2XKEA

Structure of nek2 bound to aminipyrazine compound 5
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
277
structure length
243
Chain Sequence
SRAEDYEVLYTIGTGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDLKPANVFLDGKQNVKLGDFTPYYMSPEQMNNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Aminopyrazine Inhibitors Binding to an Unusual Inactive Conformation of the Mitotic Kinase Nek2: Sar and Structural Characterization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 243
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xkeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xkeA01
4KBAA 2UVYA 3EL7A 3VF8A 3AC2A 3Q4UA 4PL4A 2BZJA 4X2JA 2W7XA 4CEGA 4CD0A 3OOMA 3N4UA 4ERKA 3TJDA 2JLDA 3NEWA 4UMQA 2HAKA 4TT7A 5C4KA 4QYHA 3DK6A 1G3NA 3PZEA 3V5TA 4ANOA 1VR2A 3DTWA 2UW4A 4H36A 4KS7A 1XBBA 3W2RA 4D4VA 4IE9A 4UX9A 5DYJA 3RAIA 4QMWA 4HPUE 4Y46A 4FEVA 2JBOA 3GVUA 3RZBA 2XJ1A 2PVLA 4C3PA 2ZMCA 2R3PA 1ZY5A 3EMGA 1M2QA 5AR7A 4F7LA 5IDPA 3U6JA 2V22A 3BYUA 4ZTLA 3KCKA 2ZM4A 1JBPE 1GZKA 3EL8A 3FI8A 3QTIA 4R3RA 2JEDA 3QQJA 4FI1A 4UWYA 3MH0A 1XBAA 3OUNB 4G16A 4UEUA 3ROYA 2OO8X 5BVWA 4WD5A 3NNVA 4BI1A 1UVRA 3H4JA 3PVBA 4RA5A 3NYXA 2JC6A 4ARKA 4BR3A 5HGIA 5I0BA 3COKA 3PA4A 5E8VA 4DFZE 4JVGA 5JK3A 1T46A 4CMTA 2PMLX 5EW3A 1MQBA 2WEIA 5E9EA 3EZRA 3Q9YA 5AUUA 3ENHA 2QO2A 2IG7A 5FTGA 1CKJA 1GIIA 2YM3A 3FLZA 4O7VA 3MVJA 5D11A 2XYUA 2OJGA 4Y72A 2GPHA 4OBPA 4WUNA 4NIFB 5ETCA 2VTHA 3Q5IA 1K3AA 2RG6A 4DEAA 5JRSA 1H27A 3MPAA 4KUJA 3ITZA 2X81A 4FSNA 4U44A 4M66A 2ERKA 3A60A 4I4FA 4RJ5A 2B9FA 5KMJA 4YBJA 5EI2A 3THBA 5A9UA 3L9NA 4FEQA 4RIXA 1ERKA 1NVQA 2OH4A 5D10A 5EK7A 2PVYA 3P7AA 4BDCA 4FKVA 1ZOHA 2OW3A 2HZIA 2WTKB 3AT3A 3TDWA 3DJ7A 4M15A 4MVFA 3DBCA 3NGAA 5FBNC 4H1JA 4EK5A 4CKRA 2XK9A 5HKMA 2F7XE 2XMYA 2ZDUA 3GEQA 4JR7A 3Q9WA 4QD6A 4AS0A 5M53A 5H8EA 5C4LA 2ZYBA 1ZYSA 3FE3A 2XNEA 3VS3A 4IFCA 4OT6A 4W4YA 2GS7A 5L2WA 1AGWA 1PXLA 1QPJA 1U46A 2P33A 2YWPA 3ZBFA 5KO1A 3OY3A 5AFVA 3ZUVA 5IQBA 2CJMA 4XG6A 5HHWA 4WRGA 5KX8A 4DH8A 2C47A 2VTOA 1S9JA 4GMYA 3KK9A 5IPJA 3PIZA 4O21A 3SA0A 2GMXA 4FTOA 2ESMA 3HMPA 4L44A 1F3MC 3B8QA 3COHA 4PP9A 2F9GA 4H05A 1Q5KA 3FKLA 1MRYA 3H30A 3FLYA 5FTQA 5I9WA 3KXMA 4FOBA 1ZZ2A 3I0QA 2JITA 3VUTA 4Y73A 4NUSA 3UVQA 3BHUA 1YOMA 4YZDA 3FDNA 3FKOA 4BZDA 3CPBA 4RJ8A 4BI2A 4L52A 4NM5A 2ITYA 2E9NA 4YJNA 5TE0A 3ORPA 4BVUA 2XNOA 5AP3A 2XIKA 3WZDA 5L8LA 3IGOA 3NZ0A 5HEZA 2WMWA 4UWBA 2GNFA 5IQFA 2BIKB 2XCKA 3W1FA 2Q83A 4QTAA 4YJVA 3VS2A 4ACHA 3CD3A 3TDVA 4ZTQA 5BUJA 3ZS5A 3NW7A 4MQ1A 2OJ9A 4N6ZA 3HA6A 5DT3A 4BGQA 2X39A 1Q8TA 2YM5A 4ZTNA 4BWXA 3VBXA 4PWNA 3ODYX 4A06A 3PVUA 4BKZA 4F7JA 2XA4A 1CSNA 3RZFA 4AZVA 4FA2A 3FXWA 4LOPA 5BYYA 3NPCA 5J5TA 4HW7A 4J98A 4OW8A 3RK5A 5HZNA 1W98A 3LFAA 1OBGA 3U87A 3MFTA 3W2CA 4G31A 2XNGA 2F7ZE 4L6QA 2QKRA 2WMQA 3KGAA 4USFA 2PUUA 2EB3A 4TYGA 4F0IA 3E5AA 2ZVAA 5L2IA 3PP0A 3NW6A 4FVPA 3A2CA 1LUFA 4DH5A 1OIUA 1PMUA 3EIDA 2BDJA 5AADA 2QOQA 3ALOA 4H58A 2A2AA 4TYIA 3VBQA 4D28A 2HENA 4FZFB 3C13A 3POZA 4G5JA 1IR3A 4XG9A 3GU4A 3VS6A 3PRIA 3D15A 4RIWA 2QVSE 4L8MA 1B38A 1YXTA 3NNXA 4KSPA 4RWIA 2CLQA 3S4QA 3SHEA 3PDTA 4YC6A 1G5SA 4FYOA 3U8WA 4MH7A 4EHEA 4GG5A 3QKLA 2B54A 4G3DA 1LR4A 2OZAA 5HIBA 5AUXA 4AP7A 5IQHA 4BDJA 5GJGA 3W8QA 5IA4A 2YWVA 3JVRA 4HYSA 3IDPA 4S33A 5LARA 4ORKA 4JI9A 3CLYA 2WIHA 3OG7A 2I6LA 2C1AA 3OT3A 3ZFYA 3CP9A 4C3FA 3Q4TA 4XG2A 5BNJA 2PVFA 3V01A 4Y8DA 4NJ3A 4FKRA 4MBLA 4ZY4A 3BYOA 1NW1A 5M08A 1OKZA 3ORMA 4NKAA 2QR7A 3LM0A 3PFQA 4AZEA 5D1JA 1K2PA 3PYYA 3R1YA 4ZEGA 3BBTB 3G6GA 3NCZA 2IW9A 3ZC6A 3MTLA 4D2RA 4F6WA 2PVJA 3A99A 4A9RA 2XJ0A 2C30A 3PY1A 2GHGA 3A7HA 3ZSHA 3BGQA 2RGPA 2BKZA 4X0MA 4ERWA 3RALA 3R8PA 4ZLZA 5BYLA 3UMXA 4C2VA 2HWOA 2WMSA 4E4LA 2JBPA 3VW8A 4FE2A 3QCYA 2IPXA 4QMPA 4EK6A 1LP4A 3ZDUA 4JBPA 4BCQA 2UW0A 5H8GA 3AMBA 2QG5A 4QQ5A 4IB3A 3KMUA 3TIZA 2XKFA 2W1IA 1M14A 3A4OX 2BAKA 1ND4A 2JDRA 2UW5A 4M68A 2PTKA 4YPDA 2DS1A 3DAKA 3U51A 3HUBA 1JAMA 4MXZA 3WILA 5JFSA 2QOLA 3DB8A 4HPTE 1M52A 3FLNC 3EHAA 3BGZA 2XCHA 5M56A 4R3PA 4ACCA 3LMIA 3UC3A 3ZM4A 3DDPA 3BE9A 4WT6A 3EYGA 3F3VA 5I5ZA 2UZEA 5LQFA 3R9RA 2C6LA 3KRRA 3W16A 4F70A 4BBFA 3EKKA 4ZY5A 2OFVA 4YJPA 2R3NA 3OFMA 5CX9A 4FV6A 5CANA 3R8UA 4GEOA 3W33A 4MTAA 5EM6A 3SX9A 1R0EA 3G90X 3L8SA 4OLIA 3R6XA 1PYEA 1OL2A 3LXNA 3Q53A 3UOJA 5HO8A 1BX6A 3UMWA 5KHWA 3F61A 1TVOA 2JDOA 4I92A 3FMJA 4FKPA 4LMUA 5IG1A 3P4KA 5FGKA 1OMWA 1V0BA 1YXXA 4QP8A 4TWPA 4XNEA 4Y85A 4IWPA 4MD8E 4W4VA 2QODA 5CEOA 3A8WA 5CAVA 3F2NA 4L00A 3DLSA 4BZNA 3ZZWA 5EM8A 4MXOA 4BB4A 3ZXZA 4RQVA 5CY3A 3RBWA 2CGXA 5GZAA 5A6NA 5M44A 2BALA 4F63A 3PG1A 4GUEA 4XLVA 4R7HA 3DPKA 2GNHA 5GZ9A 2QO7A 3FZRA 1UNLA 2YCSA 3VUDA 2IVUA 4EH2A 1MUOA 2V0DA 4B0GA 1SM2A 5JGDA 4JIAA 3K5UA 1UWJA 1IAHA 4JQ8A 1OL1A 2HW7A 3I60A 4WNOA 2CCHA 4L68A 1K9AA 2ONLA 4BCNA 5BVNA 5KBRA 1REJA 3MSSA 3SC1A 5J9ZA 2ZB0A 4X2FA 2R4BA 2O64A 4EH7A 3LE6A 1PYXA 4MQ2A 4RGJA 5CSHA 1FBNA 2UZWE 1Q8ZA 5TR6A 5IA3A 3LFEA 3AGMA 3BV3A 3P0MA 1LEZA 4ID7A 4YJRA 2P4IA 3TV4A 4BCOA 5K0XA 2CKEA 2F4JA 3BZ3A 2R7BA 3EN7A 5T6KA 2C5VA 3QC4A 3WYYA 5HOAA 5AR8A 