3L9PA

Crystal structure of the anaplastic lymphoma kinase catalytic domain
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
303
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Anaplastic lymphoma kinase
publication title Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 303
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3l9pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3l9pA01
5DG5A 2Z7RA 4YGAA 2VWXA 1P4OA 2C0OA 3U87A 3EQGA 4BDDA 5J79A 3FMKA 4N70A 3K5VA 3PP0A 4C61A 5KMKA 3PPZA 4NWMA 3IDCA 2QONA 4YO4A 5AFVA 5JFVA 1G8AA 4KB8A 2IZTA 3R7EA 2BUJA 3ITZA 4V04A 2YM5A 4PMTA 4Y46A 1YOMA 4YJSA 4JBVA 3EHAA 4L67A 3RCDA 4TT7A 5EW9A 5A4TA 2WGJA 4EJNA 5BVKA 4RPVA 2QOCA 5J5TA 2ZYBA 2HY81 5M56A 4ZTSA 5GIOE 5HG7A 4DEBA 3K2LA 2IZSA 2X39A 1YW2A 4ANMA 4EK8A 1UNGA 3VS0A 3L9MA 1T46A 3EFWA 5EYCA 4R5YA 2XJ0A 5CVFA 4S30A 4Q5EA 4IVBA 3KCFA 1OGUA 5FUTA 2BALA 1VYZA 4ZTRA 4DGOA 1XH5A 2FH9A 3UOJA 2QO2A 3ZLYA 3GOKA 3QL8A 4FF8A 4GG7A 3DFAA 5AP2A 2BFXA 2VUWA 3HV6A 3PIYA 4FKSA 2WFYA 4MBJA 3BWFA 4ARKA 3UNKA 1G3NA 2E9PA 4IVDA 4MBLA 3MVMA 3RINA 4RIYA 3TWJA 4F7JA 4GSBA 1B6CB 4LRJA 3QTSA 4U45A 4IAIA 3VF9A 2XNOA 4CXAA 3MFUA 3ULZA 1OPJA 4MAOA 3LCTA 3EIDA 3NW6A 2ITTA 3PSCA 5CY3A 5ANDA 5IQGA 4TYEA 3LZBA 4CKJA 3MFTA 3DPKA 4QMZA 1MP8A 3UP2A 5EKOA 3QGWA 4AOIA 1H1PA 4KRDA 4CZYB 3AD6A 5LMKA 4HPUE 2GCDA 5AP0A 3U9NA 4U3ZA 4EEVA 5CT0A 5FG8A 3AC1A 3RZFA 3DXPA 2IVSA 2QLUA 2R64A 4XV2A 2XA4A 2FUMA 4HYUA 2RL5A 3ACJA 3COKA 4N0SA 5CZHA 4DHFA 3I7BA 2XEZA 4MYGA 1XWSA 4QP9A 4QPAA 2YCQA 3G5DA 2WQEA 2I40A 3NYOA 5DLSA 4BRXA 2YJSA 5I9ZA 2W5BA 2OJGA 1E1VA 2OF4A 3LPBA 4IZAA 3D0EA 4RIOA 4GFGA 3BKBA 3WARA 3P9JA 1HCKA 1JKKA 3SGCA 1BL6A 1MRVA 1XR1A 4FG8A 3RPVA 3VHKA 3ZFYA 2WOTA 4D1ZA 5HE2A 2FSMX 4APPA 4KRCA 1UKIA 4X21A 4ZTNA 2C6IA 1UU9A 5HO8A 3W2CA 3DNDA 4BDBA 4NL0A 3KRJA 5GJFA 2BDFA 5D7AA 5IEVA 1OUKA 5C03A 4TL0A 1QPJA 4XNEA 2A27A 2XMYA 3CTQA 3V8WA 3DB6A 2CNUA 4AACA 4C62A 5FDXA 4GFMA 2QU6A 2W1IA 3R1NA 3FC2A 3BPRA 4L44A 3WF8A 4I92A 1H1RA 5A3XA 3T9IA 3C51A 1YWRA 5H8GA 3QRKA 2VWIA 4DH3A 4TYHB 2UZNA 4UYAA 2J4ZA 3OCBA 1U46A 1HCLA 2ZM1A 4H3BA 4AFJA 5IUGA 2ZV8A 3HX4A 4BWKA 4PP9A 5ANEA 3ORKA 1YXVA 2W0JA 3RM7A 4XV9A 3VBXA 1Y57A 3PSBA 5B0XA 3VS6A 4PDSA 4TRLA 4U6RA 4IDVA 2R3NA 4ACMA 4AG8A 2OSCA 1V0OA 3S2PA 4IIRA 5IMXA 3R1YA 2JDTA 3HMNA 5DT0A 3R7YA 4EH3A 3HV3A 4WG4A 3L8XA 5GNKA 2VO0A 5TOZA 3OWLA 3MESA 2Y8OA 3HAVA 3ACKA 2FGIA 2X8DA 2QC6A 2VTJA 5AAEA 4I0SA 4YZCA 3P79A 2VTHA 1H1WA 1Q8TA 3SG8A 1QPCA 3OMVA 3NPCA 1OL5A 4EHZA 4I3ZA 3SXFA 3E64A 3QU0A 1GNGA 1IAHA 3LFAA 5E7RA 3PXZA 2X2LA 3HYHA 3QUDA 5BMMA 4CFUA 3W2RA 5CF4A 3K5UA 1J7LA 2RFDA 1JVPP 2XUUA 5BYLA 2GHMA 3KRRA 4L6QA 2QCSA 2Z60A 4DYMA 1U54B 2C68A 3FEGA 3FQHA 1PXPA 3OD6X 1WBVA 4R3PA 4RQKA 1OIRA 4PL4A 2PTKA 4GUEA 4Y5QA 2SRCA 2BDJA 4KUJA 3R28A 2YAKA 2OXXA 4EOSA 3B2WA 2OJIA 1UNHA 4BYIA 2BVAA 4DH8A 4S34A 3UOHA 4F64A 3FLZA 4HW7A 3II5A 2WMWA 1STCE 5DOSA 2VWWA 3QTQA 2JDRA 2BIYA 5E8YA 1EH4A 2F7EE 2IW6A 4EYMA 3O51A 4JAJA 3FJQE 4D0XA 4I93A 3VVHA 2C47A 2WMXA 3KMWA 5C8NA 2VTLA 2CGXA 1R39A 4LM5A 3DKOA 3R21A 4KKEA 4S31A 1VYWA 5BVDA 3N4TA 2C4GA 5EYDA 1RW8A 2OU7A 1ZYJA 4V0GA 4EI4A 3V5LA 4DH1A 2WTVA 5K4JA 4MXCA 2ZV7A 1VEBA 5A46A 3A4PA 4TWOA 3P86A 5TKDA 4F9CA 4DEHA 3FI2A 2X7OA 4IWQA 5CTPA 4OGRA 5B2MA 3BQCA 4A7CA 4FKVA 1GAGA 1WMKA 2PMOX 5E8SA 4F9YA 4H3QA 3ENHA 3MS9A 2P55A 4X0MA 5A6NA 4ZY4A 4AFEA 1E9HA 3O50A 3BEAA 5JN2A 3ZLXA 2XK4A 4YZ9A 2B52A 3IPHA 5HIDA 4HYIA 1RDQE 4ITIA 5HVJA 4BDHA 5BUJA 1BX6A 2J6MA 4MXZA 3Q53A 2O0UA 5AX9A 2HCKA 3QD3A 4R3CA 5I9XA 4G2FA 5KO1A 5HO6A 2HZIA 3ALOA 1MQBA 1O6LA 3LQ5A 2VWVA 3LCOA 4PV0A 4QT1A 3HP2A 5ETCA 2PYWA 3WIGA 4FBXA 3EKKA 2HWOA 3PRFA 3NNXA 4QYGA 1OL1A 4F6UA 4ZJVA 1JLUE 2VD5A 2GHGA 2Z7LA 5AJQA 3CY2A 4TZRA 5F95A 2GS2A 1YXSA 1SYKA 2YDJA 3BE2A 4BKJA 5IMEA 4RZVA 5HNGA 3QTUA 1FQ1B 1J3HA 4A9RA 5FTQA 2C6LA 3NIEA 2IVUA 4FIGA 4IFGA 4FV3A 4K0YA 4NIFB 3C5UA 4LRMA 4C2WA 3KL8A 1VJYA 3SW7A 4FV7A 3R1SA 4OTPA 1G8SA 1ZYDA 3AD5A 3HMMA 4YTCA 3FMEA 2W1ZA 3MJ2A 3NNUA 4RJ7A 5AV2A 3MIYA 3Q9YA 1BLXA 3QWKA 3ELJA 3R73A 4KS8A 4P90A 5D41A 5G6VA 1YXXA 3TIYA 2CN5A 1M17A 2VGPA 4HJOA 2CPKE 1M2PA 2WEIA 3Q6UA 3LXKA 4GEOA 4IWPA 4C4FA 1KE8A 1IG1A 3DLSA 2PMLX 2X9FA 5BYZA 3HECA 2YZAA 3CIKA 2UZEA 4YPSA 3GFEA 2JAMA 5J1VA 4ZTHA 3EMGA 5J9ZA 2IW9A 4CFWA 2BDWA 2OKRA 3OXTA 4FVQA 2VTQA 3C4WA 3S95A 4GK4A 4GJ3A 2OXDA 5DR6A 3QQUA 3LHJA 3LXLA 3IW8A 2GPHA 3DBCA 3TKIA 5CF6A 4KIOA 4YHTA 4YC8A 3U4WA 3ZTXA 4DEGA 3SQQA 4L3LA 1ZOEA 4E5WA 2XYUA 4I5HA 2UW0A 5KMLA 4AW5A 5TT7A 3FMDA 1REKA 5ETFA 4CRLA 3CSVA 2UW4A 2YN8A 2OIQA 4LMUA 2PMNX 4JG6A 3W1FA 3OY1A 4N6ZA 3MFSA 4RWKA 2J90A 4UV0A 1WBPA 4MXXA 3UC3A 1I09A 4O7VA 5ICPA 4ZAUA 3IG7A 2CKOA 4DH5A 3C4FA 1ZXEA 1TVOA 4IXPA 4RX8A 4EOLA 1O6YA 2F49A 1OIQA 4FVPA 2GFSA 3V04A 4ERWA 4FK6A 2ETRA 1XH4A 3D5XA 3VUDA 3N4VA 4QP6A 3GT8A 4WOVA 3UMXA 4C3FA 2WTCA 2BZHB 3ZXZA 2YJRA 2I0HA 3LFSA 3Q5IA 4HVDA 5C8KA 5HTIA 2IO6A 5L2TA 4YURA 4RIYB 4IANA 4P5ZA 2QD9A 3LE6A 4XRJA 1Q97A 4L52A 4R78A 3EOCA 3SXSA 4BTMA 5KMMA 4FI1A 3FSFA 4G6LA 3MH2A 4JBPA 2I7QA 2RKUA 