2XKEA

Structure of nek2 bound to aminipyrazine compound 5
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
277
structure length
243
Chain Sequence
SRAEDYEVLYTIGTGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDLKPANVFLDGKQNVKLGDFTPYYMSPEQMNNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Aminopyrazine Inhibitors Binding to an Unusual Inactive Conformation of the Mitotic Kinase Nek2: Sar and Structural Characterization.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 243
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xkeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xkeA01
2VAGA 2ZJWA 2W9ZB 2XKCA 3QZHA 2O8YA 5F9EA 4KBAA 3VS7A 2IN6A 1OIUA 4BY9E 2X8IA 1FVVA 4LUDA 1V1KA 3EJ1A 4XBUA 4JAIA 4K6ZA 4JIAA 2X8DA 3HDNA 4J98A 3ZSIA 4FEWA 5CEMA 3VIDA 3FI8A 2VWUA 2AC5A 4KIKB 1B38A 2C6LA 5K5NA 3QQJA 1LR4A 4FE2A 3VS5A 3OBGA 2JD5A 3OUKA 1UVRA 4HGSA 4O0XA 3IECA 3UO5A 4NYEA 2PL0A 5DA3A 2WMVA 4HOKA 4IAKA 2I0VA 1XO2B 1NW1A 1W8CA 3FMJA 5JQ8A 4FVPA 3HAMA 5CZHA 4XG4A 5HCXA 4ANNA 4OT6A 3WILA 2HK5A 1YDSE 3ZLXA 4EQCA 2RIOA 2HXQA 4JR3A 4XH6A 3LE6A 2R64A 1BLXA 2C5OA 4AGCA 4FSWA 3QU0A 1OL2A 1Y6AA 4YJQA 5E4HA 1PRYA 4L7SA 5AADA 3O50A 4YP8A 4U81A 4I0TA 3RPVA 4B0GA 3A8WA 4RC4A 5K0KA 3RAIA 4O2PA 1JKTA 3GC9A 5CXHA 4U40A 4FTOA 2P2HA 4O38A 1SMHA 2UUEA 2ZOQA 3TKIA 2J6MA 3MVHA 3SLSA 3V5PA 4F9YA 5BVKA 4PP7A 5IQHA 5EYMA 4AG8A 2Y8OA 2Q83A 4FSNA 3AC4A 3Q53A 3QZFA 5AV0A 3LPBA 4P90A 4ZTSA 5I5ZA 4ZMFA 3NMUF 5EHOA 4CCBA 3O8PA 3PFQA 4BZNA 4F1OA 4MNEB 4X2KA 4DTAA 4N70A 4XNEA 1WBVA 3M11A 4Z55A 3N4VA 4BDAA 3RHKA 4O27B 2JIUA 3PVBA 4JDKA 2J50A 4QMOA 3TUDA 3PXKA 4GKIA 1UU8A 3PE2A 4AOTA 3LFDA 4AT4A 4D58A 5CY3A 2PSQA 4UN0C 5J7BA 2YABA 4R7HA 5D9HA 1R0EA 4MQ2A 4DYMA 4AFEA 3FZPA 3ZO4A 4AWIA 2P0CA 4DEBA 4HYHA 3QYWA 4R3CA 5CQUA 4RJ7A 4O7WA 5ICPA 2Y9QA 1CMKE 4C4GA 3SG9A 2JITA 4G3CA 2GTMA 5CAPA 4OBPA 3TDVA 4QQ5A 1GJOA 4NJ3A 3PIZA 4H3QA 4KB8A 4KKEA 5E91A 5AR4A 4A4LA 2XB7A 5LMKC 4LOPA 2OW3A 3U6IA 4R1VA 5L2TA 1CTPE 2ERZE 5FP6A 1Y91A 4YJTA 1WCCA 2PVKA 3DK3A 3CE3A 4L3LA 2OFVA 5IDNA 2RFNA 4Z7HA 4M66A 1PHKA 1Q97A 4XV9A 3VUIA 2WXVA 2PVRA 3MJ1A 1L8TA 4LOQA 4U41A 5E8XA 2OF2A 1Q99A 4IVAA 1ZYDA 4GIHA 3I79A 5IA2A 4DINA 2XRUA 4XX9A 3DA6A 3NIZA 4Y95A 4C4FA 2JGZA 5ITAA 3NRMA 3COKA 4KD1A 4YZBA 5FBOA 2DQ7X 4FG7A 4AFJA 3O2MA 2QHNA 1DS5A 3FPQA 4FG9A 1PXJA 5HEZA 4ZSLA 4RPVA 4I92A 5KMOA 2X2LA 4AP7A 5AP3A 4ZOGA 2RF9A 4QMQA 4U44A 1Q4LA 4K8AA 3EQCA 2C3IB 3AT4A 4GYGA 4E5AX 2JLDA 2F9GA 5LMKA 2C6IA 3K5VA 2WQMA 2WELA 3ENMA 3FLZA 3KMMA 3OC1A 4M0ZA 3ETAA 4IEBA 2OF4A 3U54A 3ZRKA 2VTPA 3A7JA 3R04A 4FL3A 4MXAA 3IOKA 3PA3A 4MXXA 4X3FC 1Q8TA 2FA2A 3DBQA 4NWMA 2XYUA 4IANA 3WF5A 1QMZA 3PRFA 4DG3E 5DH3A 1M7NA 2GS7A 3QQLA 4QTAA 1GIIA 3R9NA 1H4LA 3DU8A 2BRGA 5HG8A 3D5XA 5JFSA 1OIYA 4FSRA 4EC8A 2AC3A 2G2IA 3PZHA 4L43A 3UP7A 5EOBA 4ANMA 3L8XA 2YWVA 2JEDA 3TL8A 4E6AA 3NUSA 1J7UA 3KCFA 4XV3A 2Y4IB 4TWCA 5K4JA 4MD8E 5AP5A 3RVGA 4BRXA 2GNJA 4CD0A 4DFLA 4EK4A 4BCKA 3S00A 3Q9WA 4I6QA 4MXZA 3MY1A 4QP1A 4YTFA 3DXQA 4E4XA 4IVDA 3KL8A 4BI1A 2EB3A 4HCTA 4YJPA 3BYOA 4FIJA 3UGCA 4AXAA 3AT2A 4YC8A 4YLKA 4GJ3A 3EL7A 4IC7A 4JDIA 2XJ2A 3LJ2A 5JZNA 5KMNA 4TYIA 3DLSA 5EHYA 1P2AA 2UW9A 2I7QA 3R1QA 4YHJA 3OS3A 4X0MA 3LM0A 4FF8A 3IW6A 4BVUA 3C4CA 3VQHA 4L46A 4UBAA 4AUAA 4PQNA 5H9BA 5DR9A 3EQDA 1FINA 3VJOA 4BKYA 2X39A 3MDYA 4F64A 4PDYA 5M4UA 4EK6A 4G3EA 3C5IA 1JKSA 2OIQA 2ITOA 5E8UA 3HV6A 2ZV2A 5CALA 4CRSA 2QLUA 4FOCA 4DAWA 4EH4A 5FBNC 1U5RA 1U5QA 4HNFA 2CGUA 4E6QA 5FDPA 4J96A 2X8EA 2YEXA 2BRMA 3BHUA 4Z16A 2W1GA 5EI8A 3EQFA 3GFWA 4RT7A 5HE0A 4BL1A 2YZLA 3PDTA 1GIHA 4W4XA 4Y46A 4EHGA 3A4PA 4JQ8A 2UW6A 3SG8A 4JQEA 4FKGA 3E7OA 3VBYA 2R4BA 2XJ0A 5J79A 4WOVA 1YDRE 2C1AA 4EKKA 4CQGA 1BI8A 2OI4X 3NIEA 4GVJA 4V0GB 3LXKA 3R8UA 4TWPA 4AOJA 3PWYA 3EH9A 3OG7A 3UNJA 4F9BA 1P4FA 3BYUA 3CSVA 2EUFB 4W8DA 2FGIA 3QXPA 3TTIA 4NTTA 2XMYA 5CU4A 3BU5A 4BDCA 5JKGA 3D94A 2WQBA 3OY3A 3DJ6A 2GNLA 2H8HA 1Q8YA 2YCRA 3EIDA 4QOXA 3VO3A 4FKQA 5ETAA 4O7VA 2CPKE 4LOOA 2C3JA 4RWJA 2WMTA 5AMNA 2FSTX 5B2LA 2XNEA 4B99A 3QTIA 4S31A 5IH6A 2UZOA 4QMZA 4HVDA 5C27A 3BLQA 5CXZA 5EM6A 4EYJA 2XNPA 1FBNA 2WOTA 3KN5A 3CPBA 3GBZA 3IGOA 3IONA 4S34A 4AZEA 4F0IA 3TXOA 4O0RA 2QOKA 2JAMA 2VWBA 4LRKA 4BF2A 4F1MA 4J8MA 3HV5A 4G16A 4DF3A 4RIYB 2X9FA 4EK3A 1H00A 4EOMA 3KRXA 2IVSA 2BZJA 3FLYA 4QQJA 4FIHA 5ANDA 3I81A 5EFQA 4QTEA 2HYYA 3R7UA 3UDBA 5AA9A 2ONLC 1CSNA 1U54B 2XK6A 1PKGA 4AA4A 5M53A 4FTNA 3D83A 2XM8A 4B6LA 4A06A 4HZRA 4BZDA 2XP2A 4ONAA 4NK9A 4WSQA 4ZP5A 3QZGA 3RNIA 5HTIA 4FSUA 4E93A 1APME 1XH7A 5FXQA 3WYYA 4MXCA 4CVAA 3FZRA 4UEUA 5IQEA 2OIDA 3HYHA 4M69A 5D7VA 5LVNA 4JX7A 5JZJA 4TY1A 5F94A 2UZNA 4IMYA 2VWIA 2VO0A 3HMNA 4R5SA 4P4CA 2BDWA 4C4JA 4NFNA 3QF9A 2HIWA 4XG3A 5FEEA 4EOKA 4FVQA 1Q8WA 4YZMA 4PPCA 2UZTA 3EKNA 4WO5A 4J52A 3VUGA 4IM0A 3CKXA 3I4BA 4GW8A 3LM5A 3H0YA 4F7NA 3F3VA 1NA7A 4WRGA 4F7SA 4RX9A 3U55A 5M4FA 4JNWA 2CGVA 4UMUA 5A4TA 2QOFA 4FT0A 3SXFA 3R71A 1VR2A 4MEDA 1YOJA 2UZWE 3MH2A 4BWKA 4G17A 4CKJA 2XCKA 2Z7RA 5ANGA 5ANKA 4APCA 4OLIA 1OBDA 1PKDA 4AAAA 3NUXA 4QNYA 2HAKA 