3L9PA

Crystal structure of the anaplastic lymphoma kinase catalytic domain
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
303
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Anaplastic lymphoma kinase
publication title Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 303
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3l9pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3l9pA01
4NTSA 3R02A 2W4JA 3O7LB 3RZFA 4FE2A 4WO5A 5KZ0A 4L7SA 3ZZEA 1QPJA 4FVQA 4JJRA 4BWXA 4C4EA 2OIBA 2HK5A 3VO3A 1PKDA 3R7GA 4NK9A 4X3FB 3AD6A 3NUSA 1AGWA 4QP7A 3EN9A 3GP0A 4KIKB 4DBXA 3QRJA 4MQ2A 2RKUA 3CBLA 3BV2A 5HVKA 3C4FA 2YJRA 1ZYJA 4QNAA 3NUYA 3CC6A 4M0YA 5IUIA 3RM6A 2X2MA 4GUBA 4BI2A 5ETIA 5M55A 3UOKA 3QQUA 3P1AA 3VUIA 5CF8A 3BQRA 4Y46A 1JKLA 4O22A 4CFFA 2C0IA 3SW7A 1O9UA 3ZXTA 1PXKA 5J5SA 3RAHA 3S1HA 3TKHA 4F6UA 3NNXA 5DR9A 3EL7A 5EHOA 2EXEA 5AWMA 3HRBA 2C6OA 3DKOA 4MQ1A 4RIXA 2YM8A 4C3FA 3LM5A 4KBCA 3VBTA 2OWBA 5F95A 5HVJA 5BUIA 4H58A 4JBPA 2W7XA 3FMKA 2OLCA 3DK3A 4YHFA 4ZEGA 3ETAA 3TEIA 2O64A 1XH7A 2Q0NA 1IEPA 4CSVA 3DB8A 3K3IA 5EYCA 3EHAA 3COMA 4F65A 3HGKA 3DBQA 3GB2A 5ANOA 3ALNA 4ZK5A 5E8WA 2V7AA 4GU9A 1UWJA 3LKMA 4QRCA 4W9WA 2VUWA 3L9LA 5DBXA 3DLSA 4ZTNA 3U4WA 3EN7A 3EH9A 4ASDA 3ATTA 1Q8WA 4LV5A 2BZHB 4U6RA 4FTTA 4B8MA 3OTVA 5JT2A 5FEQA 1ZMUA 5FTQA 2B52A 3GXLA 5LWMA 3WE4A 3MB6A 1SNXA 4QT1A 2ITXA 2ZOQA 3NWWA 2IJMA 3G6HA 3QFVA 3UE4A 3FLWA 2BZIB 4B7TA 4ASXA 4CLIA 5IQIA 2HXQA 4RIWA 4O7ZA 4AGDA 4ITJA 3DOGA 2I6LA 2QOHA 3KC3A 3MH0A 2PYWA 5HTCA 2PU8A 4IZYA 5LMKC 2HAKA 1I09A 2C5OA 3JY0A 4KIPA 1W0XC 3AT4A 4ZJVA 4WG5A 4FGBA 1V0BA 3AT3A 5ETFA 3BGPA 2QOBA 2ZMDA 3RWPA 4F7SA 3QKMA 5BVDA 4BTJA 2XK9A 4Z7GA 3VHEA 3EZRA 1U54A 2W5BA 3BYUA 3GVUA 4IWOA 5HIEA 3N4VA 4IWPA 3D83A 5AIRA 2CGVA 4F64A 4OTGA 3QTXA 5FRIA 5KX8A 3F7WA 2QHMA 4MWHA 5JFVA 4BHNA 1M2PA 5CU0A 3DAKA 2C47A 3TNIA 4S31A 2XIXA 5FP6A 3EFJA 3ZLYA 4AN9A 5KMJA 2XRUA 4GVAA 4PP9A 5B0XA 3U51A 2F2CB 5JEBA 4FNZA 3ANRA 2XEYA 2XYUA 2ITYA 3ZM4A 4IJPA 2GMXA 5C8NA 3K3JA 4CT1A 3HL7A 5CLPA 3VNTA 5H3QA 3FQEA 1LUFA 4H1JA 5AUZA 2VWVA 3FI8A 1NA7A 3IECA 5CF4A 3D7TA 3OBJA 3DDQA 2HZ4A 3FWQA 4DG0E 3PJ2A 4OLIA 2XK3A 3NCGA 3I79A 3QQKA 3RKBA 3PWDA 4E7WA 3CQUA 4EC9A 4APPA 4C02A 3DXNA 3DNEA 2R3NA 5L2WA 3P4KA 3CQWA 4TXCA 3DFCB 3QRKA 1OKYA 2ITQA 2KTYA 3ORTA 5GJFA 1LPUA 2ITUA 3SC1A 4FG7A 3TTJA 1JSTA 4B6LA 4CTCA 4RGJA 1TKIA 2J0KA 3FUPA 3VS1A 1OKZA 3FSFA 1HOWA 3LFQA 4GW8A 4I1ZA 4F99A 2R3PA 3GC9A 4IDTA 4TYGA 2JDOA 1UV5A 2Y4PA 3QLFA 2AYPA 3QQJA 1CMKE 3R22A 3EB0A 4G31A 1SYKA 4CFXA 4AA5A 4CVAA 2X0GA 5KKRB 2ETRA 4ZSLA 4DEDA 2IVUA 2XP2A 1ZY4A 4E5WA 4DH1A 5BQ0A 4W4VA 2Q0BA 4YZDA 5HCYA 3VS4A 3R0TA 3VW8A 5DFPA 3Q4UA 3EIDA 1TQMA 1H01A 4XG7A 4FNWA 4XX9A 3TL8A 3LMHA 4RFZA 2C6LA 5AP7A 2SRCA 1QCFA 3QA8A 3VUMA 1Q8YA 3KEXA 1V1KA 1PXNA 2BDJA 3QKKA 1OI9A 4TTHB 2VTPA 3P7BA 4FV3A 2R0IA 1OBGA 5K4IA 5JGBA 4R7HA 2GFSA 4AA4A 4FI1A 4DA5A 1Q8TA 2H8HA 3HECA 3IO7A 3LJ1A 4L8MA 4Z9LA 2Y8OA 2GNJA 1YDSE 2PSQA 2XS0A 2QURA 3B8RA 4M7IA 3FV8A 4PRJA 5CSHA 5KMKA 3GENA 3MPTA 5EI8A 2Y7JA 3FLNC 4BBFA 4FEUA 3O96A 1FGIA 2WMAA 4I22A 2J50A 4XBRA 4CQGA 5TR6A 5GIPE 4EOJA 1OKWA 3L8PA 4RFYA 1YXXA 2RL5A 4G34A 5AV4A 4ANOA 2XIKA 4ORKA 4C62A 3FC1X 4ANQA 4X2KA 2XKCA 4FTRA 4WIHA 3CSVA 3H9FA 3VBVA 1M7QA 1B38A 3KF7A 3PZEA 5AR2A 5HE3A 1PYEA 3HMMA 1GZ8A 2ZB1A 2ITOA 3F9NA 4X3FC 4ANLA 5IA3A 4S30A 4XOYA 5HNBA 1OM1A 2YISA 2OFVA 5DI1A 4LYNA 4LRKA 3P5KA 3PFQA 4EOSA 4ZY4A 4GSBA 4EOMA 2XKEA 5TT7A 5E1SA 3OW4A 3I81A 4KKEA 3VHKA 4E6DA 1WVYA 2R7BA 3QUDA 3IPHA 4ZLYA 1ZYCA 5KMOA 2BPMA 4F0GA 2OH0E 3NYNA 3CXWA 4FF8A 4I94A 4I20A 4QYYA 5CT7A 4FT9A 3DAJA 2QVSE 1BI8A 5I9UA 4AU8A 2FO0A 5KHXA 5KE0A 4JDKA 5T3QA 1YOLA 3CP9A 4BWPA 2Z8CA 2BAKA 3OTUA 4OTQA 3Q53A 2O5KA 4UMTA 2X4FA 4FUYA 4FT0A 4RJ4A 3ZS5A 5F9EA 2ZB0A 3DBDA 4O1OA 3TKIA 4DFBA 4NU1A 3UC3A 2G2FA 2YCQA 3BEGA 2QLQA 3EYHA 4UY9A 4PL5A 3FXWA 4U41A 4BZOA 2VU3A 5CEPA 2JKQA 4GFMA 3R8ZA 3VQUA 2X2KA 3KKVA 2C3JA 3NNVA 4Z55A 3ZC5A 1Y57A 4G3FA 3LXLA 3H10A 4FG9A 3R71A 3VRYA 1PKGA 2CJMA 3AXWA 3HYHA 4LL0A 4J71A 2OZAB 5BVNA 5KNJA 3UDBA 4NM7A 3BQCA 5BYLA 4C38A 4BCJA 4MWIA 4DGOA 2J2IB 4WOVA 3V5WA 3CY3A 4EH5A 4ANMA 2J51A 2RG5A 3BE9A 2CHLA 2ITVA 2V7OA 4FSTA 4O2PA 4U43A 5DOSA 1MRUA 1M2RA 4CV9A 3B8QA 5GJGA 2HZNA 4YBKA 5CSXA 4FV6A 3R9DA 1W8CA 4YHJA 2QG7A 4QP4A 5BUEA 2OJFE 1RQQA 3JS2A 3FKOA 4HOKA 4MBIA 3IS5A 4EH9A 4FTUA 1GZKA 3W2OA 5IA2A 4CGAA 2IVSA 1YQJA 5L4QA 3ITZA 3TT0A 4KIQA 2OBJA 2J5EA 2R7IA 4IB5A 3PXQA 5ACKA 1PW2A 1NVQA 3ZM9A 2XIZA 3FHIA 4DITA 2C5VA 4M66A 4WKQA 2YWVA 4RPVA 2PUIA 2BFYA 2RIOA 4I5HA 3A61A 5J1WA 4FTMA 3LFSA 4YLKA 3TJDA 4ASZA 2QU5A 4MK0A 1XO2B 5M4UA 4DN5A 5BUJA 3WF8A 4EC8A 3QXOA 5E8SA 2CDZA 3IDPA 4IX5A 2JDRA 1XJDA 3UJGA 4A9SA 1PXOA 5LWNA 1AD5A 3IGGA 3Q9YA 3RHXA 3IDBA 3U54A 2F2UA 4MXAA 2UZBA 1IASA 3DJ5A 3KCFA 3MPAA 3ZDUA 1YXTA 4L53A 2PUNA 4DFXE 3KGAA 3PTGA 5FXRA 1Q5KA 2PVMA 2J0JA 4R1YA 4YZCA 4QO9A 5CQUA 3R28A 4J53A 2WXVA 4BIEA 2ZYBA 2I7QA 2WMBA 3ACKA 4A9UA 2YERA 2ITWA 4YZBA 2VTLA 2CMWA 2X7GA 4X0MA 2GHLA 2YCSA 3T8OA 1U46A 4PF4A 1FQ1B 2FSLX 