3LVPA 4X2JA 4DG0E 4J52A 3FQSA 3RK7A 4PMMA 4GFOA 4O27B 3HZTA 5L6PA 2WXVA 4KKHA 5L4QA 2BKZA 4KIPA 2QVSE 2WMUA 3A7IA 1ZZ2A 3IOKA 5FLFA 3V6RA 2OZAB 1XHAA 4E6DA 3R6XA 4DG2E 3ATSA 1W98A 2HXLA 2WKMA 3DNEA 5EYKA 2WMQA 5FEDA 3OTUA 2O2UA 1XQZA 2ERKA 3FKNA 5CU2A 4EH6A 3QTRA 4QMVA 3R8UA 4YLLA 3ZC6A 3I81A 2X1NA 4I6FA 3E8NA 4I0RA 5HOAA 3CCNA 4AGDA 4BF2A 5CNOA 3F88A 4CQGA 4NTTA 3NYXA 1M7QA 4IZ5A 5FEQA 3C50A 3FI8A 5DT3A 4F0GA 4XEYA 4NKSA 1FGIA 2B54A 3VQUA 2JKMA 3DZOA 3G9LX 2OK1A 4BKYA 5C27A 4KINA 2XIRA 2GS6A 3OBGA 2PVHA 4YJOA 4FTAA 4RGJA 3ZYAA 5DPVA 3UMWA 4NCTA 4H36A 5CU3A 3VBQA 1B39A 2Z2WA 4WNPA 3BBTB 3D7ZA 2RFNA 3DAKA 4FKIA 4ONAA 4ZSJA 5T6KA 2BPMA 3GCQA 3ZFMA 4PTCA 5T68A 4AQCA 4PMPA 4FV0A 4IH8A 5CVGA 3SRVA 4O83A 2W1GA 4NTSA 2VTRA 3LFCA 4PUZA 5HEZA 3MVHA 3V8SA 4DITA 5L6WL 4K18A 4CTBA 4D4VA 3KN5A 3VBYA 4PRJA 3QBNA 3ORTA 2QKRA 4RA4A 1YI3A 3R7GA 3NLBA 4HGSA 1K2PA 4FT7A 1L3RE 5GZ9A 1SVHA 3ORLA 1UU8A 1W8CA 3DY7A 1Q5KA 4KAOA 4PF4A 4CFVA 2W05A 3BZ3A 4FKRA 5HE1A 4FTNA 3KC3A 2OLCA 1Y6BA 3DAEA 5TR6A 3KF7A 4RWJA 4GCJA 4CYJA 2ETMA 4DFBA 3MI9A 2PHKA 1KE6A 2XNGA 4FTUA 3UQFA 3MPAA 1XBAA 3UODA 4IWOA 4BR3A 2CCHA 2WTKC 4FYNA 3VS4A 5AP6A 4IAFA 3EFKA 4O6EA 4QPMA 3ZRMA 2YEXA 3FZSA 3PVUA 4HCUA 5L8LA 3ZM4A 1O9UA 2JKQA 2G15A 2UZTA 4XOYA 5I4NA 4RIXA 3HUBA 5K5NA 2PL0A 4AZWA 2BTRA 4WRGA 2ITWA 2DYLA 2CGWA 5HQ0A 2JBPA 2VX0A 3U6IA 2NP8A 2PVNA 5ACKA 3E63A 2R3OA 4IFCA 2Q0NA 4BIBA 3U8WA 4CGAA 1M14A 2WTIA 2PVFA 3PJ1A 5CU4A 2XIKA 2BTSA 5HCXA 4BHNA 2JEDA 1W83A 4RMZA 5DNRA 5C4LA 3EQRA 4BC6A 4J96A 4XHKB 4EK4A 1R0PA 2R3MA 5AEPA 2Y7JA 3POOA 1OITA 3WBLA 1SMHA 1ZMWA 1M2QA 5HLNA 2C6TA 3O71A 2VTPA 3EL7A 4FTOA 2CSNA 4E4MA 4J8NA 4M68A 3FL4A 1YWVA 2X8EA 2BRMA 2HK5A 1LEWA 3KXNA 2RSVA 3D5UA 4GT5A 3Q9ZA 2JDVA 2IZUA 2Z7QA 2R0UA 4NM3A 4ZJIA 4E5BA 4V0GB 3TV6A 1P5EA 5KHWA 3S00A 4OTQA 3U54A 3OEZA 1ZYCA 4ENYA 5DGZA 4IC7A 2CHLA 4BI0A 4R7HA 4FOCA 4ANNA 1OIYA 5M4CA 1YHSA 3FLYA 2HZNA 5DT4A 4MK0A 1M2RA 4IVCA 5CEPA 5CSHA 5DYJA 3EFLA 3HV4A 4QTDA 5FDPA 5KKRB 3ZHPC 2YWVA 2VTIA 4O7WA 2PPQA 4X2KA 4EHEA 5DEWA 5FGKA 1OBDA 4KKGA 4O91A 2NRYA 2V5QA 3NIZA 3Q4TA 4E6QA 5EQYA 3ANRA 2GHLA 2YCFA 3G33A 4Z7HA 1IA9A 3NUSA 4ZTLA 3FMLA 2PE0A 3QC9A 3TIZA 1B38A 3HVCA 3LJ0A 5EFQA 4DC2A 4XG7A 3FQEA 4YZMA 3KULA 4TWPA 4ID7A 1H00A 5F94A 4O84A 4AW2A 3QCSA 4BBFA 4MD7E 3KMUA 4F1OA 3NW7A 4QQCA 4WNOA 4FSUA 4U80A 2GQGA 4IM2A 3FHIA 5KMOA 3P7CA 4FT9A 5A4EA 2QNJA 3EB0A 4ZSEA 3QX2A 2WU6A 4E8AA 2CCIA 4M12A 3GP0A 4EWHA 4XMOA 3VNTA 2VO6A 2BZKB 4EZ3A 4WUAA 3TACA 4NW5A 1PRYA 4AGCA 4LUDA 5AA9A 2RG5A 4W4YA 2E2BA 3MPMA 4C38A 3PRIA 4FZ6A 3GOPA 1NA7A 4YUQA 2OH4A 3FMMA 4CLJA 3I7CA 3RHXA 3R71A 5AP5A 4EONA 2IN6A 3FV8A 1DI9A 5I9UA 4C3PA 4JG8A 4PL3A 3CD3A 2YM3A 2PE2A 4U40A 2YM8A 1GIJA 4FA2A 2NRUA 2X2KA 2XM9A 5AUWA 3L9NA 2RFEA 2WQOA 3DV3A 3GU6A 4H58A 3A61A 5HBJA 4W9WA 4DE4A 5JQ8A 1CTPE 1UKHA 3BYVA 3F5XA 2V7AA 3MY5A 4XG8A 4NYEA 2JIIA 3AC3A 5C1QB 2WEVA 3NX8A 4FSZA 3JR1A 5DR2A 3WF6A 3KRLA 3IONA 5DN3A 5J87A 1PKDA 3E93A 1CSNA 3LMHA 1H25A 5I9WA 3K3IA 4L01A 4W4WA 5AR5A 3ZSHA 5IQEA 4RVTA 2UW8A 5F9EA 3H0ZA 5I3RA 4O0RA 2G2FA 4V05A 3H4JA 5JQ5A 5AV4A 4WT6A 4FTLA 4Q5HA 1WBNA 2CNVA 3IK3A 1PF8A 3TEIA 4C57A 4FG7A 3E7OA 3EFJA 4BB4A 5K0XA 2F4JA 2W7XA 2YFXA 3EQPA 4L3JA 5HORA 5EI6A 1NVSA 4IE9A 3R30A 4Q2AA 2XNNA 3ROYA 4L9IA 3WZKA 2WZJA 2Z02A 1NW1A 4GS6A 4YC3A 5CYIA 4NFMA 2WU7A 3R9DA 1Y91A 4IX5A 5AUVA 3PUPA 3QHWA 3AGMA 4ENXA 5BVOA 5EG3A 2JC6A 1GZKA 1LP4A 1K9AA 3V51A 1P14A 3AC5A 4Y72A 4FOBA 4XCUA 4FEXA 2E9OA 5GZAA 4QMSA 5M4FA 4TPTA 2VTNA 4MNFA 1KE5A 4XP0A 3PIXA 3Q4ZA 3LIJA 1CDKA 5EHLA 3PY3A 4JBOA 2PVLA 3H30A 2A1AB 3ODZX 3O96A 4AA4A 2W4JA 3FY0A 3QQKA 4C3RA 4DTKA 3QXOA 2WQBA 3R8MA 4MQ2A 1YI6A 2UZVA 3HEGA 3IW6A 3FMHA 1AQ1A 4HZSA 4XG3A 3R8PA 4N6YA 3BHVA 3OW4A 3UIUA 5IQAA 3KXGA 3TKUA 5E8VA 4GUBA 3V8TA 3TT0A 5M09A 1F0QA 3DDPA 3D7TA 4C4IA 1YOLA 3LFBA 4XRLA 4G31A 3GQIA 2R3FA 3WIKA 4ORKA 5AAFA 4F0IA 4AF3A 3DOGA 1PMNA 4BCNA 1MQ4A 4UXLA 2XJ1A 2R3LA 3RGFA 5LOHA 3ZEWA 3P7AA 1BMKA 5C9CA 3R8ZA 2BZJA 2EVAA 3FYKX 3MA3A 1KV1A 1Y8YA 2VTMA 3PVGA 3ZSIA 3ZUTA 3MV5A 5IA1A 4YJNA 2G2IA 4XOZA 4DFZE 3P78A 4FSNA 3BBWA 2W96B 4CV8A 5AR8A 2ZMCA 5L8JA 1WVXA 3PZEA 3AMBA 3FL5A 3RPRA 4AW0A 3EH9A 4C34A 3HLLA 2ETKA 4FL2A 3T3UA 2IWIA 3HRFA 4M14A 3CXWA 1H26A 4DEDA 2QO7A 4F63A 1ZY5A 4QYEA 3THBA 4QTCA 3HKOA 3S1HA 3Q9WA 5EM6A 4R7BA 4CLIA 1H08A 3F7WA 3O7LD 3PA3A 1XH9A 1YDRE 2W1FA 3B8RA 2A4LA 4FKGA 3OC1A 4P2KA 5AV3A 5IA4A 4ZIMA 1PXJA 5BQ0A 3QTXA 4BCQA 1YI4A 3DB8A 1IA8A 4A06A 3VF8A 5J9LA 5K5XA 1OZ1A 1PXOA 3HMOA 3MH1A 3V01A 3RI1A 3SRVB 4GKHA 4CRSA 4L8MA 3QD2B 5CSWA 4O96A 4PTEA 4O7TA 3JUHA 1KE9A 4PPCA 3U6HA 2ZV2A 5KX8A 2OFVA 2FSTX 3OFMA 1H27A 4M0ZA 3MIAA 3ZXTA 4RLKA 3T3VA 4EHVA 1KSWA 2EWAA 4QNYA 4RJ4A 2OBJA 3RWQA 4AUAA 2VN9A 4JT3A 4UMTA 3RZBA 2F2CB 3LCDA 2YLFA 2X2MA 4FT3A 4ZS4A 4K2RA 4YHJA 3KY2A 3ERKA 4RJ5A 2JKOA 5AP1A 2C6OA 5FTOA 3QA8A 2YCRA 3FI4A 4GYGA 4K8AA 4FTRA 3PDTA 3AOXA 2XK6A 4EUUA 4O0YA 5HBEA 3LKMA 2J7TA 2VO7A 1W0XC 3I0OA 3A7HA 4H39A 4K9YA 4O86A 4QD6A 3I6UA 4ZXTA 3QTZA 4FKJA 4ALUA 5CANA 3UTOA 3AC4A 4M69A 