2R3JA 2H6DA 4XYFA 4XP2A 4BIBA 4U79A 2WTVA 1REKA 3DBDA 4EWQA 3ZLWA 1F5QA 4RX5A 5FXRA 5HICA 3IDBA 4U0IA 5HU9A 2IPXA 4IB0A 3DTWA 2GSFA 3HMPA 4FV7A 3I6WA 4O6EA 2IVUA 4MD9E 5FQDC 4S30A 5KMIA 4JBVA 4E73A 4G31A 5C8MA 3HMMA 1NXKA 4XP0A 4LRMA 2BAKA 3BPRA 3I60A 4XJ0A 4ZSEA 3Q5IA 5KMKA 5EYKA 3VUHA 3EQBA 2HELA 4YTCA 3PE1A 1ZYJA 3GU7A 4YTIA 5DFPA 3R7OA 5M08A 1MRVA 3CIKA 3ODYX 4YLLA 5DOSA 1YWVA 2OJ9A 2XIKA 4OTRA 3VC4A 2NPQA 1YRPA 3BQRA 1OM1A 4FSQA 4TNDA 5CEPA 3RWPA 3MVJA 3QYZA 3OEFX 3RZBA 2B9JA 2CGXA 3HKOA 3GI3A 3IDPA 3F5PA 3Q04A 4R7BA 3VBTA 5EM5A 4QMUA 3TZ9A 4R78A 2A2AA 4ID7A 4OTFA 3G9LX 5JGDA 5EQYA 4AT5A 3NCZA 3OW3A 3OXTA 2ITNA 1YXXA 4E6DA 2XKFA 2J51A 2GHMA 2WMSA 5AX9A 3DKFA 4YNOA 1WBWA 2W5HA 4KNBA 2XZSA 3QALE 5D7AA 3S2PA 4WKQA 3V5QA 3UPZA 1TQPA 1WBSA 4F99A 5EYCA 2OZOA 3D0EA 4QD6A 4PPBA 4RWKA 3WYXA 2CNUA 1H08A 3PVUA 4FTAA 4BBEA 1GZ8A 2W1ZA 2O0UA 5KX8A 5H2UA 4ERWA 4FEUA 1T46A 2OGVA 3FMNA 4F1TA 2B4SB 2X6DA 1SVEA 2HOGA 2EXEA 1M2PA 4Y85A 3SXSA 5HD7A 2WKMA 2ZDTA 4EC9A 3UJGA 2JIIA 4X6RA 4IJ9A 2ZV7A 3PP0A 5AP6A 3U6JA 3W2RA 5BVFA 5AIRA 3ACKA 5AP7A 4D1ZA 1ZY5A 2Z8CA 4AE6A 2R3PA 3D5VA 5HOAA 2XBJA 1FMOE 3NSZA 3IG7A 3G6HA 4NKAA 4OBOA 4ZTQA 2B54A 5HE3A 3R0TA 3ZHPC 2P55A 2W99B 4RFYA 2OSCA 4OAUC 4N57A 1OUKA 4I6BA 3P7BA 4JG8A 4PNKA 5DR2A 4JJRA 4WD5A 1QCFA 4M3QA 3I0OA 4O0VA 5CQWA 3DK7A 1H24A 3CQUA 4M14A 4RSSA 3NUAA 4L7FA 4D28A 1YWRA 4M15A 4I5MA 4QRCA 3RKBA 3JYAA 2VTTA 1URCA 4OR5A 4RFMA 4Y72A 3V6SA 4D1XA 1P5EA 3SQQA 4D2RA 4V05A 3GFEA 4FV5A 2I0HA 2OZAB 5DMZA 2HY81 3E5AA 4I21A 4G6LA 1XBCA 3WOWA 4XOYA 2WQOA 3GT8A 3QUDA 5IPJA 4FT5A 3FMHA 3DAJA 1U4DA 2VV9A 3C0IA 4OT5A 2YM5A 4I5HA 4BCPA 3R2YA 4TYJA 4IQ6A 5AM7A 3PVGA 5DEYA 4QP3A 2YIYA 4MVFA 4NM0A 2V7AA 2GHLA 4LMUA 2PZ5A 1NVSA 2I6LA 5TO8A 3NNWA 3DGKA 1H0WA 5DRBA 3GU4A 4XG7A 1PMUA 2W9FB 5AV2A 3ZC6A 5J7HA 4Z7GA 3W1FA 3QBNA 3E8NA 3AT3A 2F2CB 3Q9XA 4FKRA 2QVSE 4G9CA 2JKQA 3R63A 3UPXA 4FA2A 4MD7E 2GFCA 2VX1A 5EOLA 3DLZA 4X2GA 4MBIA 3ZTXA 2A0CX 3D7TB 4PF4A 3ZXTA 3SVVA 3GGFA 5T3QA 5D41A 4PDOA 4I0RA 3QGYA 5CI7A 4LM5A 4LRJA 2CKOA 5HE1A 3BZ3A 2QODA 2HXLA 2BROA 5IDPA 2JBOA 3LQ5A 4OAVB 3MB6A 3QHRA 1X8BA 4WA9A 2VTHA 4D4RA 5I4NA 2WNTA 2PZRA 3DNEA 3UMXA 4GYIA 4CZYB 1U46A 5IA1A 5IEXA 1KV2A 3T3UA 3HEGA 3HUBA 5C01A 2PPQA 2RL5A 1Z5MA 2WAJA 4NH1A 3V5JA 4CZTA 5LVMA 4LGGA 4DTKA 2VTJA 2JAVA 3P79A 4L45A 1PXIA 3IO7A 4IZYA 4Q9ZA 5L6WL 1WVXA 4B7TA 5JGBA 4ZLYA 4LG4A 2VTRA 3TACA 2PHKA 3TWJA 3UYSA 3EN7A 4HZSA 4OTIA 3V5LA 4YMJA 3B2TA 4TWOA 3VS1A 5B7VA 3PRIA 4IX3A 1H1PA 4IFCA 1WVWA 3P86A 2C6OA 1G5SA 3PXYA 3H0ZA 4GU6A 3EFJA 4I41A 3TJDA 2BZIB 1GOLA 2EWAA 2Y6OA 3R7IA 4RVKA 4R1YA 3KQ7A 4RMZA 1YOMA 3ALNA 4GG7A 3QFVA 3SRVB 4ZZNA 2JIVA 4GUBA 5A6NA 2PU8A 2PWLA 4HYSA 5FRIA 1MQ4A 5AAGA 3NWWA 4II5A 3QTUA 2QO2A 2QONA 1Y8GA 4ZTNA 3W8QA 4A9SA 4G5PA 5KKRC 5I9VA 3UVPA 4BN1A 4FEXA 4ALVA 3FL5A 1OL7A 4ITJA 4NUSA 2GNHA 4IB1A 4W8EA 4J99A 4M7IA 1KOBA 5L2WA 2QCSA 4C61A 4JL9A 5D1JA 3UOKA 3FSFA 3FYJX 2BILB 1YWNA 1YXVA 2Z2WA 5C1QB 4EYMA 3TNHA 5IUGA 2CN5A 5DHJA 4MCVA 5ANIA 4EOIA 2JC6A 5CSWA 3DCVA 3H9OA 3MY5A 4ANQA 2B9IA 3KXHA 4GL9A 2UW7A 2B53A 2QG7A 5HG5A 1ZMUA 4XV1A 5KUPA 4NTSA 3TIZA 2ZYBA 3VS3A 3JR1A 2ZMCA 2CLQA 4D2WA 5JFXA 4DG2E 4A9TA 3VN9A 2E9VA 5HBJA 3LFNA 4OTQA 5J8IA 2BIYA 3JVSA 3NCGA 3IDCA 3DBFA 4Z3VA 4HYIA 5GJDA 4TRLA 4EOPA 3WZEA 3SD0A 3DXNA 4X2NA 3D5UA 1FGIA 2C4GA 3IW8A 3R7EA 2BDFA 4GS6A 5DEWA 3QCXA 3MS9A 4ZK5A 3TEIA 2Z7SA 3PIYA 3KXNA 4QMSA 5IQIA 4O21A 4BI2A 3QA0A 1ZLTA 4PPAA 4BDBA 4GK4A 3O8UA 4WG3A 3TV4A 3P78A 1NY3A 4YPSA 2YCFA 4MBJA 4ZY4A 2ZV9A 3Q3BA 4F0FA 4MXOA 4NM5A 3GU6A 4WG5A 4F09A 3DTCA 2VGPA 3KXXA 1ZOEA 3RINA 4O7SA 3ZRLA 2FH9A 2IVVA 3QUPA 4K2RA 4D0XA 4TL0A 1BI7A 4RQVA 5JMSA 2YJRA 3MB7A 4RRVA 5IA3A 2XUUA 3G9NA 1OECA 2GNIA 4FTKA 3ZO3A 5B2MA 3LLAA 5M07A 3GXLA 4C0TA 5I9ZA 1IASA 1GZKA 2WTWA 3P1AA 4CCUA 3UOJA 1I44A 4HJOA 3WZJA 2OXXA 3O8TA 4Z9LA 4YURA 5CYIA 4HVSA 1ERKA 2VRXA 1LEZA 1JLUE 1QPJA 5EK7A 4EOLA 4AF3A 4MXYA 3Q9ZA 5CT7A 5JH6A 1YI6A 3UBDA 3ANRA 4MWHA 4AA5A 5CENA 4I93A 3UIXA 1BKXA 2R3LA 4X3JA 2VWYA 4ASEA 5L2IA 1M7QA 5ACBC 5IMXA 1WVYA 3EN4A 2HWOA 3OWJA 3GC7A 3PSBA 4FX3A 4TYHB 4ACDA 4QMNA 4JR7A 4YJSA 5ETFA 3FBVA 3GENA 2B52A 4O0TA 3MPMA 4KIPA 3HP2A 4H1MA 5A6OA 1OPKA 1R78A 4WSYA 4YZCA 3VVHA 4FV2A 3S3IA 3KF7A 2C6EA 3AQVA 3DY7A 4QP8A 5CU0A 3ROYA 3GU5A 3D9VA 1F0QA 4MNEA 1YHSA 3BHHA 1LEWA 3NUNA 1YOLA 2BALA 4I6FA 2PYWA 3MY0A 5FLFA 1PJKA 2V0DA 3LFBA 2J9MA 1XR1A 3FI4A 4YR8A 1TVOA 4I23A 2GFSA 2XIRA 1YXSA 3GCPA 1Q41A 5DR6A 1UV5A 2BRNA 3KRJA 2W05A 5I0BA 4CYIA 1XH6A 3QRKA 4O7RA 5HCYA 5HKMA 3G90X 2X6EA 4YZDA 1YHVA 2YM4A 4GKHA 1ZYLA 1JBPE 1JOWB 3FQEA 4W4YA 1LUFA 1Q24A 5AP4A 5AUUA 4H05A 4OTHA 4DH7A 5A54A 3HX4A 5E92A 1R39A 1E1XA 2KTYA 2WTCA 3C5UA 3QTQA 4OTGA 4D5KA 4RWIA 1M14A 4DH5A 3HL7A 3NPCA 5KCVA 4IW0A 1K2PA 2WMRA 4AW5A 4RZVA 1J1BA 4CFVA 3E92A 5FWKK 1XWSA 3F7ZA 4B4LA 3NX8A 3K5UA 3ULZA 4ACHA 4NZWB 4P2KA 4JBOA 4D0WA 4GK3A 2P33A 3ZSHA 1FVTA 2HZIA 3FMEA 3NUPA 3Q4CA 4ACMA 4BGQA 4BTJA 4XV2A 4CEGA 1O6YA 3GB2A 4KKGA 2J5EA 3ZUTA 3ZSGA 1YVJA 5IQCA 5HE2A 3TKUA 4UMTA 2JFMA 5HO6A 3PLAE 2GQGA 