3Q96A 1OB3A 3NUPA 4FKLA 4Q5EA 4DE4A 4O0RA 4XLVA 5BVWA 4RIOA 2E2BA 3HUBA 4RQVA 1PXLA 3KRXA 4GUEA 4TYJA 1MRYA 3WOWA 5CEMA 4IVDA 1G8SA 1MP8A 4PNKA 2VTSA 3NSZA 3OC1A 3H4JA 2WD1A 2C1AA 3H0YA 3V6RA 2PVRA 5HNIX 3O23A 1YKRA 4C4IA 2ITZA 4S32A 4ZTHA 4D0WA 3R30A 2HWOA 5DMZA 1W98A 3CCNA 5KKRC 3CR0A 1DM2A 1Q24A 1ND4A 3MYGA 4ZSAA 3U55A 1NW1A 1YI3A 1G3NA 2YCFA 3MTLA 4ACDA 2BRBA 4EH8A 4C3RA 4FEVA 3EQBA 3RPYA 1NVSA 4D4SA 5LVLA 2JIUA 1GIJA 4BI1A 1DI9A 5I3RA 3AG9A 2UW8A 4HZSA 3HLLA 4FNXA 4RC4A 5TO8A 1YWRA 4RJ7A 1JKSA 3NCZA 3V51A 3W18A 5HX8A 1VR2A 4D9UA 2CNVA 2QO9A 1E1VA 5HLPA 2W17A 3WYYA 3C4WA 5JFSA 3G90X 4EZ7A 5HD4A 3O7LD 1GAGA 5M53A 3SQQA 2BZJA 1OECA 4I3ZA 3GUBA 2VV9A 2XB7A 3HP5A 5CU4A 4BKYA 5HBJA 1LR4A 5I5ZA 3R9NA 3FI4A 4BTKA 1JOWB 3UOJA 2BIYA 3LXNA 1O6YA 2BTRA 3OD6X 1J1CA 3OHTA 2VGOA 3RINA 2HXLA 4IAYA 3UOLA 4R3PA 3VS2A 3K2LA 4EH6A 2XNBA 2YLEA 5EHYA 2ACXA 3W33A 4ZAUA 4WNMA 4ALVA 1UU7A 4IX6A 4WRSA 2C1BA 2YN8A 4YZ9A 2BDFA 4GFGA 3H9OA 3VS7A 2EU9A 2OU7A 4D2SA 2RG6A 2VWZA 5CVFA 5T6KA 4ASEA 3DXPA 2LAVA 3BE2A 4F70A 5AR5A 1IAHA 4F7NA 4IC7A 1FVRA 3VVHA 3A8XA 4QMZA 5M4IA 5A14A 4AT5A 4HW7A 4C36A 3AMYA 3HMOA 4U5JA 4AS0A 2O8YA 5HCXA 5L2SA 4ZS0A 4OTPA 2C6MA 2FB8A 2WFYA 2Y6OA 3VQHA 2PY3A 1UWHA 3EYGA 3DT1A 3CJFA 4M12A 3UG1A 3V5TA 2XEZA 3SXRA 3QQGA 4R8QA 2PUUA 2GPHA 2OJGA 3MVLA 4XCUA 1CM8A 2YHVA 4PL3A 3MH3A 2OKRA 2W99B 3DZOA 3PP0A 2PUPA 4O82A 4JNWA 1I44A 1XR1A 3P08A 4IXPA 1ERKA 2ZM3A 4FTNA 4C4GA 2XA4A 2JITA 5A3XA 3QHWA 4AACA 4O91A 1Q97A 2VX3A 2W5HA 4AOIA 4KNBA 3WF6A 1K2PA 4AW1A 5CI7A 4O84A 5JGDA 3NRMA 4FIEA 1PRYA 2B9HA 4IVBA 3H30A 4EHEA 3C0HA 4FKOA 3W1FA 4RBLA 5M51A 3BV3A 5TF9A 2QLUA 3DLZA 3PG1A 4UMPA 3NNWA 1BL7A 2JFLA 2WOTA 3BHVA 4EH3A 2ZAZA 2BRHA 4LMUA 4DCEA 4CKRA 4Y5QA 3E3PA 1ZOEA 4U80A 3WYXA 2HIWA 4KIKA 3D5VA 4UALA 4EH2A 4RA5A 3R6XA 3HV3A 2F4JA 4RX8A 2BUJA 3OFMA 3UIMA 4JS8A 4YO4A 5G1XA 4L01A 4OTDA 4LUEA 3LLAA 5IQCA 4PDYA 4NW6A 3LJ2A 4GMYA 3VBYA 1VYWA 3TZ9A 5CU6A 2WIPA 4CMTA 4FKRA 4BY9E 4ERWA 5EM5A 4F7JA 3AC8A 4FV4A 2WB8A 4YURA 2I0VA 3WZEA 4DG3E 4YGAA 4ZXTA 2IZTA 3R63A 4N6YA 3TZMA 3R7OA 4JL9A 5J8IA 1ZRZA 4PNIA 3MVHA 2GQGA 4YPSA 5IQAA 4CZUA 3GI3A 4E4MA 4DCAA 5CY3A 4BKJA 5CSPA 3LJ0A 4K6ZA 4YJOA 4IJ9A 3TWJA 2Z02A 4YJNA 1YVJA 4EOQA 3GCSA 5BYZA 3MIAA 4RC3A 5JK3A 4ZSJA 4G3DA 2WMSA 3B2TA 4U40A 1PMUA 3PXFA 2ZJWA 4MXOA 3GOPA 3UNKA 1O6KA 4HGSA 2VX0A 5JRSA 4ENYA 5CXHA 4WBOA 3GEQA 4LOQA 2BIKB 2P2HA 3D0EA 5AA9A 3LPBA 1FBNA 4EH7A 3LAUA 5AP6A 3ID6C 1F5QA 5EM8A 3UVPA 3KN5A 4QP9A 3C5UA 1SZMA 4CFUA 4CCUA 4NWMA 5AV3A 2WMUA 4DEEA 5LMAA 3Q5IA 5IH6A 2X7FA 2W96B 3Q32A 3SAYA 4BL1A 2WEVA 5AEPA 3M11A 3FBVA 2C5NA 3E7VA 3POOA 4I24A 4C35A 3GC0A 1GJOA 3FMDA 4ZTMA 4OTRA 2IW6A 4I23A 2GNFA 2F57A 4QMSA 3H0ZA 3MFRA 2G01A 4AOJA 5JKGA 4O7LA 4M69A 1E1XA 2F7XE 4QYEA 1DAYA 1XBBA 4H39A 4Y8DA 1P4FA 4BHZA 1PJKA 3PG3A 2J90A 3DK6A 3NNUA 4OTFA 4ZIMA 4BBMA 3IW5A 1KE5A 3AMAA 3VUTA 4BDHA 4G3EA 2Y9QA 2CN5A 4FZAB 5HCZA 3P7CA 2CGUA 5D1JA 3HV6A 5JH6A 4FV2A 4FV7A 4E20A 3IK3A 4JG7A 3RPRA 3BHYA 1E9HA 4FV9A 1Q62A 3QRIA 4M0ZA 4S2ZA 1T45A 4EKLA 3E63A 1J7UA 5AMNA 4CD0A 3BHHA 2V0DA 4RJ3A 4M13A 4I0TA 5KMLA 1P4OA 4U7ZA 2BR1A 3ZEWA 2GHGA 2J0LA 4BCGA 5HESA 3VJOA 3C4EA 3DQXA 4QQ5A 4NT4A 1IA8A 3P78A 4IZ7A 1W82A 3UOHA 3L9PA 5HX6A 3ZFXA 4TKSA 2PZPA 4AQCA 3C9WA 2ONLC 3A7FA 3UMXA 4MXXA 4BCPA 3SA0A 1UU9A 2QKRA 4QYHA 4CTBA 4ZZMA 1SVGA 3NUNA 4IVAA 3MH2A 3KRRA 3MSSA 5DEYA 2PZYA 5E92A 3HV5A 5D41A 2CLQA 3BYMA 4FKWA 2DS1A 4RVTA 4O0YA 3QUPA 3JXWA 3D5WA 4U8ZA 4UBAA 3MFSA 3G2FA 4GU6A 1MUOA 2R9SA 2OO8X 4IX4A 1J7IA 3QGYA 5CAPA 2C69A 3HMIA 4FSYA 3F2AA 4M67A 4MYGA 4Q9SA 4M8TA 3EFWA 4DEBA 4KD1A 4PMPA 3DKFA 2CGWA 1BX6A 3E62A 4KAOA 4C3PA 4V04A 3DAEA 4GT5A 4YJSA 2VD5A 5HGIA 3W2CA 4EEVA 2Z7LA 1MRVA 4ACHA 5CANA 3R2BA 3BIZA 4TYEA 3IG7A 4MX9A 4JDJA 4RIYB 5EHLA 4FV8A 3U8WA 1GIHA 4CV8A 2ERZE 2VTIA 2XF0A 4LV8A 2IWIA 4N70A 4UMRA 3FY2A 3QX2A 4IFGA 3TUDA 3ZSHA 1IR3A 1STCE 5A9UA 5L6PA 5EYDA 1KV2A 4ZLZA 1A06A 3QLGA 3KRJA 5E4HA 1Z57A 5IKWA 1CTPE 1YHWA 2PVLA 2YEXA 1M7NA 2A1AB 4WNPA 3TV7A 5D11A 5CAOA 4W4XA 1WBOA 1OGUA 3C4ZA 4PY1A 4AUAA 4E4LA 4UZHA 4ENXA 4B4LA 4GIHA 4QQTA 4RVMA 4ZTSA 1ZZLA 3GQIA 2Z60A 2WAJA 4GK2A 4WD5A 4C57A 4D1SA 1IA9A 3CS9A 4O86A 2REIA 3W32A 4MD9E 5HZNA 4W4WA 2EB3A 4PPAA 3DDPA 3FZOA 4H05A 1Q99A 4EOIA 4XP3A 5B2KA 4PQNA 3I6UA 3ATSA 3FHRA 3ZRMA 1AQ1A 1EH4A 4QPAA 2XNMA 5C1QB 1FINA 4AZSA 1U5RA 4QMOA 2UZEA 2JAMA 5E9EA 3JUHA 2CKEA 3ENHA 2J5FA 3WIKA 4BIBA 4CKJA 4IH8A 1H24A 4R6VA 2IVTA 1KOAA 2OJIA 5AUWA 3UIXA 2JBPA 2PTKA 3OF0A 2J0MB 3FZ1A 4AX8A 4FIHA 1XH4A 3ORLA 5BVFA 4BCFA 4LOPA 3MJ1A 5ANIA 3VF9A 3P0MA 3V3VA 5CXZA 5DT0A 5FXQA 3RAKA 4U97A 3VBQA 3OWKA 3V5QA 3PA3A 2RFSA 5DT4A 3R8PA 4A9YA 1Q3DA 3V8TA 3IKAA 4FIGA 1SVHA 1FMKA 4R7IA 3R1SA 3OS3A 2G15A 3PLSA 4RX7A 2XCKA 1WBPA 4UMQA 2QNJA 4O0XA 4JVGA 3BU6A 2R3LA 3A99A 2PVHA 2ITNA 3IW4A 3KFAA 4JAIA 4LGHA 4LOOA 2GTMA 2BALA 4FTQA 1NY3A 4R5SA 4Z3VA 5J9LA 2OG8A 3LMIA 2JC6A 3F7ZA 4JDHA 4LI5A 2WMVA 5C4LA 1UKIA 2BRNA 2WMTA 2QOFA 2YCRA 2PMNX 4QP8A 3UIBA 4CFVA 4DEGA 3DJ6A 5EW8A 2XCHA 2B54A 4IDVA 3F6XA 4CT2A 