1BUHA 2H6DA 4OBQA 4UMQA 4EK3A 3S0OA 5E1EA 4DFYA 1H4LA 4LL5A 4KSPA 3N9XA 3WOWA 2C6MA 3FLQA 3R7OA 2OJ9A 3RWPA 3QFVA 1OM1A 4AZSA 3E8DA 4L7FA 4AN3A 4EL9A 2R7BA 3O8TA 3P1AA 3NUNA 5AIRA 5CASA 3NVMB 5M55A 4BWXA 3QCYA 4OUCA 4L43A 3WE8A 3SC1A 4O7NA 1PMEA 2WB8A 3E8EA 3W8QA 3TNQB 3P5KA 1WCCA 3GCPA 4QMLA 4M13A 2OW3A 4ZSLA 3AC8A 2H34A 5HKMA 3NNWA 1BI8A 2YZLA 3UO4A 2I0YA 2JLDA 5D1JA 5IPJA 4AT5A 3HMPA 3V6SA 4IAKA 1A9UA 1Q41A 3MDYA 4RFYA 4R8QA 4AOJA 2Y4IB 2HIWA 2NPQA 3VJOA 4C8BA 3HA6A 3BRBA 3F2NA 2C5XA 3G51A 3WI6A 4C0TA 5L6OA 3CC6A 2CKPA 2C3IB 1ZZLA 3QGYA 4P5QA 4FE2A 3UVPA 5AX3A 1WZYA 4ERKA 2ZM3A 5M57A 4HNIA 2UZUE 1ZLTA 3FZ1A 3ZC5A 1WBSA 2UW6A 3Q4UA 3CTHA 2F9GA 4LFIA 5AWMA 5HCZA 2Z7SA 3W32A 5JZJA 1MRYA 3KXXA 3GC9A 4G9CA 3CQUA 4IM0A 3R01A 5IA2A 1VZOA 4NM7A 3ORMA 3D5VA 3LFEA 3QXPA 4RX5A 2Z8CA 3O0GA 4P4CA 5AMNA 3CEKA 3DXNA 4FZAB 2CKQA 4G6NA 3FI3A 2OXYA 3ZRKA 4O0VA 4DF3A 4DLIA 2ITVA 4IB3A 2OICA 4RZWA 2WMTA 5E91A 4ZTQA 4CQEA 2GTNA 3OVVA 3ZUVA 1Q8UA 5M51A 4TNDA 2RGPA 1FGKA 3QF9A 2VO3A 4WSQA 2FSLX 4NM5A 1OKVA 4JRVA 4XG4A 1YKRA 5CT7A 5DRDA 3GU5A 3IDPA 4AW1A 2UV2A 4BY9E 4O7YA 4MXYA 3W16A 3EQBA 1PJKA 4YJQA 5I0BA 4FVRA 2OFUA 2J0IA 2PVKA 3EN4A 4JQEA 2O63A 4WNMA 1U4DA 2UW7A 3BX5A 2GMXA 3F61A 1KE7A 4QNAA 5M4UA 4KABA 5JEBA 2VTTA 4M84A 1NT2A 4YBKA 4EORA 1FMKA 4GL9A 3QA0A 5JH6A 3LFQA 5A54A 3NGAA 2HZ0A 4JX3A 4LQMA 4BYJA 2PUNA 4KD1A 4B9DA 4JS8A 3D94A 4CZUA 1UU7A 3HDMA 4L68A 3ZDUA 4L7SA 3DXQA 1JNKA 2Y4PA 4UMUA 4GH2A 2ZV9A 3UG1A 4DT8A 5LJJA 4JIAA 3P08A 3VN9A 4FNXA 4UMPA 3OEFX 3TZ9A 3OXZA 4RVMA 5JGBA 4YNOA 4D4SA 2VU3A 4NH1A 2OIDA 5CAQA 4JDKA 4OLIA 3LFDA 1TQMA 4EKKA 3ZUUA 2OH0E 4RJ3A 1FBNA 5FEEA 3NW5A 4F0FA 3NVKI 4I94A 3R02A 3REPA 3C4EA 4UYNA 4FTTA 4GJ2A 2OF2A 3P7BA 3GU7A 2CJMA 2V0DA 4QYFA 3HP5A 3U4UA 4QPSA 4KIKA 3F5PA 5JRSA 4RRVA 3HGKA 3RAKA 5HICA 4BCKA 4IB1A 3UIBA 4E73A 3WYXA 5JMSA 3EQCA 1ZMVA 2ONLC 2PMIA 4I6QA 2WTDA 1Z9XA 2XF0A 3R83A 4BDKA 3R9OA 4HVSA 3DJ6A 1J7UA 3C13A 4A9SA 4WNKA 3IOPA 4MXAA 3NUUA 4FL1A 2C6KA 3PXQA 4ACCA 4KIQA 4MQ1A 3MSSA 3ZONA 2PZPA 2Y6MA 4JAIA 4NSTA 4FL3A 2C5OA 5CSVA 3GU8A 4TYGA 2E9NA 2PZ5A 1XO2B 4FTQA 3OXIA 3NSZA 5EK7A 4IAYA 3EN9A 4MD9E 3I6WA 4JDHA 4FIEA 4TYIA 2WELA 3UO5A 1ERKA 3MB7A 4NM0A 4AP7A 4LUEA 2VNYA 4DTBA 1RQQA 3WZEA 3GCUA 3D2IA 4IX4A 4PX6A 4U0IA 3ZS5A 2R4BA 5CI6A 3KQ7A 3Q6WA 2WTJA 3RJCA 3DS6A 4QTBA 3GNIB 4GK2A 5EDPA 3TKHA 3R2BA 4JRNA 4C7TA 5E8UA 3HMIA 3C0HA 1LEZA 4S32A 5DHJA 3WZDA 4YNEA 1YDTE 3A62A 3BYOA 4KBCA 4RIWA 4RSSA 3R7IA 5ANJA 4F9WA 2BR1A 3NUXA 1KOAA 3R2YA 1CKJA 4BZNA 2QHNA 3D7TB 3HA8A 3EL8A 4E7WA 4IMYA 2ITZA 2XM8A 4HOKA 3WF9A 4D2SA 2WAJA 5EM8A 4AWIA 5EM5A 2BRNA 4UX9A 3VULA 5I9VA 3JS2A 5EQEA 2OZOA 2UW9A 4RC3A 5AV0A 2B1PA 4RBLA 4X3FA 1Y8GA 3FXZA 3ZU7A 2C30A 1WVWA 4FNZA 3F3TA 3BEGA 3COMA 4QP3A 5FBNC 3EWHA 4XS2A 5LVPA 1XBCA 3AT4A 4FSRA 4RG0A 3RKBA 3L9LA 4J7BA 5IF1A 2GNIA 4Z9LA 3TTJA 2XNPA 1O6KA 3UQGA 3F3VA 3MY0A 4GU9A 4WKQA 3UZRA 4WRSA 3BU3A 4O81A 5HESA 3E88A 3AMAA 4G16A 1J1BA 2HY0A 3FZTA 2C3JA 1PHKA 3MWUA 3KK8A 2AC3A 5CU0A 4I6BA 4XLIA 4D58A 3Q2JA 4E93A 2B9FA 4I1ZA 3I79A 4L00A 3TL8A 4ZS0A 2ERZE 3FLWA 4F1MA 5BVEA 2JITA 3JVRA 3QRJA 2IPXA 3PSDA 2ITNA 4QMXA 2YIYA 2HELA 2WIPA 4BTJA 2WMBA 5DA3A 5IQDA 1BI7A 4BTKA 1P4FA 4RVKA 3EZVA 4BL1A 4QQTA 3PXYA 5LXMA 4FTMA 5FM3A 4O7SA 3LFNA 5LMKC 5B7VA 2QOFA 3MGYA 2XEYA 4BIEA 1M52A 4EQCA 4FTJA 4PL5A 4XX9A 4AZTA 3GC7A 4KS7A 3GI3A 2BAKA 1XH8A 1R1WA 3SKCA 5DMZA 4H05A 2GS7A 3TNIA 1ND4A 5ACBC 4DGGA 2HENA 2W1HA 5DBXA 4D2TA 3DTWA 3DBEA 4FSWA 3R1QA 2HW6A 4JQ7A 2UUEA 1PXKA 1PMVA 2EXCX 3IW5A 3B8QA 3QZHA 2YM7A 4BTFA 1Q3WA 3SA0A 3LW0A 4LYNA 3WZJA 1ZAOA 2EUFB 2QOQA 3R9NA 1J7IA 3KFAA 1PYEA 1Z57A 4FKTA 4M69B 4CKRA 2ESMA 4ANQA 2ZJWA 2RIOA 4EOJA 4FV4A 2YIRA 3CTJA 2GDOA 5EDRA 3IO7A 1BYGA 4D55A 1YHWA 2V7OA 2X6DA 4QRCA 2GSFA 4R7IA 3CPCA 3OROA 3A8XA 4ACHA 4D2VA 4M97A 3UOLA 1TQPA 3KXHA 3ATTA 4BI1A 2HZ4A 5HD4A 3L8SA 3IGOA 3GQLA 5IEYA 4IB5A 1YOJA 4JR7A 3AXWA 4R6VA 2Y0AA 4FIJA 2YIQA 5E9EA 3H9OA 4AZVA 2CLQA 4XBRA 1M7NA 2W1DA 4I0TA 2O65A 4USDA 4YLKA 4W8DA 4B99A 5ITAA 1WBOA 5ANOA 4JR3A 4YR8A 4WD5A 3L8VA 1T45A 2FYSA 3QLFA 5IH5A 1OB3A 5L3AA 4C59A 4YJUA 4MH7A 3VBWA 4HVGA 2O5KA 3Q04A 3BLRA 3ULIA 3MB6A 3VW8A 2X81A 3OOMA 3FC1X 4JBQA 4BDFA 3UPXA 3U6JA 4AA5A 4B8LA 5HNIX 3HRBA 1R0EA 4CYIA 4K6ZA 4YMJA 3BQRA 3R7VA 2C3LA 2XK8A 3IGGA 4L3PA 2W4OA 4QMMA 5KMJA 3FBVA 2GNHA 2BRBA 3NYNA 2BCJA 2FO0A 3CP9A 3CPBA 2W4KA 4DBNA 4CEGA 1F5QA 3RK5A 2IJMA 2LAVA 4E4XA 4O0WA 2I6LA 2PUIA 3G2FA 4JX7A 4G5PA 2XBJA 4BFMA 3DK7A 3NR9A 4LL0A 3DJ5A 4EOPA 3TCPA 3M42A 5HVYA 3UG2A 4ZLOA 4TN6A 2YAAA 4FTIA 4J1RA 2W06A 2PVMA 5HG8A 2JFMA 2GU8A 3LFFA 2BROA 4XYFA 1SVGA 3MH3A 4BDGA 4CZTA 1GIHA 4EH9A 4FV1A 5DRBA 2PZRA 3GC8A 4OT5A 4CMUA 2R3JA 4USFA 2EXEA 4TWCA 3PG3A 5LARA 5IH4A 4DT9A 3UIXA 4JQ8A 4WHZA 1OKZA 2C0TA 1Y6AA 1UV5A 2IVTA 3D4QA 4AXAA 4LGDA 5HZNA 4QMOA 4C4EA 4EH7A 2PUPA 4N57A 3EN6A 3OCGA 4HCVA 5IH6A 3OS3A 3OTVA 5HO7A 2QI8A 3FPMA 1LR4A 1JSVA 1TKIA 5HU3A 1K3AA 5JZNA 2OG8A 5H9BA 3A2CA 4O2PA 5HE3A 4Q9ZA 4FNYA 2ZB1A 3OY3A 4WG3A 3BU5A 3H3CA 4IZ7A 2BILB 3O2MA 4JDIA 