 4I4EA 4RG0A 3VONA 4U44A 5TKDA 3IDCA 2WTWA 3F82A 4XG4A 3ACJA 1XH5A 3RM7A 3VIDA 4I6LA 3PXKA 5AUTA 3NIEA 3OT3A 4GCJA 4G17A 4GFOA 3UODA 4A9RA 4PL5A 2PMLX 5FEQA 3R04A 1XH7A 4L42A 3LQ3A 4KBAA 4B99A 4CQEA 2A0CX 2GQGA 4RBLA 3FSFA 4I23A 4D2VA 4E5BA 4IZ7A 3BHUA 1FVVA 2J9MA 2GTMA 3W1FA 3UO5A 4LM5A 3RHKA 1H8FA 2B54A 4ZSGA 3ZUVA 5DBXA 2CKQA 4WBOA 3Q32A 1OZ1A 4F64A 4YURA 4ZMEA 5H9BA 3R1YA 1V1KA 3FI3A 4HPTE 4L53A 3EN5A 4JX3A 4F08A 5JMSA 4UMPA 4BKYA 4EWQA 5K5XA 4QP2A 1Q99A 4MCVA 1ZYJA 4NIFB 3FWQA 2J2IB 2GHLA 2PE0A 3DFCB 3QQLA 3WARA 4ENYA 5M55A 4FIJA 1OPLA 3D2IA 3MN3A 2BZHB 3O2MA 4U45A 3LXNA 3P1AA 2KTYA 1LP4A 5A6OA 2VTHA 5CASA 4YJVA 4FIGA 5EHYA 1MRUA 3PVWA 2PE2A 4IDVA 1YOMA 4GV1A 4CG8A 3LM0A 3UIXA 5CSHA 3WF7A 4M3QA 4OW8A 4FV7A 4FTLA 2XAMA 4FTNA 4PPAA 4V0GB 3TUDA 4YPDA 4YTHA 4D4VA 5DNRA 3LLAA 4YZMA 3EFWA 4W8DA 4NL0A 3MY1A 3R7GA 3UO4A 3V5PA 4EOMA 3LJ2A 3QQHA 4G16A 3K5UA 2V7OA 1ZY5A 5HNBA 3BLQA 2W5BA 5AADA 1G8JA 4ASEA 4RQKA 3AD5A 3ZOSA 5JSMA 3LCTA 4J71A 5JT2A 4J95A 4GU6A 3O17A 3MVLA 1OIRA 4IADA 1PXMA 4EHGA 3GC7A 3AGLA 3IW6A 4IW0A 4YC3A 3G5DA 5ETIA 2VTRA 4ZY4A 3NVMB 5LWNA 3D5XA 2ACXA 4JRVA 3H4JA 2YM4A 1DI8A 2OIQA 3R02A 2NRYA 4YZCA 5CWZA 4CG9A 1M2RA 4FTKA 4AGWA 5D10A 2W5AA 5AP6A 3N4VA 3A7FA 4FKWA 4EH2A 4D5KA 4XLVA 4PP9A 3ZYAA 5AJQA 5CLPA 3GQLA 3KRWA 3FMDA 4NM0A 1E1XA 2W4KA 4D2RA 4EKLA 4EC8A 5DWRA 2WFYA 2VTTA 3W0OA 2XH5A 2Y9QA 4DG0E 5B7VA 4F1MA 3TUBA 4EH6A 3ALOA 2WHBA 3V8WA 1R0EA 4K8AA 3WZJA 3PPKA 5HO8A 3TN8A 3KCKA 4BJJA 4YJOA 3WZDA 3W0QA 4HGEA 3MWUA 2XYUA 2DYLA 4DC2A 3NWWA 3A60A 4UEUA 1G8AA 3O7LD 3TT0A 3FHRA 5B2LA 5EM6A 3MVMA 3MESA 3QD3A 4ANMA 5GZ8A 4JQ7A 3IGOA 5HEZA 2VGOA 3QXPA 4PX6A 4FX3A 2WTVA 5C26A 2X4FA 3OP5A 1R1WA 4XCUA 5I5ZA 3FY0A 3IW5A 3UNKA 1U5QA 2PMOX 4H3BA 