3L9PA

Crystal structure of the anaplastic lymphoma kinase catalytic domain
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
308
structure length
303
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Anaplastic lymphoma kinase
publication title Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 303
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3l9pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3l9pA01
1REKA 4K8AA 3COMA 3MN3A 1AQ1A 3FLZA 4MXOA 3E92A 4G9CA 3EQIA 3HV7A 2QOOA 5DEWA 5HBEA 5LOHA 3ANQA 4C8BA 3O8TA 4YJQA 3OBJA 4RSSA 1P14A 3PXYA 2WTVA 4FGBA 4BCOA 5EKNA 3LMIA 5IQHA 5DRDA 3NS9A 3EMGA 4N0SA 5F9EA 1URWA 3V5WA 5IA4A 1XO2B 5KZIA 2QOCA 3WYXA 5EM7A 4USFA 3DA6A 5E8ZA 4ZTQA 2OXDA 2B7AA 3RCDA 1AGWA 2VX1A 4O0YA 1R39A 1DI8A 5ETAA 1ZYLA 3R7UA 4WNMA 2YM6A 4FKTA 4PDSA 2REIA 2I6LA 2PMLX 2R3HA 4OTQA 2IZTA 3GOKA 5C4KA 3MS9A 3CEKA 3PVUA 1Y8YA 2ZJWA 1O6LA 3KU2A 4B7TA 4RIXB 3CY2A 1NA7A 2HWPA 1HCLA 5BVNA 3AC2A 5CSVA 4A9UA 4I92A 1GZOA 2V0DA 4DG3E 3DGKA 1LPUA 2OJ9A 1WVXA 4X3FC 5EYMA 3DB6A 3TIYA 4FEXA 1NY3A 5D7VA 1NVQA 4D2RA 2EUFB 2RG6A 2YM3A 5IQIA 1W98A 2G1TA 4HCUA 4FSQA 2ACXA 3DNEA 1Q62A 3U4UA 4BFMA 4JI9A 3O51A 2YWVA 2XIKA 4O7ZA 1XBAA 4PTGA 4S30A 3V5LA 3OT8A 4AW5A 4I6FA 3TZ7A 4WHZA 1ZOGA 5I9ZA 3I81A 3ETAA 4LYNA 3QQKA 5D7AA 2WOUA 5HIBA 4RWJA 4L3PA 2HZNA 5IUHA 2PZRA 4XG9A 3PWYA 2J5FA 3DAKA 4G3EA 1BMKA 5K3YA 3BHTA 4BWPA 1YRPA 2R3KA 1XH9A 4BHNA 4PRJA 2YIQA 5LMBA 3O50A 4UMPA 1G5SA 3CKXA 2H34A 2ZDTA 3IW5A 3LFFA 2J0KA 5HNGA 2ITNA 3EKKA 3NIEA 5C27A 3R7EA 3CP9A 2A1AB 3EN5A 2ZYBA 3LCSA 3SC1A 3RHXA 1XH5A 3NUNA 4FZAB 5ANJA 2QR8A 1ZYSA 4PMPA 3I0QA 2ONLA 3VNTA 2F49A 3R1YA 4B8MA 3VUMA 5KMJA 4HW7A 4D2TA 4DGLC 4KKGA 4USDA 1YXSA 2ITPA 4HZSA 5I3OA 4D2WA 4EUUA 3G6HA 4CMUA 3LVPA 4M0YA 4RIWA 3VUKA 4XBUA 4I0RA 3UOHA 3MPMA 5HE2A 1Q97A 5HORA 3K3JA 1PXIA 3QTZA 3NNVA 2BRGA 4EK6A 1RQQA 3BKBA 2J0LA 2CCHA 1JNKA 2XKDA 3HRBA 4AZEA 4S33A 5ICPA 2WKMA 5CY3A 1YWRA 1YOMA 4D4SA 5HU9A 4FEQA 3AGLA 3CD3A 3NUSA 4DLIA 4IVCA 5TF9A 5JRQA 2IZRA 2E9NA 3HP5A 3CQEA 3FMHA 4Q9SA 4X6QC 3VWAA 1JBPE 4O83A 4GSBA 1UKIA 4BDJA 2CMWA 3I5NA 5J5SA 5TO8A 4FTRA 4CVAA 2PZPA 2YLEA 5A4CA 1IR3A 4XRJA 4DH7A 4K77A 4CG9A 3TL8A 1NVRA 2F4JA 4EORA 4JR3A 2OJFE 3D83A 1IA8A 3RVGA 4KWPA 4E4LA 4EJ7A 3BIZA 2BAQA 4D5HA 3VW6A 2BMCA 4M3QA 