1PKGA 1Q61A 3SW4A 5M07A 2OIBA 2WNTA 3FUPA 5K9IA 2CGVA 3FZOA 4OR5A 3PYYA 3OG7A 4U97A 3SXRA 3ZO3A 2YABA 1SM2A 3DTCA 4LGHA 2PZYA 3NCGA 1YRPA 3OUNB 4CG8A 2P4IA 3SAYA 3VW6A 3LAUA 3QKLA 4QQ5A 2DUVA 5CEQA 1S9JA 4HPTE 4U7ZA 4AS0A 2YLEA 1XKKA 4GIIA 1OVEA 4QP2A 4JNWA 2UVYA 4Q9SA 4J98A 3TJDA 1MUOA 2XK3A 3PLSA 5JFSA 4DFXE 4FSYA 5KZ0A 3GFWA 5C01A 2YHVA 4G6OA 2YERA 5KKRC 2C5YA 2B9HA 4D0WA 5L2SA 1OPKA 5GZ8A 1BKXA 5EOBA 3BI6A 4CD0A 4F7SA 2QLQA 4BBMA 3FHRA 2JGZA 5CALA 4KWPA 4NU1A 5EM7A 2HWPA 4FIIA 2E9UA 1SNUA 4QMPA 3D83A 4KIKB 4EC8A 3MTLA 4OTWA 2DWBA 3W10A 5KHXA 5LWMA 4ITJA 5KMNA 2XKFA 3LJ2A 5CI7A 2J0MB 2J2IB 3OCSA 3ZO1A 3QQGA 4EZ7A 1RJBA 3Q32A 4OTHA 2RF9A 3Q9XA 4BICA 3M1SA 3TUCA 2X7FA 5KNJA 4G17A 4HYHA 3SHEA 2KTYA 3QQHA 5LWNA 4UWYA 2O3PA 4DINA 2XRWA 4FSMA 4G34A 3PG1A 4C37A 4YU2A 1CMKE 3QALE 2XRUA 3JVSA 4DBXA 3I0QA 1J91A 2R3GA 4GVJA 3OF0A 1GOLA 3EYHA 4HZRA 3SVVA 2WIHA 3FAAA 4EC9A 3MFRA 3QQFA 4QYHA 1FVTA 4AT4A 2ZAZA 4BZOA 2R3QA 1U54A 3QQLA 5G1XA 3UE4A 2PZIA 4DGLC 4PP7A 1GZNA 5CAPA 3PJ8A 4UWBA 2J51A 2YIXA 5E1SA 1Q24A 1FINA 2OJJA 5FQDC 1DS5A 1QPEA 2UZDA 3JY0A 5CEMA 5M08A 5E8ZA 1JKTA 1U5QA 5ETAA 4D1SA 4RIWB 3R9HA 3CLYA 5IQBA 4OAUC 2JFLA 4FV5A 1Q99A 4I4EA 5J7BA 4XH6A 3KREA 4D2RA 1DAYA 3P0MA 1ZYSA 2X7GA 1H1QA 3CQEA 3V3VA 4DEEA 3NAYA 1TQIA 4D28A 3I5NA 4ALVA 1PXIA 5A4LA 4DFNA 3KN6A 3MA6A 4XJ0A 5M53A 4RLLA 4X3FB 2HXQA 2IW8A 4QMWA 2ITUA 3EQHA 3DGKA 2B0QA 1PXNA 5CVHA 1J1CA 5HG9A 4ZLYA 3BLHA 3SOCA 2IZRA 2XP2A 4AZFA 2ITPA 2JD5A 4J97A 5EW3A 3D9VA 4FTCA 3HDNA 4ZLZA 3D5WA 3OCTA 4O7ZA 4BCGA 4FNWA 4X6RA 3NDMA 2B53A 2PVYA 4UY9A 2XYNA 5IZFA 5J8IA 2ZDUA 3PP1A 3FZRA 4Z7GA 4TWNA 3DBQA 3UP7A 3W33A 4DG3E 4USEA 3QZIA 4X2FA 4ZP5A 3OHTA 4JXFA 4FICA 4YHFA 2V62A 2QG5A 4EBVA 5HIEA 3GB2A 2V22A 4IVAA 3TTIA 4X7QA 3QD4A 4RX7A 3IW7A 4IAZA 4YBJA 3TUDA 3BE9A 3PWYA 2J0KA 5IKWA 5A6OA 3U51A 3AQVA 3SDJA 2IG7A 5I3OA 2QURA 2J5EA 3C4CA 3IDBA 4C36A 4ZZNA 2GFCA 2ZVAA 5AR4A 4AX8A 5J1WA 4C4GA 5EDQA 3VC4A 4WIHA 3OWKA 3A60A 1KWPA 4G5JA 3G0FA 2W17A 4W4XA 4XG2A 5CNNA 5CENA 5TE0A 3ZSGA 3WYYA 3EQIA 3JY9A 5AUYA 4BCJA 3RBWA 4G3CA 3QYZA 5E90A 4QP7A 3QRIA 4O1PA 3VIDA 3NUPA 4PTGA 4FV9A 3BGPA 3M11A 4QP4A 4U44A 3CKWA 4YZDA 5J95A 4LOPA 4IDTA 4YTFA 4FZFB 2VX1A 1NVQA 2G9XA 4IACA 1OBGA 3L8PA 3CJGA 3FMNA 5IA3A 4M15A 4FTKA 4AA0A 3OT8A 4TKSA 4U8ZA 1HOWA 4QP8A 3WILA 4X6QC 3QYWA 4DLJA 2GTMA 2OO8X 3EKNA 3AD4A 2F57A 2X9EA 1YXUA 4XP2A 2EB2A 5HHWA 4CTCA 2W9ZB 3FZPA 1IR3A 4CV9A 5HTBA 1PYXA 4EYJA 1OMWA 3G15A 5DVRA 3PJ3A 3KXZA 3C1XA 3TZMA 2VWUA 4ANSA 5CAVA 3U55A 1IAJA 2UZBA 1H8FA 5HBHA 4E5AX 5J9YA 5CQUA 3OUKA 2J9MA 4PDYA 4WBOA 3DU8A 2YISA 3F69A 5K0KA 2BAJA 4NCTC 2AC5A 1FOTA 1KV2A 2ZDTA 3FWQA 4BDCA 4FKOA 2OJFE 4EZ5A 4CKIA 3R04A 1IEPA 5BVNA 3EQFA 4GKIA 4FV6A 4C4HA 4E26A 4RX9A 1ZRZA 3GU4A 4F6WA 3FPQA 4ZJJA 2CGUA 5AIKA 3COHA 3RAIA 5AM6A 2I0EA 3ANQA 3BV3A 3W8LA 3U9CA 3RNYA 3PXRA 3QLGA 1Q8WA 2P3GX 2XVDA 3QAME 3VUGA 4EQUA 2RFSA 4M3QA 5HX6A 2A19B 5JFXA 3TM0A 3ZM9A 3DKCA 1A06A 2ZOQA 3E92A 3F2RA 2PSQA 4G3FA 5AADA 4FG9A 3BYSA 2A2AA 2XH5A 4IBMA 3OWJA 4RFMA 4GV1A 1OKWA 5IA5A 4Z55A 3DBFA 5JGAA 2ZB0A 4XP3A 4E1ZA 3F9NA 3KVWA 3VUHA 2J0LA 2ZMDA 5IQHA 3CJFA 4FR4A 3A7JA 4X3JA 5HIBA 2VTSA 3W55A 1Q8YA 4DGMA 3L1SA 5FBOA 3LLTA 3KA0A 4ANOA 4WUNA 4GRBA 1YWNA 1JKSA 3BCEA 3BYMA 4YTHA 1GJOA 3CR0A 3E7VA 5CXHA 3UQCA 1OL7A 4D5KA 3IKAA 4D9TA 5BVWA 4O1OA 2PE1A 4B8MA 4BDEA 5D7VA 5CU6A 4C33A 4HGTA 4JL9A 1UVRA 2I0VA 3Q2MA 2UVZA 1R3CA 3F6XA 4R3RA 4RIXB 5ANIA 3TN8A 4M8TA 1S9IA 3CGFA 2PU8A 1W82A 3BU6A 2OZAA 4UWCA 3W2QA 4FEQA 5FD2A 5HGIA 3QUPA 1YDSE 2P0CA 1QCFA 4X2GA 3RPOA 4OTRA 4R5SA 3PXFA 4PNIA 2NNWB 5BUIA 2R5TA 1NVRA 1PXLA 3EQDA 2VWBA 4B0GA 1NY3A 3G6HA 5LVMA 4IZYA 4LGGA 3UVQA 5CF5A 5CX9A 3ZBFA 3BYUA 4UZHA 4IJPA 3VHEA 2QOLA 3NMUF 3RP9A 3WZUA 5GINE 3UZTA 5D10A 3MPTA 4ASDA 2QHMA 2Y4IC 2PWLA 3DK6A 4L46A 3K3JA 1OIUA 1ZWSA 3RPYA 2H8HA 2YWPA 2JKKA 3NWWA 2XKDA 4FK3A 5AP7A 3B2TA 3PY0A 3S3IA 3MYGA 4QTEA 3KGAA 3ZOSA 3P23A 4U79A 3I4BA 2BAQA 2XCKA 5FP6A 3R7UA 5HVKA 4C4JA 4ZMEA 5KCVA 2AUHA 3H9FA 3PJ2A 4W4VA 4O38A 3TI1A 1IASA 2X4FA 4EJ7A 3QZFA 5GIPE 4GU6A 3AMYA 3FDNA 4HVIA 4FUXA 4RJ6A 4S2ZA 4CG9A 1JSUA 3BHYA 5LVOA 3C9WA 2UVXA 3C5IA 5LMAA 3QUEA 2ITQA 4O0UA 1FVVA 2JBOA 4J95A 3TV4A 4AAAA 3R9RA 4M0YA 2VX3A 4MD8E 3C4XA 3I1AA 1I44A 3NRMA 3ORZA 4U81A 3VBVA 4EOKA 3RNIA 5EW8A 1KOBA 5JT2A 4X2NA 4DCEA 1UU3A 5AP3A 3V5JA 2X8IA 5F20A 2P33A 3KF4A 4F65A 2V55A 4O7RA 3KULB 2F2UA 1H24A 2R9SA 3GXLA 4K77A 1G5SA 2F7ZE 1CKPA 3ZO2A 3N4UA 4RWIA 4D9UA 3RAHA 4YSMA 3PFQA 5IQFA 2PK9A 3MY1A 4A9UA 4EWQA 2O64A 1CM8A 3E5AA 4FIHA 4KSQA 5EH0A 3NAXA 2P2HA 3BLQA 3FLSA 4FZDB 3LXPA 3PJCA 4NJ3A 5FP5A 3CBLA 5CEKA 4ZMFA 3FE3A 2WPAA 1RE8A 3R0TA 5D9HA 2DS1A 3FKLA 4MNEA 4FC0A 3KMMA 1P2AA 4PQNA 2R3HA 4LOQA 4FEUA 3VQHA 5FWKK 4CMOA 4OTGA 5I5ZA 2B7AA 4AN2A 1URWA 2QOKA 1GIIA 3ODYX 2B9IA 2J5FA 2YACA 4Y83A 4A4XA 5KBRA 4KBKA 3UVRA 2Y6OA 5BNJA 3ZMMA 2CN8A 2GNJA 4NKAA 5I9YA 1YHVA 2WMSA 3BHHA 1SZMA 3OWPA 4IHPA 5EKNA 3IS5A 3MW1A 4H3PA 1LPUA 5ANGA 4TW9A 2R3IA 4R1YA 5HE0A 4NW6A 2QR8A 4D4RA 5AA8A 4N4SA 1Q8ZA 2PVJA 4UZDA 3WE4A 