1Q8ZA 4BDCA 3D5UA 2E9PA 3PXZA 2BKKA 4RVKA 1JPAA 1Y6AA 3K5UA 2YIQA 4G3GA 3AD5A 1K9AA 1IAJA 2FYSA 2ESMA 4QPMA 2XJ1A 2HCKA 3NIZA 4FT7A 2OZAA 4W8EA 4I93A 5IQGA 2XK6A 1BLXA 3UQGA 3W2QA 1T46A 3IW7A 4PPBA 5L3AA 5IQFA 4F9CA 1H1SA 4XOZA 4DGMA 2OH4A 3GOKA 3RNYA 3QAME 4YUQA 3ZRKA 5FTGA 2C30A 1DAWA 2WPAA 4P5QA 3RAIA 5F20A 4QMPA 3HV4A 3L1SA 3OWLA 5KMMA 1GOLA 1W7HA 4FK6A 4BGGA 2VO7A 2VO3A 1PY5A 3UNZA 3WZUA 2HY81 3R7EA 5C8KA 3FI3A 1P2AA 3BU5A 2B4SB 4HVDA 3V5JA 5EI6A 2QU6A 4KABA 2VWBA 5AP4A 5GINE 3KVXA 4YZNA 4EK8A 1R78A 3NW6A 3PYYA 4QMTA 4HJOA 1TQIA 3FLSA 3PVBA 5DVRA 1A48A 3ZTXA 2XK4A 1J7LA 5E91A 4CMUA 3ZOSA 3FMNA 4HPTE 1FGKA 5BYYA 5DGZA 2CGXA 3QQLA 1PXMA 4BCIA 2WTIA 4DFNA 1YXUA 4XUFA 2YM6A 4O1PA 3Q52A 3QC9A 2AC3A 4NKAA 2UW7A 4XH6A 4QMLA 3ZBXA 4DLJA 2JLDA 2IG7A 3BI6A 2UZWE 3C13A 3EN4A 1QMZA 1R1WA 3LQ8A 4J52A 4WG3A 3OY3A 3FXXA 2UZOA 4X2JA 4JQ8A 5M57A 4DH5A 2QOIA 5EQEA 2VWWA 4CEGA 2UZUE 4C4JA 2A27A 1BMKA 4FOBA 3CIKA 5CAQA 5AUXA 4HPUE 4PDOA 4R3CA 2WGJA 3FMHA 5FEEA 2VGPA 2WQBA 4K2RA 5HBHA 4TNDA 3LFAA 4YPDA 3TKUA 3TTIA 3Q9XA 2EXMA 4IC8A 4L3LA 4OW8A 4P2KA 4G5PA 4MTAA 1M2QA 4D1ZA 5EDQA 3IGOA 3F3UA 4QMYA 3R7VA 1VJYA 3EKNA 4ARKA 1YDRE 4UYNA 5AIKA 2W5AA 4D4YA 3MIYA 5H8BA 2C3KA 3ALOA 4QTCA 4NIFB 4YJQA 3RCDA 3CEKA 4GVJA 3PY3A 2HELA 1TVOA 1UNHA 3FKNA 4O7RA 3QTSA 3NW5A 3F3VA 3QX4A 4E93A 2PWLA 4XNEA 5HO8A 4UZDA 1YWVA 2NRUA 3P23A 3SXFA 3ZSIA 4D4RA 5BMMA 4E4XA 1G8AA 4C2WA 4M3QA 3UQFA 3GCUA 4I6QA 4TYIA 5GHVA 3PP1A 4FA2A 4FIJA 4L7FA 4RX5A 4YBJA 2YIWA 3NS9A 3NYXA 4L67A 2CNUA 3R04A 3ORKA 4FEWA 1JWHA 3A7IA 4D9TA 2GQRA 2BDWA 4MF1A 4NW5A 3DCVA 3OUKA 5CU2A 5C9CA 3TI1A 4DTKA 2B0QA 3QALE 2QONA 4L3PA 4LM5A 2J6MA 4O7WA 4FSQA 4ACGA 2HENA 1XBCA 1LEZA 3ODZX 2FSOX 5TKDA 1OL1A 1UVRA 3L9MA 2WU7A 3FZSA 2HY0A 4HVHA 2W1CA 3KVWA 3VBXA 5JQ8A 1VZOA 4FSZA 3WE8A 4XG4A 4JBQA 4NCTA 2P55A 4O6EA 4WNOA 4A4OA 2X9FA 1NVRA 3E64A 2UVZA 5ANGA 2YDKA 3Q9ZA 2IZSA 3VS6A 5KO1A 4I5PA 5LXMA 4FV1A 3BWFA 3OCSA 4XMOA 5KZIA 4E5AX 2XIRA 2UUEA 1RW8A 4FSRA 1JLUE 3R83A 4BYJA 5HIDA 4DC2A 5K9IA 2W4KA 4O38A 4EOLA 4E6AA 5GZ8A 4MD8E 4CCBA 1PMVA 2G2HA 3WF9A 4DLIA 3ZUUA 3S2PA 3KXGA 3D4QA 4O27B 4EUUA 4NUSA 2O2UA 3C4XA 3U4UA 1RDQE 4DEAA 3EJ1A 4J98A 4PDPA 3V8WA 3R8UA 5BVKA 4L46A 3VAPA 4YSJA 4RIXB 4PPCA 2OF4A 3MGYA 3JY9A 5CVHA 4FZFB 5FDPA 3DJ7A 4J7BA 2FA2A 5HG8A 1URCA 2WIHA 2PMOX 2OJJA 3BRBA 3CTHA 4I6BA 3DQWA 3MVMA 5AM6A 4AFJA 5I9VA 3G0EA 1PXPA 1G5SA 3T9TA 4JRVA 5KBRA 5DIAA 3VS3A 3AQVA 2OJ9A 3OXTA 3RM7A 3UO4A 5M44A 5CAUA 2C6EA 2O65A 3A4OX 2BHEA 3AOXA 4M14A 5K0KA 2VTNA 4FVRA 4GG5A 1WCCA 3RMFA 1HCLA 5EM6A 5IEXA 2W4OA 2JIVA 5IU2A 3HMNA 1DS5A 4NJ3A 1APME 3CLYA 4FX3A 3CTJA 4IX3A 3GCPA 4NZWB 2QD9A 4X6QC 3CKWA 5J1VA 3UMWA 5FWKK 3C4CA 2I0HA 5AX9A 2F7EE 3N4UA 5LVNA 2I40A 4KBKA 4G9CA 3UPZA 3LCTA 4D58A 4O0TA 3LCSA 4JT3A 4DF3A 1MQBA 3TNWA 2OF2A 2BRGA 3EKKA 5CZHA 3TIZA 2WQOA 4RMZA 3NAYA 4NM0A 5I4NA 3OUNB 3JYAA 4KIOA 1PXJA 3COKA 4HGEA 3BLHA 4FV5A 2CKPA 2E9VA 1Z9XA 2XYNA 4ZSGA 2B53A 4C33A 2BAQA 5K5XA 3HZTA 2GNGA 3F61A 3HDMA 2GQSA 3C51A 4AP7A 3D2IA 4LQMA 5HHWA 5FM2A 2ERKA 3KN6A 1ZXEA 4FG8A 4MBJA 4WBBB 2XNOA 2FUMA 4Y95A 5EOBA 3ZBFA 2G9XA 3UG2A 3TUCA 4J8MA 2QQ7A 3BLQA 3PXRA 4H3BA 4MXCA 5J5TA 2X8IA 2XM8A 4FTCA 5HG7A 1KV1A 3I7CA 1JVPP 4YC6A 3H3CA 4OBQA 2J4ZA 2Z7QA 3FMMA 4FEQA 2VTOA 4RWJA 4PP7A 3E87A 4ITHA 4F63A 4FL3A 5H8EA 4APCA 4X21A 3FPQA 3TM0A 5AX3A 1OUKA 5J7BA 5EW3A 4FSNA 5EK7A 3A7HA 2A4LA 4JIKA 1YOJA 5AR3A 5LMBA 3UZTA 4S34A 4OAVB 5CF5A 1ZYLA 4F08A 4OTIA 2PL0A 4JBVA 2WTCA 5A54A 3FMLA 4FSUA 4BCMA 5FQDC 4Y73A 5M56A 4I6FA 2FH9A 2W1HA 3MTFA 4QYGA 5DHJA 4GKIA 4BF2A 2XNPA 4J99A 4OTHA 3TZ7A 3KXNA 3OMVA 5KCVA 3I60A 5LMKA 4TNBA 1CKIA 1XH9A 2XNGA 1ZYDA 4ZMEA 4GEOA 4TWNA 3GFEA 3SRVB 3U6JA 4DFUA 4AZFA 5BPYA 4EYMA 1Q3WA 1FOTA 3GU4A 2F7ZE 4ZLOA 2PVJA 4EZ3A 5GIOE 2NPQA 3R8LA 5IISA 1OKVA 4IANA 1ZOHA 2YZLA 1S9IA 4BI0A 2R3GA 3PY1A 3ELJA 4FTJA 5AV1A 5HU3A 2YM4A 4CFWA 5GZAA 5HTIA 3GU7A 2WZJA 4OTWA 1PMNA 5ETAA 3QZHA 3FLYA 4U9AA 2YDIA 4UWCA 3NLBA 4II5A 3FKLA 4U0IA 4XV1A 5DPVA 3ZFMA 1YWNA 1REJA 5H8GA 4LGDA 3QCYA 3TXOA 4Z16A 4FEXA 4R7BA 5I9XA 5CTPA 3PY0A 4HZRA 5AUVA 2XNEA 4K9YA 4QQJA 4F1OA 5LVPA 3A7GA 4IM3A 3MB7A 3ZSGA 1H26A 2XBAA 4DEHA 2F49A 4FVPA 4UWBA 3EQFA 3NUUA 5FG8A 4ZTRA 3BBTB 4GK3A 3CD8A 3FQHA 4LGGA 2B55A 4QYFA 5F94A 3LCDA 4FKUA 4BZNA 4L42A 4BCHA 4DTAA 1RE8A 2B7AA 4MNEB 5AUUA 4QD6A 4WUNA 1GZOA 3OW3A 2XKFA 4QQCA 4KBAA 5A4QA 2CN8A 2J7TA 3V5PA 4CLJA 5AR7A 2H34A 1BKXA 3FI2A 3IOPA 3G51A 5IG1A 3G15A 4D2TA 4FKIA 3QGWA 4G9RA 2YIXA 4PTGA 4FTLA 3IQ7A 3NIEA 4MEDA 4MD7E 4WRGA 3WF7A 2Z7SA 3F5GA 4EHVA 5A4EA 3QU0A 4F9AA 4JXFA 3FXZA 2BFXA 2OK1A 4QMXA 4HCTA 1MQ4A 1CKJA 2AC5A 4DG2E 4O6LA 5ANKA 1YHVA 5CSWA 2GTNA 5DR2A 2G2IA 3QD3A 4S33A 1GNGA 1M52A 2R3QA 3Q6UA 4ANNA 1H25A 4AG8A 4QMQA 4JG6A 4XV2A 4QP1A 2I0EA 4PMTA 3VWAA 3W2RA 3NVMB 3NW7A 2WQEA 2YM3A 3G9LX 3ZO4A 5HIBA 3EFKA 4AOTA 3CJGA 4BDEA 4E6CA 4XS2A 3OXIA 1OL6A 4PTCA 3ZLSA 5JFWA 3ROYA 5KMIA 2HYYA 4BDIA 4BIDA 4XJ0A 4B9DA 4FUXA 4HYSA 4YC3A 2IZUA 4UXQA 4PL4A 1H4LA 4EK6A 4UYAA 3V6SA 2QI8A 2V5QA 3R8VA 3QF9A 3SW4A 