4MNFA 3QZFA 2EWAA 4U9AA 4YC3A 4C4IA 4BCPA 1WCCA 2NPQA 3HRCA 5J9ZA 2ZB1A 4H58A 4MVFA 3M2WA 1E1VA 4G17A 5IDNA 3A61A 3KF4A 4A07A 3F3UA 3A4PA 3SOCA 2VWUA 2WELA 3UVQA 4DEAA 4XV2A 2FO0A 1H1WA 3T3VA 5CF8A 2IW6A 2E9UA 3A62A 1WBSA 4NH1A 3FI2A 1UVRA 3ULZA 4EWQA 4DBXA 3CLYA 2WEVA 3NAYA 4GFMA 5HBJA 4II5A 3QQFA 3TKUA 4TL0A 2W1DA 4QO9A 3KULA 3OF0A 4UZHA 4FA2A 2R3QA 2VTSA 3MTFA 4D58A 4QP1A 3KRWA 1M7NA 5EDQA 4F9BA 4FV8A 3BZ3A 4YJRA 1YI3A 3QTWA 4JBQA 2E9PA 4EONA 1Z9XA 1VYWA 1MRVA 4E7WA 1KSWA 1I44A 2BZKB 4FKUA 5K0KA 3QLFA 5KHWA 3Q04A 1YDRE 2FSMX 4I6HA 2C6LA 5EQYA 3MY5A 1PKGA 2IJMA 4BCFA 2X7GA 1UNLA 2BROA 4RFZA 4I5MA 2BVAA 3G90X 4EHGA 5HU3A 3KMUA 5HCYA 4OT6A 5KZ0A 3UPXA 1PXNA 1QPCA 1X8BA 3GNIB 4OBQA 4XLIA 1IEPA 4X21A 4CEGA 3E8CA 5IQEA 4O21A 4QMWA 4M69B 3V8SA 2F57A 2WTKB 3OOMA 4LG4A 3WILA 4AFJA 5LMKA 2VTMA 3UNJA 3TDVA 4F1OA 4MEDA 5AUTA 4ZY4A 3IW7A 1KE6A 1UV5A 4CYIA 2UVXA 1PXOA 3HP2A 2ITOA 3ELJA 4FL1A 4IX3A 3FHRA 4QQJA 5CSXA 1J3HA 5T3QA 3ZS5A 4C7TA 3NNXA 1M17A 1ZYDA 2ITVA 3PVWA 4FG7A 2WFYA 2PSQA 2CN8A 3BE9A 4J8MA 4WSYA 3U9NA 4C2VA 4DG0E 5JFVA 2UW5A 5M07A 4F64A 1H4LA 4JIAA 1PKDA 2JBOA 3D5UA 4NYEA 4BHZA 2HYYA 4L9IA 3L9NA 4BRXA 4FEVA 1KV1A 2VO3A 4NT4A 4QRCA 3H30A 4ASDA 2BIYA 3QXOA 2Y4IB 4RLLA 3RZFA 4F6WA 3GU8A 4TYJA 5IH6A 3G6GA 4FT5A 1BI8A 3CJGA 2WU7A 2VWWA 1OIYA 3BQCA 3JVSA 3PIYA 4UBAA 2IZSA 4GUBA 5HCXA 3BGZA 3C0IA 4BYIA 3R04A 4GVAA 3BLHA 1UNHA 2XJ1A 4R6VA 3BGPA 4U40A 3E64A 5AIRA 5E8TA 5KBQA 4AF3A 4HYHA 4IWQA 4FSZA 4I5PA 2ITXA 4W4XA 4AQCA 3DV3A 4IM2A 4EOLA 1APME 3BELA 4TY1A 3P0MA 5AV0A 4RMZA 3RWQA 2J9MA 2CLQA 5J79A 4KBKA 5H8GA 4J99A 5JGBA 5CNOA 4R3CA 4G9RA 1JWHA 5CASA 2V55A 3Q9ZA 3LCOA 5A54A 2VAGA 2AUHA 3LXKA 3VAPA 4BWXA 1NXKA 1CDKA 3GCVA 5DLSA 4EKKA 3SG9A 3SRVA 4M66A 4PWNA 4MAOA 2VN9A 1YXXA 4J8NA 5CANA 2P55A 1JKLA 5LARA 1FOTA 1OVEA 2HY81 3FKNA 4J98A 4QMLA 1GNGA 5DT3A 4LMUA 5CQWA 2C4GA 3WARA 3WBLA 3EYHA 4DFXE 5JH6A 4L7SA 4FV6A 4B9DA 5K0XA 5E9EA 2HCKA 3IW8A 3KQ7A 4G3FA 5GIOE 1XBCA 2R9SA 4AW2A 5HTIA 2FSOX 4ZEGA 2J0IA 3BYVA 5JMSA 4ANLA 2BIKB 3BV3A 3QA8A 3PXFA 2VTIA 3PA3A 2GPHA 3NNUA 3FYKX 2JD5A 3R22A 4YSMA 3Q96A 5J95A 1K9AA 4BGQA 3P9JA 1DAYA 5M57A 4BCNA 3PG3A 4OAUC 4FSWA 4CFWA 2RF9A 3QA0A 3QD3A 3QD4A 4Z3VA 4KD1A 2R7IA 4GV1A 3DK3A 3D7ZA 1MRYA 3KB7A 2XNMA 5AX3A 2QLQA 3W33A 1ZOHA 4YC8A 4AT4A 