4C4IA 3ZRMA 4FGRA 4FL2A 2W06A 1VZOA 2Y4IC 2VO3A 2IVTA 1IG1A 3KRLA 4RVLA 3D2IA 3ZLSA 2BRHA 3VF8A 4I6HA 1UWJA 3MH3A 3TUCA 5E8ZA 5KNJA 5KE0A 3GOKA 4RWLA 4UMQA 4BCQA 4U7ZA 3LCOA 1ZY4A 4A07A 5AP2A 3ULIA 2R2PA 2O64A 2XJ1A 3KULA 3IW5A 3N51A 4IFGA 3DBCA 1BYGA 5KZIA 4D5HA 4ZSAA 3I7CA 5GZ8A 2W5BA 3FXWA 2Z60A 1OMWA 3PSDA 3GNIB 3F88A 3UP2A 3F61A 4FOBA 2BFYA 1V0OA 4USEA 2C5VA 5H3QA 1W84A 2A19B 2BZKB 1PXOA 2R7IA 4AE9A 3AOXA 1H1RA 1PYEA 2ACXA 3ALOA 5DBXA 5KO1A 1PXKA 5CU3A 3LMHA 5BX0A 4KSQA 2WMBA 1YI4A 5LVOA 4C58A 2O2UA 3R1NA 4RG0A 3W2SA 3K2LA 3S0OA 5J9YA 3ZM9A 3DAKA 3OZ6A 3LXPA 4NW5A 2UZDA 4EH5A 5C4KA 2C3KA 2F57A 1RE8A 4KIQA 4RIOA 5T6KA 4CKIA 2EXCX 3ANQA 5ANEA 2W1FA 4G3FA 5CU2A 2BAQA 3KC3A 4A9YA 4YSJA 3UVRA 2JKOA 4LV5A 3VUMA 1NVQA 2X0GA 4HCUA 1ZRZA 3FHRA 3PA4A 3KU2A 2O63A 3KY2A 5JK3A 4QO9A 4OTWA 4XLVA 3A7FA 3R9DA 4BYIA 4FT7A 2WB8A 5AUTA 4X21A 2XK9A 4L3PA 2ITYA 3ZZEA 5KHWA 2W5AA 1ZYCA 5AR8A 5HZNA 4O82A 1AGWA 1O6KA 4DFZE 3F6XA 4U6RA 3THBA 3F5GA 2R0IA 3OVVA 3WZDA 5HO7A 3COHA 1XHAA 2YM8A 4PTCA 4OUCA 4JQ7A 4L53A 4MQ1A 3QX2A 3H4JA 3RAKA 4XLIA 5IISA 4NW6A 3R2BA 3RWQA 5K4IA 5B2KA 4FKJA 3SW7A 4JX3A 2DUVA 3ZZWA 3P7CA 3F2NA 4C3RA 3W2QA 3LQ3A 4FNYA 3MPTA 4IX6A 3UZRA 5EH0A 4NSTA 4YC6A 2XK8A 1R3CA 5AUXA 4D9UA 3B2WA 2GNFA 3L9LA 3OWPA 4FKIA 4NM3A 3RPYA 4IDVA 5IH5A 2VTLA 5I9XA 3F9NA 3UZPA 5FM3A 2VTNA 4HGTA 4ZTRA 3HMOA 2OJJA 5EYDA 1O6LA 2XKDA 3TNPC 3POZA 2EB2A 4TWNA 5L6PA 3QGWA 3OEZA 4X3FA 3A62A 5CWZA 3VWAA 4C35A 3IW7A 1SM2A 1WFCA 2WZJA 3U9CA 2XKEA 3EOCA 2PVJA 3U9NA 2GMXA 4X6QC 5L8JA 3UYTA 3PZEA 1HCLA 1W0XC 3JY9A 5EHLA 4O0SA 4XEYA 5LARA 2C0TA 5HCZA 3WIGA 5G1XA 4C7TA 5BYLA 5CSHA 5AP1A 4DE4A 4IC8A 1A9UA 4FTTA 1PXLA 5KZ0A 4CKRA 5H8EA 3CQWA 3C4WA 5BVNA 1PXNA 3EQHA 1PXPA 4DGMA 5IEVA 4IZAA 5CAQA 3B8QA 2WTIA 4L6QA 1VYWA 2XNOA 3OCTA 4I3ZA 3W55A 3WF6A 3V5WA 5J95A 3OUNB 5HVJA 3R7YA 5GINE 1V0BA 3NZ0A 3MW1A 5BQ0A 1T45A 3LQ8A 4IBMA 4BICA 2QO9A 3RALA 4R7IA 4PDPA 3BE2A 1CKIA 1XBBA 5AUYA 3FPMA 4MKCA 3OF0A 3TNIA 4FTUA 5LWMA 3O71A 2QLQA 2VTOA 2GQRA 3FUPA 4BDJA 1XH8A 3SA0A 2PUIA 3R8PA 4O2ZA 3LAUA 4BDDA 4FSYA 4TZRA 5IMEA 3OHTA 3BYSA 3MIYA 2WQNA 4L00A 3E88A 3OFMA 1M52A 5JSMA 3TTJA 4G6OA 1FMKA 3HMIA 4F0GA 5IUIA 3RAWA 5DIAA 4ZJJA 3QLFA 1TKIA 4CG9A 3V04A 4DT8A 5JFWA 3EHAA 4ZJVA 2H9VA 3REPA 4PMSA 2RG5A 3RI1A 4FTRA 2J0LA 4TPTA 4PMPA 4JRVA 3V8WA 3NVMB 3OOMA 5HLNA 3QRJA 1AQ1A 2VWWA 5E8SA 1SZMA 5J87A 4F63A 4HYUA 1RQQA 2G1TA 3DPKA 3ORNA 4KBCA 5EI6A 2VO6A 5E7RA 3U87A 3PLSA 1H1SA 3VBXA 3R73A 3CP9A 4RJ3A 4ACGA 1UU3A 4TN6A 1OI9A 3Q32A 3QC4A 1YDTE 4I4FA 1OPLA 3LFAA 3K3IA 3K3JA 4WBBB 5JRSA 3SOAA 5KHXA 2YIXA 2G15A 3BELA 5E9EA 3GUBA 5L2SA 4PV0A 5TOZA 3UVQA 1YI3A 3PPKA 4NIFA 4G3GA 4YJRA 3AD4A 4BCNA 4D1SA 4RA5A 2BCJA 5CVGA 3UC3A 2VNYA 2XVDA 3ATTA 2P4IA 4KBKA 1FOTA 3QCSA 2O5KA 3GCQA 5ETCA 5JN2A 1B39A 4GG5A 4GFGA 4DFNA 4LUEA 5LCJA 2VO7A 2IZSA 4F70A 4QMMA 3C4EA 4CMOA 3UIUA 4F7LA 1IA9A 1UU9A 3UIBA 2VGOA 4F4PA 4I5PA 4QYGA 3MGYA 5EKOA 2CHLA 3B8RA 3CJFA 5AR2A 4O7NA 1M17A 4FTMA 4EH7A 4C37A 3VW6A 1M2RA 2ERKA 4ANLA 2XF0A 5CU6A 3FV8A 4B8LA 4U3ZA 4CTCA 2YCSA 4F9CA 4DTBA 3MV5A 5CF5A 4GFOA 4C2WA 3KA0A 3PUPA 3CY3A 2HY0A 2YDKA 2R3IA 4GH2A 4CT2A 4YNEA 4FI1A 4XRLA 3LFSA 3R00A 4XG2A 3G15A 4FUYA 4AN9A 1NT2A 5AFVA 2BUJA 5CVHA 1J7IA 3ERKA 1Q61A 2GTNA 3MH0A 2ONLA 5FTOA 2PUNA 3C4XA 4AZFA 4ALUA 3TCPA 3FQHA 5HORA 2FO0A 4I5CA 3EB0A 4RIWA 4EH8A 2FB8A 3BV2A 4ZS4A 2CN8A 2WEIA 3RK7A 1MQBA 3L1SA 4DGLC 4QNAA 3TJCA 4F6WA 2W0JA 4GT3A 5HNBA 4BZOA 3NAXA 4AZTA 3PA5A 4O0UA 5GZAA 4IWOA 2R3HA 4MNFA 2NO3A 4K18A 3R30A 4CYJA 4HPUE 4IB5A 2CSNA 3FL4A 4FV0A 4GRBA 4DLIA 5IQFA 3F3WA 5HU3A 2R3KA 4A9UA 3I5ZA 2X2MA 4PTEA 3VAPA 4AQCA 4QMXA 3W16A 3IW4A 5F1ZA 2B9HA 3PTGA 3E62A 3FLQA 1Q8ZA 1H26A 2PVMA 3C0GA 3EKKA 4TT7A 4O1PA 4EOOA 4DFUA 2A1AB 3DFAA 4N6ZA 2RKUA 5CVFA 3TNQB 3ZEPA 4BCGA 2PVHA 2BMCA 4CRLA 5C8NA 5BMSA 4CLIA 3R1SA 2PMIA 3KB7A 4GEOA 4NT4A 3LFFA 3V8TA 2UW4A 4DA5A 1BX6A 1E1VA 2UW8A 3FQSA 4M13A 3LCSA 2OH0E 2WQEA 4M69B 1RJBA 2ITXA 2YM3A 1IAJA 3UZTA 4M12A 5ANOA 3VUDA 3ATSA 5FDXA 4W9WA 3A4OX 3RAHA 4C4EA 4FEVA 1W98A 3KF4A 4MAOA 3OTVA 4PL5A 3ZO2A 2ETKA 1FVRA 2GS6A 4XUFA 2QU6A 3WF8A 4ACCA 3A61A 4FKPA 1UKHA 2QR8A 4YTHA 3ORPA 3FY0A 1KE7A 4JXFA 5J5TA 5TE0A 4QYFA 3CXWA 2C69A 4ZTHA 2RSVA 3GQLA 1KOAA 1SNUA 3BX5A 5CSVA 2QOIA 4FR4A 4FNXA 1XH9A 3HAVA 5M57A 3D5WA 3IQ7A 4A4XA 4EEVA 4J95A 2KULA 4N6YA 4C3PA 5A4CA 3VJNA 4KAOA 5BYYA 2C0IA 5CF6A 3LJ0A 3WIKA 2BHEA 4S32A 4Y5QA 2C6KA 5GJFA 4EHZA 2XK3A 1CKJA 4FV9A 3ITZA 2PY3A 2REIA 4YBKA 3RHXA 3QAME 3CPCA 3DAEA 3TUBA 2FUMA 4QTDA 5FM2A 4R3PA 4DCEA 3R8MA 3KXZA 3Q2MA 3ZUVA 5IUHA 3P23A 4M8TA 3BGQA 4FKWA 4G3DA 3NLBA 2HENA 3V51A 4TNBA 2ITUA 3OBJA 4DT9A 5FP5A 3QLGA 4NEUA 5J5SA 5AJQA 4DGOA 1U59A 1YXTA 4FIGA 4S33A 1OVEA 2WTKB 4S2ZA 1H28A 3EMGA 3G0EA 4AN3A 2WU7A 1GNGA 5TF9A 3SAYA 3W8LA 4O1OA 4FKOA 3LMIA 2NRUA 4FZ7A 5E8TA 4CTBA 2WMQA 5HESA 4FSMA 4FZAB 1DAWA 4K9YA 2ITWA 4GMYA 3HZTA 4J7BA 5CAUA 4FSZA 4QT1A 1A06A 1Z9XA 3CTHA 3E87A 2IWIA 2QOOA 3F3UA 2RG6A 4UWCA 3VS0A 2XNNA 3BGZA 3RGFA 2JDRA 3MTFA 4ASZA 5JGAA 4DEAA 4EKLA 5CEOA 4APPA 5M56A 3EL8A 