1OIQA 1RJBA 3L8VA 4KKGA 1YXVA 4FSMA 4XG3A 3EFLA 3ZO1A 5L8LA 3FC2A 4D2VA 4EOKA 3UODA 4EYJA 2EB2A 3DGKA 3KU2A 5E8UA 3F3ZA 3QTIA 3TIYA 3BYVA 5LQFA 4WT6A 2QO7A 4A4XA 3E92A 3CPBA 5E8VA 2GS2A 2XJ0A 5C4KA 4I5MA 4ZMFA 1WBNA 2YM5A 3A60A 4YO6A 3W8QA 2Y4IC 4L45A 2LGCA 4TWPA 4AN3A 4RLKA 3L8XA 5ICPA 2UW5A 4R77A 1NXKA 1ZOGA 2X8DA 4FYNA 3DTCA 3OVVA 4JRNA 2WMQA 3LFCA 3G0FA 4X3FA 5IQDA 3EOCA 3ZLWA 2R2PA 4MF0A 2OICA 3RK5A 4GCJA 1WBWA 3OWJA 4TWOA 4YLJA 2ZVAA 3O17A 3EQIA 1Y91A 3EMGA 5IDPA 2C6DA 3LFNA 3W2PA 5JFXA 1W84A 3OG7A 3N4TA 3KRLA 4XG2A 2OXYA 1WZYA 3ZH8A 5DEWA 3LM0A 4GH2A 4BZDA 4M15A 4TRLA 3UYSA 4FICA 4FK3A 2X1NA 4HGLA 3NR9A 5CEIA 4Y83A 1WBTA 4MH7A 4MXZA 1YXSA 2JGZA 3HA8A 4I4FA 4IMYA 4P5ZA 5E8ZA 5JGAA 2GU8A 5K4JA 1PYXA 3QWKA 3GC8A 5L2TA 4FYOA 4E73A 4NL0A 4TWCA 4LMNA 4NJDA 3BPRA 3QUEA 2VTAA 4RG0A 4UB7A 5CEKA 5AJQA 3C0IA 4FODA 5BVOA 3E3BX 3IDCA 5CALA 3Q5ZA 4IEBA 3FYJX 4GKHA 3QZFA 4L44A 4MCVA 4TPTA 3NX8A 3OBGA 3QZIA 4C59A 3DA6A 5FBOA 2R3JA 2XNNA 3E8DA 3Q2MA 1XWSA 3FEGA 4V0GB 1KE8A 1LEWA 2OXDA 3GNIB 3C50A 4YP8A 4PX6A 2HW7A 4O21A 1OIUA 3MFUA 3VULA 4PUZA 3KMWA 4IAAA 4TL0A 4DH8A 4AZVA 5LVMA 4BDJA 3EQDA 4XV3A 4IZ5A 2OZOA 4Y72A 4F7LA 5IA4A 5M08A 1S9JA 1YOMA 4JDIA 3TUBA 3JVRA 3PJ1A 1OMWA 4G6OA 3AGLA 3A62A 2GNIA 4NH1A 3DB6A 2VWUA 2YM7A 5GNKA 4U44A 4NTTA 2HZIA 4USDA 2IO6A 4RVLA 1JBPE 5B2MA 2QHNA 2XJ2A 3W55A 4DT9A 5JQ5A 4R1VA 3KULB 4O0SA 4EK3A 3UVRA 3LFDA 3E93A 5HKMA 3A7JA 2UZDA 3RHKA 2QOKA 4JLCA 5K3YA 5FDXA 2J9MA 3BX5A 3DKCA 4ZP5A 2RFDA 3I0OA 5C26A 4G5JA 5HLWA 3R21A 3TCPA 4N6ZA 3S00A 1H1QA 2YFXA 2X6DA 2C5XA 2QOLA 3R01A 3UZRA 2PE1A 4QTDA 3GGFA 3UP2A 4CYIA 5EOLA 4P4CA 4K0YA 4ANSA 3UGCA 3OXZA 3R7IA 4EL9A 2BVAA 1P5EA 2R4BA 4FL2A 3LLTA 4W4YA 3RWQA 3PSCA 4M68A 4AN2A 5HICA 4MXYA 3ZUVA 1OPJA 3HP2A 3MY5A 4QTAA 2R3KA 2QO2A 3PPJA 2X2LA 3PXKA 3SKCA 2XMYA 2ZV7A 5CYIA 3TNQB 4CG9A 1ZY5A 2I0YA 4QPSA 3BZ3A 1CKPA 2NP8A 3VIDA 1OVEA 5AA8A 4PMMA 3EQHA 2PVFA 2UZVA 5D12A 3U9NA 2XZSA 3BELA 4FZDB 2GHMA 4X2GA 4AFEA 4CXAA 5HO7A 2PPQA 4W9XA 3F66A 1OL2A 2DQ7X 4F0IA 5DN3A 5I9YA 5A6OA 4AW0A 4E26A 1UU3A 4BTFA 3Q2JA 4AE9A 2FVDA 3LW0A 1ZARA 3HEGA 4M84A 4QMWA 3RPVA 3LQ3A 5HG9A 2W1EA 3FJQE 4L68A 3UBDA 4QMNA 1B6CB 1CSNA 4C61A 4I4EA 4N57A 4M97A 5LVOA 4ZY6A 5IA0A 4BDDA 4HGTA 3I5ZA 3R9RA 1A9UA 2QC6A 3G6GA 3MN3A 3ORNA 4FOCA 2IW9A 4CZYB 4HVGA 2QOOA 3BGQA 2PZ5A 3ODYX 4C37A 4R78A 2WTVA 5DRDA 4F1MA 3MPMA 3LCOA 3TG1A 3QCQA 3TNHA 4IM0A 5AUTA 4AWIA 5HU9A 2ZDUA 2G1TA 4NIFA 4NYEA 1SM2A 3L9NA 2B1PA 5IUGA 2DUVA 3PVUA 4YNEA 4YTFA 4YTIA 4EH4A 3R7YA 3MY0A 1YI6A 4CRLA 5IMEA 3NEWA 1SMHA 3DZQA 2GNLA 5C03A 3UYTA 3OROA 4RQKA 3PPZA 1M14A 1UA2A 3FL5A 5EYKA 3DNDA 4AZTA 4CYJA 3LOKA 3LQ5A 4FL1A 1OUYA 5DH3A 5ANJA 1GIIA 3OWPA 1UKHA 4V01A 2YIYA 4PV0A 3O8TA 5AFVA 2GSFA 4OUCA 3R7UA 4DH3A 4EWHA 4ONAA 3A4PA 3PVWA 4IFCA 3Q6WA 4AT3A 4YR8A 3PE1A 2WQMA 1CDKA 1JQHA 3QRTA 3F2NA 4AGCA 4JX3A 4HVSA 1QPDA 2W1GA 3EQRA 5F4NA 2WMWA 4ZOGA 4KSPA 4FKSA 5TOZA 4CFMA 3R1YA 2QOCA 2C0OA 3RGFA 1PXIA 2NRYA 1V0OA 5H9BA 2VO0A 5IMXA 5CF6A 2A0CX 4GJ3A 4ZTQA 4D55A 4NSTA 3NZ0A 3QTUA 3QZGA 3TACA 3ULZA 3AC1A 3PIXA 4ERKA 4OAUC 2W9ZB 4RRVA 3PRFA 2C6IA 3PUPA 3W10A 3WZKA 2X4ZA 4CFNA 2UW9A 3Q4CA 2VNWA 2XVDA 5JSMA 3BYSA 5AAEA 2C6TA 3RK7A 3TJCA 4ACCA 2FGIA 4EK4A 3D14A 4EHGA 3RI1A 4E5BA 1ZWSA 3MI9A 2DYLA 3QXPA 2WNTA 4X2NA 3R1QA 4NKSA 3KMMA 3POZA 3QKLA 4K11A 4BDAA 3LCKA 3C5IA 4D2PA 4R5YA 4RSSA 4H3QA 5L2IA 3MBLA 4UXLA 1ZMWA 1WFCA 4Q9ZA 1Q61A 4ITIA 2QCSA 5C01A 3O0GA 3EQCA 3CTQA 3HDNA 3QTRA 2Z2WA 3BKBA 3DPKA 4NEUA 3S3IA 4CQEA 5KHWA 3MJ2A 4JQ7A 4RJ6A 2E9NA 4DGGA 1J1BA 5CI6A 4YLLA 2B9JA 2P4IA 2W1FA 3FY0A 3QQHA 4IAKA 4YTHA 3T3VA 3PIZA 4BCOA 5K0XA 4O7SA 4FKGA 3GCQA 2YAKA 4BCKA 5EM7A 5HVYA 3TDWA 2WELA 4I0SA 2WEIA 5AR4A 3OT8A 1BUHA 3QHRA 1K3AA 3SX9A 1QPEA 2YDJA 1OITA 3ORPA 4GG7A 4GT3A 4JX7A 4KSQA 4RWLA 5ANEA 5HLNA 5M07A 2H96A 4G17A 2QG5A 1ZYSA 4OBPA 4FTAA 3K54A 3D2KA 4YJPA 3L8SA 4EQCA 3EQGA 3NGAA 1H08A 3BHUA 3LFFA 4GK4A 4GYGA 4D5HA 3CGOA 5AADA 5BX0A 5L8KA 2B9FA 5CSVA 2GNHA 3I7BA 4WG4A 3DXQA 2JFMA 4EOOA 4QNYA 4E6QA 2XBJA 3UNJA 3CD3A 4G3CA 4LRJA 1JAMA 2R3OA 2XRWA 3P86A 4XG6A 3WI6A 4EJ7A 5AM7A 3NVKI 2WQNA 3PSDA 3PE2A 4QP3A 4FTIA 3UQCA 3KREA 3FMEA 4JG8A 3LFBA 4XBUA 3FMJA 4FIFA 3AD4A 4AGUA 3O71A 4IACA 1KOBA 2R64A 4O7NA 1FMOE 1KSWA 2PE0A 5K5NA 4IQ6A 3PRIA 3UP7A 3ZUTA 3TV6A 4U45A 4CNHA 4QP6A 5FP5A 2PZRA 1H8FA 3Q04A 3QC4A 2OIQA 4UEUA 5CZIA 4CKIA 1TQPA 1V0PA 4M69B 2Y0AA 3PXYA 4AF3A 5BMSA 5E8YA 5AP0A 2OI4X 3RPOA 4BC6A 3MDYA 4XG8A 5L6OA 4O7YA 4CRSA 4G16A 5DG5A 3QYWA 1H1WA 3P7AA 4O7VA 1BL6A 5HI2A 3CPCA 3PLAE 4A9RA 4BYIA 3JR1A 3JPVA 4Y85A 2XK7A 3E8EA 4RFMA 2GDOA 5CS6A 5FUTA 4HCVA 4FZ6A 2V55A 4QOXA 3FAAA 4DT8A 3T9IA 4JIAA 4H1MA 3VUKA 5E8XA 3QYZA 1NT2A 2HOGA 4HNFA 5L8JA 2FSMX 2UZTA 5BVEA 4XP2A 5HOAA 5C8MA 5FM3A 4YNOA 1XH5A 4KA3A 2VTJA 2PULA 1SVEA 2XK8A 4IWDA 2A2AA 2IN6A 4RJ8A 1H27A 4GIIA 4ID7A 1L3RE 5E1EA 5D9HA 3SG8A 2C0TA 4O0VA 4HYUA 4AA0A 4PTEA 4AZWA 2VTHA 4WNKA 4J95A 4NFNA 3LFEA 4EJNA 3O2MA 4FTKA 4EBWA 2X7OA 4TYHB 1J3HA 2EUFB 1R0PA 3IONA 2OW3A 5JZNA 3SRVA 4J1RA 1WBSA 4C2VA 5FEDA 