2WEVA 3AGLA 1YW2A 4Y95A 4ZJVA 1CKIA 2ZV8A 1FVVA 2X7GA 3FMEA 3VS0A 4FGRA 3E62A 2QLQA 3FAAA 4PMTA 5E7RA 5LOHA 2O0UA 3TM0A 3QHWA 1WBPA 2NNWB 1VZOA 4C58A 2VTNA 1E1VA 3QHRA 3VC4A 2G2IA 3D7ZA 3FUPA 3ORZA 5HG5A 4HYHA 3R83A 3UQCA 4EI4A 3ZUUA 4YUQA 4WG4A 3KY2A 4IZ7A 5J79A 3RWQA 4K11A 4D55A 2BMCA 4AOIA 1XWSA 4WO5A 2JKOA 4RX7A 4RIWB 3D2IA 2YM6A 3GENA 4KRCA 3GOKA 3R7YA 3GC0A 2R3MA 5ANJA 4E4XA 1SMHA 2YJRA 4NKSA 3U9NA 2YISA 1PXJA 5HE3A 4JL9A 4BDFA 2GHMA 5J1WA 4R3CA 5M4FA 4RIOA 1M2PA 1PKGA 1FVRA 2UZVA 3HP5A 2QG7A 1Z5MA 1DS5A 3F5UA 4IAAA 1KV2A 2J0JA 2YFXA 4Y5QA 1NVRA 3EQDA 4HCVA 2P2HA 4RWKA 3MS9A 4K2RA 3VIDA 3WARA 5BYZA 3H9OA 3MPMA 2NRUA 3MVLA 4ENXA 1H07A 2R3JA 4KKGA 3MA3A 4Y83A 4Z3VA 4AW5A 3GBZA 4OBOA 5E8YA 4O22A 3FQSA 2VUWA 3UNZA 4FSWA 3VAPA 4DCEA 1F0QA 4L7FA 4KS8A 3HV3A 3R7UA 5CEMA 2B1PA 2IJMA 3EFWA 3VS7A 2G01A 3O50A 4LMNA 4TZRA 3RM7A 5DBXA 2BRBA 4ZJIA 4F65A 4M69A 3V8WA 3IG7A 2JKMA 2OU7A 3E87A 4YNOA 3ZRKA 4A4XA 4BCJA 5IH6A 3Q4ZA 4FIGA 4MKCA 4C57A 4RIYB 4U3ZA 3UNJA 4BDKA 4XV3A 4ASXA 4R1VA 3ZMMA 4NL0A 3KN6A 1R1WA 2YITA 4FKUA 4GH2A 4OBQA 5FP5A 2QURA 4BC6A 2C6EA 4K1BA 3T3UA 4O6LA 5CVHA 5IQEA 3K5VA 1QL6A 5CSXA 3TNQB 2JDSA 2FA2A 1ATPE 2Z60A 3PY3A 2JD5A 4AQCA 2G2FA 3L9PA 5IH4A 5JMSA 4RJ6A 4ZTHA 4FNZA 4RJ3A 4EH8A 4IB0A 3F5GA 4HNIA 2HZ4A 5AEPA 5GINE 2XB7A 2X8DA 1W84A 4F64A 4RZWA 5TT7A 3UOKA 2ETRA 4BDGA 5B2MA 1H01A 1DAWA 1Y8YA 2BRMA 2C3LA 4G3GA 3F6XA 4YGAA 1GZNA 4O0TA 3UP7A 2UW9A 4FR4A 4FNWA 4J53A 4W9XA 2Y8OA 3MH1A 4RBLA 4BN1A 5KMIA 4PL3A 4ZTRA 5A4TA 4MBIA 5F1ZA 3MA6A 3GT8A 5HIEA 5LMKA 3REPA 4PL5A 2J5EA 5FEDA 4ACGA 5I9VA 5CU2A 5ETAA 4EWHA 3LJ1A 3OXTA 2PL0A 4H1MA 5DR2A 3NVMB 4AGWA 4PPAA 4ZIMA 4DFYA 3T8OA 4F9WA 3QX2A 3LCSA 2Y4IB 4DH3A 3PSBA 3PWYA 1E1XA 1R3CA 3GQLA 2XIXA 4IFGA 3HRCA 3SV0A 3G15A 5K3YA 1FGIA 2E9OA 2O65A 4IC7A 4K33A 2WMTA 3P78A 2QKWB 4USDA 4AZFA 4FV1A 2IZRA 4JBOA 3W32A 4EOLA 3ATSA 1XR1A 4R1YA 5D9HA 4EBWA 3GCSA 2WQMA 5D12A 3KXGA 1Q61A 4WG5A 2I0EA 2X7FA 2VTRA 4EJ7A 2AC3A 4AT5A 4EJNA 4FKQA 4NTSA 3QYZA 2C4GA 3DNDA 3FWQA 4FKGA 4QYYA 1STCE 4F9BA 4ZP5A 4RG0A 4WBBB 5BUIA 5AMNA 5CZHA 2EU9A 2XF0A 4R78A 4U81A 4TPTA 3UDBA 2XEYA 2GU8A 3I1AA 1W82A 4LYNA 4O1OA 3MH2A 2PK9A 3VF9A 4HVHA 3O51A 3RAHA 1SVGA 3PJ8A 3FJQE 3RINA 3ALNA 2EXCX 4OTFA 4PX6A 5GJFA 5H2UA 3C4WA 4EC8A 2XNMA 3F3TA 3TJCA 4FKWA 3IECA 4TNDA 3D5UA 3V8SA 4DGNA 1O9UA 4BDBA 2FSOX 4XOZA 3EQCA 4PTCA 5A4LA 4M67A 4E6AA 3HRFA 2GSFA 5JGBA 5M06A 2V55A 2VZ6A 3TXOA 5CEPA 4EYJA 1CDKA 3R30A 4D1ZA 2BTSA 4BIEA 2UZBA 3ORLA 4FGBA 4IC8A 3SW4A 4B99A 3HECA 5EW9A 3I5ZA 3A7GA 4NM0A 2BCJA 3V5QA 3D0EA 4BFMA 4IVCA 2QOKA 4F6SA 3NW5A 2VWXA 3PPJA 5AR4A 4HVIA 2GFSA 2YM8A 3FZSA 5FUTA 2BAQA 3PVGA 4GT4A 2O5KA 3KFAA 3SXRA 2QLUA 1DI9A 3E93A 4YSJA 3DJ6A 2PYWA 5AP7A 2C6MA 2OF2A 3LFBA 3OEFX 4IX6A 1V1KA 2C6KA 3KK8A 3VHEA 2BVAA 3A7IA 4XG7A 2C6TA 4GW8A 3IPHA 5AV1A 3R9DA 5BMSA 2CN8A 4AW1A 4D4RA 2ZMDA 2PUIA 5EI8A 4H3BA 1SYKA 5DA3A 5J7HA 3CTJA 4CVAA 2CKPA 2C6IA 2SRCA 4G1WA 4R77A 1Q41A 3JPVA 2CPKE 4ANLA 3ACKA 4XV9A 2CGVA 4BTMA 4CV9A 5HLNA 4YJSA 4K77A 5KMOA 2J4ZA 4O0XA 2IW6A 5AAGA 4RWLA 3MY5A 3EYHA 3ZYAA 5DG5A 3LFNA 3O71A 4CFWA 2GQSA 2W1FA 3LW0A 5LJJA 1XH7A 3TNIA 5IA2A 1RQQA 4GCJA 3D4QA 3H9FA 3UJGA 5JFXA 4IM3A 4A4LA 4FKOA 2A4LA 1UNGA 3MI9A 4KIKA 3QD2B 3WOWA 5EKNA 1A06A 1ZYJA 4QT1A 3CEKA 3R7IA 2J6MA 2HK5A 2VTQA 4JAJA 4M97A 4RT7A 3Q4CA 4IWDA 2ZV9A 1FPUA 1GJOA 2BZIB 2V7OA 4UYAA 4DFXE 2J90A 3BHTA 3FMDA 3V5WA 4ANNA 3TUCA 4X3FA 4B8MA 2G9XA 2YCQA 5K4JA 3UPXA 2QQ7A 4X2KA 3DXPA 4TWCA 3AQVA 4RFMA 4O86A 3NYVA 4IAFA 4IHPA 3O96A 5EQEA 4GS6A 2HCKA 4EH3A 3DS6A 1VEBA 3PPZA 3SLSA 3LMGA 1QPCA 4MXCA 1APME 2WTWA 3DGKA 3NSZA 1O6LA 3R0TA 4XRJA 4PNKA 5BVDA 4UBAA 5T3QA 1OKVA 4YHJA 3MVMA 3OVVA 4UMRA 4PMPA 3KXNA 3O8TA 3UIBA 4CSVA 3VN9A 3WI6A 1BUHA 4JXFA 4L9IA 2UZDA 4MF0A 4YZ9A 5FM3A 5KMKA 2F2UA 3GU8A 1QPEA 1TQMA 4RVTA 2WD1A 3ET7A 4I0SA 5AV0A 4F99A 4F9AA 3FC1X 3R9HA 2WKMA 3RAKA 2IZUA 3PZHA 4BDAA 2RSVA 4KB8A 2WO6A 4F0GA 3CIKA 4EH5A 5LVMA 1SNUA 2WHBA 5IEVA 1YXVA 2Z7RA 3G6HA 5ANGA 4F9CA 3WE8A 5EKOA 4FT7A 4IB1A 3I6WA 4FKLA 5CNNA 5I9YA 5CQWA 4CT1A 2VWIA 4CTCA 2YLFA 2W9ZB 4K9YA 3VJOA 3MJ2A 5JT2A 3BV2A 2Y4IC 2VWBA 5JQ5A 2W4OA 3SGCA 4IAKA 4QMUA 5BX0A 2QI8A 3P1AA 3VHKA 4O0WA 4CQGA 3EQGA 3U6HA 2GDOA 3FZ1A 4MD7E 5EYMA 2B4SB 2WGJA 3G0FA 3G0EA 4Q9ZA 3ZHPC 4RWJA 4CQEA 3DDQA 1MQ4A 4JX7A 4FV2A 1JPAA 4A7CA 1NT2A 2WFYA 3GU6A 3R1QA 2BHHA 4WOVA 2LAVA 4KA3A 4IVDA 4EL9A 1BKXA 2JAVA 4LFIA 1FVTA 3LQ5A 4YLJA 3QTQA 3QZIA 3RNYA 4CT2A 4D9TA 5E4HA 3BGPA 3R7EA 3ZM9A 4FKSA 3DY7A 2H9VA 3IW8A 4NW6A 3TNPC 2UW7A 3CE3A 2WU6A 5JZNA 4AU8A 2OI4X 3CS9A 4FKIA 4GFMA 3ZLSA 4JNWA 3FHRA 3RK7A 4KIQA 2QD9A 2R64A 3NDMA 3P5KA 3IONA 4BCGA 4F1TA 2BZHB 2YJSA 5KKRC 3LIJA 4JX3A 1UWHA 4HZSA 4QQCA 2EUFB 2P55A 4EH4A 3KA0A 5AUZA 4JDKA 4TYHA 3R71A 3DOGA 3MIYA 4WA9A 5HE1A 3D7TA 3E88A 3O8UA 3EQHA 5EHLA 2PE2A 4B6LA 3MH3A 4E26A 5CQUA 4J96A 4PMMA 4IEBA 2PSQA 3SRVA 5JEBA 5CAUA 1JVPP 5EW8A 3DQXA 4LL0A 5AV2A 5KUPA 4UY9A 1XH5A 2X4ZA 3LCOA 3TKIA 4DTAA 4FC0A 4ZSLA 2VD5A 1RW8A 3QZGA 1JKKA 5J9YA 3QTZA 4KKEA 3K2LA 2UZTA 2DQ7X 4FTKA 4J8NA 2RKUA 