3CD3A 5HX8A 4WG4A 1I09A 2YIQA 3PWDA 2XM9A 4USDA 3ORZA 3WE4A 2JDVA 4Q5EA 3R02A 4RLLA 3PP1A 5KBQA 3QA8A 4K0YA 4EH6A 4JVGA 2QO7A 1PMVA 2CLXA 4IVCA 2WFYA 1KV1A 1CDKA 3SRVA 3BBTB 3UIMA 5CAVA 4JOAA 3FAAA 4BHNA 4ENYA 3JY0A 3BBWA 4U5JA 4O6LA 3S95A 3OCGA 4H3BA 4DH3A 3WF7A 4FL1A 2NRYA 2WMAA 2OWBA 2PVYA 3TZ7A 3O51A 3OOGA 5KMMA 4BGHA 2WIHA 3QQKA 3CLYA 4IZ7A 2EU9A 3OMVA 3LLTA 4FTCA 4YO6A 2QG5A 3TG1A 3NW6A 4XHKB 4D2SA 2YHVA 2P3GX 1WBPA 3ORLA 3PVWA 4FGBA 3C9WA 3VRZA 4FNWA 5AV3A 2QOBA 4PL4A 3TM0A 5DGZA 3D15A 2UZVA 4HVHA 1Y57A 5DN3A 3GOPA 5GIOE 2UW0A 3ORMA 3QZIA 4YC3A 2UZBA 3PPZA 2UV2A 5GJGA 3U51A 2PUUA 4HNIA 3UQGA 3W33A 1R0PA 2BHHA 1KWPA 3HRCA 4LQMA 1JAMA 2YWPA 3VNTA 4MYGA 4MH7A 3FZ1A 4ANSA 5ANJA 2PUPA 3OY1A 3MVLA 5AUZA 4NFMA 3GC0A 4U8ZA 4ZXTA 3ZFMA 4CMUA 4DCAA 4PDSA 5I3RA 4J97A 4EH2A 3QD0A 4OBQA 4CNHA 3MN3A 3BWFA 4E5BA 3C7QA 4QYYA 2X81A 5HLPA 5IQBA 4RC2A 3W2OA 4DH8A 5EW9A 4EJNA 3E7VA 3AC2A 4UYNA 4ZTMA 2PTKA 2JKKA 3ZOSA 4YO4A 1DI8A 3ODZX 2RGPA 3SW4A 3RPRA 3H9RA 5IQGA 2BTSA 3AC5A 1PXMA 3NYVA 4G9RA 2W1IA 1ND4A 5EW3A 4CMTA 3NW7A 4IB3A 4BDEA 3V01A 4AS0A 5K9IA 1OUYA 1KE5A 4GUEA 5AR7A 4BGGA 3QQFA 4YU2A 4ENXA 3K54A 4BDFA 2XCHA 4R77A 5E90A 4ZJIA 4XP3A 4F6UA 4MTAA 5J9LA 2OFUA 4C33A 5BUIA 2C3LA 1REJA 2CKQA 2PVLA 4IAFA 3UODA 3AC8A 3EZVA 3IK3A 3R9OA 3KRRA 4BCJA 3SGCA 2BKZA 1W82A 1QPEA 2GCDA 2QOCA 4IADA 3ZLYA 4QPSA 5DT4A 4P5QA 3IGGA 4E8AA 5IF1A 1G8AA 3R1YA 2Z7QA 1KUTA 2UVXA 1BL7A 4WNMA 3QTSA 4LYNA 4MHAA 4E4NA 2BAJA 4EORA 4H3PA 4UV0A 5CF8A 3C51A 1OIRA 2W96B 5EDRA 3EFLA 4ZTLA 5M44A 5DT0A 3PG3A 1UNGA 1RDQE 2FSOX 2XIXA 4EOQA 3BLRA 3QXOA 2CCIA 2ITTA 2I0EA 4XG6A 5JEBA 3PPJA 1ZXEA 3T9TA 5AAEA 3H9FA 3WF9A 3A7GA 2EXMA 3QRUA 3Q2JA 3GP0A 3OD6X 2F7EE 3OCBA 3RPSA 3HRFA 4PY1A 1PF8A 4GCJA 4DG0E 3BEAA 3LW0A 4IM2A 4KIKA 5FXSA 2X7GA 4DC2A 1JNKA 3ELJA 5IA0A 5FG8A 3QRIA 3CTJA 4I4EA 1H25A 3TZ8A 4ORKA 4QP6A 4UMRA 4FSTA 4GU9A 2FYSA 4WIHA 2GHGA 2QKWB 3W18A 3R01A 2XA4A 3TIYA 4AGUA 4BWXA 4ANBA 3F2RA 2J0IA 5AUWA 5AEPA 4USFA 2Y7JA 2C5NA 3E63A 1TQMA 4YGAA 2WTJA 4E3CA 3I6UA 5HG9A 3TDWA 3DJ5A 4GT5A 5AP0A 4CFUA 4RIXB 3FWQA 3T8OA 2RFSA 4FYNA 3GQIA 1TQIA 3NNUA 4FK3A 4D2VA 1GAGA 4O0WA 4E4LA 2P2IA 4N4SA 4D9TA 3DT1A 5AAFA 3V5TA 3W2PA 4DFYA 3HV3A 4U9AA 3FYKX 1OGUA 3FY2A 3II5A 5GNKA 1HOWA 2B7AA 2QOLA 3SKCA 3R22A 3ZFXA 5H8BA 3A7IA 4J8NA 4CV9A 4LI5A 4QTBA 3C0HA 3R7VA 3MA3A 4QMYA 5AM6A 5BMMA 5EG3A 3LVPA 2SRCA 3NNVA 2OH4A 4IHPA 5CEIA 4AGWA 2E9NA 4FKUA 2QR7A 5BYZA 5DG5A 1P4OA 3SX9A 3NEWA 3GCVA 3KCKA 1XH5A 4RLKA 4YPDA 5HTCA 4PWNA 1K9AA 5BVOA 1OPJA 3ZFYA 3FXXA 3KGAA 4NL0A 3MFSA 3L9PA 3QKMA 4O7YA 4PNIA 5E8VA 3UNZA 4FT3A 2PZIA 3DV3A 5E8YA 4F9AA 2W1DA 3PY0A 3P7AA 3GCSA 4UWBA 2PZPA 3CD8A 3OW4A 3MYGA 5EDQA 4M84A 3L8PA 2OG8A 1UU7A 1WBNA 3SV0A 1QPCA 1XQZA 2ITZA 4FMQA 5HGIA 3CJGA 2ZAZA 1WBOA 3KXMA 4X2JA 5CSPA 1ZZ2A 2GNGA 2PE0A 5EM8A 2BRBA 1OL5A 4NKSA 4EHVA 2HCKA 4QPAA 4CSVA 1WZYA 3WZUA 3DB6A 3Q4UA 3L9MA 3PYYA 3ZUUA 2XH5A 2HZ4A 4ZMEA 3FMKA 5KMLA 1KE6A 1WMKA 2YJSA 2C5XA 3FMMA 4H36A 4IWPA 5F20A 4RJ6A 4L68A 2R3QA 4FV3A 4JDJA 1B6CB 5DPVA 3ORIA 3U4UA 1WAKA 4H58A 4KABA 4CFXA 5K5XA 2J90A 2WD1A 4U97A 1ZAOA 3PSCA 4AW2A 4BHZA 5A4EA 4UMPA 5LXMA 4OTDA 4FVRA 3QL8A 4W4VA 4ALWA 1Q5KA 3BGPA 4QTCA 1A48A 3RZFA 3DKGA 3TZMA 3EWHA 2DWBA 3PY1A 4BCOA 2LGCA 2OK1A 5CI6A 4BKZA 4AZVA 4K1BA 2FSMX 3D7ZA 2YAAA 2OXYA 3SOCA 2XRWA 3R8ZA 2VNWA 3AD6A 3Q96A 3RP9A 2OXDA 1DAYA 4D4VA 4IAYA 5M06A 4ZY5A 3PXFA 2BKKA 3L8SA 5IQAA 3IS5A 2Y0AA 5HD4A 3LKMA 5HVKA 3MFTA 3AMYA 3CS9A 3F5UA 3RJCA 3LZBA 3HA8A 4JIKA 4R3RA 3KMWA 4EBWA 2V22A 2HW7A 2YERA 2OIBA 4BI0A 1JKLA 3OT3A 2A27A 4BBFA 5E8WA 1K3AA 2R7BA 5L6OA 5M4IA 3QTZA 3NVKI 2YZAA 3F5XA 5CNOA 1CKPA 4D2PA 5IQDA 3FKLA 4MX9A 3UTOA 2YIWA 4K33A 2I0YA 5A9UA 3VHEA 4CLJA 3BYMA 3NYNA 4UX9A 4C2VA 3CGOA 5IEYA 3AGMA 2IW8A 1V0PA 5CF4A 1H01A 3P0MA 5FEDA 3VBQA 3AC1A 2W4JA 3RM7A 4DEHA 2XEYA 4BC6A 5CASA 3UO4A 4JS8A 3IPHA 1DI9A 4HGLA 2IO6A 4IM3A 2O3PA 4KWPA 4W9XA 4GT4A 3QRTA 2GPHA 1J3HA 3WI6A 2YN8A 3E8EA 2CNVA 4MF1A 4BIDA 1PYXA 2YIRA 2PULA 3W2CA 3OCSA 5DT3A 3R8VA 4FC0A 4QP4A 2C30A 2R3OA 1OZ1A 2X9EA 3KMUA 3QD4A 2R3NA 2X2KA 3SXRA 2OKRA 3RMFA 3G5DA 4ZLZA 3GVUA 2WPAA 3Q9YA 4IAAA 4YUQA 3D2KA 4TTHB 2QNJA 5L2QA 5HNIX 3BHYA 3NS9A 2GQSA 5FD2A 4B8MA 5TR6A 4FNZA 3EQRA 2JDOA 3OWKA 4BDIA 1VJYA 4JT3A 5E1SA 1KE9A 2YACA 4IH8A 3RPOA 5BNJA 5EKNA 3DS6A 3BWJA 1RW8A 3EQPA 3FKOA 3G33A 4C4HA 2IJMA 3Q52A 4C57A 4IZ5A 5AV1A 4FBXA 2YA9A 4FKSA 4ARKA 4K11A 4O7TA 2V7OA 2XK4A 3BYVA 3DQWA 5B0XA 3CQEA 3Q6UA 4BIEA 5A14A 4XRJA 2BZHB 2ITVA 3UMWA 4DBNA 1UA2A 2VTAA 4YHFA 5C9CA 4KS8A 4EH3A 3LJ1A 2VUWA 1SYKA 3TV6A 5CAOA 2R3RA 2IG7A 4QYEA 2HZ0A 3LIJA 3ZO1A 2A4LA 4UY9A 4D2TA 4GFMA 4IAIA 3DQXA 2ITPA 3CR0A 1PMEA 4YBJA 5CSXA 4UZDA 1G3NA 1WBTA 2XIYA 3UOLA 4WNPA 4X2FA 4FUXA 1JKKA 4UB7A 5IU2A 1GY3A 2OJFE 2XBAA 5EI2A 4DEGA 4C34A 2NNWB 3R6XA 4L3JA 4FTJA 2IW6A 4CFNA 3QQUA 3KULB 3QKKA 4FICA 4KKHA 4L67A 4UYAA 4E1ZA 2J0MB 3DKCA 2QQ7A 2J0KA 4YJNA 1BUHA 1QL6A 3DKOA 4IX4A 3FMDA 4CFWA 5LVPA 3U6HA 4CG8A 3DDPA 4HW7A 2R3FA 4V0GA 3A99A 3ZBXA 3FHIA 4EONA 4Q9SA 3ZYAA 3I1AA 3MBLA 2VX3A 3DJ7A 3LMGA 