3ZDIA 1URCA 3JPVA 2UW3A 4W9XA 3KB7A 4GT4A 4WG5A 2G2HA 2ZM4A 3HUCA 4MVFA 1OL6A 4QO9A 4YTIA 2R2PA 5TO8A 3UYTA 4CFNA 4AGUA 4CT1A 2BRGA 2UZLA 2WHBA 5L2QA 4YP8A 1QL6A 4APCA 4YLJA 3TZ7A 4EOIA 5CAOA 3MVLA 1FVRA 2XS0A 4AE6A 4E3CA 4I5MA 4PMSA 4I41A 2QOIA 4F9BA 3CQWA 5IUIA 4I6HA 5BPYA 3TNWA 3PPJA 3UNJA 2C69A 3TUBA 3QKMA 4YO6A 3UIMA 3IECA 4EK6A 4BCFA 5JSMA 2FB8A 2LGCA 1E1XA 5B2KA 3ROCA 2YM4A 4DCAA 2XIXA 4I4FA 4QP1A 3VUKA 4IB0A 1W84A 2EU9A 2YDKA 4U42A 1OKYA 4YZBA 3H0YA 3QQJA 4BCPA 2CMWA 1DI8A 3DZQA 4FGBA 5DWRA 3EN5A 4FSTA 4EHGA 3POZA 4IWDA 2J50A 4RT7A 3A8WA 5A4CA 3RMFA 4XBUA 2VAGA 3F3UA 4FUYA 1WAKA 4J8MA 4TYJA 3C0GA 3UO6A 4GW8A 3EJ1A 4PDPA 4BDAA 5M44A 3HV5A 4JIKA 4M66A 3ENMA 2W5HA 4DFUA 3UJGA 5BX0A 4FEVA 2WQMA 2Y9QA 3M2WA 1CKIA 5C8MA 5CSXA 4E20A 2QODA 3QD0A 1UWHA 5EQPA 4LV5A 5EHYA 3LCSA 3A7GA 3BHTA 4ZOGA 4I24A 3FMJA 5AUZA 4M7IA 4FKQA 3NEWA 3ZRLA 3PA4A 4JG7A 4UEUA 4CFMA 2O8YA 2QU5A 3DCVA 4OTIA 4EH2A 5JK3A 2XKCA 5CEIA 3COIA 3SX9A 3S4QA 5LMBA 4R1VA 5HLWA 4GG5A 4E4LA 2C0IA 3I60A 3QKKA 4WO5A 3RK9A 4KNBA 3W2OA 1Q62A 3ET7A 5DE2A 3G90X 5AUTA 4ZTMA 2BRHA 2BZIB 2F7XE 3TG1A 2CDZA 3VUMA 2GQRA 3D14A 3WF5A 1JQHA 1JAMA 4I5CA 4LOOA 2Q0BA 3DQXA 4JOAA 4M67A 5F1ZA 2PUUA 3DBDA 3G9NA 3ORIA 3VBTA 4F70A 2WO6A 1OI9A 3HV7A 4DH7A 1H01A 4LMNA 3DQWA 4J71A 3TZ8A 5HTCA 4EUTA 2ITYA 3P4KA 1FMOE 4BCOA 4BGQA 5JFWA 4G9RA 5JGDA 4BDIA 4FMQA 2B4SB 4IX6A 1GZ8A 2YIWA 4CVAA 4YC6A 3QTIA 3ORNA 4NZWB 1DM2A 1JWHA 4PPAA 3ZO4A 4O0SA 2JDSA 4U5JA 3LOKA 2C6DA 4YPDA 3T8OA 3GBZA 3TDVA 3WF7A 2XIYA 2XBAA 4XG6A 4CMTA 3R00A 3VJNA 4BI2A 5K4IA 3DLZA 3QRUA 3DJ7A 3OOGA 5CQWA 5EHOA 3PLAE 5BUEA 5B2LA 2X0GA 2C3KA 2VV9A 4JI9A 5CXZA 4LI5A 5AM7A 4CSVA 2HAKA 2QKWB 2XJ2A 4HGEA 3V5PA 1GY3A 3FY2A 4BVUA 4II5A 4MKCA 4MTAA 5ANKA 5E8XA 1ZOGA 3OBJA 4PDOA 4ASZA 1ZMUA 3ETAA 3QTWA 3V5WA 3VRZA 4D5HA 3O8UA 4F09A 2UW5A 3Q5ZA 4GIHA 2XNBA 4HNFA 4IW0A 4U43A 4Y73A 4MX9A 4TXCA 4F99A 4FT0A 3PXKA 4IADA 4MWIA 4OTFA 4ANLA 1PXMA 2JDOA 3CGOA 4EQMA 3KRWA 5AR2A 2QR7A 3GC0A 4CFFA 4L45A 4JVGA 4F9AA 5IQCA 2AYPA 4DGNA 2KULA 4EKLA 4K33A 2IVVA 3GGFA 4EH8A 4C2VA 3O8PA 4I5PA 4QQJA 4BN1A 4FZ7A 4ZY5A 1XH6A 5A9UA 4GVAA 5J5SA 4KA3A 1XBBA 5L2IA 3A4OX 3BGQA 1LUFA 5M4IA 2ITOA 2QOBA 3Q4CA 4U3YA 3UPZA 4YJRA 5D11A 2VRXA 3LJ1A 3LM0A 3ZCLA 1ZYLA 5EYMA 4ASEA 2FSOX 3HNGA 4F4PA 4PY1A 4F1TA 3ORPA 4O0XA 3BV2A 2VGOA 5CLPA 2FVDA 2XIZA 5FXQA 2ACXA 3SV0A 4AN9A 4OAVB 5E8WA 1SNXA 3ZLWA 3NYVA 2XCHA 5K3YA 3F5UA 4XUFA 3LXNA 4OTDA 1JBPE 4B6LA 5IEXA 5IU2A 3DT1A 3NZ0A 4NUSA 4RC2A 3F3ZA 3VS1A 1YXTA 3DA6A 5H8BA 5JKGA 3LLAA 2WMAA 3JXWA 3LQ8A 4TTHB 2W1CA 4XV1A 1OL2A 3CS9A 3W2PA 4IJ9A 5KE0A 4ACDA 4ZZOA 4QMUA 3W18A 2E9VA 2J0JA 1YQJA 5EI8A 5LCKA 4EOOA 3BHUA 1V1KA 4IAAA 5DH3A 1JSTA 1PY5A 3H10A 4A9YA 3BGZA 5DIAA 1DAWA 3VS7A 2C6EA 5AR7A 5KZIA 4K1BA 1V0PA 3EYGA 4NJDA 3MBLA 4YJTA 4AT3A 5FTGA 1H0WA 2G01A 3TV7A 1AGWA 3DKGA 4BKZA 2WOUA 4YJVA 2YM6A 2GQSA 4FSQA 5IG1A 2OWBA 3MJ1A 3VS2A 2PY3A 4U9AA 3EN7A 4G1WA 4G3EA 4L53A 1REJA 5HLPA 4H1JA 3GVUA 1QPDA 4B4LA 3AT2A 4BGGA 3Q60A 3ALNA 3C7QA 4G3GA 5BMSA 3RM6A 1Q4LA 5DEYA 3QRTA 3G6GA 4RQVA 1F3MC 4E6CA 2C5VA 3Q52A 2R3RA 3KEXA 4L42A 3OT3A 4QOXA 4WSYA 5CZIA 3TNHA 3F66A 4TY1A 4J53A 3BWJA 1L8TA 2DQ7X 2WMVA 1PMUA 4OW8A 4CT2A 5KMIA 3R63A 5E92A 4HCTA 2JIVA 4G3DA 2BMCA 4FKLA 3OZ6A 3PIZA 4QMYA 4E6AA 4BIDA 4NK9A 3GCVA 1APME 4F6SA 4EK5A 3FSKA 4MBIA 2QQ7A 3ZEPA 3G0EA 1BL7A 4FODA 4PWNA 3NS9A 2REIA 2VNWA 3IQ7A 3DKFA 3T9TA 3ZBXA 3E8CA 3PZHA 5C26A 3KVXA 3R22A 2GNGA 2VWYA 3TJCA 4DEAA 5TF9A 4QMTA 3LCKA 3F82A 4A4OA 5J7HA 3VS5A 4CCBA 2HOGA 2PVRA 2W9FB 4EH5A 2VTOA 4C02A 3NUYA 5HI2A 5H2UA 4I21A 3KXMA 3KCKA 4MNEB 4LG4A 4MWHA 1FPUA 4W8EA 4BCIA 4EOMA 5BYYA 4O22A 4UBAA 2JIUA 4FT5A 4I23A 3LMIA 3O23A 4HGLA 4BGHA 3NUAA 3ZLSA 3QCXA 4BCHA 4F08A 3HAMA 4IX3A 2OGVA 3E62A 3UZPA 4R77A 2WTKB 2BKKA 1R78A 2C1AA 3JYAA 5GJDA 3ID6C 3NCZA 4UN0C 2YITA 2HW7A 1UNLA 3ZZEA 1IRKA 3QX4A 2I1MA 4OBOA 4D4YA 5E4HA 5AR3A 4Y85A 5CEOA 1H07A 3NNVA 4ZY6A 4IQ6A 4NFNA 4QYYA 5FRIA 5HG5A 2X4ZA 4PPBA 2R3KA 3N51A 3UC4A 3CD8A 2XZSA 3C0IA 3HL7A 3VUTA 3GUBA 4HVHA 4D2WA 5M06A 2CKEA 3L9PA 4CNHA 5HX8A 4OT6A 3Q96A 4DEIA 4TYHA 4K11A 4B7TA 4ZK5A 4E4NA 3QWJA 1MRUA 3FKOA 4ZZMA 3UNZA 4H1MA 5E8TA 4IM3A 3IW4A 4ZSGA 2QOHA 5LVLA 4ANBA 3CE3A 5AV1A 2HYYA 2ITXA 2C1BA 4OBPA 4J99A 4YSJA 2XK9A 2NO3A 1WBWA 4UB7A 5CS6A 5LVNA 4PNKA 2QO9A 4QTAA 5A4QA 4V01A 3AC2A 4Y5HA 3RHKA 3ZFXA 4AGWA 4Z3VA 3TDWA 3MH0A 3RAWA 1UWJA 5KUPA 5LQFA 4S33A 4LRKA 4FV8A 3EZRA 4EBWA 4RC4A 5HCYA 3R8LA 5FXSA 5ETIA 4DAWA 4FEWA 1JKLA 4QMNA 4GMYA 5LCJA 3PE1A 1GZOA 1ATPE 4FIFA 3F2AA 4LV8A 3AGLA 3MVJA 4JLCA 3D2KA 5D12A 5F4NA 4O7LA 5CF8A 5IA0A 4Z16A 5IDPA 2WTWA 4P7EA 2XB7A 4MHAA 3ZH8A 3PE2A 4XLVA 4FYOA 4FX3A 1PW2A 2GNFA 2OI4X 4GT3A 4RVLA 2H96A 5AP4A 4AE9A 4ALWA 2WD1A 1A48A 4RA5A 1H28A 3MN3A 3KKVA 1X8BA 4A9TA 3GENA 3ORXA 3A99A 2UZWE 2YA9A 2BHEA 4ZEGA 3SOAA 2P2IA 3HRCA 2A0CX 3BELA 4AZEA 5L2WA 2WMRA 1NXKA 5CWZA 3PWDA 5HU9A 3KK9A 4DFLA 3O7LB 4MEDA 3OW3A 2Q83A 4TNBA 2XNEA 3UBDA 2R0IA 3F7ZA 3PA5A 3DFCB 4ACGA 4IEBA 2EB3A 3Q3BA 3C4ZA 4NEUA 4X3FC 5BVFA 5GJGA 3K54A 