3PE1A 5I9ZA 2WTVA 2WTIA 2X6EA 5E92A 4O83A 5E1EA 3WF9A 1Q3DA 5DFPA 3IS5A 3S3IA 3K54A 3C4EA 2BHEA 1OIRA 4RVKA 3V5JA 4E5BA 4DH7A 2PMOX 3IGGA 3QL8A 4CG9A 3PIXA 3JR1A 2ERZE 3MFUA 2YDIA 3ERKA 4H39A 3R2BA 4HVDA 5J9LA 2CNQA 2Q0BA 4HZRA 5HTBA 1OIQA 5DT0A 2V5QA 3C0GA 3NYOA 2ITUA 3LKMA 2VX3A 1OECA 4DE4A 1NA7A 3MBLA 3OP5A 4BGHA 3BYMA 2OJFE 3GC7A 3TKHA 4J71A 5DEWA 3C7QA 5E8XA 1R0PA 2OK1A 3NUXA 3HV6A 4EC9A 3DBDA 4YZCA 3HL7A 3W8LA 1IEPA 2B53A 2GCDA 3E92A 4FKJA 3TV7A 1WMKA 3IKAA 3MVHA 5DEYA 4YZNA 3I81A 4OR5A 3U4WA 3NWWA 5CASA 4AFJA 1PW2A 4FG8A 1YDTE 4FYNA 3OWKA 4KIKB 4CFMA 4QMLA 1H0WA 4DFLA 5ANEA 2UW6A 4TN6A 2JDVA 3P86A 4FUYA 3VBYA 5DLSA 3C9WA 1KOAA 4U8ZA 3DA6A 2Z7QA 4LV5A 1QCFA 5A46A 5A4QA 5HTCA 4IWOA 2UZUE 5DRDA 3QZFA 5EOBA 4YHFA 3QQKA 4TL0A 2PVMA 5ICPA 1W7HA 3F2AA 3CGOA 4AA4A 2C3JA 4I6FA 4BGGA 3RAWA 4CFXA 4FTQA 4NEUA 1PXMA 4M8TA 2GQGA 3KKVA 3TZ7A 3R22A 4JG8A 4TXCA 3GB2A 4BTJA 4PDYA 3F82A 3P7BA 4FV9A 2H6DA 4PMSA 3GCPA 5HG9A 3HAVA 5M07A 2X0GA 3FLWA 4UXQA 4X3JA 4C02A 4D5KA 2W1CA 3COIA 3QKKA 4GG7A 2BDWA 4GV1A 4XG3A 4YJUA 5KE0A 3TWJA 4AZSA 4IAZA 4BICA 2WELA 4JDHA 4GKIA 5EQPA 3PA3A 4YZBA 3W2QA 3UQFA 2IO6A 3F66A 5LXMA 4E5AX 5F9EA 1BMKA 4QP6A 5HE0A 4LRMA 2XKEA 4O2PA 4RLLA 4IW0A 2ETMA 5BVFA 3AC5A 3E8EA 2NPQA 2GTMA 5IA1A 3DV3A 5LMKC 2R2PA 4OUCA 4ZXTA 4BRXA 1DI8A 5AUYA 4BDHA 5DHJA 3LVPA 1XH9A 1U4DA 3O8PA 3FXZA 3G2FA 4O7NA 3R8LA 3CR0A 4F6UA 3DKOA 4DEEA 1OUKA 3F3ZA 1P4FA 2R5TA 3FQHA 3GC8A 1OPJA 4TRLA 5HX8A 4AA5A 5AX3A 2OWBA 2Y0AA 4OTPA 4EZ5A 3OBGA 3EOCA 5FLFA 3GU5A 4F0FA 4N4SA 3OWLA 3N51A 3DU8A 3FLSA 1HCKA 1PXPA 2R3OA 3OEZA 4GSBA 4NT4A 3ODZX 4II5A 5ANKA 1H00A 5AM7A 4FTJA 2OXYA 1OGUA 3VO3A 1JKSA 2VO7A 1OZ1A 3CCNA 4O0YA 3ZDIA 5ANOA 3T9IA 2C3IB 1GOLA 2FSMX 2VWWA 3DBEA 2XIYA 2CN5A 1YDSE 5CVFA 4PPBA 4YHTA 5DGZA 4NWMA 2IVSA 4R5YA 3ZONA 4ANMA 2J9MA 4Q9SA 3SDJA 4FBXA 5DIAA 2ZV2A 4KD1A 2VO3A 5IQAA 5HG8A 3HP2A 2R3HA 3JY9A 3PG3A 2OIQA 4S34A 4XMOA 1W0XC 2FVDA 3VBTA 2J5FA 2R0UA 4M0YA 4NM3A 4W9WA 3KMWA 4G3EA 3I4BA 2BUJA 4QQJA 3QCXA 1Q8WA 1ZMVA 2A0CX 4MAOA 4TWOA 4YLLA 5E8ZA 4BDDA 3VQHA 4NJDA 4P4CA 4E7WA 5B7VA 4GT5A 2BILB 4YURA 4YTCA 4M3QA 3D7TB 3AMAA 2GS2A 2ITPA 4LGGA 4P5QA 2H8HA 3P08A 1GIHA 3UC4A 1PXIA 4C34A 4ZSGA 4DBNA 4FT9A 3R1NA 4X2NA 3KCFA 2X7OA 3IDBA 1MRUA 5IQCA 1XO2B 2R0IA 1ZY4A 3GUBA 5CEQA 4EH6A 4C59A 3BWFA 3ULZA 4ASEA 1PMNA 2QHNA 4BKYA 2HXLA 2HOGA 3FXXA 4KWPA 1KE7A 3PJ1A 3NS9A 1TKIA 3QD0A 4EEVA 4AX8A 3VBVA 4Z7GA 3IW6A 4O7TA 1OKWA 3LCDA 5GJDA 2H96A 3D5XA 3R00A 4YLKA 4FZ6A 1H26A 1Z9XA 5HD4A 1YWNA 4RIXB 4JDIA 3R21A 1YQJA 4OGRA 3ZUTA 3H9RA 3KVXA 5HVYA 2HIWA 2BRHA 2W5BA 4O0RA 5DPVA 2EWAA 5KMLA 4FV5A 1TQIA 4EONA 1ZLTA 3KF4A 4ALVA 4PNIA 1BLXA 3AC8A 5DE2A 3DAEA 5TOZA 2WQEA 3BKBA 4J1RA 4WNMA 3MJ1A 2RL5A 4PQNA 4BF2A 4HJOA 2F49A 4ZLYA 2OXXA 1IG1A 4C4JA 4PP7A 2XK4A 3H3CA 2BFYA 4E6CA 3TEIA 4QP3A 4I4EA 4ASZA 3ORNA 4DH1A 1CMKE 3F69A 5ETIA 4D4YA 3F7WA 3NR9A 3NAXA 1GAGA 2C6DA 2XBJA 4DGMA 4YU2A 3KRXA 3P79A 3V8TA 3DAJA 1ZRZA 4AXAA 3Q04A 4D58A 3HVCA 4HGLA 3Q6WA 2WQOA 4FICA 3R7OA 5LWNA 4IVBA 2WOTA 3QTSA 3UTOA 5FD2A 4F1MA 2XVDA 5FBOA 4G3FA 4GVAA 3TTJA 3W2OA 5A6OA 1KE6A 3MV5A 4D2SA 3A7FA 4AZWA 3ZO1A 5IMXA 5AM6A 4XS2A 3M1SA 4FZ7A 4RRVA 5LMAA 4RC3A 2C5XA 2JFLA 4MHAA 1M2RA 5F94A 4QMNA 3I79A 4E4MA 3QA0A 4V0GA 2X9EA 4X3FC 5J87A 2VTJA 5JGAA 2OXDA 4ZMFA 2DWBA 4JQEA 2BRGA 5AWMA 4G6OA 4DEHA 1H4LA 3E8NA 3A7JA 2GNGA 2JKKA 3PVWA 4CZTA 3TV6A 4D1XA 5G6VA 2J0MB 2Y9QA 2ITQA 5A54A 1ZMWA 2W5HA 3UIMA 3DZOA 2VX1A 1BL6A 3ORTA 4XP3A 2YZLA 4ALUA 4FKTA 3LXKA 2C0TA 2ZDTA 3Q52A 4I0RA 3LQ3A 2W1EA 4FK3A 4MXYA 3ACJA 2WXVA 3A62A 3GI3A 3H0ZA 3B2WA 4V01A 2GQRA 3MGYA 1JLUE 2HZ0A 4V04A 2VWVA 5CXHA 2QC6A 2I0YA 2NRYA 1TQPA 3FZOA 2NO3A 4NCTC 4ZTSA 4AW2A 1YOLA 2WQNA 4OTHA 2WPAA 1WAKA 3UYSA 2OGVA 2J50A 2YABA 2W1ZA 4UMTA 4D2WA 4U41A 5E8TA 4E8AA 4M12A 4YC8A 4EZ3A 5EM7A 1JSTA 3FY0A 3OW3A 4XEYA 4CLJA 3R02A 4FSQA 3A8XA 2VGPA 2IZTA 4O96A 5GIOE 4FIJA 2PZ5A 4MWHA 4HCTA 3KN5A 5HLPA 4AN2A 2R3IA 5ANIA 5L6WL 3T3VA 1Y8GA 3I0OA 4O27B 4CRLA 3QTUA 1PRYA 3Q5ZA 3EQPA 3UG2A 5EDPA 5IU2A 3MN3A 1V0PA 3FV8A 4LOOA 4HGTA 2VTLA 5K0KA 5IZFA 5EYKA 2WMAA 5FWKK 1OVEA 2W96B 3ZC5A 4D2TA 3N9XA 4AGDA 5FRIA 1SVHA 2O3PA 4UB7A 3FYJX 2VTIA 4NTTA 3DQWA 3POOA 5HD7A 4E3CA 1JQHA 3M42A 1YI4A 4QP7A 5C8KA 3D14A 3HV7A 5L4QA 2I0VA 1A9UA 3PJ2A 5CLPA 4MNEA 4QTCA 1OUYA 2OZAB 2X2MA 2P3GX 3L9LA 3OD6X 4FVRA 4GU9A 4XP2A 4WBOA 1UA2A 4IJPA 5F20A 4YNEA 3KRJA 3KXXA 4HVGA 5C8MA 5EH0A 4WSQA 3DKFA 1H25A 3QQGA 5KNJA 1FGKA 4FV8A 3MB6A 2P0CA 4L7SA 5CAOA 5HE2A 3QBNA 5KHXA 3UG1A 4I21A 3QLFA 3BQCA 4IIRA 3BU3A 4DA5A 2VV9A 3G5DA 4LGHA 4BY9E 4DN5A 1P5EA 4BYIA 2PZYA 3ZRMA 1PXKA 3IOPA 5EDRA 1S9IA 3L8PA 4EORA 4RX5A 3GC9A 3LXPA 5JFWA 4R7BA 2C5NA 5E91A 3M11A 1QPDA 2VTAA 1H08A 3R9NA 1XH6A 4JQ7A 4DFNA 1URCA 1UNHA 4FL2A 5GHVA 1Y57A 2QU5A 3HDNA 4GT3A 1OL6A 4LRJA 4LGDA 4C36A 4U97A 3CKWA 3Q9ZA 4YP8A 4C2WA 1H8FA 4FTRA 5AP6A 3MESA 4AWIA 4EHGA 4IZ5A 1SZMA 2O2UA 4BWKA 4RC2A 1JKTA 4QTDA 3KREA 2OIDA 4IJ9A 4GU6A 4G3CA 4W4XA 4L67A 3CY2A 3FL5A 4H3PA 2X4FA 3NIEA 5C27A 2PVRA 2JDTA 3I7CA 4OAVB 1FMKA 1M7QA 3E63A 1Q8UA 