2Q0BA 2OO8X 3E3PA 4IACA 4O84A 1FPUA 2Z7LA 2WOUA 2ZVAA 3BHVA 3PJ3A 4BCMA 3KRWA 4AU8A 3NUUA 3T9IA 3AXWA 4AZSA 1JWHA 3V8SA 1UKIA 3HUCA 5I9UA 2JDTA 3G6GA 4ZS0A 2E9OA 2ETRA 2XNGA 4YZNA 5C26A 4KUJA 3BRBA 1YW2A 4FK6A 2X1NA 3M2WA 3RBWA 2XNBA 4PL3A 2AYPA 2BTRA 4YSMA 1ZMVA 4QMWA 3BCEA 4FEQA 4FV8A 2J0JA 4QPMA 4BDGA 2CNQA 3F3TA 1PW2A 2C6DA 5AA8A 5I9YA 4EQMA 4JI9A 1JVPP 1H1WA 3QCQA 2CKPA 3PXRA 4DBXA 5IH4A 5BPYA 4RIYA 4PRJA 3EN6A 4M67A 4A7CA 3NW5A 4FTLA 2F7ZE 3NAYA 4YHTA 4FT9A 5C8KA 3QTWA 3UQCA 2OU7A 3BI6A 5EM7A 3PG1A 1U54A 3QWKA 2WGJA 3MVMA 5HI2A 2YFXA 4M97A 4L01A 3RNYA 5JFVA 3EN5A 4L52A 3MWUA 4KA3A 4E5WA 4IDTA 1XBAA 2NP8A 5IA5A 3VF9A 4BCIA 4EQUA 3HLLA 4KS7A 4E6CA 3N4TA 3C13A 4AOIA 4DH1A 5HLWA 3F2AA 4YJOA 4V01A 2C47A 2JDSA 4EK5A 2XK7A 3LHJA 4IE9A 2YM6A 2WO6A 4RJ8A 3DZQA 3JUHA 4K77A 4IJPA 4MK0A 3ZH8A 1IR3A 3DFCB 4G2FA 4FKTA 4YJUA 5HVYA 4EHEA 3HGKA 4J53A 3AMBA 1KE8A 3O96A 3QC9A 5LCKA 4F08A 2DYLA 2E2BA 4G5JA 4ERKA 3CCNA 1IAHA 4HCVA 3WE8A 4JAJA 4QQCA 5HBEA 4TKSA 1YKRA 4P7EA 3EN9A 4X3FB 1PMNA 5AUVA 3O23A 5EQPA 2C68A 1JQHA 1XKKA 3KVXA 5IG1A 4R8QA 5J9ZA 2ZB1A 3Q60A 4XBRA 4RJ5A 1MRUA 2OICA 1H1QA 5DI1A 3MA6A 1BL6A 4Q5HA 3KVWA 3O7LB 3LFQA 3JPVA 5FEQA 1LP4A 1YHWA 2PVNA 3HRBA 3ACJA 4KRDA 4U43A 3BKBA 4DFXE 3PJ2A 3CY2A 3SDJA 4A4OA 4EZ5A 3ZXZA 4DEEA 2BIKB 4TYEA 4LFIA 5A46A 1E9HA 2B0QA 2WMUA 4IX5A 3A60A 3F82A 1OIQA 4L42A 5LMBA 2J2IB 3EFKA 4UXLA 2W4OA 2V62A 3CGFA 3O7LD 4RBLA 4QQTA 2IZTA 5AV4A 4FIIA 1W7HA 3A8XA 4CT1A 4F9WA 3T3VA 2G01A 5ETIA 1VYZA 4GK2A 2VTIA 5K0XA 4XG9A 3O0GA 3S4QA 4BTMA 5BVWA 3MI9A 5FGKA 5C4LA 3P4KA 3LXLA 2G2FA 4XG8A 4KINA 5DNRA 3ZDIA 4IAZA 4O7ZA 2VTMA 4PTGA 3FKNA 5AIKA 4AW0A 5EQEA 2YAKA 4XMOA 5KMJA 3M42A 2F49A 3F3ZA 3VRYA 2CGWA 5LJJA 3EQIA 3JVRA 4BR3A 4FV4A 3W32A 3S1HA 3COIA 3MSSA 3NR9A 4C59A 3IKAA 2ZDUA 4FZFB 3NGAA 2ZM3A 5HIEA 1SNXA 4PMMA 4EI4A 5LOHA 1Q3DA 5HBHA 2I1MA 3AMAA 4HVGA 4WNKA 2BVAA 2HW6A 3DB8A 3OXIA 5BUEA 3VUKA 3I0QA 4XCUA 3VS4A 5T68A 3RK9A 3V6RA 4BB4A 1EH4A 3FI2A 4BYJA 2PZYA 3FC1X 3QQHA 3DOGA 3VUTA 1YXUA 4JDHA 2UZLA 4IXPA 2B9FA 4ASDA 4RJ4A 2WTKC 4ASXA 1J7LA 2PVFA 1MP8A 1SVHA 2YM7A 5DE2A 2LAVA 3TN8A 2W1EA 4AACA 4DEIA 3LCDA 3MESA 4IIRA 4W4WA 4OTPA 4E20A 2C6TA 4UWYA 4FKVA 4O7LA 4FTIA 2UZEA 2ETMA 3PY3A 1M2QA 3PXQA 4NIFB 2YLEA 1FGKA 1JPAA 1OKYA 3EFWA 1UNHA 3OROA 4DITA 4J1RA 5BUJA 2YDJA 3D14A 1DM2A 2WMWA 1R1WA 2YDIA 3CTQA 3D4QA 4ITIA 3TV7A 4BFMA 2C5YA 5I3OA 5HNGA 4FYOA 4BBMA 3E64A 1OKZA 4I0SA 4LL5A 3DDQA 4LL0A 4FTQA 4EH9A 4EOJA 3FC2A 3I7BA 3QX4A 2X4ZA 3FMLA 2YITA 4QMVA 4BKJA 2VTSA 3R8LA 2PMLX 5LMAA 5AR3A 2VD5A 5L8LA 4PX6A 4JG6A 4C8BA 2BFXA 4XS2A 4KIOA 5M55A 1H07A 4IWQA 4X7QA 4E7WA 4GJ2A 3TI1A 3KREA 4JLCA 4AN2A 5CNNA 3E8DA 3BQCA 4XOZA 5M51A 3UO6A 4EBVA 4CGAA 3O17A 3FSKA 4H1JA 3JXWA 1IA8A 2OZAA 4DLJA 4JRNA 2IZRA 1Z57A 3HV4A 3OT8A 4GV1A 2W4KA 2Q0NA 4HGEA 4ZY6A 4OGRA 3RCDA 2XEZA 3W10A 4OW8A 3OWLA 4TYGA 4UALA 2PMOX 2XYNA 1MRYA 1XJDA 3R21A 3QUEA 3HECA 3ZC5A 4O86A 3FDNA 4WRSA 4NM7A 3QTXA 2JBPA 3QQGA 5AWMA 4I20A 2F7XE 2YLFA 3N9XA 4FKLA 4MWIA 2O65A 3H30A 5CANA 3ZCLA 2VWXA 3P08A 4BWPA 1OL1A 3E3BX 4RIWB 4EJ7A 5H8GA 2H34A 3NYOA 4AT3A 3ZM4A 3LXNA 4AW1A 4WHZA 4WBOA 5HX6A 2PE1A 2HWPA 2UVYA 3D7TA 2UW3A 3OTUA 5DLSA 4M68A 3QWJA 4RFZA 3DZOA 4E4MA 1IEPA 4YZ9A 3UNKA 5DYJA 3H3CA 4FV1A 2ZB0A 4RX7A 3KK9A 3DNDA 5D11A 3DBEA 3A7HA 3UG1A 1XH4A 2F2UA 3L8VA 1Y6BA 2QKRA 3MJ2A 4BDHA 4AX8A 2GU8A 4QP9A 1S9IA 1GIJA 3EYHA 4ZSJA 3WARA 4CFMA 3F69A 4Q2AA 2W1CA 2ZV8A 5J1VA 4G34A 4F6SA 3PJ8A 4YJVA 2G2HA 3FZSA 4BDKA 1F3MC 4FG8A 4O0YA 4CXAA 4EK8A 5J1WA 2VWZA 2CJMA 1S9JA 3Q6WA 3QHWA 5BVEA 3NUYA 4FIFA 5DVRA 4WNOA 1L3RE 1OL6A 1ZYSA 2GDOA 3CKWA 2ZM4A 5IKWA 1IRKA 5AR5A 3RK5A 4ANOA 5CEKA 1KSWA 4ZZOA 1URWA 1UNLA 4EWHA 5LWNA 4F65A 3ORKA 4NJDA 2YISA 4I22A 4KRCA 5CT0A 5A3XA 3ZS5A 3KKVA 3IOPA 1Q62A 4R5YA 3LCKA 3LOKA 4I94A 4IVBA 4H39A 1O9UA 4U45A 2X4FA 2BDJA 5TT7A 3LCTA 3CBLA 3ORTA 2PMNX 3MFRA 2XIZA 3ZU7A 1G8SA 4O96A 1NVRA 4U3YA 3UQFA 4EOSA 4NU1A 5E1EA 4L9IA 2QOHA 4A9RA 2RFEA 5CLPA 4E26A 5I9WA 4EUUA 2QD9A 3A2CA 2JFLA 2ZMDA 3BIZA 3JS2A 3C1XA 5CZIA 5D12A 3FZOA 2E9PA 2FSLX 2VZ6A 4AA0A 5GIPE 5F4NA 4GVAA 3R83A 3UC4A 2VTQA 2X7OA 3ID6C 3FLWA 4LV8A 3F7WA 3QKLA 5HIDA 1ZARA 3HDMA 5A4LA 4FV6A 3PIXA 5HO8A 5IZFA 3AC3A 4NCTC 3DXPA 2BR1A 3NDMA 3NNXA 2B1PA 3I5NA 4JBQA 3FLNC 4Y83A 3FI3A 1Q8UA 3BV3A 3HV7A 5IA4A 3POOA 2C1BA 1Y8YA 4U80A 3TKHA 1OB3A 2ZM1A 3COMA 4I24A 2J5FA 3BU6A 5DRDA 2WIPA 5GHVA 3V3VA 3TT0A 3FEGA 2C6MA 3F66A 3HNGA 2F4JA 2I40A 3AGLA 3P9JA 4DEDA 1JSVA 2V5QA 4C38A 2QHMA 2QC6A 1H0VA 5EW8A 2R5TA 2W17A 3FZTA 2OJIA 4G1WA 1JSTA 3PXZA 4UXQA 5CX9A 3OXZA 1OBGA 4RVMA 3BHTA 3VS2A 2WU6A 4CQEA 2C0OA 3FE3A 4G6NA 3UE4A 4TW9A 4U42A 2UW5A 1ZOHA 3LFEA 3ZBFA 4CV8A 2R0UA 3R7GA 3C4ZA 5G6VA 2Y6MA 5FUTA 4EZ3A 3C4FA 1SVGA 3MH1A 4NCTA 2QURA 4LMNA 2CMWA 3KEXA 4P5ZA 2Y4PA 4WUNA 2J7TA 3ZEWA 2CCHA 3DK6A 4ITHA 2DS1A 3SHEA 2BPMA 5TKDA 4D4SA 3FJQE 3M1SA 1ATPE 4C3FA 4F7JA 3G2FA 2QU5A 4JG7A 4RGJA 5BVDA 3QTRA 3BLHA 3LFCA 5GZ9A 4DGNA 2V55A 5HIBA 2ESMA 2J4ZA 3E8CA 4PMTA 2YCQA 3KXGA 5DWRA 5M4CA 2CDZA 1PY5A 2XS0A 3G0FA 4HPTE 1CM8A 4M0YA 