4AW1A 4F6UA 2CKQA 1H07A 4RVMA 4N57A 3FMDA 4O0SA 4CV9A 3I79A 4FYNA 4P4CA 5L3AA 5BVWA 3VUGA 4ZJVA 3ZBXA 3FXWA 1KE5A 4G2FA 3ZM4A 2BFYA 3EQRA 5A46A 3ORLA 1IG1A 4UN0C 3C4CA 4IHPA 2OFUA 4O7LA 5H3QA 5J5TA 1DI9A 4AZWA 4XV3A 3O2MA 4KSPA 2XYNA 3ZCLA 4MD9E 1JKKA 1GZNA 3QWKA 5CEMA 4L46A 5EM8A 3ZBFA 5DNRA 5H8EA 4BDKA 3COKA 2PE2A 3F88A 3KC3A 4QMTA 5FP5A 3VJOA 3I7CA 4F63A 3CTJA 5BPYA 3MH3A 3CD8A 1R78A 2XJ2A 5E4HA 3Q9YA 4GU9A 4NTSA 4HVDA 3AC3A 3FI3A 3ROYA 3TV7A 1YQJA 3FC1X 4ZTRA 4O91A 4XV1A 3D7TA 4EHZA 5K9IA 5H8BA 4EK3A 2BKKA 1H27A 4HVHA 3LFQA 4MXYA 3KRLA 5C1QB 1OKYA 3VS2A 2RG5A 3QKMA 2GNJA 4IADA 5CWZA 2JGZA 2NP8A 3MESA 3IONA 3D14A 5J9LA 4RWIA 3W2RA 4EH5A 3LE6A 3PVGA 1JVPP 5EHLA 2C6TA 2CKEA 2QC6A 1V0BA 1KOAA 3PSDA 3LXLA 4CQGA 5JGDA 5CI6A 4NFNA 2P0CA 2YN8A 4FV2A 2OFVA 5IKWA 4D0XA 3GB2A 2YM4A 3HLLA 3UIBA 5E1SA 3LJ0A 3NNWA 2XBJA 2RIOA 2BRNA 2R3OA 4E93A 2XH5A 4O7YA 3QGYA 3FQSA 1L8TA 5DT4A 3L1SA 2X4ZA 3O17A 3LLTA 2HZ4A 2V5QA 4E6CA 4F70A 3LFNA 3NZ0A 5HKMA 1Q8ZA 4EOMA 2KTYA 4JX3A 4QMXA 3WF8A 4CV8A 3ZYAA 3KREA 3MYGA 3QCSA 4JX7A 4KIKB 2VTQA 4XNEA 1DAWA 5E8SA 5AAFA 4IJ9A 1SZMA 2HAKA 3DBQA 3E3PA 3PY1A 4HYIA 4NUSA 4QQCA 4U42A 5ACBC 4AA5A 4ANMA 1YOLA 4K9YA 3VO3A 4IH8A 4A9TA 3C5UA 2B0QA 4GCJA 4I0SA 4MBLA 3OS3A 3MFRA 1WVYA 3MVHA 2PTKA 3R71A 2FYSA 3OWPA 4XG2A 5B2KA 3VC4A 4GH2A 4JT3A 4XG6A 5GZ8A 1BLXA 4KRDA 4IAYA 4O1PA 5FWKK 4ZSEA 1JSTA 3V01A 5C26A 5L2IA 1U54B 3LXNA 5LVPA 2P33A 2BUJA 3ZUVA 4ZSJA 2HENA 5AP1A 4G3GA 3NUYA 3ZOSA 5E90A 5CNNA 2F2CB 4OBPA 2ITWA 3A2CA 3OBGA 1Q5KA 5ETCA 3VBWA 4TYHB 3DK6A 2JDTA 5J8IA 4A9YA 2R5TA 2HWOA 4AGUA 4GS6A 2CGXA 4I94A 4BCGA 5AP4A 5FEQA 4CGAA 4OBOA 3ZSGA 2EXCX 2HIWA 2VD5A 3PJ8A 2EU9A 4V01A 3RAWA 3K3IA 4OT5A 4QTCA 1QMZA 2XKFA 1ZMUA 3DK7A 4PTEA 1FBNA 2CNVA 3G5DA 3ZEWA 2J90A 4O96A 1SVHA 4WG5A 4JG6A 4CKIA 2R3FA 4MBIA 5B2LA 3GUBA 4KKHA 4WRSA 3ET7A 2IZUA 2H6DA 4KUJA 4FKWA 2XIYA 5D10A 4EOOA 3PDTA 2PVLA 3OUKA 4YNOA 3MB6A 1KUTA 2F7EE 4IAIA 5J87A 4OTDA 4ZLYA 5LCJA 5DR9A 4XP0A 4ZAUA 3F61A 3ORXA 4FZ7A 3E93A 4YLJA 4GL9A 4RIOA 4QYEA 3PP0A 3DQXA 3NUAA 1H1QA 3DCVA 1GIIA 3FLNC 4RC3A 3L8SA 5FEDA 2VV9A 4DGGA 5C8NA 3A7FA 3CPCA 3ZDUA 2IVSA 4GU6A 4JLCA 4MD7E 3NMUF 5FTOA 2W9ZB 3QTQA 4U3ZA 4O86A 3IECA 2C30A 2ZV9A 3P7CA 2JLDA 3EFKA 5DR6A 4JDIA 4ZTNA 1IA9A 1QPDA 3R02A 4QQTA 4QOXA 3IDCA 1WBTA 