2XZSA 1LEWA 4QYEA 4EHVA 5LVOA 4IX5A 1IAJA 3MY0A 4BIBA 5GNKA 4K8AA 5IMEA 3CY3A 4R7IA 5HX6A 4Y5HA 3NUAA 3PSCA 4APPA 1H1PA 4GRBA 2X8EA 3C4ZA 3W10A 3BYVA 4WSYA 3ELJA 4ALWA 4RA4A 4B7TA 4BDEA 4OTRA 4ACDA 4KNBA 4BTKA 3D5WA 3UIUA 3S00A 2C1BA 4U5JA 1JSUA 1P14A 2CNVA 5DR6A 4AE6A 4CCUA 4E5WA 4RVMA 3AC4A 5AR3A 4C4FA 1ZMUA 2QOHA 2CMWA 3LM5A 5DWRA 4IZYA 5JRQA 4FZAB 4OTDA 5FTOA 3HNGA 3V5LA 4MF1A 4V0GB 4CRSA 3GP0A 3ATTA 2XRWA 3GXLA 4UALA 1H28A 2ZM3A 5T68A 3GGFA 1UU9A 5EQYA 1XH8A 4RPVA 4FEWA 5GIPE 3RHKA 3UZRA 4F7NA 5HTIA 1U54A 1WBVA 2UZLA 2CDZA 2ETKA 3DB6A 3JS2A 3OCGA 4QP4A 3PE2A 4YPSA 2Z7SA 4GK2A 4C37A 4XCUA 4EZ7A 4FODA 2OBJA 1Z57A 3K3IA 3KQ7A 2C5YA 5EHYA 3VUGA 1J1BA 1REKA 5CZIA 1LPUA 5FM2A 2QR8A 3ZEWA 4F1OA 3HZTA 3RM6A 2YN8A 2X6DA 4YR8A 3DJ5A 2XIZA 3QXOA 3RWPA 2G1TA 3ZLXA 4CYIA 4EQCA 1BL7A 4GVJA 4W4WA 5AP5A 5HCXA 4TW9A 3ZFXA 4P5ZA 4GJ3A 4N57A 3WF5A 4DG3E 3IO7A 2IW8A 4JDJA 1ZZLA 5K5XA 5K9IA 4QNAA 4C0TA 2WU7A 4I22A 4IAIA 4GL9A 2J0KA 4XX9A 2E9UA 3UQGA 2WOUA 2YCFA 4I6BA 5IUIA 3CSVA 3BLQA 3OTVA 3FZPA 2X8IA 4L45A 1NXKA 3CTHA 4HOKA 5J95A 2PWLA 4W8EA 3LQ8A 3QTRA 1YHWA 2UZOA 2PZPA 3EKNA 2Q0NA 3MTFA 2PHKA 3QGWA 3NNUA 5LCKA 1J7UA 2CKOA 1B6CB 2R3RA 5CYIA 3OXZA 1OPLA 4G6NA 3FC2A 1HCLA 4D0XA 3MYGA 1OKYA 2VO0A 5LVPA 3CQWA 2G2HA 5AUWA 3RGFA 3HAMA 3EB0A 4J95A 1ZOEA 1KE5A 2GS6A 2PZRA 4AOJA 4NFMA 2XUUA 4ZZMA 3FI4A 4A9SA 3Q3BA 4M13A 3N4TA 4O7YA 2W06A 4QMYA 4AG8A 2W0JA 4DYMA 2HELA 3UGCA 4EH9A 1JKLA 3FMHA 5HNBA 3UO6A 4AOTA 3TUDA 3NRMA 3PXRA 5LWMA 1OI9A 3LCTA 3LFQA 1KSWA 1NY3A 1OIYA 3R73A 4IVAA 3F9NA 1R39A 5LVNA 3QQFA 2ZJWA 4QMTA 2BRNA 2YA9A 4A9YA 4XBUA 3QRKA 2WTCA 3UNKA 3HUCA 3HEGA 3DBQA 2I40A 2H34A 4P7EA 4DTBA 2A27A 3CXWA 3QAME 3UZPA 5CF5A 3BBWA 3FHIA 1Q24A 3HV4A 4GYGA 5L2QA 4DGGA 4S2ZA 3HMNA 2FO0A 3C5UA 4NU1A 1J7LA 4C35A 3F88A 5AP2A 4PTGA 4IXPA 4DT8A 2ITTA 4LL5A 2DYLA 3MY1A 2GHLA 3EN9A 3EQIA 2UUEA 2QOBA 4M69B 4O84A 1NVSA 4FTMA 5KZIA 4A9UA 4APCA 3I7BA 4BBMA 3E64A 3EWHA 3CKXA 4EOPA 3GQIA 4Z55A 2WMVA 5A14A 3ENMA 2PPQA 3MDYA 4BIDA 4B9DA 5HNGA 1FOTA 2FH9A 2UVXA 3LZBA 5DR9A 3QF9A 2E2BA 4KBCA 2OJJA 4FTTA 5I3OA 3BU6A 3FLQA 3FSFA 5LVLA 5G1XA 2BR1A 3UO5A 1YDRE 4FEUA 4P2KA 3IQ7A 3L9MA 3QD3A 5IH5A 3LOKA 3W18A 4K18A 3UP2A 2Y4PA 4JJRA 3BWJA 3O2MA 3C51A 4QMXA 4ZLOA 2RFDA 5CF6A 3OCSA 3WF6A 4ZSEA 5CAQA 3KXHA 4O7SA 5TF9A 4DBXA 3ZOSA 2X9FA 5EYCA 1Y6BA 2BROA 3EQFA 2W17A 3KL8A 5AP1A 5FDXA 3GCVA 3UOLA 4AN3A 3BIZA 5E8SA 2C5OA 2GTNA 4ZY6A 3UE4A 4FSMA 4EKLA 4LI5A 5LMBA 2IZSA 3QGYA 3FQEA 2J0LA 3TCPA 4KAOA 4MK0A 4XUFA 3DXQA 5DH3A 1PMEA 3OTUA 5H9BA 3F2RA 3OUKA 4YZMA 2C68A 4UMPA 4W8DA 1YXUA 4AT4A 3VUMA 2BKKA 2ITWA 2QOCA 2R9SA 1YHSA 3CGFA 4BHZA 4YJOA 5BVKA 1YRPA 3NLBA 3VWAA 3TT0A 3WE4A 3PUPA 3GOPA 3E8DA 3PJCA 4PDOA 1V0OA 2FGIA 4HNFA 1XH4A 2QHMA 5DRBA 5EFQA 3ZH8A 2XM8A 5BUEA 3ROCA 2CSNA 4UWCA 2PY3A 3BEGA 3DZQA 4KIOA 3EN4A 5HVJA 3R8MA 1YVJA 3CC6A 4I93A 2GNIA 5BVOA 3U4UA 4O82A 4FT0A 3BYSA 4M0ZA 4RSSA 5IEYA 2Y6OA 4NSTA 5CSWA 4KSQA 3SD0A 4USEA 5CT7A 1IRKA 4MWIA 3WYXA 4CLIA 2F7EE 2XK8A 2G15A 3QRUA 4GYIA 4LUEA 4M7IA 4QMVA 4RQKA 1Q99A 1KE9A 4C62A 3CQEA 3WF7A 2WB8A 1U54B 5CVGA 5L8JA 3PJ3A 3FPQA 4ZSJA 3LHJA 3LFCA 4FOCA 5C9CA 3TACA 4JG6A 1WZYA 3CJGA 2W9FB 3Q2JA 5CSVA 4I6HA 1ZYDA 3BRBA 1YKRA 2BZKB 3TTIA 2W4KA 4ENYA 3PXFA 5CXZA 3C0HA 1H24A 2ONLC 3II5A 5HCZA 5F95A 3C4XA 5FG8A 3ZXTA 3NUSA 5CU6A 3IW5A 4JR3A 4O0UA 3ORKA 3ZRLA 3BHVA 4CYJA 4DITA 5IA0A 5FEEA 4DEDA 2XBAA 3GCUA 3ANRA 3QALE 5DN3A 3R9OA 5DMZA 3R7VA 3V3VA 1GIJA 4GK3A 3QQUA 1F5QA 5KBQA 3OOGA 3QUDA 4NZWB 3SAYA 4K6ZA 1CTPE 2XK6A 3DK7A 4FTAA 4LOQA 1URWA 3R8VA 4BYJA 3S2PA 4I1ZA 5DOSA 3OWPA 5EG3A 5CALA 3FZTA 4OTIA 2VNWA 4IADA 1T45A 5CU4A 4JRNA 4L01A 1U5QA 2HWPA 3FMNA 2PE0A 2VWYA 4FNXA 4GIIA 4D4SA 4ZSAA 4O7LA 4FSTA 4DG2E 2JKQA 4AN9A 5ACKA 2CCIA 2QO9A 4DC2A 4I5HA 4DF3A 3AXWA 3E7OA 4RFZA 1DAYA 1FQ1B 3P7CA 4H3QA 5E8UA 3CQUA 3RCDA 4CNHA 2AUHA 1OBDA 5B0XA 4A07A 2ITVA 4FT3A 4FK6A 5HU3A 3F3WA 2XKCA 5DNRA 4X7QA 4JT3A 3AG9A 4DT9A 1PY5A 3PXZA 4QP2A 1PF8A 4Z9LA 4ZK5A 3RPOA 3OC1A 4HGEA 3DT1A 4AFEA 5C1QB 3LFFA 3V04A 2ITNA 2QOOA 2WMRA 1PKDA 3P9JA 3FMKA 4S31A 4O7WA 3EFKA 2W1GA 3ZLWA 4D2PA 4DG0E 4UV0A 3TL8A 4E20A 1JOWB 3OCTA 3TI1A 5AUVA 3HX4A 5C03A 3GNIB 2JGZA 4EWQA 2J0IA 2XRUA 4OTQA 5FQDC 3TIYA 4C4IA 5HORA 4U42A 5IEXA 3ZFMA 4XV1A 4E73A 1H1SA 4UN0C 2VTSA 3NIZA 5CENA 3I5NA 2QONA 2C6OA 5KMNA 3O17A 4FTNA 2PU8A 5M4UA 1J7IA 5IA5A 4I5MA 3P23A 3SW7A 4RVLA 4OTWA 2IN6A 4MXAA 2GNLA 2YIWA 5M55A 3RP9A 4OT5A 5KMMA 2BIYA 1U5RA 3R63A 4V05A 4BCKA 4XOYA 4D2VA 3D83A 3IOKA 4AT3A 3L8VA 3ZCLA 4EYMA 2W1HA 4IANA 4E6QA 4YSMA 5AAFA 3LJ0A 3LLAA 4X3FB 5EDQA 3VVHA 3LJ2A 4BCHA 2AYPA 3GCQA 4C3RA 5JZJA 1ZAOA 5KKRB 4K0YA 3EFLA 4D0WA 3FKNA 4JS8A 4QMZA 5CEKA 1CKPA 4EK8A 2IVVA 2X1NA 4FMQA 3D9VA 4U0IA 3VNTA 4L53A 3RTPA 2I0HA 1FINA 3FMLA 4FSZA 2YIQA 4RX8A 5CNOA 5HIDA 5ITAA 4O7RA 5TO8A 1WBSA 3RNIA 2VTTA 4RZVA 4IACA 3V6RA 4RLKA 3WF8A 2HY0A 5J7BA 4IX3A 4I5PA 5HBEA 3KXZA 4U40A 3PP1A 5A4EA 3NUPA 5CEIA 2BDFA 2YACA 4R5SA 1SVEA 2F2CB 3QRIA 1P2AA 4CMUA 5M09A 1ZOGA 4BCPA 3RI1A 3IW4A 2JIVA 3QWKA 2HXQA 4GFOA 2UVZA 3PLSA 1AD5A 