3CPBA 4BIBA 5KMOA 1OKZA 2HENA 5I9XA 3QHWA 2ITYA 4PMTA 4DHIB 3AQVA 4DFXE 3QD4A 2JBOA 5KZIA 5EM8A 4J99A 3DT1A 3PSDA 5HE2A 5BVDA 4YGAA 2Y4IC 2XIZA 4I6QA 2UW5A 4ZTSA 5EYMA 4DN5A 2PYWA 3FEGA 4BDAA 4FEQA 4AXEA 3D5UA 5AP2A 3FL5A 3WF5A 2JC6A 3KY2A 1U4DA 3ET7A 4IAYA 3NIZA 4O6EA 3UPZA 3HRCA 3MVHA 3W0SA 1ATPE 1OL1A 4FZFB 3QRIA 3D2KA 2O2UA 3C13A 5JZJA 2JKKA 1QPJA 3NCGA 3MH0A 4ZTMA 5HVYA 4NFNA 3HAMA 3R8UA 3NSZA 3CJGA 3AGMA 4Y5HA 4YLKA 3ORIA 5H8BA 3FZPA 5E90A 3RCDA 2PPQA 4BGQA 3ATSA 2B0QA 3CKWA 2GDOA 3LZBA 4W9WA 2QOLA 4MXZA 4DEBA 1WCCA 3IDPA 3PG1A 1A48A 3KB7A 1H25A 3ZO2A 4PY1A 5ANKA 4AGUA 4FTCA 4WOVA 3R7UA 5HU9A 2J0IA 5C8NA 3QWKA 2CGWA 4CRSA 4TN6A 4TYGA 4RWJA 3TACA 4WNPA 5JFVA 2VD5A 3NFGB 2J5FA 5AX9A 3SGCA 4USDA 2GU8A 3EL7A 2VGPA 5L8LA 3RTPA 1J91A 4ZP5A 4L01A 4ZXTA 1G3NA 2GNFA 3JYAA 4PMSA 1PYEA 5GJDA 5HHWA 2IG7A 5ICPA 5DR6A 4D28A 3WZUA 1YHWA 4EJNA 3FKLA 3PJ8A 5DH3A 4EHEA 3BV3A 4K9YA 2Z7SA 5E8XA 4F78A 3KU2A 3VS4A 2NNWB 4GK3A 4ACHA 3CXWA 4HNFA 4V01A 3AT2A 1W83A 5DHJA 2WEVA 3VS1A 3OWKA 2I0VA 3KVWA 5FDXA 1FMOE 1UKIA 2WU6A 4QPSA 5L2TA 2YDJA 4DFLA 5HBEA 5EG3A 2R3RA 4LL5A 3DGKA 4MVFA 4AXDA 2CMWA 4DBXA 5FGKA 4M84A 2V62A 2P55A 5I9YA 3ORKA 1Y57A 3CKXA 4EOPA 2OKRA 1XH4A 2SRCA 2R0UA 3R8ZA 4TYEA 1YRPA 5JH6A 4UXQA 3PUPA 1UNGA 4KA3A 4NTSA 5TF9A 3UC4A 4J1RA 2ITVA 3LFNA 2WMQA 2JEDA 4RX8A 5JRQA 4FIEA 4FG8A 3TUCA 5DRDA 1H27A 1R0PA 3KN6A 3PFQA 3D15A 4G3CA 3WE8A 1ZAOA 4DCAA 3P7CA 4ZLZA 5L2IA 3HA8A 4FA2A 3C9WA 4L3LA 3I4BA 1PXIA 1XWSA 4DGGA 4ZAUA 3ATTA 3OBJA 2WMBA 3CJFA 3C4XA 4XP0A 4FNWA 4CV8A 4KIKA 2GS6A 3MH1A 4IX6A 5BMSA 4EOQA 4HVSA 3ANQA 3HMIA 4Q2AA 4EOIA 4FSRA 1JPAA 5I3OA 4BKZA 5J7BA 4QYEA 4CFVA 4JG6A 5ETCA 4HVHA 2R0IA 3JS2A 4IAKA 5BYZA 2A2AA 3WE4A 4FKLA 3NNXA 2YIXA 2JKOA 3PXRA 