4CFFA 1GZNA 2IZUA 4PP9A 1GZOA 4N0SA 3AG9A 3GCUA 4UZHA 5F95A 3WZKA 4BCFA 2WHBA 3VBVA 1OKVA 4KSPA 3RTPA 3UG2A 5KBRA 1UWHA 4O91A 3HP5A 2E9UA 4GIIA 4QP7A 3VW8A 4AZWA 3VHKA 4DN5A 4RIXA 4FIEA 2PE2A 3BU3A 4V04A 4BCHA 3PJ1A 4O22A 2GS2A 2RFDA 4TXCA 4Y73A 5L8KA 5LQFA 1ZOGA 3MPAA 3H10A 2W1HA 5HG7A 4QP2A 5D10A 1H27A 4MBLA 4JBPA 5JQ5A 3L9NA 2FVDA 2R3GA 2IW9A 1OITA 3Q4TA 4RQKA 1MUOA 1VEBA 2QI8A 2VWVA 3Q4ZA 2XNMA 4TYHA 3U4WA 5HTBA 4EZ7A 2VX0A 3EYGA 2WTDA 5FTQA 4O83A 4I1ZA 3VS6A 1Q3WA 3FLSA 3P5KA 4GSBA 3RCJA 4R6VA 3BEGA 5M09A 2EVAA 1BMKA 2B55A 4IWDA 4ZIMA 2OJGA 1OKWA 4QMPA 2R3MA 1STCE 4L8MA 4PUZA 1QPDA 3N4UA 3ZONA 2R9SA 5CTPA 4D55A 5K3YA 3MFUA 2G9XA 2X7FA 5LVLA 1W83A 4QMLA 1YQJA 1ZZLA 3ENHA 3GEQA 2OBJA 3ORXA 2QOQA 4FZ6A 4RVTA 4LGDA 3GC8A 2HZNA 3RM6A 4EL9A 2OLCA 2ITQA 4Y8DA 3VQUA 2H96A 3BE9A 4RC3A 1J1CA 5HHWA 3EZRA 3KFAA 4HVIA 5L3AA 3HA6A 3QD3A 4DFBA 3WBLA 5HQ0A 4C02A 3VULA 4O81A 3PJCA 4L44A 4DGGA 1H8FA 1P14A 4QMTA 4ZLOA 4WUAA 3R9RA 3SC1A 2AUHA 3CC6A 4MF0A 1AD5A 4RA4A 1LPUA 4Y5HA 2CKEA 5AX3A 4BTFA 3UOHA 4C36A 4LGHA 3CEKA 3U8WA 4YLJA 3OP5A 3FXZA 3ZDUA 3ZMMA 3VBWA 3AD5A 3C50A 2Z02A 3KN6A 3NYXA 4FZDB 5A4QA 4AGDA 4WT6A 5JT2A 3Q5ZA 3QCYA 5CS6A 1JSUA 1HCKA 3QD2B 4ZSGA 2VU3A 3EQGA 4FODA 1ZWSA 4B9DA 2VN9A 3G51A 3TNWA 2WMXA 4D4YA 3R28A 4RX8A 3MIAA 1FQ1B 4DHFA 3ET7A 3KK8A 4EUTA 4BTKA 3ROCA 4J71A 2W7XA 2UVZA 4ZAUA 5CEQA 5EDPA 3R9HA 4CZUA 5FTGA 2UZUE 4ZZMA 5L4QA 3GU8A 4RZWA 2PK9A 1J91A 3HVCA 3MTLA 2JKMA 4ZEGA 5ACKA 4C62A 5C03A 5JRQA 5KKRB 3E93A 2WEVA 4QYHA 1ZMWA
chains in the Genus database with same CATH superfamily
2VAGA 2ZJWA 2W9ZB 2XKCA 3QZHA 2O8YA 5F9EA 4KBAA 3VS7A 2IN6A 1OIUA 4BY9E 2X8IA 1FVVA 4LUDA 1V1KA 3EJ1A 4XBUA 4JAIA 4K6ZA 4JIAA 2X8DA 3HDNA 4J98A 3ZSIA 4FEWA 5CEMA 3VIDA 3FI8A 2VWUA 2AC5A 4KIKB 1B38A 2C6LA 5K5NA 3QQJA 1LR4A 4FE2A 3VS5A 3OBGA 2JD5A 3OUKA 1UVRA 4HGSA 4O0XA 3IECA 3UO5A 4NYEA 2PL0A 5DA3A 2WMVA 4HOKA 4IAKA 2I0VA 1XO2B 1NW1A 1W8CA 3FMJA 5JQ8A 4FVPA 3HAMA 5CZHA 4XG4A 5HCXA 4ANNA 4OT6A 3WILA 2HK5A 1YDSE 3ZLXA 4EQCA 2RIOA 2HXQA 4JR3A 4XH6A 3LE6A 2R64A 1BLXA 2C5OA 4AGCA 4FSWA 3QU0A 1OL2A 1Y6AA 4YJQA 5E4HA 1PRYA 4L7SA 5AADA 3O50A 4YP8A 4U81A 4I0TA 3RPVA 4B0GA 3A8WA 4RC4A 5K0KA 3RAIA 4O2PA 3UDTA 1JKTA 3GC9A 5CXHA 4U40A 4FTOA 2P2HA 4O38A 1SMHA 2UUEA 2ZOQA 3TKIA 2J6MA 3MVHA 3SLSA 3V5PA 4F9YA 5BVKA 4PP7A 5IQHA 5EYMA 4AG8A 4O4EA 2Y8OA 2Q83A 4FSNA 3AC4A 3Q53A 3QZFA 5AV0A 3LPBA 4P90A 4ZTSA 5I5ZA 4ZMFA 3NMUF 5EHOA 4CCBA 3O8PA 3PFQA 4BZNA 4F1OA 4MNEB 4X2KA 4DTAA 4N70A 4XNEA 1WBVA 3M11A 4Z55A 3N4VA 4BDAA 3RHKA 4O27B 2JIUA 3PVBA 4JDKA 2J50A 4QMOA 3TUDA 3PXKA 4GKIA 1UU8A 3PE2A 4AOTA 3LFDA 4AT4A 4D58A 5CY3A 2PSQA 4UN0C 5J7BA 2YABA 4R7HA 5D9HA 1R0EA 4MQ2A 4DYMA 4AFEA 3FZPA 3ZO4A 4AWIA 2P0CA 4DEBA 4HYHA 3QYWA 4R3CA 5CQUA 4RJ7A 4O7WA 5ICPA 2Y9QA 1CMKE 4C4GA 3SG9A 2JITA 4G3CA 2GTMA 5CAPA 4OBPA 3TDVA 4QQ5A 1GJOA 4NJ3A 3PIZA 4H3QA 4KB8A 4KKEA 5E91A 5AR4A 4A4LA 2XB7A 5LMKC 4LOPA 2OW3A 3U6IA 4R1VA 5L2TA 1CTPE 2ERZE 5FP6A 1Y91A 2AQXA 1WCCA 2PVKA 4YJTA 3DK3A 3CE3A 4L3LA 2OFVA 5IDNA 2RFNA 4Z7HA 4M66A 1PHKA 1Q97A 4XV9A 3VUIA 2WXVA 2PVRA 3MJ1A 1L8TA 4LOQA 4U41A 5E8XA 2OF2A 1Q99A 4IVAA 1ZYDA 4GIHA 3I79A 5IA2A 4DINA 2XRUA 4XX9A 3DA6A 3NIZA 4Y95A 4C4FA 2JGZA 5ITAA 3NRMA 3COKA 4KD1A 4YZBA 5FBOA 2DQ7X 4FG7A 4AFJA 3O2MA 2QHNA 1DS5A 3FPQA 4FG9A 1PXJA 5HEZA 4ZSLA 4RPVA 4I92A 5KMOA 2X2LA 4AP7A 5AP3A 4ZOGA 2RF9A 4QMQA 4U44A 1Q4LA 4K8AA 3EQCA 2C3IB 3AT4A 4GYGA 4E5AX 2JLDA 2F9GA 5LMKA 2C6IA 3K5VA 2WQMA 2WELA 3ENMA 3FLZA 3KMMA 3OC1A 4M0ZA 3ETAA 4IEBA 2OF4A 4FJVA 3ZRKA 2VTPA 3U54A 3A7JA 3R04A 4FL3A 4MXAA 3IOKA 3PA3A 4MXXA 4X3FC 1Q8TA 2FA2A 3DBQA 4NWMA 2XYUA 4IANA 2ZFYA 3WF5A 1QMZA 3PRFA 4DG3E 5DH3A 1M7NA 2GS7A 3QQLA 4QTAA 1GIIA 3R9NA 1H4LA 3DU8A 2BRGA 5HG8A 3D5XA 5JFSA 1OIYA 4FSRA 4EC8A 2AC3A 2G2IA 3PZHA 4L43A 3UP7A 5EOBA 4ANMA 3L8XA 2YWVA 2JEDA 3TL8A 4E6AA 3NUSA 1J7UA 3KCFA 4XV3A 2Y4IB 4TWCA 5K4JA 4MD8E 5AP5A 3RVGA 4BRXA 2GNJA 4CD0A 4DFLA 4EK4A 4BCKA 3S00A 3Q9WA 4I6QA 4MXZA 3MY1A 4QP1A 4YTFA 3DXQA 4E4XA 4IVDA 3KL8A 4BI1A 2EB3A 4HCTA 4YJPA 3BYOA 4FIJA 3UGCA 4AXAA 3AT2A 4YC8A 4YLKA 4GJ3A 3EL7A 4IC7A 4JDIA 2XJ2A 3LJ2A 5JZNA 5KMNA 4TYIA 3DLSA 5EHYA 1P2AA 2UW9A 2I7QA 3R1QA 4YHJA 3OS3A 4X0MA 3LM0A 4FF8A 3IW6A 4BVUA 3C4CA 3VQHA 4L46A 3W0NA 4UBAA 4AUAA 4PQNA 5H9BA 5DR9A 3EQDA 1FINA 3VJOA 4BKYA 2X39A 3MDYA 4F64A 4PDYA 5M4UA 4EK6A 4G3EA 3C5IA 4AQKA 1JKSA 2OIQA 2ITOA 5E8UA 3HV6A 2ZV2A 5CALA 4CRSA 2QLUA 4FOCA 4DAWA 4EH4A 4BJJB 5FBNC 1U5RA 1U5QA 4HNFA 2CGUA 4E6QA 5FDPA 4J96A 2X8EA 2YEXA 2BRMA 3BHUA 4Z16A 2W1GA 5EI8A 3EQFA 3GFWA 4RT7A 5HE0A 4BL1A 1OGYA 2YZLA 1GIHA 4W4XA 4Y46A 4EHGA 3A4PA 4JQ8A 2UW6A 3SG8A 4JQEA 4FKGA 3E7OA 3VBYA 2R4BA 2XJ0A 5J79A 4WOVA 1YDRE 2C1AA 4EKKA 4CQGA 1BI8A 2OI4X 3NIEA 4GVJA 4V0GB 3LXKA 3R8UA 4TWPA 4AOJA 3PWYA 3EH9A 3OG7A 3UNJA 4F9BA 1P4FA 3BYUA 3AKKA 3CSVA 2EUFB 4W8DA 2FGIA 3QXPA 3TTIA 4NTTA 2XMYA 5CU4A 3BU5A 4BDCA 5JKGA 3D94A 2WQBA 3OY3A 3DJ6A 2GNLA 2H8HA 1Q8YA 2YCRA 3EIDA 4QOXA 3VO3A 4FKQA 5ETAA 4O7VA 2CPKE 4LOOA 2C3JA 4RWJA 2WMTA 5AMNA 2FSTX 5B2LA 2XNEA 4B99A 3QTIA 4S31A 