2PHKA 1Q4LA 2JEDA 5JZJA 3EN6A 4AE6A 3U6IA 3BEAA 4KWPA 5J95A 3RAWA 4MVFA 3IOKA 2QKWB 3KK9A 3LE6A 4FV0A 3O8UA 3FZPA 2WMRA 3MV5A 4TW9A 3UO6A 4D4VA 2NO3A 3ZHPC 3FYKX 3QBNA 4BDBA 4Z7HA 3D15A 4N0SA 2C6KA 4HCUA 2VO6A 5EDPA 3HRFA 4LFIA 3QTZA 3SOCA 3V5LA 3ZONA 1WBVA 4JI9A 2WU6A 5HE0A 4BRXA 3II5A 3F88A 2W06A 4IZAA 4NM3A 4XRLA 2C3LA 3H9RA 5FD2A 4FT3A 1YRPA 5EKOA 4B8LA 4EQMA 1R0EA 4UMUA 1WMKA 3LXKA 2WTWA 4KB8A 5D7VA 3B2WA 3RALA 4UX9A 4J97A 4FMQA 2PVKA 4IW0A 5KUPA 4QTBA 4DAWA 4JR3A 5A46A 3OY1A 5HNGA 1U4DA 4IBMA 5CENA 3ORXA 2B9IA 3S0OA 1KUTA 2ONLA 3GBZA 4I92A 4J8NA 3ZDIA 3ZYAA 4MNEA 5IA1A 4W8DA 3LVPA 5FXSA 4BB4A 4QMUA 3OOMA 4UV0A 5ANDA 2YJSA 5J79A 4G2FA 4R3RA 4HYHA 5IA5A 3NUAA 4F9WA 2UZNA 5CASA 1ATPE 3FE3A 3DTWA 5FTOA 3E8NA 4BN1A 4ZS4A 2RF9A 4X6RA 5DNRA 3T3UA 2I1MA 5IEVA 4N4SA 5HO6A 2OIDA 2NNWB 3FZTA 3CKXA 3OEFX 3KXHA 5G6VA 4EKKA 2A19B 4PWNA 2ZV9A 4O83A 5IQEA 4L3JA 1U59A 3QA0A 4RT7A 5EDRA 4L00A 4DYMA 4F0FA 5EQYA 3DBCA 3JVSA 2JD5A 3OP5A 2VTQA 3SD0A 5GZ9A 3PPKA 3QD4A 4MAOA 4DH7A 1REKA 3D9VA 4QTEA 5M4FA 4XV9A 5LARA 4YJUA 3NDMA 5LCKA 4ALUA 4PMSA 4YSMA 2BRMA 2W05A 5CX9A 5HEZA 2Z7RA 5I3OA 4YJVA 3W2SA 4EHZA 4TZRA 2CPKE 3WZDA 3N51A 3V8SA 3GC7A 4A07A 2ZV2A 5EI2A 3MA6A 4DTBA 2BZKB 4C8BA 5GJDA 5AP5A 5BNJA 3VS0A 2Y4IB 4ZSEA 3VW6A 3VUDA 5EG3A 4ZZOA 3FL4A 1H0VA 3C7QA 2RFEA 4O81A 1OIRA 5EW9A 5IPJA 4L9IA 3E7OA 5DYJA 3QQFA 3RVGA 3C0GA 4EBVA 5L6WL 4IAIA 4RJ5A 4TT7A 3K5VA 2VWIA 4MBLA 4OBOA 2X9EA 4DFLA 3I5NA 4YMJA 3AT2A 5IZFA 3UVQA 5HE2A 5E8TA 3RPSA 3SHEA 3WIGA 4A06A 3EWHA 2PVNA 1H1PA 4WA9A 2YZAA 4C4FA 1L8TA 4ZTLA 4JBOA 4RIWB 2E9UA 1GY3A 3C1XA 3G5DA 4H36A 5H2UA 3ZC6A 4DFYA 5AV0A 2ZMCA 4OT5A 1O6LA 3LXPA 2WHBA 3VC4A 5CVGA 3WZJA 3RNIA 5B2LA 3ANQA 4UWYA 4DGLC 3TN8A 2E9OA 5IH5A 2DWBA 3RZBA 2W1DA 1XH6A 4EI4A 4F9YA 3F82A 2YIRA 3KXMA 2BAJA 1U54B 3KA0A 4F09A 4MKCA 1BYGA 3LMGA 2X39A 3OT3A 4L52A 3VRZA 4UN0C 2UVYA 2YAAA 3FSKA 3OCGA 1KE6A 1W83A 2XKDA 4BR3A 3I0QA 4U81A 2V62A 3D7ZA 3SVVA 3TZ8A 3ZRLA 1KE9A 4FZ7A 3ROCA 2RFNA 4FR4A 2WO6A 4P90A 2QR7A 5IEYA 1SNUA 3ULIA 3DKGA 4MHAA 1XHAA 4FBXA 4YTCA 3BYOA 1XQZA 2QR8A 4FIIA 2VRXA 4YZMA 4V0GA 2WTDA 2WOUA 3R1NA 3D7TB 5LOHA 4F9BA 3UIUA 3WILA 1H1RA 3I1AA 5IQHA 2ITPA 3VUGA 4I6HA 5AP1A 1PHKA 2ITTA 3I6WA 5L2QA 4GFOA 5HD7A 4Y5HA 5FGKA 3WARA 4P7EA 3IW8A 3QCSA 5KMNA 4EZ5A 3Q4ZA 4U3ZA 5AAGA 3F3TA 5EQPA 4V05A 4AXAA 3DK7A 4DFZE 4GJ2A 3V01A 3E88A 3Q60A 2JBOA 5JN2A 5HQ0A 4D1XA 3MESA 4FT5A 2H6DA 3KQ7A 5JMSA 4EQUA 3PSBA 5DWRA 5IH4A 2VTTA 3KCKA 3RK9A 4U79A 5HG5A 1X8BA 4X2FA 5AUYA 3GU6A 1QL6A 4XRJA 3ZLXA 3ORZA 1FVTA 4KS7A 4E8AA 1UU8A 3P79A 1Y6BA 3G9NA 2ZM4A 3KULA 3SV0A 2UW4A 3HA6A 4BDGA 2C5YA 4OT6A 3SDJA 3TV4A 3O50A 5DR6A 3WF5A 1Q8UA 4BKZA 1H00A 3MW1A 2O0UA 2UW0A 2ZM1A 4YJRA 4BTMA 4USEA 4Q2AA 3FPMA 4G6LA 1H07A 2R5TA 4WUAA 4OGRA 1M17A 1YW2A 3SLSA 5AP2A 4IAFA 1VEBA 3KRWA 4BGQA 1B39A 4BCQA 4XEYA 3WBLA 3M1SA 4IVCA 4EWQA 4O7TA 2VTRA 4LL5A 4MNFA 2C68A 2X6EA 4FKVA 4U3YA 3VN9A 4KKHA 3KXXA 2Q83A 5IDNA 1F0QA 3EQPA 4WSYA 2O63A 2R3HA 4RLLA 1GZNA 4K33A 5HTBA 4GL9A 4AAAA 3OEZA 2OXXA 2PVYA 3MS9A 1IG1A 1WVXA 2WTJA 3M42A 2YA9A 3COHA 3QD2B 3DU8A 4PDSA 3EZVA 4ZY5A 3W16A 5J9ZA 2P0CA 2JIIA 5DE2A 2PZIA 4RWIA 3GT8A 5IUHA 4FKTA 3F5XA 5CQWA 4YJTA 4I5CA 3GQLA 3D5XA 3QL8A 2R3MA 2W1IA 1ZZ2A 3MWUA 4H3PA 1XH8A 2BROA 5EFQA 4E4NA 1JKKA 3ORMA 3DFAA 2WKMA 1OPKA 3HMPA 2VX1A 3I4BA 4FC0A 3O51A 4RZVA 1ZMVA 5F1ZA 2R3FA 2V22A 5TE0A 2VWXA 2CLXA 4DINA 2WTKB 1HCKA 2HWPA 5EH0A 5A6NA 1JNKA 3RP9A 4ACMA 4GYIA 3ZO2A 1FVVA 3FLQA 4RA4A 5ETCA 5ITAA 3HX4A 3PJ8A 3PVGA 1VYZA 4RIYA 3E5AA 3KF4A 1OZ1A 5AP3A 4DEIA 4NM5A 3HRCA 1Y8YA 2JDTA 3Q4TA 3KMUA 4O0WA 3TDVA 4XP0A 2GFCA 1BI7A 3EN5A 2F9GA 3OCBA 3P9JA 5DRBA 4RZWA 3FQSA 4A4LA 4JR7A 2RSVA 3ERKA 3FLZA 2HZ0A 3PA5A 4FNYA 3FZRA 4GT4A 3DY7A 3M2WA 3SG9A 1H28A 4O0UA 4F6WA 3VUHA 4I0RA 3TNPC 3N9XA 2PE2A 2VAGA 4FKQA 4ZJIA 2Y6MA 1OL7A 1R3CA 2FSTX 2ZDTA 3G33A 3CE3A 3Q3BA 4K77A 5D7AA 4AGWA 2CCHA 1OIYA 3MVJA 4GRBA 2R3IA 3R2YA 5EYMA 2IW8A 3RJCA 2ETKA 3HKOA 3MY1A 3PIYA 4LUDA 4KINA 5J9YA 3DS6A 3HUCA 3ZZWA 2GS7A 5CNOA 1R39A 2VTMA 5CT0A 4G1WA 1YI4A 1OL5A 1P14A 4C34A 1ZLTA 2VN9A 2X8EA 4K18A 4FKJA 4QP2A 4AW5A 3V04A 4U42A 5CU3A 4IIRA 4ANBA 2AUHA 5B7VA 5AAFA 3BBWA 5J7HA 5A4LA 2J0IA 4I41A 4EK5A 4OR5A 3R8MA 4O2ZA 2QODA 3SXSA 5LJJA 4USFA 3F2RA 1PMEA 1KWPA 4HYIA 3IW6A 1JKTA 4E3CA 3LZBA 4XHKB 4IWQA 3EL8A 3KK8A 5FBNC 1QPCA 2JKMA 2BMCA 4DBNA 2CCIA 2JAVA 4RC2A 5CEQA 1WVWA 4B0GA 5CEOA 4HNIA 3Q9WA 1Y8GA 1XBAA 2W0JA 4IB1A 3VJNA 4IE9A 3MFTA 2GCDA 4EONA 2ETMA 3A2CA 2EXCX 5I9ZA 1U5QA 2UZLA 4C4HA 4DHFA 1LP4A 3ET7A 3OZ6A 3QD0A 3AMBA 2UW6A 4RX9A 4XG9A 4BDKA 4AW2A 2P3GX 4ZZNA 2H9VA 4FGRA 5HORA 3BCEA 3W8LA 2OSCA 3BLRA 4A7CA 3NAXA 3BWJA 3F5PA 4JQEA 2ZV8A 3U9CA 4KRDA 1F3MC 3UPXA 2YWPA 3GFWA 2YABA 3PWYA 4IADA 4X3JA 3KB7A 1XKKA 4FTOA 4X7QA 5M09A 4ZJJA 2CKOA 4BFMA 2YITA 3GCVA 3CGFA 5D10A 4KS8A 4XLIA 4RWKA 5AR8A 5C27A 4WHZA 3ZMMA 2CKQA 4BCNA 4EOPA 1H0WA 5M06A 4JOAA 1Q41A 2X81A 3PJCA 3KY2A 4IB0A 3HAMA 4D2RA 4IB3A 2R0UA 3R00A 2CSNA 2OFUA 3U87A 4KUJA 3UO5A 3REPA 4QMVA 1OBDA 2XIYA 3CY2A 4CMOA 4C0TA 