4FKPA 3MJ2A 4CFXA 1CTPE 3ORNA 3HMIA 4ZOGA 4RJ8A 5ETFA 4ZMEA 1U5RA 4GKIA 2LGCA 3UG1A 3C4ZA 2G2IA 2KULA 2OIBA 4R77A 3P1AA 3QTIA 4G6NA 4OTFA 1RE8A 3ZTXA 4E5BA 5IU2A 5DPVA 2UZVA 3QAME 4NKSA 3EFLA 2YM8A 3EKNA 2NRYA 4IZYA 4QP6A 1Q3WA 2BCJA 4FTUA 4O0VA 3W55A 3RAIA 2I7QA 4D1XA 4D55A 2JBPA 3VQHA 4HPTE 3M42A 3H10A 2Y6MA 4G34A 4E1ZA 3T3UA 1VZOA 3II5A 1FMOE 1PXPA 4S2ZA 4WNOA 2JEDA 4L3LA 3IG7A 1R0PA 2W1ZA 4AOTA 4R5YA 4BTFA 4EEVA 2R3RA 1H01A 3QRJA 4N4SA 3IW4A 2J0MB 4FGRA 5E7RA 5C4LA 2OH4A 4FTJA 2XK7A 2I0HA 2BRHA 4PQNA 2W1GA 3P86A 1H08A 3EOCA 3EFJA 4K0YA 4RIWB 2OKRA 5EHYA 3KVXA 5D41A 5B7VA 4DTBA 4CG8A 2BRBA 4GT5A 4IX6A 5CF5A 4KNBA 3VVHA 3W18A 4MF1A 4AAAA 3Q5IA 3PTGA 1RJBA 1BX6A 2XEYA 4IWDA 3R01A 5ACKA 3UIUA 1XH7A 2XNEA 1Y91A 3DNDA 2O63A 3KEXA 3PXZA 5AV1A 4O7NA 4UB7A 2DS1A 4DT8A 2VWIA 1OKZA 4PMTA 4F9YA 1H25A 2W17A 1GIJA 4DEGA 4YHTA 3OOGA 3VF8A 2WU6A 4DC2A 4EH9A 3NYNA 1K3AA 3GQIA 2V7AA 3E88A 4RJ4A 2OIDA 2QO7A 1XWSA 3QUDA 1KV2A 3MDYA 3DXQA 2Z2WA 1KOBA 4PP7A 5JEBA 3QRKA 2W1FA 4YPSA 4E6QA 3VUHA 2UW0A 3QQHA 4IAZA 4TWPA 3AT3A 3QBNA 4E26A 2YJRA 5JFSA 4U81A 4P2KA 2PL0A 4F08A 3BYSA 4BIBA 4Y72A 5H9BA 4O0TA 5LWNA 3HRFA 1WBVA 3O0GA 1ZAOA 3TEIA 5IH5A 4E4XA 3C13A 5GJGA 3HMOA 4NM7A 4QMZA 4DTAA 5HZNA 4IEBA 4AX8A 4UMQA 1OITA 1FQ1B 4L45A 2X6EA 2BDFA 4BL1A 2Y4IC 4X7QA 4U3YA 1PYEA 3G2FA 2H8HA 2XK9A 2O3PA 3BBTB 3QTUA 5HNBA 3R28A 3G15A 5AUVA 4RX7A 2XCHA 4DG2E 2WNTA 4YUQA 2GFSA 4MXAA 3DFAA 2R3PA 2QHNA 3V51A 5ANDA 3C0GA 4J52A 4FV4A 5CSHA 3V5QA 4NK9A 2PVFA 4BCIA 3ODYX 4NTTA 4P90A 1Q41A 5I4NA 1UA2A 1DS5A 3EL8A 5HEZA 2QG7A 4CCBA 2PVNA 5FRIA 5EH0A 5FTQA 2JC6A 1TQMA 4FVRA 1IRKA 1PJKA 4JDHA 2JKOA 4K18A 4ACHA 4CXAA 2E9VA 5CAOA 3MGYA 1ND4A 3FMMA 2WTCA 4NW6A 2CKPA 2OW3A 3P08A 3MJ1A 3SQQA 5EYCA 4BCJA 3T9IA 5IH4A 5JN2A 1ZWSA 4FT7A 4FTAA 5ETIA 3F2NA 3ZFXA 3FL4A 3ZZEA 4EH3A 4EOIA 2NNWB 5K4JA 3FHIA 4FEWA 5CAUA 2P2HA 1U46A 3PUPA 4PDYA 2XIXA 3E8DA 3WOWA 3G0FA 5M06A 4E6AA 5HICA 5CVGA 4U43A 4FZFB 5F4NA 4TRLA 3LMGA 3LIJA 2Y9QA 2RGPA 3NYXA 3GU6A 3B8RA 3CE3A 3EN9A 3MBLA 3NW5A 3SV0A 3ZMMA 4A9SA 4AT3A 3TUDA 4EH7A 5HLPA 3HAVA 4FNWA 4QMSA 2IVVA 4BICA 2QOKA 2X9EA 4TW9A 2GS6A 2QOBA 2YCQA 4XEYA 5LWMA 3P4KA 5CX9A 4PMMA 3ANRA 5ANEA 2FUMA 5IF1A 4ZMFA 3OFMA 4FBXA 4L43A 4BCQA 2WGJA 3U6HA 4AN2A 4APPA 2Q0BA 2PVKA 2VWYA 4YTFA 3QX4A 3TI1A 3CQUA 