5IH6A 2UZOA 4QMZA 4HVDA 5C27A 3BLQA 5CXZA 5EM6A 4EYJA 2XNPA 1FBNA 2WOTA 3KN5A 3CPBA 3GBZA 3IGOA 3IONA 4S34A 4AZEA 4F0IA 3TXOA 4O0RA 2QOKA 2JAMA 2VWBA 4LRKA 4BF2A 4F1MA 2XAMA 4J8MA 3HV5A 3VONA 4G16A 4DF3A 4RIYB 2X9FA 4EK3A 1H00A 4EOMA 3KRXA 2IVSA 2BZJA 3FLYA 4QQJA 4FIHA 5ANDA 3I81A 5EFQA 4QTEA 2HYYA 3R7UA 3UDBA 5AA9A 2ONLC 1CSNA 1U54B 2XK6A 1PKGA 4AA4A 5M53A 4FTNA 3D83A 2XM8A 4B6LA 4A06A 4HZRA 4BZDA 2XP2A 4ONAA 4NK9A 4WSQA 4ZP5A 3QZGA 3RNIA 5HTIA 4FSUA 4E93A 1APME 1XH7A 5FXQA 3WYYA 4MXCA 4CVAA 3FZRA 4UEUA 5IQEA 2OIDA 3HYHA 4M69A 5D7VA 5LVNA 4JX7A 5JZJA 4TY1A 5F94A 2UZNA 4IMYA 2VWIA 2VO0A 3HMNA 4R5SA 4P4CA 2BDWA 4C4JA 4NFNA 3QF9A 2HIWA 4XG3A 5FEEA 4EOKA 4FVQA 1Q8WA 4YZMA 4PPCA 2UZTA 3EKNA 4WO5A 4J52A 3VUGA 4IM0A 3CKXA 3I4BA 4GW8A 3LM5A 3H0YA 4F7NA 3F3VA 1NA7A 4WRGA 4F7SA 4RX9A 3U55A 5M4FA 4JNWA 2CGVA 4UMUA 5A4TA 2QOFA 4FT0A 3SXFA 3R71A 1VR2A 4MEDA 1YOJA 2UZWE 3MH2A 4BWKA 4G17A 4CKJA 2XCKA 2Z7RA 5ANGA 5ANKA 4APCA 4OLIA 1OBDA 1PKDA 4AAAA 3NUXA 4QNYA 2HAKA 2R3JA 2H6DA 4XYFA 4XP2A 4BIBA 4U79A 2WTVA 1REKA 3DBDA 4EWQA 3ZLWA 1F5QA 4RX5A 5FXRA 5HICA 3IDBA 4U0IA 5HU9A 2IPXA 4IB0A 3DTWA 2GSFA 3HMPA 4FV7A 3I6WA 4O6EA 2IVUA 4MD9E 5FQDC 4S30A 5KMIA 4JBVA 4E73A 4G31A 5C8MA 3HMMA 1NXKA 4XP0A 4LRMA 2BAKA 3BPRA 3I60A 4XJ0A 4ZSEA 3Q5IA 5KMKA 5EYKA 3VUHA 3EQBA 2HELA 4YTCA 3PE1A 1ZYJA 3GU7A 4YTIA 5DFPA 3R7OA 4MUQA 5M08A 1MRVA 3CIKA 3ODYX 4YLLA 5DOSA 1YWVA 2OJ9A 2XIKA 4OTRA 3VC4A 3W0RA 2NPQA 1YRPA 3BQRA 1OM1A 3PUFC 4FSQA 4TNDA 5CEPA 3RWPA 3MVJA 3QYZA 3OEFX 3RZBA 2B9JA 2CGXA 3HKOA 3GI3A 3IDPA 3F5PA 3Q04A 4R7BA 3VBTA 5EM5A 4QMUA 3TZ9A 4R78A 2A2AA 4ID7A 4OTFA 3G9LX 5JGDA 5EQYA 4AT5A 3NCZA 3OW3A 3OXTA 2ITNA 1YXXA 4E6DA 2XKFA 2J51A 2GHMA 2WMSA 5AX9A 3DKFA 4YNOA 1WBWA 2W5HA 4KNBA 2XZSA 3QALE 5D7AA 3S2PA 4WKQA 3V5QA 3UPZA 1TQPA 1WBSA 4F99A 5EYCA 2OZOA 3D0EA 4QD6A 4PPBA 4RWKA 3WYXA 2CNUA 1H08A 3PVUA 4FTAA 4BBEA 1GZ8A 2W1ZA 2O0UA 5KX8A 4QDEA 5H2UA 4ERWA 4FEUA 1T46A 2OGVA 3FMNA 4F1TA 2B4SB 2X6DA 1SVEA 2HOGA 2EXEA 1M2PA 4Y85A 3SXSA 5HD7A 2WKMA 2ZDTA 4EC9A 3UJGA 2JIIA 4X6RA 4IJ9A 2ZV7A 3PP0A 5AP6A 3U6JA 3W2RA 5BVFA 5AIRA 3ACKA 5AP7A 4D1ZA 1ZY5A 2Z8CA 4AE6A 2R3PA 3D5VA 5HOAA 2XBJA 1FMOE 3NSZA 3IG7A 3G6HA 4NKAA 4OBOA 4ZTQA 2B54A 5HE3A 3R0TA 3ZHPC 2P55A 2W99B 4RFYA 2OSCA 4OAUC 4N57A 1OUKA 4I6BA 3P7BA 4JG8A 4PNKA 5DR2A 4JJRA 4WD5A 1QCFA 4M3QA 3I0OA 4O0VA 5CQWA 3DK7A 1H24A 3CQUA 4M14A 4RSSA 3NUAA 4L7FA 4D28A 1YWRA 4M15A 4I5MA 4QRCA 3RKBA 3JYAA 2VTTA 1URCA 4OR5A 4RFMA 4Y72A 3V6SA 4D1XA 1P5EA 3SQQA 4D2RA 4AXDA 4V05A 3GFEA 4FV5A 2I0HA 2OZAB 5DMZA 2HY81 3E5AA 4I21A 4G6LA 1XBCA 3WOWA 4XOYA 2WQOA 3GT8A 3QUDA 5IPJA 4FT5A 3FMHA 3DAJA 1U4DA 2VV9A 3C0IA 4OT5A 2YM5A 4I5HA 4BCPA 3R2YA 4TYJA 4IQ6A 5AM7A 3PVGA 5DEYA 4QP3A 2YIYA 4MVFA 4NM0A 2V7AA 2GHLA 4LMUA 2PZ5A 1NVSA 2I6LA 5TO8A 3NNWA 3DGKA 1H0WA 5DRBA 3GU4A 4XG7A 1PMUA 2W9FB 5AV2A 3ZC6A 5J7HA 4Z7GA 3W1FA 3QBNA 3E8NA 3AT3A 2F2CB 3Q9XA 4FKRA 2QVSE 4G9CA 2JKQA 3R63A 3UPXA 4FA2A 4MD7E 2GFCA 2VX1A 5EOLA 3DLZA 4X2GA 4MBIA 3ZTXA 2A0CX 3D7TB 4PF4A 3ZXTA 3SVVA 3GGFA 5T3QA 5D41A 4PDOA 4I0RA 3QGYA 5CI7A 4LM5A 4LRJA 2CKOA 5HE1A 3BZ3A 2QODA 2HXLA 2BROA 5IDPA 2JBOA 3LQ5A 4OAVB 3MB6A 3QHRA 1X8BA 4WA9A 2VTHA 4D4RA 5I4NA 2WNTA 2PZRA 3DNEA 3UMXA 4GYIA 4CZYB 1U46A 5IA1A 5IEXA 1KV2A 3T3UA 3HEGA 3HUBA 5C01A 2PPQA 2RL5A 1Z5MA 2WAJA 4NH1A 3V5JA 4CZTA 5LVMA 4LGGA 4DTKA 2VTJA 2JAVA 3P79A 4L45A 1PXIA 3IO7A 4IZYA 4Q9ZA 5L6WL 1WVXA 4B7TA 5JGBA 4ZLYA 4LG4A 2VTRA 3TACA 2PHKA 3TWJA 3UYSA 3EN7A 4HZSA 4OTIA 3V5LA 4YMJA 3B2TA 4TWOA 3VS1A 5B7VA 3PRIA 4IX3A 1H1PA 4IFCA 1WVWA 3P86A 2C6OA 1G5SA 3PXYA 3H0ZA 4GU6A 3EFJA 4I41A 3TJDA 2BZIB 1GOLA 2EWAA 2Y6OA 3R7IA 4RVKA 4R1YA 3KQ7A 4RMZA 1YOMA 3ALNA 4GG7A 3QFVA 3SRVB 4ZZNA 2JIVA 4GUBA 5A6NA 2PU8A 2PWLA 4HYSA 5FRIA 1XMMA 1MQ4A 5AAGA 3NWWA 4II5A 3QTUA 2QO2A 2QONA 1Y8GA 4ZTNA 3W8QA 4A9SA 4G5PA 5KKRC 5I9VA 3UVPA 4BN1A 4FEXA 4ALVA 3FL5A 1OL7A 4ITJA 4NUSA 2GNHA 4IB1A 4W8EA 4J99A 4M7IA 1KOBA 5L2WA 2QCSA 4C61A 4JL9A 5D1JA 3UOKA 3FSFA 3FYJX 2BILB 1YWNA 1YXVA 2Z2WA 4F78A 5C1QB 4EYMA 3TNHA 5IUGA 2CN5A 5DHJA 4MCVA 5ANIA 4EOIA 2JC6A 5CSWA 3DCVA 3H9OA 3MY5A 4ANQA 2B9IA 3KXHA 4GL9A 2UW7A 2B53A 2QG7A 5HG5A 1ZMUA 4XV1A 5KUPA 4NTSA 3TIZA 2ZYBA 3VS3A 3JR1A 2ZMCA 2CLQA 4D2WA 5JFXA 4DG2E 4A9TA 3VN9A 2E9VA 5HBJA 3LFNA 4OTQA 5J8IA 2BIYA 3JVSA 3NCGA 3IDCA 3DBFA 4Z3VA 4HYIA 5GJDA 4TRLA 4EOPA 3WZEA 3SD0A 3DXNA 4X2NA 3D5UA 1FGIA 2C4GA 3IW8A 3R7EA 2BDFA 4GS6A 5DEWA 3QCXA 3MS9A 4ZK5A 3TEIA 2Z7SA 3PIYA 3KXNA 4QMSA 5IQIA 4O21A 4BI2A 2IEWA 3QA0A 1ZLTA 4PPAA 4BDBA 4GK4A 3O8UA 4WG3A 3TV4A 3P78A 1NY3A 4YPSA 2YCFA 4MBJA 4ZY4A 2ZV9A 3Q3BA 4F0FA 4MXOA 4NM5A 3GU6A 4WG5A 4F09A 3DTCA 2VGPA 3KXXA 1ZOEA 3RINA 4O7SA 3ZRLA 2FH9A 2IVVA 3QUPA 4K2RA 4D0XA 4TL0A 1BI7A 4RQVA 5JMSA 2YJRA 3MB7A 4RRVA 5IA3A 2XUUA 3G9NA 1OECA 2GNIA 4FTKA 3ZO3A 5B2MA 3LLAA 5M07A 3GXLA 4C0TA 5I9ZA 1IASA 1GZKA 2WTWA 3P1AA 4CCUA 3UOJA 1I44A 4HJOA 3WZJA 3P5JC 2OXXA 3O8TA 4Z9LA 4YURA 5CYIA 4HVSA 1ERKA 2VRXA 1LEZA 1JLUE 1QPJA 5EK7A 4EOLA 4AF3A 4MXYA 3Q9ZA 5CT7A 5JH6A 1YI6A 3UBDA 3ANRA 4MWHA 4AA5A 2XARA 