4BVUA 5CAVA 5DA3A 5AV2A 3RTPA 3NPCA 4GS6A 4AZEA 5A4CA 1YDTE 4A9TA 3AGMA 4WSQA 2OGVA 3UZPA 4NFMA 4D28A 4IM2A 3NMUF 1KE7A 4BWKA 2R3RA 2P33A 2YACA 2CNQA 2EVAA 3QTQA 3NYVA 2C3IB 4JAJA 4YU2A 3QWJA 3D94A 4K8AA 3VBWA 2VNYA 3S4QA 3AC2A 4TY1A 1J91A 3DBEA 4O96A 3RBWA 3HAVA 1IRKA 1FPUA 5T68A 2EWAA 4FSWA 3F69A 4B99A 3DBFA 3F3WA 5M4CA 3UTOA 1DI8A 3AC5A 3SGCA 2JKKA 3PA4A 3THBA 2BILB 2VWYA 4LG4A 2PMLX 4GV1A 1PF8A 4BDFA 4L43A 1UNLA 5A4TA 2WMXA 4BICA 3BGZA 4C58A 4EUTA 2BTSA 3AC4A 3NYOA 4QMMA 2XM9A 3MA3A 4FKPA 4F6SA 3PDTA 4XYFA 2GS6A 3O8PA 5IF1A 3ENMA 4J96A 2VZ6A 2JKOA 4D0XA 3VF8A 5LCJA 1YHSA 3ZO3A 2IVVA 3DV3A 4ALWA 4D2WA 2O3PA 5FLFA 2JDSA 5I9WA 4AT4A 2W1ZA 3ZXZA 3HVCA 2XUUA 3AC3A 5KBQA 4DGNA 3RCJA 3OCTA 3ACJA 5E7RA 3BU3A 3HNGA 5E90A 4I21A 4NCTC 3VS5A 3S95A 4C7TA 4K1BA 5ACBC 1ZAOA 4EORA 3U6HA 4TN6A 3R9HA 1WAKA 3FDNA 1JSUA 3KL8A 4TYHA 2IZRA 4LRMA 2XH5A 2C4GA 3ZU7A 3PZHA 1OPLA 2BCJA 3QTWA 5I0BA 4E1ZA 2UW3A 5J87A 3R9OA 3LHJA 3F5UA 3MH1A 3QRUA 4BGHA 3COIA 4HVIA 4IAZA 5DT3A 3ZFYA 2WTKC 5HE1A 5JRQA 2RGPA 4YHTA 4CZTA 4D5KA 3HV7A 3ORIA 5CNNA 4F1TA 3ZEPA 3CQEA 3A8WA 4BBEA 5DLSA 1URWA 4CG8A 5HBEA 2QOQA 3R73A 3KXZA 3OOGA 4L6QA 3ZCLA 2JDVA 3NUXA 3GU8A 4G6NA 2KULA 4IHPA 4YC8A 2PMIA 3LIJA 1UNGA 2P2IA 3SOAA 3BHTA 5EKNA 5IQBA 3E8CA 3QCXA 3PJ3A 2BHHA 2BKZA 2W9FB 4Q5HA 3UC4A 2UVXA 1JSVA 2PK9A 1Z5MA 2YLFA 2IPXA 2HW6A 5CWZA 2UV2A 3GU5A 4KRCA 4F4PA
chains in the Genus database with same CATH superfamily
4NTSA 3R02A 2W4JA 3O7LB 3RZFA 4FE2A 4WO5A 5KZ0A 4L7SA 3ZZEA 1QPJA 4FVQA 4JJRA 4BWXA 4C4EA 2OIBA 2HK5A 3VO3A 1PKDA 3R7GA 4NK9A 4X3FB 3AD6A 3NUSA 1AGWA 4QP7A 3EN9A 3GP0A 4KIKB 4DBXA 3QRJA 4MQ2A 2RKUA 3CBLA 3BV2A 5HVKA 3C4FA 2YJRA 1ZYJA 4QNAA 3NUYA 3CC6A 4M0YA 5IUIA 3RM6A 2X2MA 4GUBA 4BI2A 5ETIA 5M55A 3UOKA 3QQUA 3P1AA 3VUIA 5CF8A 3BQRA 4Y46A 1JKLA 4O22A 4CFFA 2C0IA 3SW7A 1O9UA 3ZXTA 1PXKA 5J5SA 3RAHA 3S1HA 3TKHA 4F6UA 3NNXA 5DR9A 3EL7A 5EHOA 2EXEA 5AWMA 3HRBA 2C6OA 3DKOA 4MQ1A 4RIXA 2YM8A 4C3FA 3LM5A 4KBCA 3VBTA 2OWBA 4AXFA 5F95A 5HVJA 5BUIA 4H58A 4JBPA 2W7XA 3FMKA 2OLCA 3DK3A 4YHFA 4ZEGA 3ETAA 3TEIA 2O64A 1XH7A 2Q0NA 1IEPA 4CSVA 3DB8A 3K3IA 5EYCA 3EHAA 3COMA 4F65A 3HGKA 3DBQA 3GB2A 5ANOA 3ALNA 4ZK5A 5E8WA 2V7AA 4GU9A 1UWJA 3LKMA 4QRCA 4W9WA 2VUWA 3L9LA 5DBXA 3DLSA 4ZTNA 3U4WA 3EN7A 3EH9A 4ASDA 3ATTA 1Q8WA 4LV5A 2BZHB 4U6RA 4FTTA 4B8MA 3OTVA 5JT2A 5FEQA 1ZMUA 5FTQA 2B52A 3GXLA 5LWMA 3WE4A 3MB6A 1SNXA 4QT1A 2ITXA 2ZOQA 3NWWA 2IJMA 3G6HA 3QFVA 3UE4A 3FLWA 2BZIB 4B7TA 4ASXA 4CLIA 5IQIA 2HXQA 4RIWA 4O7ZA 3TMOA 4AGDA 4ITJA 3DOGA 2I6LA 2QOHA 3KC3A 3MH0A 2PYWA 5HTCA 1ST4A 2PU8A 4IZYA 5LMKC 2HAKA 1I09A 2C5OA 3JY0A 4KIPA 1W0XC 3AT4A 4ZJVA 4WG5A 4FGBA 1V0BA 3AT3A 5ETFA 3BGPA 2QOBA 2ZMDA 3RWPA 4F7SA 3QKMA 5BVDA 4BTJA 2XK9A 4Z7GA 3VHEA 3EZRA 1U54A 2W5BA 3BYUA 3GVUA 4IWOA 5HIEA 3N4VA 4IWPA 4I6LA 3D83A 5AIRA 2CGVA 4F64A 4OTGA 3QTXA 5FRIA 5KX8A 3F7WA 2QHMA 4MWHA 5JFVA 4BHNA 1M2PA 5CU0A 3DAKA 2C47A 3TNIA 4S31A 2XIXA 5FP6A 3EFJA 3ZLYA 4AN9A 5KMJA 2XRUA 4GVAA 4PP9A 5B0XA 3U51A 2F2CB 5JEBA 4FNZA 3ANRA 2XEYA 2XYUA 2ITYA 3ZM4A 4IJPA 2GMXA 5C8NA 3K3JA 4CT1A 3HL7A 5CLPA 3VNTA 5H3QA 3FQEA 1LUFA 4H1JA 5AUZA 2VWVA 3FI8A 1NA7A 3IECA 5CF4A 3D7TA 3OBJA 3DDQA 2HZ4A 3FWQA 4DG0E 3PJ2A 4OLIA 2XK3A 3NCGA 3I79A 3QQKA 3RKBA 3PWDA 4E7WA 3CQUA 4EC9A 4APPA 4C02A 3DXNA 3DNEA 2R3NA 5L2WA 3P4KA 3CQWA 4TXCA 3DFCB 3QRKA 1OKYA 2ITQA 2KTYA 3ORTA 5GJFA 1LPUA 2ITUA 3SC1A 4FG7A 3TTJA 1JSTA 4B6LA 4CTCA 4RGJA 1TKIA 2J0KA 3FUPA 3VS1A 1OKZA 3FSFA 1HOWA 3LFQA 4GW8A 4I1ZA 4F99A 2R3PA 3GC9A 4IDTA 4TYGA 2JDOA 1UV5A 2Y4PA 3QLFA 2AYPA 3QQJA 1CMKE 3R22A 3EB0A 4G31A 1SYKA 4CFXA 4AA5A 4CVAA 2X0GA 5KKRB 2ETRA 1OGYA 4ZSLA 4DEDA 2IVUA 2XP2A 1ZY4A 4E5WA 4DH1A 5BQ0A 4W4VA 2Q0BA 4YZDA 5HCYA 3VS4A 3R0TA 3VW8A 4QEBA 5DFPA 3Q4UA 3EIDA 1TQMA 1H01A 4XG7A 4FNWA 4XX9A 3TL8A 3LMHA 4RFZA 2C6LA 5AP7A 2SRCA 1QCFA 3QA8A 3VUMA 1Q8YA 3KEXA 1V1KA 1PXNA 2BDJA 3QKKA 1OI9A 4TTHB 2VTPA 3P7BA 4FV3A 2R0IA 1OBGA 5K4IA 1W2CA 5JGBA 4R7HA 2GFSA 4AA4A 4FI1A 4DA5A 1Q8TA 2H8HA 3HECA 3IO7A 3LJ1A 4L8MA 4Z9LA 2Y8OA 2GNJA 1YDSE 2PSQA 2XS0A 2QURA 3B8RA 4M7IA 3FV8A 4O4DA 4PRJA 4FJVA 3O5AA 5CSHA 5KMKA 3GENA 3MPTA 5EI8A 2Y7JA 3FLNC 4BBFA 4FEUA 3O96A 1FGIA 2WMAA 4I22A 2J50A 4XBRA 4CQGA 5TR6A 5GIPE 4EOJA 1OKWA 3L8PA 4RFYA 1YXXA 2RL5A 4G34A 5AV4A 4ANOA 2XIKA 4ORKA 4C62A 3FC1X 4ANQA 4X2KA 2XKCA 4FTRA 4WIHA 3CSVA 3H9FA 3VBVA 1M7QA 1B38A 3KF7A 3PZEA 5AR2A 5HE3A 1PYEA 3HMMA 1GZ8A 2ZB1A 2ITOA 3F9NA 4X3FC 4ANLA 5IA3A 4S30A 4XOYA 5HNBA 1OM1A 2YISA 2OFVA 5DI1A 4LYNA 4LRKA 3P5KA 3PFQA 4EOSA 4ZY4A 4GSBA 4EOMA 2XKEA 5TT7A 5E1SA 3OW4A 3I81A 4KKEA 3VHKA 4E6DA 1WVYA 2R7BA 3QUDA 3IPHA 4ZLYA 1ZYCA 5KMOA 2BPMA 4F0GA 2OH0E 3NYNA 3CXWA 4FF8A 4I94A 4I20A 4QYYA 5CT7A 4FT9A 3DAJA 2QVSE 1BI8A 5I9UA 4AU8A 2FO0A 5KHXA 5KE0A 4JDKA 5T3QA 1YOLA 3CP9A 4BWPA 2Z8CA 2BAKA 3OTUA 4OTQA 3Q53A 2O5KA 4UMTA 2X4FA 4FUYA 4FT0A 4RJ4A 3ZS5A 5F9EA 2ZB0A 3DBDA 4O1OA 3TKIA 4DFBA 4NU1A 3UC3A 2G2FA 2YCQA 3BEGA 2QLQA 3EYHA 4UY9A 4PL5A 3FXWA 4U41A 4BZOA 2VU3A 5CEPA 2JKQA 4GFMA 3R8ZA 3VQUA 2X2KA 3KKVA 2C3JA 3NNVA 