3HMOA 4ZS0A 4XG4A 4PRJA 3WIGA 3UIXA 3BHHA 3CPCA 3BLRA 3QCQA 4EK3A 1M17A 3UBDA 4U6RA 3RPVA 3FMMA 2OH0E 3QTXA 3DLZA 1Y6AA 4I3ZA 4XG8A 3VBWA 3EJ1A 4IB5A 4BI0A 3RPSA 3OMVA 3QWJA 3SKCA 4DTKA 2F57A 3E3PA 3E8CA 4FVQA 1KUTA 2I1MA 1R78A 1GNGA 3UO4A 5JFVA 3RPRA 4BWPA 4FT5A 3CD8A 4IX4A 3B2TA 4BCIA 3HGKA 4ANSA 1WVWA 2YM7A 3QYWA 1VYWA 3NYNA 4XV2A 3AC3A 2OSCA 4IM0A 3T9TA 2XM9A 5FDPA 1IA8A 3K3JA 3U6IA 2ZV7A 3SG8A 3QCSA 4MXXA 4J99A 4JG7A 2VO6A 3MFSA 3FEGA 3KRWA 4O1PA 4KIPA 2VWZA 1PXOA 5L6OA 1XKKA 4TTHB 3FI2A 4CCBA 3C4CA 3FY2A 4U80A 4Q5EA 2ZOQA 5AX9A 3TN8A 4FTCA 3VW6A 4I23A 4RX9A 3DKGA 1XJDA 3HRBA 4JLCA 3VRYA 1QMZA 4TYHB 4DEIA 3WZJA 4QQTA 3LFDA 2RIOA 3LMHA 4G17A 4WUAA 4YO4A 3RMFA 4TY1A 3D94A 2ITOA 2VWUA 3NX8A 4WHZA 4O0VA 1Q97A 2FUMA 4X2GA 2Z7LA 3A61A 4I5CA 4R8QA 3SRVB 2HW6A 2V62A 2YCRA 3QUEA 5J1VA 2PUNA 4CGAA 4NK9A 4DHFA 4ZZNA 3MIAA 1P4OA 3NUUA 4I24A 1WBWA 4GFGA 3MB7A 1O6KA 1Y91A 5IQDA 3DCVA 4NH1A 4IWQA 4I6QA 5AP0A 4GUBA 5ETFA 3Q32A 3QD4A 3QC9A 1BYGA 4PUZA 3KB7A 5FXSA 5C26A 4WRSA 1YOJA 1YXSA 2B9JA 4XHKB 5HG7A 4ASDA 5AR5A 1I44A 4Q2AA 3AD6A 4QPSA 3IK3A 3ULIA 4BCMA 5HO7A 3R8ZA 3R7GA 4ZTMA 5A4CA 2W99B 4CV8A 5I9XA 4EUTA 1L8TA 3ORIA 4UZHA 3VRZA 4G9CA 4RIYA 2REIA 2B9HA 1VJYA 2R3KA 1OB3A 1ZYLA 4XRLA 3TZ9A 4CFNA 4DLIA 2PE1A 5E8WA 3CBLA 5CWZA 4NW5A 5A3XA 4U9AA 4UMUA 4ACMA 2BAJA 1UKHA 4J52A 4RMZA 3WZKA 5AA9A 1OITA 3ZO3A 2RFSA 4QRCA 2XJ2A 4O81A 2ITZA 2V7AA 2WIPA 3QZHA 3OROA 5DVRA 5M4CA 3RPYA 5K5NA 3U9CA 4KABA 2C0IA 4FTUA 4AF3A 3G9NA 4AA0A 2HZNA 2XNBA 3BPRA 3ETAA 2ACXA 4UXLA 5E1SA 3SOCA 2XNNA 2VGOA 3OWJA 4QP9A 4DGOA 3A4PA 5IUGA 5DT4A 4RC4A 4B8LA 4M14A 4FV0A 4FSUA 4EKKA 3IW7A 4FG7A 1PXNA 2WTKC 4QMQA 2PVKA 1YI3A 4G6LA 3WZUA 5M57A 4CZUA 4XH6A 1Q3WA 3Q96A 5AIRA 4AZTA 4ITJA 4G34A 3VULA 1UU8A 1YWVA 3BX5A 4XJ0A 1ZYCA 4AGCA 3AMYA 3FBVA 3HDMA 4D9UA 2YERA 3DBFA 2WZJA 4TKSA 5CTPA 4FF8A 3VQUA 4BZOA 5HQ0A 4MCVA 3BCEA 5EYDA 3QUPA 4FNYA 4QP1A 3TKUA 5B2LA 3EQBA 5HVKA 4DFUA 2R3QA 3AD4A 5IDNA 1CM8A 1H1QA 4Z16A 1AQ1A 2O63A 4QMOA 2OG8A 3Q6UA 5DI1A 3S95A 4PV0A 4EOIA 4QYGA 4ZZOA 3HMIA 3KVWA 5H8BA 3AT4A 2R3LA 2W05A 2YHVA 4B4LA 5CF8A 5K4IA 5ANDA 2FB8A 5GZ8A 3KULA 3Q9XA 4IM2A 4J97A 2WTDA 5I3RA 3PWDA 2C0OA 4DGLC 3D5VA 4I0TA 1YI6A 2BFXA 3MFRA 5I9UA 4EOKA 2A1AB 4EOOA 5JN2A 4MD9E 3CTQA 4O2ZA 3W55A 3TNHA 4X21A 4J8MA 1GZOA 3QFVA 4BCFA 2XKDA 1J91A 2BTRA 2P2IA 3ZU7A 4X6QC 3C0IA 4TYEA 4KBKA 4YO6A 4BBEA 3C50A 5FP6A 2CNUA 3NVKI 3I6UA 3VUIA 4UYNA 1Q62A 2YZAA 3DNEA 4ZOGA 5D7AA 5F4NA 4AGUA 5M4IA 4JIKA 5HBJA 4CG8A 5C01A 3ANQA 4ITHA 4GIHA 1G8SA 3U54A 3NAYA 4U3YA 2YM4A 3FPMA 2IWIA 3LLTA 4FSYA 3PXQA 4JBVA 4NYEA 4FIIA 3C4FA 2RF9A 3EN6A 3ZTXA 3VUKA 2I7QA 3DKCA 3ZO2A 3CJFA 4TWNA 4HVSA 3R04A 4IBMA 3D2KA 3C1XA 4O38A 4CZYB 3HKOA 3GFWA 2YDJA 4FV4A 4HYIA 3KRLA 3Q60A 3TZ8A 2B0QA 5JH6A 1G8AA 2AC5A 4JRVA 2QOIA 4PDSA 4EOMA 3UZTA 3QQLA 4LUDA 5L2SA 5C8NA 1UV5A 1OL7A 4U43A 1X8BA 3JUHA 4YMJA 4QTBA 4XYFA 3FSKA 1YWRA 2ZM1A 4QTEA 2YAAA 2EB2A 3UVPA 5IF1A 5JQ8A 1OL5A 3IDCA 4XP0A 2PMIA 2WAJA 3OCBA 5J8IA 3SXFA 4EOSA 2PMNX 3QKMA 1KV1A 4IH8A 4FIFA 1ZXEA 4A4OA 1GZ8A 5I4NA 3BELA 2YIYA 4MEDA 1Q8YA 2VRXA 4CFUA 1RE8A 3C5IA 2IVTA 4ITIA 3LPBA 2KULA 2XK3A 3DXNA 4RFYA 2RG5A 4IDVA 3SQQA 4F7SA 3UODA 4I41A 1M7NA 2JFMA 4QYFA 3EN5A 3COMA 4L42A 2XS0A 1W8CA 2XK7A 5AIKA 5AAEA 4C4HA 5HESA 2CKQA 4JBQA 4HGSA 3ZZEA 4EBVA 2BPMA 1XQZA 3PXYA 2UZNA 5HNIX 5CU0A 2PVHA 5AJQA 3BU5A 4EHZA 2XH5A 3DFAA 3JXWA 2R3GA 3RHXA 1I09A 4HCUA 5J5SA 3F3UA 3ZBXA 2WMBA 3BI6A 4IQ6A 2YEXA 4FV3A 4HYUA 3U55A 4GKHA 1JNKA 5CU3A 4QMMA 1MP8A 4BTFA 3SG9A 1KOBA 2PVNA 3PRFA 4DEGA 3HA8A 4AAAA 1IASA 2RFEA 4S32A 2VTMA 4O91A 3WBLA 4WNPA 3UVRA 5HLWA 1UKIA 3AT2A 4E4NA 3B8RA 3S0OA 2LGCA 3PPKA 3JVSA 5CAPA 4U7ZA 5FEQA 2WMUA 4C4EA 5L3AA 4PTEA 3F5PA 2XEZA 4GJ2A 2HY81 2VU3A 4YBKA 3VJNA 2UW8A 1UU7A 1SNXA 5EHOA 3OF0A 4IDTA 3QLGA 1U59A 4DLJA 3V6SA 4FTLA 4E93A 3NMUF 1VYZA 3MW1A 3QXPA 1O6YA 5ACBC 1BI8A 3H0YA 3BE2A 2ZB1A 4FL1A 4G2FA 4NM7A 5D7VA 5HCYA 5BVEA 2X2KA 4FEXA 2UV2A 3MWUA 4F9YA 3TUBA 1H1WA 1PJKA 5HI2A 4O0SA 2EVAA 5AV3A 5BMMA 3R1SA 5IKWA 3HYHA 4RJ4A 3QX4A 1OM1A 3E7VA 2GFCA 4L43A 4PDPA 3RJCA 4L3JA 4DINA 1WVXA 3PLAE 1XBCA 4F4PA 4M84A 2OZOA 2CLXA 3FL4A 4P90A 4EOQA 2CGUA 2A19B 2C3KA 3R28A 2B9IA 2EXMA 2VTPA 2FSLX 3AC1A 3HV5A 4JOAA 5TKDA 3VS1A 1WVYA 2YLEA 4XLIA 5HICA 3LFSA 3W2SA 3G9LX 2QU6A 2PZIA 3BQRA 5IQIA 2OKRA 3AOXA 4R6VA 4YC3A 3EQRA 1JSVA 3QU0A 3ZEPA 3ZO4A 5IISA 2J51A 4I94A 5CT0A 3F7ZA 4E1ZA 2Z02A 3PIYA 2JIIA 2O8YA 3KULB 3BHYA 2E9VA 4KKHA 2OFUA 4CKIA 4YTFA 2GNJA 4YJTA 3RK9A 1DM2A 4U79A 4DCAA 1HOWA 3H10A 4F08A 4Q5HA 3JY0A 4N0SA 4TNBA 5CI7A 4MYGA 2WQBA 4MNFA 2R7IA 1H0VA 2YIRA 4YJQA 1PHKA 3M2WA 3UPZA 2OJIA 4EUUA 2Y7JA 1WCCA 4MBJA 3R01A 1JWHA 4QNYA 3LCKA 1KWPA 4C7TA 4E6DA 2VN9A 5EI6A 2C69A 4EOJA 4IMYA 2B7AA 3R2YA 4C4GA 2OICA 5L8KA 4Z7HA 4FX3A 2FSTX 4WIHA 3VS4A 5JKGA 4LRKA 3V51A 1KE8A 4KINA 1E9HA 2QCSA 3OXIA 2ITXA 3PA5A 1OPKA 4FZDB 4DEBA 2WNTA 3OZ6A 3OY1A 3AD5A 3ZLYA 4CKJA 2FYSA 3O23A 1L3RE 2CHLA 2EXEA 2CGWA 2RFNA 4CMOA 3SVVA 3RCJA 5H3QA 3VUHA 3W2PA 2XNPA 4LM5A 4MNEB 4CTBA 4LG4A 5BPYA 5L6PA 1UU3A 1W83A 