5CENA 4I93A 3UIXA 1BKXA 2R3LA 4X3JA 2VWYA 4ASEA 5L2IA 1M7QA 5ACBC 5IMXA 1WVYA 3EN4A 2HWOA 3OWJA 3GC7A 3PSBA 4FX3A 4TYHB 4ACDA 4QMNA 4JR7A 4YJSA 5ETFA 3FBVA 3GENA 2B52A 4O0TA 3MPMA 4KIPA 3HP2A 4H1MA 5A6OA 1OPKA 1R78A 4WSYA 4YZCA 3VVHA 4FV2A 3S3IA 3KF7A 2C6EA 3AQVA 3DY7A 4QP8A 5CU0A 3ROYA 3GU5A 3D9VA 1F0QA 4MNEA 1YHSA 3BHHA 1LEWA 3NUNA 1YOLA 2BALA 4I6FA 2PYWA 3MY0A 5FLFA 1PJKA 2V0DA 3LFBA 2J9MA 1XR1A 3FI4A 4YR8A 1TVOA 4I23A 2AEGA 2GFSA 2XIRA 1YXSA 3GCPA 1Q41A 5DR6A 1UV5A 2BRNA 3KRJA 2A98A 2W05A 5I0BA 4CYIA 1XH6A 3QRKA 4O7RA 5HCYA 5HKMA 3G90X 2X6EA 4YZDA 1YHVA 2YM4A 4GKHA 1ZYLA 1JBPE 1JOWB 3FQEA 4W4YA 1LUFA 1Q24A 5AP4A 5AUUA 4H05A 4OTHA 4DH7A 5A54A 3HX4A 5E92A 1R39A 1E1XA 2KTYA 2WTCA 3C5UA 3QTQA 4OTGA 4D5KA 4RWIA 1M14A 4DH5A 3HL7A 3NPCA 5KCVA 4IW0A 1K2PA 2WMRA 4AW5A 4RZVA 3W0MA 1J1BA 4CFVA 3E92A 5FWKK 1XWSA 3F7ZA 4B4LA 3NX8A 3K5UA 3TMOA 3ULZA 4ACHA 4NZWB 4P2KA 4JBOA 4D0WA 4GK3A 2P33A 3ZSHA 1FVTA 2HZIA 3FMEA 3NUPA 3Q4CA 4ACMA 4BGQA 4BTJA 4XV2A 4CEGA 1O6YA 3GB2A 4KKGA 2J5EA 3ZUTA 3ZSGA 1YVJA 5IQCA 5HE2A 3TKUA 4UMTA 2JFMA 5HO6A 3PLAE 2GQGA 4C4IA 3ZRMA 4FGRA 4FL2A 2W06A 1VZOA 2Y4IC 2VO3A 2IVTA 1IG1A 3KRLA 4RVLA 3D2IA 3ZLSA 2BRHA 3VF8A 4I6HA 1UWJA 3MH3A 3TUCA 1W2CA 5E8ZA 5KNJA 5KE0A 3GOKA 4RWLA 4UMQA 4BCQA 4U7ZA 3LCOA 1ZY4A 4A07A 5AP2A 3ULIA 2R2PA 2O64A 2XJ1A 3KULA 3IW5A 3N51A 4IFGA 3DBCA 1BYGA 5KZIA 4D5HA 4ZSAA 3I7CA 5GZ8A 2W5BA 3FXWA 2Z60A 1OMWA 3PSDA 3GNIB 3F88A 3UP2A 3F61A 4FOBA 2BFYA 1V0OA 4USEA 2C5VA 5H3QA 1W84A 2A19B 2BZKB 1PXOA 2R7IA 4AE9A 3AOXA 1H1RA 1PYEA 2ACXA 3ALOA 5DBXA 5KO1A 1PXKA 5CU3A 3LMHA 5BX0A 4KSQA 2WMBA 1YI4A 5LVOA 4C58A 2O2UA 3R1NA 4RG0A 4AXFA 3W2SA 3K2LA 3S0OA 5J9YA 3ZM9A 3DAKA 3OZ6A 3LXPA 4NW5A 2UZDA 4EH5A 5C4KA 2C3KA 2F57A 1RE8A 4KIQA 4RIOA 5T6KA 4CKIA 2EXCX 3ANQA 5ANEA 2W1FA 4G3FA 5CU2A 2BAQA 3KC3A 4A9YA 4YSJA 3UVRA 2JKOA 4LV5A 3VUMA 1NVQA 2X0GA 4HCUA 1ZRZA 3FHRA 3PA4A 3KU2A 2O63A 3KY2A 5JK3A 4QO9A 4OTWA 4XLVA 3A7FA 3R9DA 4BYIA 4FT7A 2WB8A 5AUTA 4X21A 2XK9A 4L3PA 2ITYA 3ZZEA 5KHWA 2W5AA 1ZYCA 5AR8A 5HZNA 1TZDA 4O82A 1AGWA 1O6KA 4DFZE 3F6XA 4U6RA 3THBA 3F5GA 2R0IA 3OVVA 3WZDA 5HO7A 3COHA 1XHAA 2YM8A 4PTCA 4OUCA 4JQ7A 4L53A 4MQ1A 3QX2A 3H4JA 3RAKA 4XLIA 5IISA 4NW6A 3R2BA 3RWQA 5K4IA 5B2KA 4FKJA 3SW7A 4JX3A 2DUVA 3ZZWA 3P7CA 3F2NA 4C3RA 3W2QA 3LQ3A 4FNYA 3MPTA 4IX6A 3UZRA 5EH0A 4NSTA 1ST0A 4YC6A 2XK8A 1R3CA 5AUXA 4D9UA 3B2WA 2GNFA 3L9LA 3OWPA 4FKIA 4NM3A 3RPYA 4IDVA 5IH5A 2VTLA 5I9XA 3F9NA 3UZPA 5FM3A 2VTNA 4HGTA 4ZTRA 3HMOA 2OJJA 5EYDA 1O6LA 2XKDA 3TNPC 3POZA 1W2FA 2EB2A 4TWNA 5L6PA 3QGWA 3OEZA 4X3FA 3A62A 5CWZA 3VWAA 4C35A 3IW7A 1SM2A 1WFCA 2WZJA 3U9CA 2XKEA 3EOCA 2PVJA 3U9NA 2GMXA 4X6QC 5L8JA 3UYTA 3PZEA 1HCLA 1W0XC 3JY9A 5EHLA 4O0SA 4XEYA 5LARA 2C0TA 5HCZA 3WIGA 5G1XA 4C7TA 5BYLA 5CSHA 5AP1A 4DE4A 4IC8A 1A9UA 4FTTA 1PXLA 5KZ0A 4CKRA 5H8EA 3CQWA 3C4WA 5BVNA 1PXNA 3EQHA 1PXPA 4DGMA 5IEVA 4IZAA 5CAQA 3B8QA 2WTIA 4L6QA 1VYWA 2XNOA 3OCTA 4I3ZA 3W55A 3WF6A 3V5WA 5J95A 3OUNB 5HVJA 3R7YA 5GINE 1V0BA 3NZ0A 3MW1A 5BQ0A 1T45A 3LQ8A 4IBMA 4BICA 2QO9A 3RALA 4R7IA 4PDPA 3BE2A 1CKIA 1XBBA 5AUYA 3FPMA 4MKCA 3OF0A 3TNIA 4FTUA 5LWMA 3O71A 2QLQA 2VTOA 2GQRA 3FUPA 4BDJA 1XH8A 3SA0A 2PUIA 3R8PA 4O2ZA 3LAUA 4BDDA 4FSYA 4TZRA 5IMEA 4DHIB 3OHTA 3BYSA 3MIYA 2WQNA 4L00A 3E88A 3OFMA 1M52A 5JSMA 3TTJA 4G6OA 1FMKA 3HMIA 4F0GA 5IUIA 3RAWA 5DIAA 4ZJJA 3QLFA 1TKIA 4CG9A 3V04A 4DT8A 5JFWA 3EHAA 4ZJVA 2H9VA 3REPA 4PMSA 2RG5A 3RI1A 4FTRA 2J0LA 4TPTA 4PMPA 4JRVA 3V8WA 3NVMB 3OOMA 5HLNA 3QRJA 1AQ1A 2VWWA 5E8SA 1SZMA 5J87A 4F63A 4HYUA 1RQQA 2G1TA 3DPKA 3ORNA 4KBCA 5EI6A 2VO6A 5E7RA 3U87A 3PLSA 1H1SA 3VBXA 3R73A 3CP9A 4RJ3A 4ACGA 1UU3A 4TN6A 1OI9A 3Q32A 3QC4A 1YDTE 4I4FA 1OPLA 3LFAA 3K3IA 3K3JA 4WBBB 5JRSA 3SOAA 5KHXA 2YIXA 2G15A 3BELA 5E9EA 3GUBA 5L2SA 4PV0A 5TOZA 3UVQA 1YI3A 3PPKA 4NIFA 4G3GA 4YJRA 3AD4A 4BCNA 4D1SA 4RA5A 2BCJA 5CVGA 3UC3A 2VNYA 2XVDA 3ATTA 2P4IA 4KBKA 1FOTA 3QCSA 4AXEA 2O5KA 3GCQA 5ETCA 5JN2A 1B39A 4GG5A 4GFGA 4DFNA 4LUEA 5LCJA 2VO7A 2IZSA 4F70A 4QMMA 3C4EA 4CMOA 3UIUA 4F7LA 1IA9A 1UU9A 3UIBA 2VGOA 4F4PA 4I5PA 4QYGA 3MGYA 3BLAA 5EKOA 2CHLA 3B8RA 3CJFA 5AR2A 4O7NA 1M17A 4FTMA 4EH7A 4C37A 3VW6A 1M2RA 2ERKA 4ANLA 2XF0A 5CU6A 3FV8A 4B8LA 4U3ZA 4CTCA 2YCSA 4F9CA 4DTBA 3MV5A 5CF5A 4GFOA 4C2WA 3KA0A 3PUPA 2HY0A 3CY3A 2YDKA 2R3IA 4GH2A 4CT2A 4YNEA 4FI1A 4XRLA 3LFSA 3R00A 4XG2A 3G15A 4FUYA 4AN9A 1NT2A 5AFVA 2BUJA 5CVHA 1J7IA 3ERKA 1Q61A 2GTNA 3MH0A 2ONLA 5FTOA 2PUNA 3C4XA 4AZFA 4ALUA 3TCPA 3FQHA 5HORA 2FO0A 4I5CA 3EB0A 4RIWA 4EH8A 2FB8A 3BV2A 4ZS4A 2CN8A 2WEIA 3RK7A 1MQBA 3L1SA 4DGLC 4QNAA 3TJCA 4F6WA 2W0JA 4GT3A 5HNBA 4BZOA 3NAXA 4AZTA 3PA5A 4O0UA 5GZAA 4IWOA 2R3HA 4MNFA 2NO3A 4K18A 3R30A 4CYJA 4HPUE 3W0OA 4IB5A 2CSNA 1G8KA 3FL4A 4FV0A 4GRBA 4DLIA 5IQFA 3F3WA 5HU3A 4DHJA 2R3KA 4A9UA 3I5ZA 2X2MA 4PTEA 3VAPA 4AQCA 4QMXA 3W16A 3IW4A 5F1ZA 2B9HA 3PTGA 3E62A 3FLQA 1Q8ZA 1H26A 2PVMA 3C0GA 3EKKA 4TT7A 4O1PA 4EOOA 4DFUA 2A1AB 3DFAA 4N6ZA 2RKUA 5CVFA 3TNQB 3ZEPA 4BCGA 4QEBA 2PVHA 2BMCA 4CRLA 5C8NA 5BMSA 4CLIA 3R1SA 2PMIA 3KB7A 4GEOA 4NT4A 3LFFA 3V8TA