3KU2A 5DI1A 1Q3DA 4BBEA 3LMGA 1OUYA 4NT4A 3F3WA 1ZOHA 3PPKA 5EI2A 3RPSA 4MF1A 5GHVA 1U5RA 1W7HA 1OECA 4I20A 2JAVA 3VRYA 5AUUA 3VWAA 2GNLA 3PTGA 3PVBA 4XV3A 3VUIA 5C4KA 2R3PA 1OPLA 1Z5MA 2BIKB 2QOOA 4D1XA 1UA2A 1U59A 2C5NA 4HYSA 4O2ZA 2VZ6A 3RVGA 3VAPA 3R8VA 5CSPA 3CKXA 2B9JA 2RG6A 2XK7A 3A7FA 4ITHA 1XH7A 5EOLA 4FKUA 3TXOA 4C35A 5HD7A 2W5AA 1KUTA 4JJRA 4O0TA 2W99B 1WFCA 4DA5A 2BHHA 2YCSA 5AUXA 4O21A 4WBBB 2XKEA 2B55A 4O82A 3PVWA 4U41A 4UALA 5AAGA 3DAJA 3D15A 1H0VA 1SVEA 1V0BA 1ZY4A 2VTAA 3E3PA 3FYJX 4ZSAA 4IC8A 4UXQA 3RCJA 3UDBA 1WBTA 3QHRA 3UYSA 5KBQA 4BCMA 3PY1A 3F5GA 3SD0A 3H9RA 2EXMA 3QZGA 3O17A 5JRQA 2ONLA 4KBAA 3DK3A 3FXXA 5IISA 4FKPA 4AOTA 4UMRA 4CFXA 4Y95A 2QG7A 3MTFA 4FV2A 2H9VA 4MXOA 1WVYA 4YZNA 3GCSA 1QMZA 4ASXA 4RWLA 4MF0A 1AD5A 4RJ8A 4AU8A 3V5TA 4F7LA 4D2PA 4DN5A 3SG9A 4YJPA 3VO3A 2UZOA 3V5QA 4I22A 1ZARA 2PULA 3AG9A 1JPAA 3UOKA 3I5ZA 5DFPA 3CY3A 4QMQA 3QCQA 2X6EA 3E3BX 2CNQA 1XJDA 3TNPC 3W2SA 5L8KA 3BIZA 4O6LA 1VR2A 4XG9A 3UGCA 3RTPA 4NIFA 1H1SA 5DR9A 5A14A 4GK3A 4JDJA 4WA9A 4A07A 4C58A 2W1EA 4A4LA 5IQIA 3RALA 4CCUA 2BFYA 3FXWA 3FLNC 3LQ3A 2XNMA 3E87A 5T3QA 2G1TA 4FKWA 2WQNA 4Y8DA 3SLSA 3KRXA 3DDQA 3OP5A 5H3QA 4EH4A 3LM5A 3ZZWA 4GYIA 4F7NA 5CAUA 4BDJA 4BZDA 2R7IA 4DTAA 5FM2A 3VS3A 2YDIA 2FA2A 2VWZA 3AT3A 3GEQA 4BHZA 1JOWB 5H8EA 5HNBA 5IUHA 3QC4A 5FXRA 4MCVA 1YVJA 2CLXA 4FGRA 4BWPA 4RFZA 5IDNA 4EOQA
chains in the Genus database with same CATH superfamily
5DG5A 2Z7RA 4YGAA 2VWXA 1P4OA 2C0OA 3U87A 3EQGA 4BDDA 5J79A 3FMKA 4N70A 3K5VA 3PP0A 4C61A 5KMKA 2AEGA 3PPZA 4NWMA 3IDCA 2QONA 4YO4A 5AFVA 5JFVA 1G8AA 4KB8A 2IZTA 3R7EA 2BUJA 3ITZA 4V04A 2YM5A 4PMTA 4Y46A 1YOMA 4YJSA 4JBVA 3EHAA 4L67A 3RCDA 4TT7A 5EW9A 5A4TA 2WGJA 4EJNA 5BVKA 4RPVA 2QOCA 5J5TA 2ZYBA 2XAMA 2HY81 5M56A 4ZTSA 5GIOE 5HG7A 4DEBA 3K2LA 2IZSA 2X39A 1YW2A 4ANMA 4EK8A 4F78A 1UNGA 3VS0A 3L9MA 1T46A 3EFWA 5EYCA 4R5YA 2XJ0A 5CVFA 4S30A 4Q5EA 4IVBA 3KCFA 1OGUA 5FUTA 2BALA 1VYZA 4ZTRA 4DGOA 1XH5A 2FH9A 3UOJA 2QO2A 3ZLYA 2NYAA 3GOKA 3QL8A 4FF8A 4GG7A 3DFAA 5AP2A 2BFXA 2VUWA 3HV6A 3PIYA 4FKSA 2WFYA 4MBJA 3BWFA 4ARKA 3UNKA 1G3NA 1W2DA 2E9PA 4IVDA 4MBLA 3MVMA 3RINA 4RIYA 3TWJA 4F7JA 4GSBA 1B6CB 4LRJA 3QTSA 4U45A 4IAIA 3VF9A 2XNOA 4CXAA 3MFUA 3ULZA 1OPJA 4MAOA 3LCTA 3EIDA 3NW6A 2ITTA 3PSCA 5CY3A 5ANDA 5IQGA 4TYEA 3LZBA 4CKJA 3MFTA 3DPKA 4QMZA 1MP8A 3UP2A 5EKOA 3QGWA 4AOIA 1H1PA 4KRDA 4CZYB 3AD6A 5LMKA 4HPUE 2GCDA 5AP0A 3U9NA 4U3ZA 4EEVA 5CT0A 5FG8A 3AC1A 3RZFA 3DXPA 2IVSA 2QLUA 3W0RA 2R64A 4XV2A 2XA4A 3UDSA 2FUMA 4HYUA 2RL5A 3ACJA 3COKA 4N0SA 5CZHA 4DHFA 3I7BA 2XEZA 4MYGA 1XWSA 4QP9A 4QPAA 2YCQA 3G5DA 2WQEA 2I40A 3NYOA 5DLSA 4BRXA 2YJSA 5I9ZA 2W5BA 2OJGA 1E1VA 2OF4A 3LPBA 4IZAA 3D0EA 4RIOA 4GFGA 3BKBA 3WARA 3P9JA 1HCKA 1JKKA 3SGCA 1BL6A 1MRVA 1XR1A 4FG8A 3RPVA 3VHKA 3ZFYA 2WOTA 4D1ZA 5HE2A 2FSMX 4APPA 4KRCA 1UKIA 4X21A 4ZTNA 2C6IA 1UU9A 5HO8A 3W2CA 3DNDA 4BDBA 4NL0A 3KRJA 5GJFA 2BDFA 5D7AA 5IEVA 1OUKA 5C03A 4AXCA 4TL0A 1QPJA 4XNEA 2A27A 2XMYA 3CTQA 3V8WA 3DB6A 2CNUA 4AACA 4C62A 5FDXA 4GFMA 2QU6A 2W1IA 3R1NA 3FC2A 3BPRA 4L44A 3WF8A 4I92A 1H1RA 5A3XA 3T9IA 3C51A 1YWRA 5H8GA 3QRKA 2VWIA 4DH3A 4TYHB 2UZNA 4UYAA 2J4ZA 3OCBA 1U46A 1HCLA 2ZM1A 4H3BA 4AFJA 5IUGA 2ZV8A 3HX4A 4BWKA 4PP9A 5ANEA 3ORKA 1YXVA 2W0JA 3RM7A 4XV9A 3VBXA 1Y57A 3PSBA 5B0XA 3VS6A 4PDSA 4TRLA 4U6RA 4IDVA 2R3NA 4ACMA 4AG8A 2OSCA 1V0OA 3S2PA 4IIRA 5IMXA 3R1YA 2JDTA 3HMNA 5DT0A 3R7YA 4EH3A 3HV3A 4WG4A 3L8XA 5GNKA 2VO0A 5TOZA 3OWLA 3MESA 2Y8OA 3HAVA 3ACKA 2FGIA 2A98A 2X8DA 2QC6A 2VTJA 5AAEA 4I0SA 4YZCA 3P79A 2VTHA 1H1WA 1Q8TA 3SG8A 1QPCA 3OMVA 3NPCA 1OL5A 4EHZA 4I3ZA 3W0QA 3SXFA 3E64A 3QU0A 3PFYA 1GNGA 1IAHA 3LFAA 5E7RA 3PXZA 2X2LA 3HYHA 3QUDA 5BMMA 4CFUA 3W2RA 5CF4A 3K5UA 4DDGA 1J7LA 2RFDA 1JVPP 4O4CA 3W0NA 2XUUA 5BYLA 2GHMA 3KRRA 4L6QA 2QCSA 2Z60A 4DYMA 1U54B 2C68A 3FEGA 3FQHA 1PXPA 3OD6X 1WBVA 4R3PA 4RQKA 1OIRA 4PL4A 2PTKA 4GUEA 4Y5QA 2SRCA 2BDJA 4KUJA 3R28A 2YAKA 2OXXA 4EOSA 3B2WA 2OJIA 1UNHA 4BYIA 2BVAA 4DH8A 4S34A 3UOHA 4F64A 3FLZA 4HW7A 3II5A 2WMWA 1STCE 5DOSA 2VWWA 3QTQA 2JDRA 2BIYA 5E8YA 1EH4A 2F7EE 2IW6A 4EYMA 3O51A 4JAJA 3FJQE 4D0XA 4I93A 3VVHA 2C47A 2WMXA 3KMWA 5C8NA 2VTLA 2CGXA 1R39A 4LM5A 3DKOA 3R21A 4KKEA 4S31A 1VYWA 5BVDA 3N4TA 2C4GA 5EYDA 1RW8A 2OU7A 1ZYJA 4V0GA 4EI4A 3V5LA 4DH1A 2WTVA 5K4JA 4MXCA 2ZV7A 1VEBA 5A46A 3A4PA 4TWOA 3P86A 5TKDA 4F9CA 4DEHA 3FI2A 2X7OA 4IWQA 5CTPA 4OGRA 5B2MA 3BQCA 4A7CA 1W2CA 4FKVA 1GAGA 1WMKA 2PMOX 5E8SA 4F9YA 4H3QA 3ENHA 3MS9A 2P55A 4X0MA 5A6NA 4ZY4A 4AFEA 1E9HA 3O50A 3BEAA 5JN2A 3ZLXA 2XK4A 4YZ9A 2B52A 3IPHA 5HIDA 4HYIA 1RDQE 4ITIA 5HVJA 4BDHA 5BUJA 1BX6A 2J6MA 4MXZA 3Q53A 2O0UA 5AX9A 2HCKA 3QD3A 4R3CA 5I9XA 4G2FA 5KO1A 5HO6A 2HZIA 3ALOA 1MQBA 1O6LA 3LQ5A 2VWVA 3LCOA 4PV0A 4QT1A 3HP2A 5ETCA 2PYWA 3WIGA 4FBXA 3EKKA 2HWOA 3PRFA 3NNXA 4QYGA 1OL1A 4F6UA 4ZJVA 1JLUE 2VD5A 2GHGA 2Z7LA 5AJQA 4DHZA 3CY2A 4TZRA 5F95A 2GS2A 1YXSA 1SYKA 2YDJA 3BE2A 4BKJA 5IMEA 4RZVA 5HNGA 3QTUA 1FQ1B 1J3HA 4A9RA 5FTQA 2C6LA 3NIEA 2IVUA 4FIGA 4IFGA 4FV3A 4K0YA 4NIFB 3C5UA 4LRMA 4C2WA 