4Z55A 3ZC5A 1Y57A 4G3FA 3LXLA 3H10A 4FG9A 3R71A 3VRYA 1PKGA 2CJMA 3AXWA 3HYHA 4LL0A 4J71A 2OZAB 5BVNA 5KNJA 3UDBA 4NM7A 3BQCA 5BYLA 4C38A 4BCJA 4MWIA 4DGOA 2J2IB 4WOVA 3V5WA 3CY3A 4DHJA 4EH5A 4ANMA 2J51A 2RG5A 3BE9A 2CHLA 2ITVA 2V7OA 4FSTA 4O2PA 4U43A 5DOSA 1MRUA 1M2RA 4CV9A 3B8QA 5GJGA 2HZNA 4YBKA 5CSXA 4FV6A 3R9DA 1W8CA 4LDTA 4YHJA 2QG7A 4QP4A 5BUEA 2OJFE 1RQQA 3JS2A 3FKOA 4HOKA 4MBIA 3IS5A 4EH9A 4FTUA 1GZKA 3W2OA 5IA2A 2NYAA 4CGAA 2IVSA 1YQJA 5L4QA 3ITZA 3TT0A 4KIQA 2OBJA 2J5EA 2R7IA 4IB5A 3PXQA 5ACKA 1PW2A 1NVQA 3ZM9A 2XIZA 3FHIA 4DITA 2C5VA 4M66A 4WKQA 2YWVA 4RPVA 2PUIA 2BFYA 2RIOA 4I5HA 3A61A 5J1WA 4FTMA 3LFSA 4YLKA 3TJDA 4ASZA 2QU5A 4MK0A 1XO2B 5M4UA 4DN5A 5BUJA 3WF8A 4EC8A 3QXOA 5E8SA 2CDZA 3IDPA 4IX5A 2JDRA 1XJDA 3UJGA 4A9SA 1PXOA 5LWNA 1AD5A 3IGGA 3Q9YA 3RHXA 3IDBA 3U54A 2F2UA 4MXAA 2UZBA 1IASA 3DJ5A 3KCFA 3MPAA 3ZDUA 1YXTA 4L53A 2PUNA 4DFXE 3KGAA 3PTGA 5FXRA 1Q5KA 2PVMA 3W0SA 2J0JA 4R1YA 4YZCA 4QO9A 5CQUA 3R28A 4J53A 2WXVA 4BIEA 2ZYBA 2I7QA 2WMBA 3ACKA 4A9UA 2YERA 2ITWA 4YZBA 2VTLA 2CMWA 2X7GA 4X0MA 2GHLA 2YCSA 3T8OA 1U46A 4PF4A 1FQ1B 2FSLX 3Q96A 1OB3A 3NUPA 4FKLA 4Q5EA 4DE4A 4O0RA 4XLVA 5BVWA 4RIOA 2E2BA 3HUBA 4RQVA 1PXLA 3KRXA 4GUEA 4TYJA 1MRYA 3WOWA 5CEMA 4IVDA 1G8SA 1MP8A 4PNKA 2VTSA 3NSZA 3OC1A 3H4JA 2WD1A 2C1AA 3H0YA 3V6RA 2PVRA 5HNIX 3O23A 1YKRA 4C4IA 2ITZA 4S32A 4ZTHA 4D0WA 3R30A 2HWOA 5DMZA 1W98A 3CCNA 5KKRC 3CR0A 1DM2A 1Q24A 1ND4A 3MYGA 4ZSAA 3U55A 4QDEA 1NW1A 1YI3A 1G3NA 2YCFA 3MTLA 4ACDA 2BRBA 4EH8A 4C3RA 4FEVA 3EQBA 3RPYA 1NVSA 4D4SA 5LVLA 2JIUA 1GIJA 4BI1A 1DI9A 5I3RA 3AG9A 2UW8A 4HZSA 3HLLA 4FNXA 4RC4A 5TO8A 1YWRA 4RJ7A 1JKSA 3NCZA 3V51A 3W18A 5HX8A 1VR2A 4D9UA 2CNVA 2QO9A 1E1VA 5HLPA 2W17A 3WYYA 3C4WA 5JFSA 3G90X 4EZ7A 5HD4A 3O7LD 1GAGA 5M53A 3SQQA 2BZJA 1OECA 4I3ZA 3GUBA 2VV9A 2XB7A 3HP5A 5CU4A 4BKYA 5HBJA 1LR4A 5I5ZA 3R9NA 3FI4A 4BTKA 1JOWB 3UOJA 2BIYA 3LXNA 1O6YA 2BTRA 3OD6X 1J1CA 3OHTA 2VGOA 3RINA 2HXLA 4IAYA 3UOLA 4R3PA 3VS2A 3K2LA 4EH6A 2XNBA 2YLEA 5EHYA 2ACXA 3W33A 4ZAUA 4WNMA 4ALVA 1UU7A 4IX6A 4WRSA 2C1BA 2YN8A 4YZ9A 2BDFA 4GFGA 3H9OA 3VS7A 4DHIB 2EU9A 2OU7A 4D2SA 2RG6A 2VWZA 5CVFA 5T6KA 4ASEA 3DXPA 2LAVA 3BE2A 4F70A 5AR5A 1IAHA 4F7NA 4IC7A 1FVRA 3VVHA 3A8XA 4QMZA 5M4IA 5A14A 4AT5A 4HW7A 4C36A 3AMYA 3HMOA 4U5JA 4AS0A 2O8YA 5HCXA 5L2SA 4ZS0A 4OTPA 2C6MA 2FB8A 2WFYA 2Y6OA 3VQHA 2PY3A 2XAOA 1UWHA 3EYGA 3DT1A 3CJFA 2X0QA 4M12A 3UG1A 3V5TA 2XEZA 4O4BB 3SXRA 3QQGA 4R8QA 2PUUA 2GPHA 2OJGA 3MVLA 4XCUA 1CM8A 2YHVA 4PL3A 3MH3A 2OKRA 2W99B 3DZOA 3PP0A 2PUPA 4O82A 4JNWA 1I44A 1XR1A 3P08A 4IXPA 1ERKA 2ZM3A 4FTNA 4C4GA 2XA4A 2JITA 5A3XA 3QHWA 4AACA 4O91A 1Q97A 2VX3A 2W5HA 4AOIA 4KNBA 3WF6A 1K2PA 4AW1A 5CI7A 4O84A 5JGDA 3NRMA 4FIEA 1PRYA 2B9HA 4IVBA 3H30A 4EHEA 3C0HA 4FKOA 3W1FA 4RBLA 5M51A 3BV3A 5TF9A 2QLUA 3DLZA 3PG1A 4UMPA 3NNWA 1BL7A 1TFFA 2JFLA 2WOTA 3BHVA 4EH3A 2ZAZA 2BRHA 4LMUA 4DCEA 4CKRA 4Y5QA 3E3PA 1ZOEA 4U80A 3WYXA 2HIWA 4KIKA 3D5VA 4UALA 4EH2A 4RA5A 3R6XA 3HV3A 2F4JA 4RX8A 2AQXA 2BUJA 3OFMA 3UIMA 4JMQA 4JS8A 4YO4A 5G1XA 4L01A 4OTDA 4LUEA 3LLAA 5IQCA 4PDYA 4NW6A 3LJ2A 4GMYA 3VBYA 1VYWA 3TZ9A 5CU6A 2WIPA 4CMTA 4FKRA 4BJJB 4BY9E 4ERWA 5EM5A 4F7JA 3AC8A 4FV4A 2WB8A 4YURA 2I0VA 3WZEA 4DG3E 1W2DA 4YGAA 4ZXTA 2IZTA 3R63A 4N6YA 3TZMA 3R7OA 4JL9A 5J8IA 1ZRZA 4PNIA 3MVHA 2GQGA 4YPSA 5IQAA 4CZUA 3GI3A 4E4MA 4DCAA 5CY3A 4BKJA 5CSPA 3LJ0A 4K6ZA 4YJOA 4IJ9A 3TWJA 1W2FA 2Z02A 4YJNA 1YVJA 4EOQA 3GCSA 5BYZA 3MIAA 4RC3A 5JK3A 4ZSJA 4G3DA 2WMSA 3B2TA 4U40A 1PMUA 3PXFA 2ZJWA 4MXOA 3GOPA 3UNKA 1O6KA 4HGSA 2VX0A 5JRSA 4ENYA 5CXHA 3W0QA 4WBOA 3GEQA 4LOQA 2BIKB 2P2HA 3D0EA 5AA9A 3LPBA 1FBNA 4EH7A 3LAUA 5AP6A 3ID6C 1F5QA 5EM8A 3BL9A 3UVPA 3KN5A 4QP9A 3C5UA 1SZMA 4CFUA 4CCUA 4NWMA 5AV3A 2WMUA 4DEEA 5LMAA 3Q5IA 5IH6A 2X7FA 2W96B 3Q32A 3SAYA 4BL1A 2WEVA 5AEPA 3M11A 3FBVA 2C5NA 3E7VA 3POOA 4I24A 4C35A 3GC0A 1GJOA 3FMDA 4ZTMA 4OTRA 2IW6A 4I23A 2GNFA 2F57A 4QMSA 3H0ZA 3MFRA 2G01A 4AOJA 5JKGA 4O7LA 4M69A 1E1XA 2F7XE 4QYEA 1DAYA 1XBBA 4H39A 4Y8DA 1P4FA 4BHZA 1PJKA 3PG3A 2J90A 3DK6A 3NNUA 4OTFA 4ZIMA 4BBMA 3IW5A 1KE5A 3AMAA 3VUTA 4BDHA 4G3EA 2Y9QA 2CN5A 4FZAB 5HCZA 3P7CA 2CGUA 5D1JA 3HV6A 5JH6A 4FV2A 4FV7A 4E20A 3IK3A 4JG7A 3RPRA 3BHYA 1E9HA 4FV9A 1Q62A 3QRIA 4M0ZA 4S2ZA 1T45A 4EKLA 3E63A 1J7UA 5AMNA 4CD0A 3BHHA 2V0DA 4RJ3A 4M13A 4I0TA 2IEWA 5KMLA 1P4OA 4U7ZA 2BR1A 3ZEWA 2GHGA 2J0LA 4BCGA 5HESA 2AEGA 3VJOA 3C4EA 3DQXA 4QQ5A 4NT4A 1IA8A 3P78A 4IZ7A 1W82A 3UOHA 3L9PA 5HX6A 3ZFXA 4TKSA 2PZPA 4AQCA 3C9WA 2ONLC 3A7FA 3UMXA 4MXXA 4BCPA 3SA0A 1UU9A 2QKRA 4QYHA 4CTBA 4ZZMA 1SVGA 3NUNA 4IVAA 3MH2A 3KRRA 3MSSA 5DEYA 2PZYA 5E92A 3HV5A 5D41A 2CLQA 3BYMA 4FKWA 2DS1A 4RVTA 4O0YA 3QUPA 3JXWA 3D5WA 4U8ZA 4UBAA 3MFSA 3G2FA 4GU6A 1MUOA 2R9SA 2OO8X 4IX4A 1J7IA 3QGYA 5CAPA 2C69A 3HMIA 4FSYA 3F2AA 4M67A 4MYGA 4Q9SA 4M8TA 3EFWA 4DEBA 4KD1A 4PMPA 3DKFA 2CGWA 1BX6A 3E62A 4KAOA 4C3PA 4V04A 3DAEA 4GT5A 4YJSA 2VD5A 5HGIA 3W2CA 4EEVA 2Z7LA 1MRVA 4ACHA 5CANA 3R2BA 3BIZA 4TYEA 3IG7A 4MX9A 4JDJA 4RIYB 5EHLA 4FV8A 3U8WA 1GIHA 4CV8A 2ERZE 2VTIA 2XF0A 