3F2AA 5LQFA 3PPJA 2J4ZA 4YGAA 2VO6A 3F69A 4HYSA 5B0XA 5L6PA 5HHWA 4IWOA 3FPQA 2W4KA 4C2WA 4UWYA 4JQEA 2RSVA 5KMIA 4HJOA 2A19B 2B53A 4G3CA 4GVJA 5AFVA 3OCTA 3SXFA 4DLJA 3CY3A 5DG5A 1QL6A 5AP2A 3A7IA 3EWHA 3UP2A 3ZC6A 2QURA 4XP2A 5D12A 4YSJA 5I9VA 3LFDA 4QYHA 4C35A 2GS2A 4AN9A 4BF2A 5IEXA 3D94A 1VJYA 1ZY4A 3BX5A 3NR9A 4YZBA 3D9VA 4X2KA 1OIUA 3PYYA 4KA3A 4KABA 2XJ0A 4QNAA 4I23A 3GC9A 1PXLA 2R0UA 3SRVB 4FKQA 4FL2A 3R8UA 4RQKA 3KA0A 5IG1A 4ANNA 4Y8DA 4YHJA 4NSTA 2ITTA 4RRVA 1BI7A 3F3WA 3QYZA 1YHSA 4WG3A 5J7BA 1NT2A 2X4FA 1YHVA 3HUBA 4M14A 3K5VA 2J6MA 3U55A 3LPBA 2I0EA 3O7LD 3RBWA 2VWZA 3HVCA 3BV2A 4M97A 1SYKA 4NM0A 3UVRA 3ATTA 3PLAE 2YM7A 3F7WA 4BCKA 3ZEPA 4YTHA 3UZTA 3D15A 3MIYA 4S31A 5DN3A 3TZ9A 3N4TA 3W16A 2W5AA 3QKKA 3QLGA 4WD5A 4ZTHA 3OROA 5EHOA 5IPJA 3W2PA 2PZ5A 2PVRA 1G3NA 3R8PA 4YZMA 4BI1A 4C58A 4YMJA 2I0YA 4PPBA 3OXZA 2UZWE 3KKVA 5CEIA 2ZMDA 3V5JA 5DOSA 3CIKA 4PV0A 4GRBA 4C4EA 3BHYA 3OCBA 4QMOA 4O22A 2HZ0A 4F65A 5AADA 4ZSGA 5CALA 5HTBA 2V7OA 5FG8A 4DCEA 4WUAA 5M55A 3PIXA 1OM1A 4PDPA 2W1IA 5GZAA 5HO7A 1REJA 2B9FA 4K11A 4R7BA 2UZNA 3TNQB 2OK1A 2OSCA 4HCTA 5DGZA 4FKRA 1OBDA 4FSUA 3KMWA 3R63A 5LMAA 4ZLOA 3LFCA 4L3JA 3O8UA 3FMLA 1M14A 2QR7A 4TWOA 4YR8A 4RJ7A 4F1TA 4BDIA 4R1YA 2OO8X 3PY0A 4CLIA 2PVJA 2UZOA 4I5CA 2OZAA 2XB7A 2YDIA 2GCDA 3BYMA 5AAEA 1LEZA 2EB3A 3QQUA 4LL0A 4DH5A 4O7VA 4QNYA 1IAHA 2QVSE 1Z57A 5AWMA 4BI0A 2XUUA 4NEUA 5EKOA 4D28A 3UQFA 3GU5A 1Q24A 4EHVA 3UYTA 1F5QA 5AUXA 4FTOA 4D2PA 3LQ3A 3OXIA 4ZSAA 2OGVA 3NPCA 1M52A 5IUGA 3OC1A 3C7QA 4NCTC 3A4OX 3CS9A 3GCQA 3LQ5A 3Q4ZA 4A4OA 2GNLA 2XA4A 3FQEA 3NW7A 4MK0A 3TTIA 4IZAA 4AE6A 5AAGA 5FM2A 4CQEA 4BGHA 1P2AA 5HX8A 4B4LA 2WMWA 3F9NA 4RVKA 2VGPA 5HLWA 4ENXA 3R9RA 3HYHA 3R00A 4EK8A 3E63A 5FDPA 3NVMB 1NVSA 4C38A 4JRNA 3DTWA 3DTCA 3UYSA 4LUEA 4BVUA 2G01A 5GJFA 3V04A 1XR1A 5I3RA 3BBWA 3FSKA 4UMRA 4O84A 5L2TA 4ZJJA 2YZAA 4C3RA 1H0VA 3W2SA 5AV4A 4MCVA 3TNPC 3QC9A 3AC8A 4H3BA 1OI9A 5A6OA 2PVHA 3RNIA 5ITAA 3UO5A 4Q2AA 4LGGA 5FUTA 3HX4A 4XMOA 4FE2A 1H00A 2HZIA 2O8YA 3FI4A 2J2IB 3BI6A 4LMNA 3SHEA 4FI1A 3ZLWA 3EZVA 3Q4TA 4QPAA 2A4LA 2X9FA 3KF7A 4FKSA 4JNWA 4A06A 5EQEA 1Y6BA 4WRGA 4GFGA 4DN5A 1F3MC 3WE4A 3QX2A 5I5ZA 3DJ5A 1JKSA 5GHVA 2J7TA 3W32A 2FGIA 4D0WA 5EW9A 4Z16A 4RPVA 4DFZE 3WIKA 4Y46A 2NO3A 4H3PA 2AC3A 5EFQA 3QFVA 