3KL8A 1VJYA 3SW7A 4FV7A 3R1SA 4OTPA 1G8SA 1ZYDA 3AD5A 3HMMA 4YTCA 3FMEA 2W1ZA 3MJ2A 3NNUA 4RJ7A 5AV2A 3MIYA 3Q9YA 1BLXA 3QWKA 3ELJA 3R73A 4KS8A 4P90A 5D41A 5G6VA 1YXXA 3TIYA 2CN5A 1M17A 2VGPA 4HJOA 2CPKE 1M2PA 2WEIA 3Q6UA 3LXKA 4GEOA 4IWPA 4C4FA 1KE8A 1IG1A 3DLSA 2PMLX 2X9FA 5BYZA 3HECA 2YZAA 3CIKA 3NFFB 2UZEA 4YPSA 3GFEA 2JAMA 5J1VA 4ZTHA 3EMGA 5J9ZA 2IW9A 4CFWA 2BDWA 2OKRA 3OXTA 4FVQA 2VTQA 3C4WA 3S95A 4GK4A 4GJ3A 2OXDA 5DR6A 3QQUA 3LHJA 3LXLA 3IW8A 2GPHA 3DBCA 3TKIA 5CF6A 4KIOA 4YHTA 4YC8A 3U4WA 3ZTXA 4DEGA 3SQQA 4L3LA 1ZOEA 4E5WA 2XYUA 4I5HA 2UW0A 5KMLA 4AW5A 5TT7A 3FMDA 1REKA 5ETFA 4CRLA 3CSVA 2UW4A 2YN8A 2OIQA 4LMUA 2PMNX 4JG6A 3W1FA 3OY1A 4N6ZA 3MFSA 4RWKA 2J90A 4UV0A 1WBPA 4MXXA 3UC3A 1I09A 4O7VA 5ICPA 4ZAUA 3IG7A 2CKOA 4DH5A 3C4FA 1ZXEA 1TVOA 4IXPA 4RX8A 4EOLA 1O6YA 2F49A 1OIQA 4FVPA 2GFSA 3V04A 4ERWA 4FK6A 2ETRA 1G8JA 1XH4A 3D5XA 3VUDA 3N4VA 4QP6A 3GT8A 4WOVA 3UMXA 4C3FA 2WTCA 4BJJB 2BZHB 3ZXZA 2YJRA 2I0HA 3LFSA 3Q5IA 4HVDA 5C8KA 5HTIA 2IO6A 5L2TA 4YURA 4RIYB 4IANA 4P5ZA 2QD9A 3LE6A 4XRJA 1Q97A 4L52A 4R78A 3EOCA 3SXSA 4BTMA 5KMMA 4FI1A 3FSFA 4G6LA 3MH2A 4JBPA 2I7QA 2RKUA 3LVPA 4X2JA 4DG0E 4J52A 3FQSA 3RK7A 4PMMA 4GFOA 4O27B 3HZTA 5L6PA 2WXVA 4KKHA 5L4QA 2BKZA 4KIPA 2QVSE 2WMUA 3A7IA 1ZZ2A 3IOKA 5FLFA 3V6RA 2OZAB 1XHAA 4E6DA 3R6XA 4DG2E 3ATSA 1W98A 2HXLA 2WKMA 3DNEA 5EYKA 2WMQA 5FEDA 3OTUA 2O2UA 1XQZA 2ERKA 3FKNA 5CU2A 4EH6A 3QTRA 4QMVA 3R8UA 2IEWA 4YLLA 3ZC6A 3I81A 2X1NA 4I6FA 3E8NA 4I0RA 5HOAA 3CCNA 4AGDA 4BF2A 5CNOA 3F88A 4CQGA 4NTTA 3NYXA 1M7QA 4IZ5A 5FEQA 3C50A 3FI8A 5DT3A 4F0GA 4XEYA 4NKSA 1FGIA 2B54A 3VQUA 3AKKA 2JKMA 3DZOA 3G9LX 2OK1A 4BKYA 5C27A 4KINA 2XIRA 2GS6A 3OBGA 2PVHA 4YJOA 4FTAA 4RGJA 3ZYAA 5DPVA 3UMWA 4NCTA 4H36A 5CU3A 3VBQA 1B39A 2Z2WA 4WNPA 3BBTB 3D7ZA 2RFNA 3DAKA 4FKIA 4ONAA 4ZSJA 5T6KA 2BPMA 3GCQA 3ZFMA 4PTCA 5T68A 4AQCA 4PMPA 4FV0A 4IH8A 5CVGA 3SRVA 4O83A 2W1GA 4NTSA 2VTRA 3LFCA 4PUZA 5HEZA 3MVHA 3V8SA 4DITA 5L6WL 4K18A 4CTBA 4D4VA 3KN5A 3VBYA 4PRJA 3QBNA 3ORTA 2QKRA 4RA4A 1YI3A 3R7GA 3NLBA 4HGSA 1K2PA 4FT7A 1L3RE 5GZ9A 1SVHA 3ORLA 1UU8A 1W8CA 3DY7A 1Q5KA 4KAOA 4PF4A 4CFVA 2W05A 3BZ3A 4FKRA 5HE1A 4FTNA 3KC3A 2OLCA 1Y6BA 3DAEA 5TR6A 3KF7A 4DHJA 4RWJA 4GCJA 4CYJA 2ETMA 4DFBA 3MI9A 2PHKA 1KE6A 2XNGA 4FTUA 3UQFA 3MPAA 1XBAA 3UODA 4IWOA 4BR3A 2CCHA 2WTKC 4FYNA 3VS4A 5AP6A 4IAFA 3EFKA 4O6EA 4QPMA 3ZRMA 2YEXA 3FZSA 3PVUA 4HCUA 5L8LA 3ZM4A 1O9UA 2JKQA 2G15A 2UZTA 4XOYA 5I4NA 4RIXA 3HUBA 5K5NA 2PL0A 4AZWA 2BTRA 4WRGA 2ITWA 2DYLA 2CGWA 5HQ0A 2JBPA 2VX0A 3U6IA 2NP8A 2XARA 2PVNA 5ACKA 3BLAA 3E63A 2R3OA 2XAOA 4IFCA 2Q0NA 4BIBA 3U8WA 4CGAA 1M14A 2WTIA 2PVFA 3PJ1A 5CU4A 2XIKA 2BTSA 5HCXA 4BHNA 2JEDA 1W83A 4RMZA 5DNRA 5C4LA 3EQRA 4BC6A 4J96A 4XHKB 4EK4A 1R0PA 2R3MA 2AQXA 2Y7JA 3POOA 1OITA 5AEPA 3WBLA 1SMHA 1ZMWA 1M2QA 5HLNA 2C6TA 3O71A 2VTPA 3EL7A 4FTOA 2CSNA 4E4MA 4J8NA 4M68A 3FL4A 1YWVA 1XMMA 2X8EA 2BRMA 2HK5A 1LEWA 3KXNA 2RSVA 3D5UA 4GT5A 3Q9ZA 2JDVA 2IZUA 2Z7QA 2R0UA 4NM3A 4ZJIA 4E5BA 4V0GB 3TV6A 1P5EA 5KHWA 3S00A 4OTQA 3U54A 3OEZA 1ZYCA 4ENYA 5DGZA 4IC7A 2CHLA 4BI0A 4R7HA 4FOCA 4ANNA 1OIYA 5M4CA 1YHSA 3FLYA 2HZNA 5DT4A 4MK0A 1M2RA 4IVCA 5CEPA 5CSHA 5DYJA 3EFLA 3HV4A 4QTDA 5FDPA 5KKRB 3ZHPC 2YWVA 2VTIA 4O7WA 2PPQA 4X2KA 4EHEA 5DEWA 5FGKA 1OBDA 4KKGA 4O91A 2NRYA 2V5QA 3NIZA 3Q4TA 4E6QA 5EQYA 3ANRA 2GHLA 2YCFA 3G33A 4Z7HA 1IA9A 3NUSA 4ZTLA 3FMLA 2PE0A 3QC9A 3TIZA 1B38A 3HVCA 4O4EA 3LJ0A 5EFQA 4DC2A 4XG7A 3FQEA 4YZMA 3KULA 4TWPA 4ID7A 1H00A 5F94A 4O84A 4AW2A 3QCSA 4BBFA 4MD7E 3KMUA 4F1OA 3NW7A 4QQCA 4WNOA 4FSUA 4U80A 2GQGA 4IM2A 3FHIA 5KMOA 3P7CA 4FT9A 5A4EA 2QNJA 3EB0A 4ZSEA 3QX2A 2WU6A 4E8AA 2CCIA 4M12A 3GP0A 4EWHA 4XMOA 3VNTA 2VO6A 2BZKB 4EZ3A 4WUAA 3TACA 4NW5A 1PRYA 4AGCA 4LUDA 5AA9A 2RG5A 4W4YA 2E2BA 3MPMA 4C38A 3PRIA 4FZ6A 3GOPA 1NA7A 4YUQA 2OH4A 3FMMA 4CLJA 3I7CA 3RHXA 3R71A 5AP5A 4EONA 2IN6A 3FV8A 1DI9A 5I9UA 4C3PA 4JG8A 4PL3A 3CD3A 2YM3A 2PE2A 4U40A 2YM8A 1GIJA 4FA2A 2NRUA 2X2KA 2XM9A 5AUWA 3L9NA 2RFEA 2WQOA 3DV3A 3GU6A 4H58A 3A61A 5HBJA 4W9WA 4DE4A 5JQ8A 1CTPE 1UKHA 3BYVA 3F5XA 2V7AA 3MY5A 4XG8A 4NYEA 2JIIA 3AC3A 5C1QB 2WEVA 3NX8A 4FSZA 2ZFYA 3JR1A 5DR2A 3WF6A 3KRLA 3IONA 5DN3A 5J87A 1PKDA 3E93A 1CSNA 3LMHA 1H25A 5I9WA 3K3IA 4L01A 4W4WA 5AR5A 3ZSHA 5IQEA 4RVTA 2UW8A 5F9EA 3H0ZA 5I3RA 4O0RA 2G2FA 4V05A 3H4JA 5JQ5A 5AV4A 4WT6A 4FTLA 4Q5HA 1WBNA 2CNVA 3IK3A 1PF8A 3TEIA 4C57A 4FG7A 3E7OA 3EFJA 4BB4A 5K0XA 2F4JA 2W7XA 2YFXA 3EQPA 4L3JA 5HORA 5EI6A 1NVSA 4IE9A 3R30A 4Q2AA 2XNNA 2XALA 3ROYA 4L9IA 3WZKA 2WZJA 2Z02A 1NW1A 4GS6A 4YC3A 5CYIA 4NFMA 2WU7A 3R9DA 1Y91A 4IX5A 5AUVA 3PUPA 3QHWA 3AGMA 4ENXA 5BVOA 5EG3A 2JC6A 1GZKA 1LP4A 1K9AA 3V51A 1P14A 3AC5A 4Y72A 4FOBA 4XCUA 4FEXA 2E9OA 4LV7A 5GZAA 4QMSA 5M4FA 3TYKA 4TPTA 2VTNA 4MNFA 1KE5A 4XP0A 3PIXA 3Q4ZA 3LIJA 1CDKA 5EHLA 3PY3A 4JBOA 2PVLA 3H30A 2A1AB 3ODZX 3O96A 4AA4A 2W4JA 3FY0A 3QQKA 4C3RA 4DTKA 3QXOA 2WQBA 3R8MA 4MQ2A 1YI6A 2UZVA 3HEGA 3IW6A 3FMHA 1AQ1A 4HZSA 4XG3A 3R8PA 4N6YA 3BHVA 3OW4A 3UIUA 5IQAA 3KXGA 3TKUA 5E8VA 4GUBA 3V8TA 3TT0A 5M09A 1F0QA 