4LV8A 2IWIA 4N70A 4UMRA 3FY2A 3QX2A 4IFGA 3TUDA 3ZSHA 1IR3A 1STCE 5A9UA 5L6PA 5EYDA 1KV2A 4ZLZA 1A06A 3QLGA 3KRJA 5E4HA 1Z57A 5IKWA 1CTPE 1YHWA 2PVLA 2YEXA 1M7NA 2A1AB 4WNPA 3TV7A 5D11A 5CAOA 4W4XA 1WBOA 1OGUA 3C4ZA 4PY1A 4AUAA 4E4LA 4UZHA 4ENXA 4B4LA 4GIHA 4QQTA 4RVMA 4ZTSA 1ZZLA 3GQIA 2Z60A 2WAJA 4GK2A 4WD5A 4C57A 4D1SA 1IA9A 3CS9A 4O86A 2REIA 3W32A 4MD9E 5HZNA 4W4WA 2EB3A 4PPAA 3DDPA 3FZOA 4H05A 1Q99A 4EOIA 4XP3A 5B2KA 3AKJA 4PQNA 3I6UA 3ATSA 3FHRA 3ZRMA 2X0OA 1AQ1A 1EH4A 4QPAA 2XNMA 5C1QB 1FINA 4AZSA 1U5RA 4QMOA 2UZEA 2JAMA 5E9EA 3JUHA 2XAMA 2CKEA 3ENHA 2J5FA 3WIKA 4BIBA 4CKJA 4IH8A 1H24A 4R6VA 2IVTA 1KOAA 2OJIA 5AUWA 3UIXA 2JBPA 2PTKA 3OF0A 2J0MB 3FZ1A 4AX8A 4FIHA 1XH4A 3ORLA 5BVFA 4BCFA 4LOPA 3MJ1A 5ANIA 3VF9A 3P0MA 3V3VA 5CXZA 5DT0A 5FXQA 3RAKA 4U97A 3VBQA 3OWKA 3V5QA 3PA3A 2RFSA 5DT4A 3R8PA 4A9YA 1Q3DA 3V8TA 3IKAA 4FIGA 1SVHA 1FMKA 4R7IA 3R1SA 3OS3A 2G15A 3PLSA 4RX7A 2XCKA 1WBPA 4UMQA 2QNJA 4O0XA 4JVGA 3W0RA 3BU6A 2R3LA 3A99A 2PVHA 2ITNA 3IW4A 3KFAA 4JAIA 4LGHA 4LOOA 2GTMA 2BALA 4FTQA 1NY3A 4R5SA 4Z3VA 5J9LA 2OG8A 3LMIA 2JC6A 3F7ZA 4JDHA 4LI5A 2WMVA 5C4LA 1UKIA 2BRNA 2WMTA 2QOFA 2YCRA 2PMNX 4QP8A 3UIBA 4CFVA 4DEGA 3DJ6A 5EW8A 2XCHA 2B54A 4IDVA 3F6XA 4CT2A 1Q8ZA 4BDCA 3BLAA 3D5UA 2E9PA 3PXZA 3ML1A 2BKKA 4RVKA 1JPAA 1Y6AA 3K5UA 2YIQA 4G3GA 3AD5A 1K9AA 1IAJA 2FYSA 2ESMA 4QPMA 2XJ1A 2HCKA 3NIZA 4FT7A 2OZAA 4W8EA 4I93A 5IQGA 2XK6A 1BLXA 3UQGA 3W2QA 1T46A 3IW7A 4PPBA 5L3AA 5IQFA 4F9CA 1H1SA 4XOZA 4DGMA 2OH4A 3GOKA 3RNYA 3QAME 4YUQA 3ZRKA 5FTGA 2C30A 1DAWA 2WPAA 4P5QA 3RAIA 5F20A 4QMPA 3HV4A 3L1SA 3OWLA 5KMMA 1GOLA 1W7HA 4FK6A 4BGGA 2VO7A 2VO3A 1PY5A 3UNZA 3WZUA 2HY81 3R7EA 5C8KA 3FI3A 1P2AA 3BU5A 2B4SB 4HVDA 3V5JA 5EI6A 2QU6A 4KABA 2VWBA 5AP4A 5GINE 3KVXA 4YZNA 4EK8A 1R78A 3NW6A 3PYYA 4QMTA 4HJOA 1TQIA 3FLSA 3PVBA 5DVRA 1A48A 3ZTXA 2XK4A 1J7LA 5E91A 4CMUA 3ZOSA 3FMNA 4HPTE 1FGKA 5BYYA 5DGZA 2CGXA 3QQLA 1PXMA 4BCIA 2WTIA 4DFNA 1YXUA 4XUFA 2YM6A 4O1PA 3Q52A 3QC9A 2AC3A 4NKAA 2UW7A 4XH6A 4QMLA 3ZBXA 4DLJA 2JLDA 2IG7A 3BI6A 2UZWE 3C13A 3EN4A 1QMZA 1R1WA 3LQ8A 4J52A 4WG3A 3OY3A 3FXXA 2UZOA 4X2JA 4JQ8A 5M57A 4DH5A 2QOIA 5EQEA 2VWWA 4CEGA 2UZUE 4C4JA 2A27A 1BMKA 4FOBA 3CIKA 5CAQA 5AUXA 4HPUE 4PDOA 4R3CA 2WGJA 3FMHA 5FEEA 2VGPA 2WQBA 4K2RA 5HBHA 4TNDA 3LFAA 4YPDA 3TKUA 3TTIA 3Q9XA 2EXMA 4IC8A 4L3LA 4OW8A 4P2KA 4G5PA 4MTAA 1M2QA 4D1ZA 5EDQA 3IGOA 3F3UA 4QMYA 3R7VA 1VJYA 3EKNA 4ARKA 1YDRE 4UYNA 5AIKA 2W5AA 4D4YA 3MIYA 5H8BA 2C3KA 3ALOA 4QTCA 4NIFB 4YJQA 3RCDA 3CEKA 4GVJA 3W0MA 3PY3A 2HELA 1TVOA 1UNHA 3FKNA 4O7RA 3QTSA 3NW5A 3F3VA 3QX4A 4E93A 2PWLA 4XNEA 5HO8A 4UZDA 1YWVA 2NRUA 3P23A 3SXFA 3ZSIA 4D4RA 5BMMA 4E4XA 1G8AA 4C2WA 4M3QA 3UQFA 3GCUA 4I6QA 4TYIA 5GHVA 3PP1A 4FA2A 4FIJA 4L7FA 4RX5A 4YBJA 2YIWA 3NS9A 3NYXA 4L67A 2CNUA 3R04A 3ORKA 4FEWA 1JWHA 3A7IA 4D9TA 2GQRA 2BDWA 4MF1A 4NW5A 3DCVA 3OUKA 5CU2A 5C9CA 3TI1A 4DTKA 2B0QA 3QALE 2QONA 4L3PA 4LM5A 2J6MA 4O7WA 4FSQA 4ACGA 2HENA 1XBCA 1LEZA 3ODZX 2FSOX 5TKDA 1OL1A 1UVRA 3L9MA 2WU7A 3FZSA 2A98A 2HY0A 3UDTA 4HVHA 2W1CA 3KVWA 3VBXA 5JQ8A 1VZOA 4FSZA 3WE8A 4XG4A 4JBQA 4NCTA 2P55A 4O6EA 4WNOA 4A4OA 2X9FA 1NVRA 3E64A 2UVZA 5ANGA 2YDKA 3Q9ZA 2IZSA 3VS6A 5KO1A 4I5PA 5LXMA 4FV1A 3BWFA 3OCSA 4XMOA 5KZIA 4E5AX 2XIRA 2UUEA 1RW8A 4FSRA 1JLUE 3R83A 4BYJA 5HIDA 4DC2A 5K9IA 2W4KA 4O38A 4EOLA 4E6AA 5GZ8A 4MD8E 4CCBA 1PMVA 2G2HA 3WF9A 4DLIA 3ZUUA 3S2PA 3KXGA 3D4QA 4O27B 4EUUA 4NUSA 4DHZA 2O2UA 3C4XA 3U4UA 1RDQE 4DEAA 3EJ1A 4J98A 4PDPA 3V8WA 3R8UA 5BVKA 4L46A 3VAPA 4YSJA 4RIXB 4PPCA 2OF4A 3MGYA 3JY9A 5CVHA 4FZFB 5FDPA 3DJ7A 4J7BA 2FA2A 5HG8A 1URCA 2WIHA 2PMOX 2OJJA 3BRBA 3CTHA 4I6BA 3DQWA 3MVMA 5AM6A 4AFJA 5I9VA 3G0EA 1PXPA 3P5JC 1G5SA 3T9TA 4JRVA 5KBRA 5DIAA 3VS3A 3AQVA 2OJ9A 3OXTA 3RM7A 3UO4A 5M44A 5CAUA 2C6EA 2O65A 3A4OX 2BHEA 3AOXA 4M14A 5K0KA 2VTNA 4FVRA 4GG5A 1WCCA 3RMFA 1HCLA 5EM6A 5IEXA 2W4OA 2JIVA 5IU2A 3HMNA 1DS5A 4NJ3A 1APME 3CLYA 4FX3A 3CTJA 4IX3A 3GCPA 4NZWB 2QD9A 4X6QC 3CKWA 5J1VA 3UMWA 4O4FA 5FWKK 3C4CA 2I0HA 5AX9A 2F7EE 3N4UA 5LVNA 2I40A 4KBKA 4G9CA 3UPZA 3LCTA 4D58A 4O0TA 3LCSA 4JT3A 4DF3A 1MQBA 3TNWA 2OF2A 2BRGA 3EKKA 5CZHA 3TIZA 2WQOA 4RMZA 3NAYA 4NM0A 5I4NA 3OUNB 3JYAA 4KIOA 1PXJA 3COKA 4HGEA 4AXCA 3BLHA 4FV5A 2CKPA 4LV7A 2E9VA 1Z9XA 2XYNA 4ZSGA 2B53A 4C33A 2BAQA 5K5XA 3HZTA 2GNGA 3F61A 3HDMA 2GQSA 3C51A 4AP7A 3D2IA 4LQMA 5HHWA 5FM2A 2ERKA 3KN6A 4BJJA 1ZXEA 4FG8A 4MBJA 4WBBB 2XNOA 2FUMA 4Y95A 5EOBA 3ZBFA 2G9XA 3UG2A 3TUCA 4J8MA 2QQ7A 3BLQA 3PXRA 4H3BA 4MXCA 5J5TA 2X8IA 2XM8A 4FTCA 5HG7A 1KV1A 3I7CA 1JVPP 4YC6A 3H3CA 4OBQA 2Z7QA 2J4ZA 3FMMA 4FEQA 2VTOA 4RWJA 4PP7A 3E87A 4ITHA 4F63A 4FL3A 5H8EA 4APCA 4X21A 3FPQA 3TM0A 5AX3A 1OUKA 5J7BA 5EW3A 4FSNA 5EK7A 3A7HA 2A4LA 4JIKA 1YOJA 5AR3A 5LMBA 3UZTA 4S34A 4OAVB 5CF5A 1ZYLA 4F08A 4OTIA 2PL0A 4JBVA 2WTCA 5A54A 3FMLA 4FSUA 4BCMA 5FQDC 4Y73A 3W0PA 5M56A 4I6FA 2FH9A 2W1HA 3MTFA 4QYGA 5DHJA 4GKIA 4BF2A 2XNPA 4J99A 4OTHA 3TZ7A 3KXNA 3OMVA 5KCVA 3I60A 5LMKA 1G8KA 4TNBA 1CKIA 1XH9A 2XNGA 1ZYDA 4ZMEA 4GEOA 4TWNA 3GFEA 3SRVB 3U6JA 1XMLA 4AZFA 5BPYA