4GK2A 2XA4A 5D41A 2WQNA 2VTPA 2CN8A 3PIZA 5KMMA 4F65A 1SVHA 3KEXA 4C7TA 2UVYA 4AXAA 2JDVA 4S34A 4BYJA 4XV9A 1WBWA 4FYNA 2VWUA 3ZDUA 1PY5A 2RKUA 4FL1A 5DA3A 4DTAA 4CYIA 4F7SA 4QMXA 2CLQA 4YPSA 4BIEA 1W2DA 1GZNA 4YHJA 3UDTA 4HW7A 1UWHA 2IW9A 5FEDA 4YZ9A 4EK5A 3NVKI 2J50A 1U46A 3MGYA 3NUPA 2FVDA 3AMAA 5G6VA 3R22A 3IQ7A 4O4CA 5CSXA 5IQHA 3CLYA 3ZFYA 1ST4A 2KULA 5H8EA 3C5IA 5CQWA 1VYZA 4DF3A 1OGUA 2AC5A 2W1ZA 2XUUA 2YIYA 4WRGA 2PULA 1PXNA 3KK9A 2J51A 4EJ7A 2GNJA 3QQKA 4C4GA 3PJ3A 3C4CA 4NEUA 1LEZA 4FEWA 4W4VA 3RINA 1YI4A 4E4XA 1PXJA 3NMUF 5C03A 1F5QA 1LUFA 3BWJA 2YIWA 3KVXA 3LOKA 4XG2A 3RPYA 5F9EA 4YZNA 4GS6A 2UZVA 3PSCA 3BPRA 4ZJVA 5DMZA 3HZTA 4HCVA 3SW7A 3LFSA 2PVMA 2R3FA 4OBPA 4WNKA 3ORMA 5H2UA 3LHJA 3TL8A 4ORKA 4ALUA 3ZZWA 3UBDA 4AUAA 3UDSA 4I21A 1H1RA 4FT7A 4MXOA 3UQFA 4FV6A 1YXUA 4E5WA 3BBWA 4UN0C 3UNZA 1RJBA 1Q62A 3QGYA 4UMUA 4L44A 1HCLA 4YZDA 1W82A 5KMNA 4JDHA 3DKOA 3FUPA 1Q8UA 3QRJA 4Z9LA 5HU3A 3P7AA 5DOSA 4H05A 2ZV8A 3OW4A 4DH5A 3A4PA 4MF1A 4YO4A 2HXLA 3I0QA 5FEEA 5KBQA 4F9AA 4FBXA 4XV2A 3V6SA 5KHXA 4FR4A 4FT9A 5M51A 5TO8A 2UUEA 2VO7A 4IM3A 4RLKA 4E5AX 3VF9A 3ZUTA 3QAME 3BL9A 4NWMA 4EZ5A 4JVGA 5EKNA 5EQPA 2R64A 2X81A 3BHYA 3F3ZA 4EH7A 2C0TA 3Q3BA 4GU9A 5HNGA 4BHNA 3M11A 3AKJA 4ENXA 4EH5A 1IASA 1YXSA 3NUNA 4WBBB 5CAVA 3BE2A 4EC9A 4LRJA 1GAGA 2JFLA 3CGFA 4L45A 5DPVA 3QCXA 3NUSA 4I92A 5JEBA 3HUCA 1JLUE 3LFCA 5HTBA 4MKCA 4DH8A 5I9VA 2C6LA 3AKLA 3OS3A 3PZEA 4KUJA 4MBLA 2Q0NA 1APME 4M67A 2I6LA 2R4BA 1CSNA 4I6HA 4J53A 5AP3A 5CANA 4O7ZA 4ZSJA 4JBOA 1M7QA 3H0YA 4O4DA 1PF8A 1XO2B 4YZBA 2O63A 3DKCA 4TNBA 5CSWA 3KXNA 2BTSA 3LM5A 4FKRA 4KBKA 3DPKA 5C1QB 2OIBA 4CV9A 3WF9A 4D2PA 2I0EA 1J7LA 3VUTA 4PL4A 5CF8A 4AP7A 2JFMA 1YWVA 5D12A 5A4TA 3RPSA 2YWVA 2BAKA 3DNDA 