3DDPA 3D7TA 4C4IA 1YOLA 3LFBA 4XRLA 4G31A 3GQIA 2R3FA 3WIKA 4ORKA 5AAFA 4F0IA 4AF3A 3DOGA 1PMNA 4BCNA 1MQ4A 4UXLA 2XJ1A 2R3LA 3RGFA 5LOHA 3ZEWA 3P7AA 1BMKA 5C9CA 3R8ZA 2BZJA 2EVAA 3FYKX 3MA3A 1KV1A 1Y8YA 2VTMA 3PVGA 3ZSIA 3ZUTA 3MV5A 5IA1A 4YJNA 2G2IA 4XOZA 4DFZE 3P78A 4FSNA 3BBWA 2W96B 4CV8A 5AR8A 2ZMCA 5L8JA 1WVXA 3PZEA 3AMBA 3FL5A 3RPRA 4AW0A 3EH9A 4C34A 3HLLA 2ETKA 4FL2A 3T3UA 2IWIA 3HRFA 4M14A 3CXWA 1H26A 4DEDA 2QO7A 4F63A 1ZY5A 4QYEA 3THBA 4QTCA 3HKOA 3S1HA 3Q9WA 5EM6A 4R7BA 4CLIA 1H08A 3F7WA 3O7LD 3PA3A 1XH9A 1YDRE 2W1FA 3B8RA 2A4LA 4FKGA 3OC1A 4P2KA 5AV3A 5IA4A 4ZIMA 1PXJA 5BQ0A 3QTXA 4BCQA 1YI4A 3DB8A 1IA8A 4A06A 3VF8A 5J9LA 5K5XA 1OZ1A 1PXOA 3HMOA 3MH1A 3V01A 3RI1A 3SRVB 4GKHA 4CRSA 4L8MA 3QD2B 5CSWA 4O96A 4PTEA 4O7TA 3JUHA 1KE9A 4PPCA 3U6HA 2ZV2A 5KX8A 2OFVA 2FSTX 3OFMA 1H27A 4M0ZA 3MIAA 3ZXTA 4RLKA 3T3VA 4EHVA 1KSWA 2EWAA 4QNYA 4RJ4A 2OBJA 3RWQA 4AUAA 2VN9A 4JT3A 4UMTA 3RZBA 2F2CB 3LCDA 2YLFA 2X2MA 4FT3A 4ZS4A 4K2RA 4YHJA 3KY2A 3ERKA 4RJ5A 2JKOA 5AP1A 2C6OA 5FTOA 3QA8A 2YCRA 3FI4A 4GYGA 4K8AA 4FTRA 3PDTA 3AOXA 2XK6A 4EUUA 4O0YA 5HBEA 3LKMA 2J7TA 2VO7A 1W0XC 3I0OA 3A7HA 4H39A 4K9YA 4O86A 4QD6A 3I6UA 4ZXTA 3QTZA 4FKJA 4ALUA 5CANA 3UTOA 3AC4A 4M69A 1BUHA 2H6DA 4OBQA 4UMQA 4EK3A 3S0OA 5E1EA 4DFYA 1H4LA 4LL5A 4KSPA 3N9XA 3WOWA 2C6MA 3FLQA 3R7OA 2OJ9A 3RWPA 3QFVA 1OM1A 4AZSA 3E8DA 4L7FA 4AN3A 4EL9A 2R7BA 3O8TA 3P1AA 3NUNA 4FRFA 5AIRA 5CASA 5M55A 4BWXA 3NVMB 3QCYA 4OUCA 4L43A 3WE8A 3SC1A 4O7NA 1PMEA 2WB8A 3E8EA 3W8QA 3TNQB 3P5KA 1WCCA 3GCPA 4QMLA 4M13A 2OW3A 4ZSLA 3AC8A 2H34A 5HKMA 3NNWA 1BI8A 2YZLA 3UO4A 2I0YA 2JLDA 5D1JA 5IPJA 4AT5A 3HMPA 3V6SA 4IAKA 1A9UA 1Q41A 3MDYA 4RFYA 4R8QA 4AOJA 2Y4IB 2HIWA 2NPQA 3VJOA 4C8BA 3HA6A 3BRBA 3F2NA 2C5XA 3G51A 3WI6A 4C0TA 5L6OA 3CC6A 2CKPA 2C3IB 1ZZLA 3QGYA 4P5QA 4FE2A 3UVPA 5AX3A 4FJVA 1WZYA 4ERKA 2ZM3A 2X0PA 5M57A 4HNIA 2UZUE 1ZLTA 3FZ1A 3ZC5A 1WBSA 2UW6A 3Q4UA 3CTHA 2F9GA 4LFIA 5AWMA 5HCZA 2Z7SA 3W32A 3BL9A 5JZJA 1MRYA 3KXXA 3GC9A 4G9CA 3CQUA 4IM0A 3R01A 5IA2A 1VZOA 4NM7A 3ORMA 3D5VA 3LFEA 3QXPA 4RX5A 2Z8CA 3O0GA 4P4CA 5AMNA 3CEKA 3DXNA 4FZAB 2CKQA 4G6NA 3FI3A 2OXYA 3ZRKA 4O0VA 4DF3A 4DLIA 2ITVA 4IB3A 2OICA 4RZWA 2WMTA 5E91A 4ZTQA 4CQEA 2GTNA 3OVVA 3ZUVA 3O5AA 1Q8UA 5M51A 4TNDA 2RGPA 1FGKA 3QF9A 2VO3A 4WSQA 2FSLX 4NM5A 1OKVA 4JRVA 4XG4A 1YKRA 5CT7A 5DRDA 3GU5A 3IDPA 4AW1A 2UV2A 4BY9E 4O7YA 4MXYA 3W16A 3EQBA 1PJKA 4YJQA 5I0BA 4FVRA 2OFUA 2J0IA 2PVKA 3EN4A 4JQEA 2O63A 4WNMA 1TFFA 1U4DA 2UW7A 3BX5A 2GMXA 3F61A 1KE7A 4QNAA 5M4UA 4KABA 5JEBA 2VTTA 4M84A 1NT2A 4YBKA 4EORA 3W0SA 1FMKA 4GL9A 3QA0A 5JH6A 3LFQA 5A54A 3NGAA 2HZ0A 4JX3A 4LQMA 4BYJA 2PUNA 4KD1A 4B9DA 4JS8A 3D94A 4CZUA 1UU7A 3HDMA 4L68A 3ZDUA 4L7SA 3DXQA 1JNKA 2Y4PA 4UMUA 4GH2A 2ZV9A 3UG1A 4DT8A 5LJJA 4JIAA 3P08A 3VN9A 4FNXA 4UMPA 3OEFX 3TZ9A 3OXZA 4RVMA 5JGBA 4YNOA 4D4SA 2VU3A 4NH1A 2OIDA 5CAQA 4JDKA 4OLIA 3LFDA 1TQMA 4EKKA 3ZUUA 2OH0E 4RJ3A 1FBNA 5FEEA 3NW5A 4F0FA 3NVKI 4I94A 3PUFC 4AXDA 3R02A 3REPA 3C4EA 4UYNA 4FTTA 4GJ2A 2OF2A 3P7BA 3GU7A 2CJMA 2V0DA 4QYFA 3HP5A 3U4UA 4QPSA 4KIKA 3F5PA 5JRSA 4RRVA 3HGKA 3RAKA 5HICA 4BCKA 4IB1A 3UIBA 4E73A 3WYXA 5JMSA 3EQCA 1ZMVA 2ONLC 2PMIA 4I6QA 2WTDA 1Z9XA 2XF0A 3R83A 4BDKA 3R9OA 4HVSA 3DJ6A 1J7UA 3C13A 4A9SA 3VONA 4WNKA 3IOPA 4MXAA 3NUUA 4FL1A 2C6KA 3PXQA 4ACCA 4KIQA 4MQ1A 3MSSA 3ZONA 2PZPA 2Y6MA 4JAIA 4NSTA 4FL3A 2C5OA 5CSVA 3GU8A 4TYGA 2E9NA 2PZ5A 1XO2B 4FTQA 3OXIA 3NSZA 5EK7A 4IAYA 3EN9A 4MD9E 3I6WA 3TMOA 4JDHA 4FIEA 4TYIA 2WELA 3UO5A 1ERKA 3MB7A 4NM0A 4AP7A 4LUEA 2VNYA 4DTBA 1RQQA 3WZEA 3GCUA 3D2IA 4IX4A 4PX6A 4U0IA 3ZS5A 2R4BA 5CI6A 3KQ7A 3Q6WA 2WTJA 3RJCA 3DS6A 4QTBA 3GNIB 4GK2A 5EDPA 3TKHA 3R2BA 4JRNA 4C7TA 5E8UA 3HMIA 3C0HA 1LEZA 4S32A 5DHJA 3WZDA 4YNEA 1YDTE 3A62A 3BYOA 4KBCA 4RIWA 4RSSA 3R7IA 5ANJA 4F9WA 2BR1A 3NUXA 1KOAA 3R2YA 1CKJA 4BZNA 2QHNA 3D7TB 3HA8A 3EL8A 4E7WA 4IMYA 2ITZA 2XM8A 4HOKA 3WF9A 4D2SA 2WAJA 5EM8A 4AWIA 5EM5A 2BRNA 4UX9A 3VULA 5I9VA 3JS2A 5EQEA 2OZOA 2UW9A 4RC3A 5AV0A 2B1PA 4RBLA 4X3FA 1Y8GA 3FXZA 3ZU7A 2C30A 1WVWA 4FNZA 3F3TA 3BEGA 3COMA 4QP3A 5FBNC 3EWHA 4XS2A 5LVPA 1XBCA 3AT4A 4FSRA 4RG0A 3RKBA 3L9LA 4J7BA 5IF1A 2GNIA 4Z9LA 3TTJA 2XNPA 1O6KA 3UQGA 3F3VA 3MY0A 4GU9A 4WKQA 3UZRA 4WRSA 3BU3A 4O81A 5HESA 3E88A 3AMAA 4G16A 1J1BA 2HY0A 3FZTA 2C3JA 1PHKA 3MWUA 3KK8A 2AC3A 5CU0A 4I6BA 4XLIA 5BV3A 4D58A 3Q2JA 4E93A 2B9FA 4I1ZA 1G8KA 3I79A 4L00A 3TL8A 4ZS0A 2ERZE 3FLWA 4F1MA 5BVEA 2JITA 4I6LA 3JVRA 3UDZA 3QRJA 2IPXA 3PSDA 2ITNA 4QMXA 2YIYA 2HELA 2WIPA 4BTJA 2WMBA 5DA3A 5IQDA 1BI7A 4O4DA 4BTKA 1P4FA 4O4BB 3EZVA 4RVKA 4BL1A 4QQTA 3PXYA 5LXMA 4FTMA 5FM3A 4O7SA 3LFNA 5LMKC 5B7VA 2QOFA 3MGYA 2XEYA 4BIEA 1M52A 4EQCA 4FTJA 4PL5A 4XX9A 4AZTA 3GC7A 4KS7A 3GI3A 2BAKA 1XH8A 1R1WA 3SKCA 5DMZA 4H05A 2GS7A 3TNIA 1ND4A 5ACBC 4DGGA 2HENA 2W1HA 5DBXA 4D2TA 3DTWA 3DBEA 4FSWA 3R1QA 2HW6A 4JQ7A 2UUEA 1PXKA 1PMVA 2EXCX 3IW5A 3B8QA 3QZHA 2YM7A 4BTFA 1Q3WA 3SA0A 3LW0A 4LYNA 3WZJA 1ZAOA 2EUFB 2QOQA 3R9NA 1J7IA 3KFAA 1PYEA 1Z57A 4FKTA 4M69B 4CKRA 2ESMA 4ANQA 2ZJWA 2RIOA 4EOJA 4FV4A 2YIRA