4O6LA 5M4UA 2ZM1A 3LMHA 2I1MA 5KUPA 4C59A 3ZLSA 4FOCA 2WTWA 3S95A 2ZM3A 3VQUA 4GKHA 5BYZA 3PZHA 4NU1A 3UC3A 4D2SA 3GGFA 4CT2A 4S34A 5DE2A 1Q3DA 4EH6A 2VX0A 4L67A 3LW0A 4Y85A 1UU9A 4R8QA 4C62A 1XKKA 3P78A 4TNDA 3ZUUA 3R8VA 4WOVA 4JAJA 4CMOA 4N6YA 2UW3A 4OLIA 4U97A 4DHFA 4C34A 3SKCA 3ZM9A 4QT1A 3UVPA 1OIRA 4BDGA 4UX9A 3FZTA 2X1NA 2B55A 1F0QA 4FKVA 3HEGA 3OY3A 3VBVA 2VTLA 2XIZA 3C9WA 2WTDA 3IS5A 3CXWA 4EHEA 5J7HA 1W84A 5FBOA 3P7AA 3P23A 3R0TA 4IACA 3FQHA 4YJUA 5I9WA 1PY5A 2I0VA 2X8IA 4FKJA 3FI8A 2X0GA 4FR4A 3RM6A 2C5NA 4MHAA 3K54A 3QKLA 3QRIA 4L00A 5E8YA 3QCQA 2QONA 2W4OA 4ZZMA 4V04A 4APCA 5IQGA 3D2KA 3K2LA 2WMVA 4O6EA 5F95A 3IGOA 4FTQA 4I6BA 2YFXA 3QXPA 1YOJA 3JY9A 4YJNA 5HD7A 3HV4A 3UOKA 1PF8A 4KAOA 1V0PA 2WMAA 4RG0A 1P4FA 1SVGA 4PUZA 3TJCA 2BAKA 1W82A 4ZZOA 3TNWA 3ZO3A 4NIFA 2YIYA 4MXCA 5HTCA 1JPAA 2PMIA 2VWVA 4IAKA 5D11A 2RKUA 4M12A 3WF7A 5A4QA 2W9FB 4BBFA 5I9XA 3U6IA 3IW6A 3JVRA 2GQSA 4ACMA 1WAKA 2C0TA 2HXQA 3UOLA 4USEA 2XK8A 3QTXA 4HYUA 4IVDA 1OZ1A 3PY3A 3LHJA 1ZY5A 4FIIA 5A4EA 4C3PA 3Q2JA 5IMXA 2ITUA 2IG7A 1OIQA 4IANA 2WMXA 4EOJA 2VNYA 2Q0NA 4L44A 3KRXA 1ZXEA 3IOKA 2ESMA 2ERZE 2VWXA 3PP1A 2W1HA 5E91A 3VBYA 3W2QA 1ZZLA 3VHEA 4I93A 3LJ2A 3DKGA 2XIRA 2YHVA 1XH8A 2CGVA 3ORZA 4U44A 5HG8A 2UZBA 3IQ7A 4R7HA 3SA0A 2OBJA 3OCSA 2R3LA 2WTJA 4FNYA 4NJDA 5AV2A 3D5XA 3VS7A 5LVNA 4ITIA 3A7JA 2PUNA 4R1VA 4WBBB 4M13A 5TOZA 3O8PA 2GS7A 4X2GA 3FZSA 4PX6A 3DB8A 2QNJA 2WB8A 1Q8YA 3I60A 3PE2A 1J7LA 1A06A 4ERKA 4D1ZA 2OJJA 3MTLA 5EYKA 4BDEA 2JFLA 4GK3A 5AP0A 3N4VA 3H9FA 2C3KA 4GT4A 1GZKA 5HVJA 2Y8OA 3FBVA 3MPAA 5D9HA 5M51A 3RI1A 3TXOA 4ARKA 1V0OA 3C1XA 3LAUA 4A4XA 2Z60A 4DF3A 3NVKI 4ACCA 4YJVA 3GCUA 3I6WA 3UIXA 4BDFA 5E8XA 2B9HA 3DS6A 5M53A 4FG9A 2X2MA 5HD4A 4RA5A 1PXKA 4FT3A 3DAEA 5BUEA 4XRLA 5AM6A 3QYWA 3G33A 3I0OA 2WQOA 3W8QA 4U79A 4XG3A 1L3RE 5KX8A 2Z7RA 3UC4A 3I5ZA 1RDQE 3NLBA 3R9DA 3T8OA 3PJ2A 3PIZA 2BPMA 4BDHA 3R7OA 2Q83A 2UW9A 4KBCA 3POZA 4RX8A 4BKJA 1T45A 3PA5A 2PULA 2Z8CA 4BWKA 2YAAA 4TN6A 2J0JA 4JG7A 2P2IA 3FV8A 4MWIA 2GU8A 3FKOA 3L9PA 2PVYA 1HOWA 3AC4A 4XLVA 3ZH8A 4BDBA 5DR2A 3BU6A 5AP6A 5EM6A 3FSFA 4HGSA 4TYEA 5BQ0A 1Q61A 2UV2A 4TKSA 5FBNC 1UU3A 1O6KA 2RFEA 4AUAA 4CCUA 4CFFA 4YLLA 5M4IA 4WUNA 4FT0A 4QTEA 2OJIA 5KKRC 4JL9A 3AC5A 4FNZA 3FLSA 3DZQA 4LRMA 5HNIX 4YZ9A 1WBPA 