4OTDA 4HVIA 3U9NA 4HGTA 4TY1A 1L3RE 4X2NA 2ITPA 3DDQA 5ACKA 4MD8E 3EHAA 3QA8A 4WO5A 4XJ0A 5IQFA 4DGNA 4CKJA 4QMZA 5K9IA 3UZTA 4Y8DA 1KOBA 3UIUA 4L67A 4DGLC 3FAAA 1VLRA 4XP2A 3NR9A 4U8ZA 4O0UA 3ULIA 2ERKA 1MQ4A 1R39A 2PU8A 3PVGA 3D5WA 2FO0A 3DBQA 2HXQA 5FP5A 4V04A 4QQCA 4GSBA 4CLIA 5L2QA 4KABA 5LMKC 3O96A 4R3RA 4AW2A 2F57A 3E7OA 2WAJA 2VWIA 4GT5A 2BVAA 4MXYA 5A3XA 4XG7A 3EN7A 4AGCA 2B9IA 1PMVA 2BHHA 4X3FA 4Z7GA 3G2FA 5EYCA 1VZOA 2VTLA 3ZEPA 2XIXA 2XYNA 3R7IA 4Q9ZA 2NYAA 4OLIA 4YC6A 2UW9A 3JY9A 4QT1A 3GFEA 4LOPA 5LJJA 4O7TA 3FKNA 4J96A 3W2CA 1FBNA 2W9ZB 2PTKA 2CPKE 4E4NA 4R7HA 1ZOGA 5DEWA 3PLSA 2I1MA 2XKDA 5LXMA 4D2SA 4O0VA 5IU2A 5JFWA 4AT3A 4IX4A 2JIIA 4CMUA 4LGGA 3OWJA 4CD0A 2X39A 5HCXA 3KMMA 1OBDA 2WMWA 5CSVA 5FBNC 3DAJA 5AM7A 2P2IA 1OL6A 3NUXA 2W9FB 4FMQA 4QDEA 3VWAA 3F5PA 5IF1A 1Q61A 2G9XA 3POOA 4MBJA 2PVFA 2XNBA 1G5SA 2WD1A 3LMIA 3R6XA 1H08A 4JX7A 4DYMA 3W0NA 2VX3A 3PA5A 4BJJB 3ZXZA 4IVBA 4EONA 4TYIA 4S33A 4M97A 1J1BA 3TIYA 3FZOA 3FQEA 3UVPA 4DEEA 2UW3A 3LFBA 2YM3A 4OBQA 4A9YA 2XJ1A 3M2WA 4IAZA 5HIBA 4EK8A 4BDCA 4HOKA 4GJ2A 1OB3A 2XK3A 4IWDA 4F70A 5J7HA 4MNEA 3G9NA 3EZRA 4BTKA 4KIOA 4Z16A 2BCJA 3V6RA 4IB0A 5HX6A 1T46A 3C4ZA 4E6CA 5KKRB 4HCTA 2BIYA 3SRVA 4O7RA 5HVKA 3MB6A 4XLIA 5FRIA 4ARKA 4D2WA 4RZVA 3V5QA 3TNIA 4BDBA 3KRJA 4LDTA 3V5JA 2C3JA 4CZTA 5AUWA 3VBWA 4F7NA 3F7WA 4BHZA 3ENHA 4QTBA 4G5PA 3F5GA 4RVKA 1CTPE 4BDHA 4WIHA 2O8YA 4D9UA 5M06A 4P5QA 4O1PA 4AACA 4CMTA 2AQXA 2HW7A 4FZDB 1M2QA 5CF6A 1XBBA 4D4YA 4AOIA 3VVHA 3W2OA 2XIKA 4EUTA 3JVRA 5M4IA 3NYOA 2PVLA 2W1CA 1CKPA 4FKQA 1LPUA 3I79A 2ZYBA 4G5JA 5CEQA 4BWPA 5BV3A 3QD0A 1WVWA 3BQRA 3QUPA 4DITA 3DFAA 4I5MA 3ZFXA 4QNAA 4Z3VA 5J9LA 2H96A 4DEIA 3JR1A 1OL7A 4H3QA 2V0DA 3DCVA 3U54A 4G3GA 3TZ7A 