5AA8A 4ZS4A 3NUNA 3RVGA 4FG9A 3QRTA 1MRVA 3N4VA 4F09A 1J1CA 2W5AA 3O7LD 4NIFA 4FSRA 5FXRA 2B52A 2VNYA 3O7LB 5EM5A 4PPCA 4RJ7A 5FXQA 2OLCA 2KTYA 2HYYA 5B2KA 3EZVA 4O6EA 3VS5A 4AACA 3F5XA 4AUAA 4FIEA 4ONAA 3GFEA 4BL1A 5IUHA 1PMVA 5LCJA 3RKBA 4QO9A 4ANBA 5CS6A 4AE9A 3JYAA 4PF4A 2OIBA 3HLLA 5HO6A 1B39A 1H1RA 5AP4A 2XIRA 2R3FA 3NUYA 4KRDA 3UOHA 5JSMA 5CSPA 2WTJA 2Y6MA 5KZ0A 2PUPA 3PSDA 4CXAA 4WG3A 2VX0A 2JIUA 4ZJJA 3QRJA 4IZAA 4N70A 4FUXA 1A48A 3PXKA 3ID6C 4ANQA 4QPAA 3KEXA 3LAUA 3S1HA 2YIXA 2Z2WA 4UZDA 3TNWA 5CI6A 3OS3A 3WZEA 2E9PA 5IQGA 4GK4A 4G5PA 4J7BA 5AV4A 2Z8CA 4L46A 3WIKA 1EH4A 4DAWA 1ZWSA 4X6RA 4I20A 4FL3A 3ZSGA 1RJBA 3E3BX 4FTIA 3GU7A 3KC3A 2W4JA 1XHAA 4YTIA 3EFJA 4C61A 5CF4A 4IAYA 4CFFA 4AW0A 4TYJA 4D5HA 1YHVA 4BHNA 2B55A 4G9RA 1WBTA 3NCGA 5L2TA 3QQHA 2YDKA 3SXSA 4BKJA 2WMXA 4DFBA 2J2IB 3G51A 3PTGA 3OHTA 4WKQA 4YTHA 4CFVA 2W1DA 1WBNA 2XP2A 1Q4LA 5BQ0A 5M51A 4QMSA 4L3PA 4ZAUA 2DUVA 3Q2MA 4ZMEA 3V5PA 3ZSIA 2J7TA 3L1SA 1FMOE 2VAGA 3QA8A 2NP8A 4XBRA 4D1SA 2X2LA 3HMMA 4LV8A 4C8BA 4QOXA 4U45A 2QOFA 2XYNA 3DFCB 3NNWA 2PULA 4QPMA 3OW4A 3G33A 2ZAZA 3O0GA 5E90A 3FI3A 1J3HA 2OF4A 1WFCA 3QTWA 4EQMA 4NCTA 4MX9A 4FIHA 1RDQE 4FV7A 3ORXA 3FYKX 3LXLA 5HBHA 3BLHA 4A9TA 3OBJA 3OT8A 4EK4A 5AR2A 4EQUA 4S30A 5EOLA 3KMMA 4BDIA 4LQMA 3DTCA 4O7ZA 1IA9A 1BI7A 4N6YA 3DK3A 3SOAA 3UYTA 1GY3A 4C38A 2YAKA 1WBOA 4PY1A 5AUTA 3KU2A 4NFNA 5HU9A 3MPTA 3EH9A 4WNKA 2QNJA 5KCVA 3BEAA 4JAIA 2JAMA 3PY0A 4OTGA 4L3LA 5D41A 3KF7A 3TG1A 4C33A 1ZARA 4OAUC 2UW3A 3TZMA 3L8XA
chains in the Genus database with same CATH superfamily
4KBAA 2UVYA 3EL7A 3VF8A 3AC2A 3Q4UA 4PL4A 2BZJA 4X2JA 2W7XA 4CEGA 4CD0A 3OOMA 3N4UA 4ERKA 3TJDA 2JLDA 3NEWA 4UMQA 2HAKA 4TT7A 5C4KA 4QYHA 3DK6A 1G3NA 3PZEA 3V5TA 4ANOA 1VR2A 3DTWA 2UW4A 4H36A 4KS7A 1XBBA 3W2RA 4D4VA 4IE9A 4UX9A 5DYJA 3RAIA 1TZDA 4QMWA 4HPUE 4Y46A 4FEVA 2JBOA 3GVUA 3RZBA 2XJ1A 2PVLA 4C3PA 2ZMCA 2R3PA 1ZY5A 3EMGA 1M2QA 5AR7A 4F7LA 5IDPA 3U6JA 2V22A 3BYUA 4ZTLA 3KCKA 2ZM4A 1JBPE 1GZKA 3EL8A 3FI8A 3QTIA 4R3RA 2JEDA 3QQJA 4FI1A 4UWYA 3MH0A 1XBAA 3OUNB 4G16A 4UEUA 3ROYA 2OO8X 5BVWA 4WD5A 3NNVA 4BI1A 1UVRA 3H4JA 3PVBA 4RA5A 3NYXA 2JC6A 4ARKA 4BR3A 5HGIA 5I0BA 3COKA 3PA4A 5E8VA 4DFZE 4JVGA 5JK3A 1T46A 4CMTA 2PMLX 5EW3A 1MQBA 2WEIA 5E9EA 3EZRA 3Q9YA 5AUUA 3ENHA 2QO2A 2IG7A 5FTGA 1CKJA 1GIIA 2YM3A 3FLZA 4O7VA 3MVJA 5D11A 2XYUA 2OJGA 4Y72A 2GPHA 4OBPA 4WUNA 4NIFB 5ETCA 2VTHA 3Q5IA 1K3AA 2RG6A 4DEAA 5JRSA 1H27A 3MPAA 4KUJA 3UDSA 3ITZA 2X81A 4FSNA 4U44A 4M66A 2ERKA 3A60A 4I4FA 4RJ5A 2B9FA 4BJJB 5KMJA 4YBJA 5EI2A 3THBA 5A9UA 3L9NA 4FEQA 4RIXA 1ERKA 1NVQA 2OH4A 5D10A 5EK7A 2PVYA 3P7AA 4BDCA 4FKVA 1ZOHA 2OW3A 2HZIA 2WTKB 3AT3A 3TDWA 3DJ7A 4M15A 4MVFA 3DBCA 3NGAA 5FBNC 4H1JA 4EK5A 4CKRA 2XK9A 5HKMA 2F7XE 2XMYA 2ZDUA 3GEQA 4JR7A 2XANA 3Q9WA 4QD6A 4AS0A 5M53A 5H8EA 5C4LA 2ZYBA 1ZYSA 3FE3A 2XNEA 3VS3A 4IFCA 4OT6A 4W4YA 2GS7A 5L2WA 1AGWA 1PXLA 1QPJA 1U46A 2P33A 2YWPA 3ZBFA 5KO1A 3OY3A 5AFVA 3ZUVA 5IQBA 2CJMA 4XG6A 5HHWA 4WRGA 5KX8A 4DH8A 2C47A 2VTOA 1S9JA 4GMYA 3KK9A 5IPJA 3PIZA 4O21A 3SA0A 2GMXA 4FTOA 2ESMA 3HMPA 4L44A 1F3MC 3B8QA 3COHA 4PP9A 2F9GA 4H05A 1Q5KA 3FKLA 1MRYA 3H30A 3FLYA 5FTQA 5I9WA 3KXMA 4FOBA 1ZZ2A 3I0QA 2JITA 3VUTA 4Y73A 4NUSA 3UVQA 3BHUA 1YOMA 4YZDA 3FDNA 3FKOA 4BZDA 4AAYA 3CPBA 4RJ8A 4BI2A 4L52A 4NM5A 2ITYA 2E9NA 4YJNA 5TE0A 3ORPA 4BVUA 2XNOA 5AP3A 2XIKA 3WZDA 5L8LA 3IGOA 3NZ0A 5HEZA 2WMWA 4UWBA 2GNFA 5IQFA 2BIKB 2XCKA 3W1FA 2Q83A 4QTAA 4YJVA 3VS2A 4ACHA 3CD3A 3TDVA 4ZTQA 5BUJA 3ZS5A 3AKLA 3NW7A 4MQ1A 2OJ9A 4N6ZA 3HA6A 5DT3A 4BGQA 2X39A 1Q8TA 2YM5A 4ZTNA 4BWXA 3VBXA 4PWNA 3ODYX 4A06A 3PVUA 4BKZA 4F7JA 2XA4A 1CSNA 3RZFA 4AZVA 4FA2A 3FXWA 4LOPA 5BYYA 3NPCA 5J5TA 4HW7A 4J98A 4OW8A 3RK5A 5HZNA 1W98A 3LFAA 1OBGA 3U87A 3MFTA 3W2CA 4G31A 2XNGA 2F7ZE 4L6QA 2QKRA 3AKKA 2WMQA 3KGAA 4USFA 2PUUA 2EB3A 4TYGA 4F0IA 4DHJA 3E5AA 2ZVAA 5L2IA 3PP0A 3NW6A 4FVPA 3A2CA 1LUFA 4DH5A 1OIUA 1PMUA 3EIDA 2BDJA 5AADA 2QOQA 3ALOA 4H58A 2AEGA 2A2AA 1TFFA 4TYIA 3VBQA 4D28A 2HENA 4FZFB 3C13A 3POZA 4G5JA 1IR3A 4XG9A 3GU4A 3VS6A 3PRIA 4DHIB 3D15A 4RIWA 2QVSE 4L8MA 1B38A 1YXTA 3NNXA 4KSPA 4RWIA 2CLQA 3S4QA 3SHEA 3PDTA 4YC6A 1G5SA 4FYOA 3U8WA 4MH7A 4EHEA 4GG5A 3QKLA 2B54A 4G3DA 1LR4A 2OZAA 5HIBA 5AUXA 4AP7A 5IQHA 3NFFB 3W0PA 4BDJA 5GJGA 3W8QA 5IA4A 2YWVA 3JVRA 4HYSA 3IDPA 4S33A 5LARA 4ORKA 4JI9A 3CLYA 2WIHA 3OG7A 2I6LA 2C1AA 3OT3A 3ZFYA 3CP9A 4C3FA 3Q4TA 4XG2A 5BNJA 2PVFA 3V01A 4Y8DA 4NJ3A 4FKRA 4MBLA 4ZY4A 3BYOA 1NW1A 5M08A 1OKZA 3ORMA 4NKAA 2QR7A 3LM0A 3PFQA 4AZEA 5D1JA 1K2PA 3PYYA 3R1YA 4ZEGA 3BBTB 3G6GA 3NCZA 2IW9A 3ZC6A 3MTLA 4D2RA 4F6WA 2PVJA 3A99A 4A9RA 2XJ0A 2C30A 3PY1A 2GHGA 3A7HA 3ZSHA 3BGQA 2RGPA 2BKZA 4X0MA 4ERWA 2X0QA 3RALA 3R8PA 4ZLZA 5BYLA 3UMXA 4C2VA 2HWOA 2WMSA 4E4LA 2JBPA 3VW8A 4FE2A 3QCYA 2IPXA 4QMPA 4EK6A 1LP4A 3ZDUA 4JBPA 4BCQA 2UW0A 5H8GA 3AMBA 2QG5A 4QQ5A 4IB3A 3KMUA 3TIZA 2XKFA 2W1IA 1M14A 3A4OX 2BAKA 1ND4A 2JDRA 2UW5A 4M68A 2PTKA 4YPDA 2DS1A 3DAKA 3U51A 3HUBA 1JAMA 4MXZA 3WILA 5JFSA 2QOLA 3DB8A 4HPTE 1M52A 3FLNC 3EHAA 3BGZA 2XCHA 5M56A 4R3PA 4ACCA 