3E8EA 5JGAA 1S9IA 5T6KA 3NDMA 1U59A 3Q60A 4G31A 2EVAA 3PLSA 4ERWA 4JBOA 3JUHA 1CM8A 4CT1A 2OXXA 2BZJA 4YO4A 4YO6A 4I6QA 3BRBA 3BEGA 4MKCA 3RNYA 1OUKA 3MB7A 2OH0E 3DJ7A 3HA6A 3TUCA 2VTNA 4QMPA 4ZTMA 3ZLXA 2UW6A 2Z7SA 3TWJA 4DFBA 3SXRA 3ZO2A 2I40A 3C5IA 5AA8A 5IA1A 4RT7A 2BTRA 2BR1A 4AOIA 4FSTA 4O82A 1OB3A 2WQMA 3QQLA 4AZSA 4D9TA 4DINA 4FIFA 3MA6A 4O2ZA 5IQDA 5KKRB 3WF9A 4K6ZA 3WZKA 5A4TA 4JS8A 5DT0A 3FKLA 4E20A 2ITQA 5BX0A 2UZLA 4QQ5A 5CXHA 4ZS4A 4YTCA 3E7VA 4HNIA 3TTJA 1VYZA 5CEQA 3VRYA 2O2UA 3PSBA 4LFIA 3W8LA 4BI2A 4BTMA 2YLFA 3KRRA 3QRTA 2WZJA 2YJSA 4XX9A 3GC7A 3KK8A 3UMWA 3DQWA 2UVYA 3BPRA 1ZOEA 1CSNA 3QZHA 2QO9A 2IW9A 4V0GA 4CRSA 4EQCA 4R3PA 3OTVA 3P7BA 2XRUA 3RALA 3PVBA 3OG7A 5IDPA 1PMNA 3GOPA 4OTGA 5CU0A 4BDCA 2GTNA 4NWMA 5DEYA 4AP7A 1Q8WA 3HDMA 3NAXA 3OW3A 3LXPA 5E8VA 1OPKA 1VEBA 5L6OA 4ZS0A 3GEQA 4FODA 3E5AA 3TIZA 4M69A 3DPKA 3ZC5A 4L8MA 3ZSHA 4XYFA 2XM9A 4Z7HA 4K2RA 4Y5HA 5BVFA 1JAMA 1PRYA 2PHKA 4UMTA 3VUDA 4AFEA 1PMEA 3QU0A 5B2MA 5HG7A 4I41A 4F9WA 3IDPA 4GK2A 3SVVA 4ZJIA 4RA4A 3GU4A 4IFCA 4WBOA 3LM0A 5KE0A 4BZDA 5J1VA 1J7IA 3GENA 2VU3A 4IIRA 3LLAA 4J71A 5IISA 3HZTA 2Z7LA 3H0ZA 4I24A 4JIKA 1DM2A 3RKBA 3DY7A 4EK5A 2CJMA 4ACDA 5HG9A 4YZDA 4GYIA 4FYOA 4YZCA 3WE8A 4F7LA 4F7NA 4CSVA 3RK7A 4DGMA 2GTMA 4LGDA 1FGKA 3A60A 2C6IA 2CPKE 3H9RA 3CJFA 5EQPA 3QD0A 3LFAA 1OECA 4F6SA 4FTIA 3R1NA 3Q5ZA 3SGCA 4DH3A 5HG5A 1WFCA 3A8XA 4QMMA 1JLUE 2CSNA 4QYGA 3AMYA 4U7ZA 4WG4A 4BZOA 4C4FA 5CEPA 4Z55A 3RP9A 3S00A 2WIHA 5BVKA 5CZIA 3KXZA 4IC8A 3TZ8A 3RPVA 5KO1A 1B38A 4QTDA 2OZOA 3FZPA 1FVVA 1JKTA 4JVGA 3DBFA 3F6XA 3BU3A 3R7IA 5EK7A 4MXXA 3UZRA 1W0XC 4XP3A 5J1WA 1H0WA 4IQ6A 1GZ8A 5JT2A 1U5QA 2BALA 2IVUA 4KIPA 4DEBA 2DUVA 3C50A 5CI7A 4HZRA 3QD2B 3SW7A 4UWCA 1ZYCA 4BZNA 4I1ZA 4F09A 5CU4A 4X0MA 2VTPA 3EHAA 3NRMA 3LFBA 5GINE 3U8WA 3FZOA 4GG5A 4FK3A 4PL4A 5DH3A 4BTKA 1GAGA 2IW8A 4FTNA 3WYYA 2VZ6A 4W9XA 2OIQA 3OEZA 3KN5A 4IWPA 3TKHA 3ULIA 5CVFA 4IXPA 3VN9A 3EN6A 2UVZA 1ZARA 4JQ8A 4ZSLA 4AGDA 4DFUA 1JOWB 5CAVA 4FSYA 4AZVA 3CSVA 4LGHA 3ZU7A 3TDWA 4TWCA 3EQFA 3CGOA 3MVLA 4LUDA 3AD6A 3JYAA 5JRSA 3TCPA 3HL7A 5EDPA 5JZNA 4E8AA 3OHTA 2ZV7A 3RZBA 4GIIA 1NW1A 2YCFA 5AP3A 2B52A 2Y6OA 3R2BA 2X8DA 5HCZA 1BYGA 2OU7A 4UV0A 4RX9A 1OMWA 2YABA 2XK4A 3ITZA 2QHMA 3S0OA 1KE7A 2C5OA 4NJ3A 5JSMA 2GDOA 3AMAA 3V6RA 