4YHTA 3ZBXA 4LGDA 5FXSA 4ZMFA 5DT4A 4B9DA 1SM2A 5AUVA 3QF9A 4F63A 3ZTXA 4A07A 5A14A 2XJ0A 3E7VA 1WAKA 2CKEA 3VO3A 3D0EA 3W18A 4AXFA 4U9AA 3FSKA 2YEXA 4IB1A 3UQGA 1IRKA 3MA6A 4IZYA 1FMKA 4O2ZA 5F4NA 2W1FA 4BF2A 3R21A 4W4XA 1Q8YA 1OIQA 2IW6A 4G9CA 5F1ZA 4WNMA 2QG5A 4O7LA 2V22A 3FKOA 3OZ6A 3PJ1A 1ZOHA 4QMYA 2YIQA 1OGYA 3UZRA 4FKVA 4M12A 3V01A 1SMHA 4EBVA 2HAKA 4O7WA 4RWLA 2EXEA 1IA9A 3MPMA 4ANBA 4QP6A 2UZNA 3E88A 3T3UA 3U6HA 3U87A 3W32A 4FTOA 4CXAA 4D0XA 5LOHA 1PRYA 4MHAA 4KAOA 4RJ3A 4FIIA 1Z57A 5EHLA 4C58A 4GIHA 2ETKA 3ROCA 4FZAB 4QMVA 4IX5A 4KINA 1XH6A 1Y91A 4BCFA 4RPVA 2I7QA 2UZLA 3Q9YA 3K3IA 1ZMWA 4LMUA 4NUSA 2HWPA 4P5ZA 3FMJA 4DFYA 2GFSA 2ONLC 3NLBA 2R7BA 4LQMA 1OUKA 3DBEA 2XBJA 1URCA 4YJUA 1NA7A 3D83A 2ZJWA 5CEOA 1VJYA 3HLLA 5HCYA 3QTUA 5C8MA 2FYSA 3LXKA 4JT3A 4YNOA 1PXPA 4JQEA 4B8MA 2IZSA 3MJ1A 4JL9A 3SW4A 3R9NA 3UG2A 3UO6A 1KWPA 4PP7A 1YHSA 2ITOA 3NGAA 4IB5A 4GL9A 1K3AA 3SOAA 3ZLSA 5J9YA 1J7UA 1W84A 1YOLA 2WTDA 2Q0BA 1IG1A 3F3TA 3FQHA 3GT8A 5AUYA 1J7IA 3NS9A 3QHRA 2VWYA 5ANOA 5HICA 1RE8A 2FSMX 2UZOA 3TKUA 3AG9A 3PP1A 1WBVA 4OT5A 3R71A 4KIKB 1STCE 4IZ5A 2VN9A 2DUVA 2YWPA 3SDJA 2PZYA 4X3FC 1W2CA 5LMBA 2QLQA 1I44A 2CHLA 5CU3A 2YJRA 4M13A 4YTFA 2JDSA 3O51A 2J0KA 2C68A 3QC9A 4G34A 3UYTA 5KBRA 4YJSA 3S95A 3C4FA 2IWIA 4U6RA 4NKSA 3WIGA 4F6UA 5L3AA 5HLPA 4KB8A 3EKKA 3MYGA 4AWIA 4JDJA 3FC2A 4FK6A 3GVUA 4EHZA 4EZ3A 1CDKA 2CN5A 3LE6A 3CE3A 5EYKA 3CIKA 3QQGA 3VNTA 3COIA 4UWBA 1OECA 1P4FA 2OJJA 2R7IA 5B2KA 5LVOA 5AV4A 4DTKA 5AV1A 3ACKA 4XBRA 5HIEA 3ZEWA 3HMPA 2XNOA 5FP6A 2V7AA 3R30A 5EDPA 1QL6A 3AOXA 4I22A 4NCTA 2WGJA 5HD4A 2UW7A 1WBSA 4I6BA 3IECA 4LUDA 5E8YA 4XNEA 3W0RA 5M09A 3KULA 3ERKA 1FOTA 1PMNA 4I41A 4IAFA 4C2WA 4L68A 4KKEA 3KXGA 2A19B 2WTIA 3P9JA 