3LMIA 3UC3A 3ZM4A 3DDPA 3BE9A 4WT6A 3EYGA 3F3VA 5I5ZA 2UZEA 5LQFA 3R9RA 2C6LA 3KRRA 3W16A 4F70A 4BBFA 3EKKA 4ZY5A 2OFVA 4F78A 4YJPA 2R3NA 3OFMA 5CX9A 4FV6A 5CANA 3R8UA 4GEOA 3W33A 4MTAA 5EM6A 3SX9A 1R0EA 3G90X 3L8SA 4OLIA 3R6XA 1PYEA 1OL2A 3LXNA 3Q53A 3UOJA 5HO8A 1BX6A 3UMWA 5KHWA 3F61A 1TVOA 2JDOA 4I92A 3FMJA 4FKPA 4LMUA 5IG1A 3P4KA 5FGKA 1OMWA 1V0BA 1YXXA 4QP8A 4TWPA 4XNEA 4Y85A 4IWPA 4MD8E 4W4VA 2QODA 5CEOA 3A8WA 5CAVA 1W2DA 3F2NA 4L00A 3DLSA 4BZNA 3ZZWA 5EM8A 4MXOA 4BB4A 3ZXZA 4RQVA 5CY3A 3RBWA 2CGXA 5GZAA 5A6NA 5M44A 2BALA 4F63A 3PG1A 4GUEA 4XLVA 4R7HA 3DPKA 2GNHA 5GZ9A 2QO7A 3FZRA 1UNLA 2YCSA 3VUDA 2IVUA 4EH2A 1MUOA 2V0DA 4B0GA 1SM2A 5JGDA 4JIAA 3K5UA 1UWJA 1IAHA 4JQ8A 1OL1A 2HW7A 3I60A 4WNOA 2CCHA 4L68A 1K9AA 2ONLA 4BCNA 5BVNA 5KBRA 1REJA 3MSSA 3SC1A 5J9ZA 2ZB0A 4X2FA 2R4BA 2O64A 4EH7A 3LE6A 1PYXA 4MQ2A 4RGJA 5CSHA 1FBNA 2UZWE 1Q8ZA 5TR6A 5IA3A 3LFEA 3AGMA 3BV3A 3P0MA 1LEZA 4ID7A 4YJRA 2P4IA 3TV4A 4BCOA 5K0XA 2CKEA 2F4JA 3BZ3A 2R7BA 3EN7A 5T6KA 2C5VA 3QC4A 3WYYA 5HOAA 5AR8A 2WEVA 3AGLA 1YW2A 4Y95A 4ZJVA 1CKIA 2ZV8A 1FVVA 2X7GA 3FMEA 3VS0A 4FGRA 3E62A 2QLQA 3FAAA 4PMTA 5E7RA 5LOHA 2O0UA 3TM0A 3QHWA 1WBPA 2NNWB 1VZOA 4C58A 2VTNA 1E1VA 3QHRA 3VC4A 2G2IA 3D7ZA 3FUPA 3ORZA 5HG5A 4HYHA 3R83A 3UQCA 4EI4A 3ZUUA 4YUQA 4WG4A 3KY2A 4IZ7A 5J79A 3RWQA 4K11A 4D55A 2BMCA 4AOIA 1XWSA 4WO5A 2JKOA 4RX7A 4RIWB 3D2IA 4QDVA 2YM6A 3GENA 4KRCA 3GOKA 3R7YA 3GC0A 2R3MA 5ANJA 4E4XA 1SMHA 2YJRA 4NKSA 3U9NA 2YISA 1PXJA 5HE3A 4JL9A 4BDFA 2GHMA 5J1WA 4R3CA 5M4FA 4RIOA 1M2PA 1PKGA 1FVRA 2UZVA 3HP5A 2QG7A 1Z5MA 1DS5A 3F5UA 4IAAA 1KV2A 2J0JA 2YFXA 4Y5QA 1NVRA 3EQDA 4HCVA 2P2HA 4RWKA 3MS9A 4K2RA 3VIDA 3WARA 5BYZA 3H9OA 3MPMA 2NRUA 3MVLA 4ENXA 1H07A 2R3JA 4KKGA 3MA3A 4Y83A 4Z3VA 4AW5A 3GBZA 4OBOA 5E8YA 4O22A 3FQSA 2VUWA 3UNZA 4FSWA 3VAPA 4DCEA 1F0QA 4L7FA 4KS8A 3HV3A 3R7UA 5CEMA 2B1PA 2IJMA 3EFWA 3VS7A 2G01A 3O50A 4LMNA 4TZRA 3RM7A 5DBXA 2BRBA 4ZJIA 4F65A 4M69A 3V8WA 3IG7A 2JKMA 2OU7A 3E87A 4YNOA 3ZRKA 4A4XA 4BCJA 5IH6A 3Q4ZA 4FIGA 4MKCA 4C57A 4RIYB 4U3ZA 3UNJA 4BDKA 4XV3A 4ASXA 4R1VA 3ZMMA 4NL0A 3KN6A 1R1WA 2YITA 4FKUA 4GH2A 4OBQA 5FP5A 2QURA 4BC6A 2C6EA 4K1BA 3T3UA 4O6LA 5CVHA 5IQEA 3K5VA 1QL6A 5CSXA 3TNQB 2JDSA 2FA2A 1ATPE 2Z60A 3PY3A 3W0QA 2JD5A 4AQCA 2G2FA 3L9PA 5IH4A 5JMSA 4RJ6A 4ZTHA 4FNZA 4RJ3A 4EH8A 4IB0A 3F5GA 4HNIA 2HZ4A 5AEPA 5GINE 2XB7A 2X8DA 1W84A 4F64A 4RZWA 5TT7A 3UOKA 2ETRA 4BDGA 5B2MA 1H01A 1DAWA 1Y8YA 2BRMA 2C3LA 4G3GA 3F6XA 4YGAA 1GZNA 4O0TA 3UP7A 2UW9A 4FR4A 4FNWA 4J53A 4W9XA 2Y8OA 3MH1A 4RBLA 4BN1A 5KMIA 4PL3A 4ZTRA 5A4TA 4MBIA 5F1ZA 3MA6A 3GT8A 5HIEA 5LMKA 3REPA 4PL5A 2J5EA 5FEDA 4ACGA 5I9VA 5CU2A 5ETAA 4EWHA 3LJ1A 3OXTA 2PL0A 4H1MA 5DR2A 3NVMB 3W0MA 4AGWA 4PPAA 4ZIMA 4DFYA 3T8OA 4F9WA 3QX2A 3LCSA 2Y4IB 4DH3A 3PSBA 3PWYA 1E1XA 1R3CA 3GQLA 2XIXA 4IFGA 3HRCA 3SV0A 3G15A 5K3YA 1FGIA 2E9OA 2O65A 4IC7A 4K33A 2WMTA 3P78A 2QKWB 4USDA 4AZFA 4FV1A 2IZRA 4JBOA 3W32A 4EOLA 3ATSA 1XR1A 4R1YA 5D9HA 4EBWA 3GCSA 4DDIA 2WQMA 5D12A 3KXGA 1Q61A 4WG5A 2I0EA 2X7FA 2VTRA 4EJ7A 2AC3A 4AT5A 4EJNA 4FKQA 4NTSA 2XAOA 3QYZA 2C4GA 3DNDA 3FWQA 4FKGA 4QYYA 1STCE 4F9BA 4ZP5A 4RG0A 4WBBB 5BUIA 5AMNA 5CZHA 2EU9A 2XF0A 4R78A 4U81A 4TPTA 3UDBA 2XEYA 2GU8A 3I1AA 1W82A 4LYNA 4O1OA 3MH2A 2PK9A 3VF9A 4HVHA 3O51A 3RAHA 1SVGA 3PJ8A 3FJQE 3RINA 3ALNA 2EXCX 4OTFA 4PX6A 5GJFA 5H2UA 3C4WA 4EC8A 2XNMA 3F3TA 3UDTA 3TJCA 4FKWA 3IECA 4TNDA 3D5UA 3V8SA 4AXFA 4DGNA 1O9UA 4BDBA 2FSOX 4XOZA 3EQCA 4PTCA 5A4LA 4QEBA 4M67A 4E6AA 3HRFA 2GSFA 5JGBA 3P5JC 2V55A 2VZ6A 3TXOA 5CEPA 4EYJA 5M06A 1CDKA 3R30A 4D1ZA 2BTSA 4BIEA 2UZBA 3ORLA 4FGBA 4IC8A 3SW4A 4B99A 3HECA 5EW9A 3I5ZA 3A7GA 4NM0A 2BCJA 3V5QA 3D0EA 4BFMA 4IVCA 2QOKA 4F6SA 3NW5A 2VWXA 3PPJA 5AR4A 4HVIA 2GFSA 2YM8A 3FZSA 5FUTA 2BAQA 3PVGA 4GT4A 2O5KA 3KFAA 3SXRA 2QLUA 1DI9A 3E93A 4YSJA 3DJ6A 2PYWA 5AP7A 2C6MA 2OF2A 3LFBA 3OEFX 4IX6A 1V1KA 2C6KA 3KK8A 3VHEA 2BVAA 3A7IA 4XG7A 2C6TA 4GW8A 3IPHA 5AV1A 3R9DA 5BMSA 2CN8A 4AW1A 4D4RA 2ZMDA 2PUIA 5EI8A 4H3BA 1SYKA 5DA3A 5J7HA 3CTJA 4CVAA 1XMLA 2CKPA 2C6IA 2SRCA 4G1WA 4R77A 1Q41A 3JPVA 2CPKE 4ANLA 3ACKA 4XV9A 2CGVA 4BTMA 4CV9A 5HLNA 4YJSA 4K77A 5KMOA 2XAMA 2J4ZA 4O0XA 2IW6A 5AAGA 4RWLA 3MY5A 3EYHA 3ZYAA 5DG5A 3LFNA 3O71A 4CFWA 2GQSA 2W1FA 3LW0A 2ZFYA 5LJJA 1XH7A 3TNIA 5IA2A 1RQQA 4GCJA 3D4QA 3H9FA 3UJGA 5JFXA 4IM3A 4A4LA 4FKOA 2A4LA 1UNGA 3MI9A 4KIKA 3QD2B 3WOWA 5EKNA 1A06A 1ZYJA 4QT1A 3CEKA 3R7IA 2J6MA 2HK5A 2VTQA 4JAJA 4M97A 4RT7A 3Q4CA 4IWDA 2AQXA 1FPUA 1GJOA 2BZIB 2V7OA 2ZV9A 4UYAA 4DFXE 2J90A 3BHTA 3FMDA 3V5WA 4ANNA 3TUCA 4X3FA 4B8MA 2G9XA 2YCQA 5K4JA 3UPXA 2QQ7A 4X2KA 3DXPA 4TWCA 3AQVA 4RFMA 4O86A 3NYVA 4IAFA 4IHPA 3O96A 5EQEA 4GS6A 2HCKA 4EH3A 3DS6A 1VEBA 3PPZA 3SLSA 3LMGA 1QPCA 4MXCA 1APME 2WTWA 3DGKA 3NSZA 1O6LA 3R0TA 4XRJA 4PNKA 5BVDA 4UBAA 5T3QA 1OKVA 4YHJA 3MVMA 3OVVA 4UMRA 4PMPA 3KXNA 3O8TA 3UIBA 4CSVA 3VN9A 3WI6A 1BUHA 4JXFA 4L9IA 2UZDA 4MF0A 4YZ9A 5FM3A 5KMKA 2F2UA 3GU8A 1QPEA 1TQMA 4RVTA 2WD1A 3ET7A 4I0SA 5AV0A 4F99A 4F9AA 3FC1X 3R9HA 2WKMA 3RAKA 2IZUA 3PZHA 4BDAA 2RSVA 4KB8A 2WO6A 4F0GA 