4O96A 3ZC5A 3LMHA 3RAWA 3GEQA 3RJCA 3WYYA 3W0MA 5DVRA 4H3PA 2YLFA 4XS2A 5C27A 5E1SA 1Q3WA 3E62A 3L8XA 3F2AA 5EYDA 4F9CA 3U8WA 4O7YA 2XK7A 4F6SA 3FZSA 2F49A 3EH9A 3GC8A 4K1BA 4L3JA 5E8WA 5GZ9A 2WTKB 5AP5A 1GZOA 2A27A 4A7CA 3R2BA 2NPQA 5CQUA 3G6HA 3LW0A 2ITQA 4M8TA 2HELA 5AAFA 1GNGA 5AP4A 3AC3A 3LCDA 3NZ0A 3E5AA 4FNYA 1B6CB 4FT3A 3TJCA 4RC4A 4D9TA 4E26A 4LOQA 4AZVA 4FICA 4H1MA 5L2WA 1QCFA 3K54A 3QRUA 4ZS0A 4QMQA 4S31A 5E8UA 5FTQA 2GS7A 3DY7A 3I6UA 4D55A 4NK9A 3DK7A 4HGLA 2W96B 5CF4A 2PL0A 3JXWA 1G8SA 2YJSA 5HLWA 1BL6A 2C5OA 4I4FA 2HWOA 4JAIA 4EOLA 4BTMA 5AUZA 1H07A 4RJ5A 5EOLA 2YIRA 3MI9A 3LFQA 3MPTA 5A9UA 4QTEA 1GY3A 4MH7A 3F66A 3WBLA 4BCJA 2J6MA 2O64A 5CSPA 1GIHA 2ZMCA 4GKIA 4LV7A 4L46A 3AKKA 4AT5A 3PY3A 4CMOA 3QXOA 3OFMA 4WRSA 4FTAA 3R1SA 5HQ0A 3FLZA 3QZGA 2W4JA 2QHMA 2R3LA 5BVFA 1FGIA 1OI9A 4XMOA 2WEIA 3HEGA 5M57A 2OXXA 3BE9A 1Q8TA 5ANJA 3RCJA 1OBGA 3LCKA 2CNUA 2PHKA 3E63A 4FNZA 3R9RA 5GIPE 3QX2A 4BDGA 4ZTQA 3R8PA 4E1ZA 2PUNA 4BGGA 4A4XA 4ALWA 5IA4A 4O82A 4GT3A 4ASDA 4QRCA 1UU3A 4IC7A 5C4LA 4C33A 4HYHA 5HD7A 4II5A 2UZWE 5G1XA 4ASZA 5JFSA 4RQVA 2GNGA 4E8AA 2JKMA 3ZO4A 2QVSE 4FIHA 2HY81 3SOCA 5ETFA 5AR8A 3MDYA 3LCSA 2WB8A 5BVKA 3PDTA 4JNWA 3MIAA 5HG8A 4ANOA 3GBZA 1OPJA 1W7HA 3P4KA 4YNEA 5CEIA 4HZSA 3UMXA 4AZFA 4QPAA 2R3OA 3BV2A 3QQJA 5EI8A 5L6PA 5HE1A 4ERKA 4MF0A 5M4FA 5T68A 2XARA 1YQJA 5LARA 5IA0A 3TEIA 3C1XA 1QPEA 4IWQA 5CU6A 4FL2A 4EKKA 2YM5A 3NFFB 4O7NA 3MH2A 3C0HA 2ZDTA 2QONA 1ZLTA 4Y73A 5HCZA 3OWPA 3W33A 5TOZA 3EYGA 2BFYA 1FINA 1CKJA 1PMEA 3DB8A 5C8KA 3ORZA 3DK3A 4CNHA 3T9IA 2XNPA 3MBLA 4K11A 4FIFA 4PTCA 2I40A 2YITA 3PIXA 3PXZA 2NP8A 1Q4LA 1Y6AA 2XF0A 3QKMA 4J52A 4U40A 4X3FB 2OO8X 4EK4A 2XM9A 4RIYA 3NW6A 1ZYCA 4BCKA 3KCFA 5FUTA 5HG5A 5EFQA 3EQPA 2YERA 5FTOA 4LRKA 3PE1A 4BRXA 1H1SA 1WZYA 4D4RA 4NT4A 2PUPA 4DDGA 4NM5A 2Z60A 4MYGA 4XV1A 5CT7A 4AE6A 3V8SA 4FRFA 3F9NA 3BU3A 3GNIB 2BKKA 3CEKA 3IS5A 1X8BA 5FM3A 3V5TA 4EQUA 5CY3A 4DFUA 4EEVA 2B53A 4BYIA 2GTNA 3I60A 3II5A 2BAJA 3NNVA 4NH1A 4AQCA 3KF4A 2QOFA 4G6NA 4O1OA 4KD1A 3G51A 4DINA 3Q2JA 4UV0A 4G3DA 2Y6OA 4A4OA 1PHKA 2OG8A 3MFTA 4FSNA 1SVGA 2P3GX 3R0TA 5DT0A 2C4GA 5H8GA 4C61A 5CEKA 4PTGA 3BLRA 3OCSA 4A9SA 3AC2A 4CFXA 4CCUA 5I0BA 3HX4A 4EK6A 2GNIA 1R3CA 3RAHA 3TZ9A 5K5NA 2XK9A 5GINE 4W8EA 3CQUA 3V8TA 1XMLA 2FUMA 4O2PA 5AR3A 2QD9A 1FVTA 4HNIA 2NO3A 4E4MA 2FGIA 2UVXA 4AW0A 2HZIA 1V0BA 3G33A 3U9CA 4MBIA 3MIYA 2IVSA 4JAJA 2LAVA 3VS7A 3VUMA 4AT4A 4CZUA 5KHWA 4J97A 1HCKA 2G2IA 2ZB0A 4GH2A 4MNEB 3ZRLA 2X7GA 4ERWA 3Q5ZA 3ZUUA 5BPYA 2FA2A 2E9VA 3JPVA 5LVMA 4AW1A 3W2QA 4ANSA 4BZDA 5ACBC 3F3VA 3SRVB 1V0PA 3ZO3A 1GZKA 3PFYA 2G2FA 5A6NA 3CY3A 1G8KA 2R3MA 1XKKA 4QEBA 3BGQA 4X0MA 1PYXA 3QZFA 3Q9WA 1EH4A 4JDIA 4NM7A 5IH6A 4UB7A 4AU8A 2G15A 2ZMDA 3K3JA 5AP0A 2OK1A 4ACMA 3VS6A 2WZJA 2X9FA 3WZEA 4P7EA 5GZAA 2YM8A 3UQCA 4M15A 4CFMA 4GUBA 1ZYDA 5DG5A 2C0IA 3IW4A 2QU5A 1KOAA 2HIWA 2YZAA 3NYNA 1M52A 3OHTA 3OUKA 4RSSA 5EDQA 3QUEA 2OJGA 3GC0A 2BZIB 4DFNA 1UKHA 2IO6A 4IQ6A 4F4PA 3I5NA 1BMKA 4ONAA 3QCSA 1BLXA 4QYGA 3DQWA 4DEGA 3RK5A 3ORXA 4O38A 3FZTA 3NAYA 4PNKA 5CS6A 5AA8A 3RWPA 3MB7A 5HO6A 1FGKA 1W2FA 4LRMA 1A9UA 3MW1A 5IEVA 4O0WA 2CLXA 3OOGA 3O50A 3UMWA 4G9RA 2PVNA 4MXXA 4AZEA 5BNJA 4D2TA 3BLAA 2FSTX 4EYMA 3OUNB 3Q5IA 3GXLA 4J8MA 2GS2A 3KGAA 3P08A 2VWBA 4GEOA 4WNOA 2HZ0A 5TE0A 4F9WA 1FVRA 4AGDA 2ETRA 5K3YA 5KUPA 5EK7A 4QMPA 4APPA 2HZNA 4RX9A 1OMWA 4DCEA 1OITA 3IW8A 4I24A 3PG3A 4O7SA 3GU4A 4WG3A 3LXLA 3NNUA 4PWNA 3UDBA 3ZLWA 1UWJA 3AT4A 4U81A 4FKPA 2XRWA 4FKSA 5AAEA