3CIKA 4EH5A 5LVMA 1SNUA 2WHBA 5IEVA 1YXVA 2Z7RA 3G6HA 5ANGA 4F9CA 4MUQA 3WE8A 5EKOA 4FT7A 4IB1A 3I6WA 4FKLA 5CNNA 5I9YA 5CQWA 4CT1A 2VWIA 4CTCA 2YLFA 2W9ZB 4K9YA 3VJOA 3MJ2A 5JT2A 3BV2A 2Y4IC 2VWBA 5JQ5A 2W4OA 3SGCA 4IAKA 4QMUA 5BX0A 2QI8A 3P1AA 3VHKA 4O0WA 4CQGA 3EQGA 3U6HA 2GDOA 3FZ1A 4MD7E 5EYMA 2B4SB 2WGJA 3G0FA 3G0EA 4Q9ZA 3ZHPC 4RWJA 4CQEA 3DDQA 1MQ4A 4JX7A 4FV2A 1JPAA 4A7CA 1NT2A 2WFYA 3GU6A 3R1QA 4O4BB 2BHHA 4WOVA 2LAVA 4KA3A 4IVDA 4EL9A 1BKXA 2JAVA 4LFIA 1FVTA 3LQ5A 4YLJA 3QTQA 3QZIA 3RNYA 4CT2A 4D9TA 5E4HA 3BGPA 3R7EA 3ZM9A 4FKSA 3DY7A 2H9VA 3IW8A 4NW6A 3TNPC 2UW7A 3CE3A 2WU6A 5JZNA 4AU8A 2OI4X 3CS9A 4FKIA 4GFMA 3ZLSA 4JNWA 3FHRA 3RK7A 4KIQA 2QD9A 2R64A 3NDMA 3P5KA 3IONA 4BCGA 4F1TA 2BZHB 2YJSA 5KKRC 3LIJA 4JX3A 1UWHA 4HZSA 4QQCA 2EUFB 2P55A 4EH4A 3KA0A 5AUZA 4JDKA 4TYHA 3R71A 3DOGA 3MIYA 4WA9A 5HE1A 3D7TA 3E88A 3O8UA 3EQHA 5EHLA 2PE2A 4B6LA 3MH3A 4E26A 5CQUA 4J96A 4PMMA 4IEBA 2PSQA 3SRVA 5JEBA 5CAUA 1JVPP 5EW8A 3DQXA 4LL0A 5AV2A 5KUPA 4UY9A 1XH5A 2X4ZA 3LCOA 3TKIA 4DTAA 4FC0A 4ZSLA 2VD5A 1RW8A 3QZGA 1JKKA 5J9YA 3QTZA 4KKEA 3K2LA 2UZTA 2DQ7X 4FTKA 4J8NA 2RKUA 3PE1A 5I9ZA 2WTVA 2WTIA 2X6EA 5E92A 3BLAA 4O83A 5E1EA 3WF9A 1Q3DA 5DFPA 3IS5A 3S3IA 3K54A 3C4EA 2BHEA 1OIRA 4RVKA 3V5JA 4E5BA 4DH7A 2PMOX 3IGGA 3QL8A 4CG9A 3PIXA 3JR1A 2ERZE 3MFUA 2YDIA 3ERKA 4H39A 3R2BA 4HVDA 5J9LA 2CNQA 2Q0BA 4HZRA 5HTBA 1OIQA 5DT0A 2V5QA 3C0GA 3NYOA 2ITUA 3LKMA 2VX3A 1OECA 4DE4A 1NA7A 3MBLA 3OP5A 4BGHA 3BYMA 2OJFE 3GC7A 3TKHA 4J71A 5DEWA 3C7QA 5E8XA 1R0PA 2OK1A 3NUXA 3HV6A 4EC9A 3DBDA 4YZCA 3HL7A 3W8LA 1IEPA 2B53A 2GCDA 3E92A 4FKJA 3TV7A 1WMKA 3IKAA 3MVHA 5DEYA 4YZNA 3I81A 4OR5A 3U4WA 3NWWA 5CASA 4AFJA 1PW2A 4FG8A 1YDTE 4FYNA 3OWKA 4KIKB 4CFMA 4QMLA 1H0WA 4DFLA 5ANEA 2UW6A 4TN6A 2JDVA 3P86A 4FUYA 3VBYA 4JMQA 5DLSA 3C9WA 1KOAA 4U8ZA 3DA6A 2Z7QA 4LV5A 1QCFA 5A46A 5A4QA 5HTCA 4IWOA 2UZUE 5DRDA 3QZFA 5EOBA 4YHFA 3QQKA 4TL0A 2PVMA 5ICPA 1W7HA 3F2AA 3CGOA 4AA4A 2C3JA 4I6FA 4BGGA 3RAWA 4CFXA 4FTQA 4NEUA 1PXMA 4M8TA 2GQGA 3KKVA 3TZ7A 3R22A 4JG8A 4TXCA 3GB2A 4BTJA 4PDYA 3F82A 3P7BA 4FV9A 2H6DA 4PMSA 3GCPA 5HG9A 3HAVA 5M07A 2X0GA 3FLWA 4UXQA 4X3JA 4C02A 4D5KA 2W1CA 3COIA 3QKKA 4GG7A 2BDWA 4GV1A 4XG3A 4YJUA 5KE0A 3TWJA 4AZSA 4IAZA 4BICA 2WELA 4JDHA 4GKIA 5EQPA 3PA3A 4YZBA 3W2QA 3UQFA 2IO6A 3F66A 5LXMA 4E5AX 5F9EA 1BMKA 4QP6A 5HE0A 4LRMA 2XKEA 4O2PA 4RLLA 4IW0A 2ETMA 5BVFA 3AC5A 3E8EA 2NPQA 2GTMA 4O4FA 5IA1A 3DV3A 5LMKC 2R2PA 4OUCA 4ZXTA 4BRXA 3BL7A 1DI8A 5AUYA 4BDHA 5DHJA 3LVPA 1XH9A 1U4DA 3O8PA 3FXZA 3G2FA 4O7NA 3R8LA 3CR0A 4F6UA 3DKOA 4DEEA 1OUKA 3F3ZA 1P4FA 2R5TA 3FQHA 3GC8A 1OPJA 4TRLA 5HX8A 4AA5A 5AX3A 2OWBA 2Y0AA 4OTPA 4EZ5A 3OBGA 3EOCA 5FLFA 3GU5A 4F0FA 4N4SA 3OWLA 3N51A 3DU8A 3FLSA 1HCKA 1PXPA 2R3OA 3OEZA 4GSBA 4NT4A 3ODZX 4II5A 5ANKA 1H00A 5AM7A 4FTJA 2OXYA 1OGUA 3VO3A 1JKSA 2VO7A 1OZ1A 3CCNA 4O0YA 3ZDIA 5ANOA 3T9IA 2C3IB 1GOLA 2FSMX 2VWWA 3DBEA 2XIYA 2CN5A 1YDSE 5CVFA 4PPBA 4YHTA 5DGZA 4NWMA 2IVSA 4R5YA 3ZONA 4ANMA 2J9MA 4Q9SA 3SDJA 4FBXA 5DIAA 2ZV2A 4KD1A 2VO3A 5IQAA 5HG8A 3HP2A 2R3HA 3JY9A 3PG3A 2OIQA 4S34A 4XMOA 1W0XC 2FVDA 3VBTA 2J5FA 2R0UA 4M0YA 4NM3A 4W9WA 3KMWA 4G3EA 3I4BA 2BUJA 4QQJA 3QCXA 1Q8WA 1ZMVA 2A0CX 4MAOA 4TWOA 4YLLA 5E8ZA 4BDDA 3VQHA 4NJDA 4P4CA 4E7WA 5B7VA 4GT5A 2BILB 4YURA 4YTCA 4M3QA 3D7TB 3AMAA 2GS2A 2ITPA 4LGGA 4P5QA 2H8HA 3P08A 1GIHA 3UC4A 1PXIA 4C34A 4ZSGA 1W2FA 4DBNA 4FT9A 3R1NA 4X2NA 3KCFA 2X7OA 3IDBA 1MRUA 5IQCA 1XO2B 2R0IA 1ZY4A 3GUBA 5CEQA 4EH6A 4C59A 3BWFA 3ULZA 4ASEA 1PMNA 2QHNA 4BKYA 2HXLA 2HOGA 3FXXA 4KWPA 1KE7A 3PJ1A 3NS9A 1TKIA 3QD0A 4EEVA 4AX8A 3VBVA 4Z7GA 3IW6A 4O7TA 1OKWA 3LCDA 5GJDA 2H96A 3D5XA 3R00A 4YLKA 4FZ6A 1H26A 1Z9XA 5HD4A 1YWNA 4RIXB 4JDIA 3R21A 1YQJA 4OGRA 3ZUTA 3H9RA 3KVXA 5HVYA 2HIWA 2BRHA 2W5BA 4O0RA 5DPVA 2EWAA 5KMLA 4FV5A 1TQIA 4EONA 1ZLTA 3KF4A 4ALVA 4PNIA 1BLXA 3AC8A 5DE2A 3DAEA 5TOZA 2WQEA 3BKBA 4J1RA 4WNMA 3MJ1A 2RL5A 4PQNA 4BF2A 4HJOA 2F49A 4ZLYA 2OXXA 1IG1A 4C4JA 4PP7A 2XK4A 3H3CA 2BFYA 4E6CA 3TEIA 4QP3A 4I4EA 4ASZA 3ORNA 4DH1A 1CMKE 3F69A 5ETIA 4D4YA 3F7WA 3NR9A 3NAXA 1GAGA 2C6DA 2XBJA 4DGMA 4YU2A 3KRXA 3P79A 3V8TA 3DAJA 1ZRZA 4AXAA 3Q04A 4D58A 3HVCA 4HGLA 3Q6WA 2WQOA 4DDGA 4FICA 3R7OA 5LWNA 4IVBA 2WOTA 3QTSA 3UTOA 5FD2A 4F1MA 2XVDA 5FBOA 4G3FA 4GVAA 3TTJA 3W2OA 5A6OA 1KE6A 3MV5A 4D2SA 3A7FA 4AZWA 3ZO1A 5IMXA 5AM6A 4XS2A 3M1SA 4FZ7A 4RRVA 5LMAA 4RC3A 2C5XA 2JFLA 4MHAA 1M2RA 5F94A 4QMNA 3I79A 4E4MA 3QA0A 4V0GA 2X9EA 4X3FC 5J87A 2VTJA 5JGAA 2OXDA 4ZMFA 2DWBA 4JQEA 2BRGA 5AWMA 4G6OA 4DEHA 1H4LA 3E8NA 3A7JA 2GNGA 2JKKA 3PVWA 4CZTA 3TV6A 4D1XA 5G6VA 2J0MB 2Y9QA 4LV7A 2ITQA 5A54A 1ZMWA 2W5HA 3UIMA 3DZOA 2VX1A 1BL6A 3ORTA 4XP3A 4AXEA 2YZLA 4ALUA 4FKTA 3LXKA 2C0TA 2ZDTA 3Q52A 4I0RA 3LQ3A 2W1EA 4FK3A 4MXYA 3ACJA 2WXVA 3A62A 3GI3A 3H0ZA 3B2WA 4V01A 2GQRA 3MGYA 1JLUE 2HZ0A 4V04A 2VWVA 5CXHA 2QC6A 2I0YA 2NRYA 1TQPA 3FZOA 2NO3A 4NCTC 4ZTSA 4AW2A 1YOLA 2WQNA 4OTHA 2WPAA 1WAKA 3UYSA 2OGVA 2J50A 2YABA 2W1ZA 4UMTA 4D2WA 4O4DA 4U41A 5E8TA 4E8AA 4M12A 4YC8A 4EZ3A 5EM7A 1JSTA 3FY0A 3OW3A 4XEYA 4CLJA 3R02A 4FSQA