4F0FA 2ZV2A 3TV4A 4OTIA 5ANIA 1M2QA 4TZRA 4ALWA 2OXYA 4M84A 2ZB0A 1WVWA 3ORIA 3PRFA 4GYGA 4MNEA 5CQUA 3U9CA 4B8LA 3BCEA 3ZHPC 4NM5A 2YA9A 3IO7A 3DJ6A 4ZLZA 2WTKC 1O9UA 3V6SA 4ZY5A 4FEUA 2QOHA 3F2RA 2CGWA 4KBAA 3SW4A 2HY0A 5C03A 2OZAB 1BL7A 2RFSA 3VJNA 4ENYA 2YAKA 1OL5A 3BHUA 5AX9A 3IKAA 2HXLA 3QZIA 4GJ3A 3D0EA 3DKCA 4TXCA 4X3FA 4Y5QA 5HO8A 4D2VA 4BYJA 4EC9A 4C36A 2W1CA 3CBLA 2XEZA 5KMOA 5JZJA 3RK5A 3EJ1A 3S3IA 4C37A 3HV3A 3JXWA 4QP3A 1Q8TA 2O0UA 4DBNA 3R7YA 3B2WA 2X7OA 4ASZA 4AOJA 1YDSE 4XV9A 3FMEA 2VGOA 3GBZA 2G2HA 2C47A 3R73A 4ZIMA 4YJTA 4CZYB 4FC0A 2BFXA 2C5YA 3PXQA 5DA3A 5F20A 2QOQA 4EYJA 2GHMA 5CF6A 1PXMA 4GIHA 2CHLA 3SAYA 1YHWA 3D2IA 4WT6A 5KMNA 3W1FA 4O81A 5BYLA 3HGKA 4PNIA 3ZRLA 5FTGA 3HKOA 2DYLA 4RJ6A 4BTJA 4DA5A 2ZMCA 5IUIA 4QMVA 5D1JA 1LR4A 3KULB 4KSQA 2GNFA 3RHKA 3UDBA 3I6UA 4RZWA 3Q9WA 5BYYA 2HOGA 3FUPA 5AR8A 4EZ7A 5CXZA 2EXEA 4FL3A 2R7BA 1OKVA 4EOQA 3O7LB 2CLXA 4ANQA 2J5EA 2PY3A 3COIA 3NCZA 5CS6A 3FXXA 4FVPA 4ANBA 2R0IA 2W7XA 3RPRA 4DTKA 5HGIA 3JPVA 5IZFA 3BE2A 1QPEA 1UU8A 1W7HA 4RVTA 5A3XA 4F7SA 1B6CB 2ETRA 5LJJA 4D1SA 2PPQA 2R3IA 4O27B 3SOAA 3U51A 4BCHA 2HK5A 2UUEA 1ZRZA 2UW8A 2W05A 5CT0A 4E5WA 3DDQA 3VS4A 4BC6A 4LI5A 4BKYA 5BMMA 4RC4A 2F7ZE 3QQGA 1TVOA 2B9JA 2YACA 3FMKA 3ZXTA 5FXSA 2YM5A 3R7GA 4KS8A 3AQVA 4RWKA 1OKWA 2YCSA 5M08A 1AD5A 1IASA 2XBAA 3NEWA 5E8WA 4DFNA 5AP7A 4J97A 2RFNA 2X6DA 3MY0A 3SXSA 4DEIA 3UNZA 3F3ZA 4IB3A 3VIDA 4AGWA 4LQMA 4I20A 3H4JA 4OTWA 5CTPA 3FYJX 2XK3A 2W06A 2XS0A 1YWVA 4BBEA 3Q3BA 2VTOA 4FTKA 3Q9XA 4ZXTA 4DFLA 4E4MA 4FV1A 5HE1A 5BMSA 4C4JA 4QTBA 4HVSA 4YU2A 3R8LA 3QCXA 2JFMA 4B6LA 1S9JA 4QD6A 2C0OA 4B0GA 4AACA 5AUWA 3R2YA 5CU2A 5BVOA 1SNUA 1SMHA 4N6ZA 5EI6A 3RCJA 5AUYA 4NCTA 4FV9A 5TR6A 5FXRA 3C4WA 4QPSA 2PU8A 3LCTA 4L6QA 3LFSA 4TNBA 2XM8A 3GCSA 4TWNA 3C4XA 3QUPA 2C6DA 3R9NA 1FVTA 2YDJA 2YEXA 3LOKA 2QOLA 5DBXA 5KMMA 4IDTA 4BBMA 4DH1A 2QODA 5HX6A 4U80A 5E1EA 2J50A 4JXFA 3MY1A 4E6DA 4LL5A 5FXQA 3QGWA 1STCE 3MH2A 2GNGA 2W5BA 3KL8A 2C3LA 4QMUA 3G51A 4R7IA 4UY9A 3KXMA 2PMNX 3RMFA 3JY0A 4IE9A 4NIFB 3C0HA 5BUJA 3BHVA 3VBXA 3EQHA 1CMKE 2E9OA 4NKAA 4R5SA 1ZLTA 4YJPA 1YVJA 3LM5A 4L42A 4ZY6A 4FKLA 3RM7A 4FK6A 3ORKA 4OR5A 3EQPA 2GMXA 2QO2A 2YIXA 5C9CA 4QMQA 5EOLA 5HO6A 3RPYA 3NUXA 5CSPA 2HW6A 4O7WA 3O71A 1MQ4A 1FINA 4HVIA 4TT7A 2VTHA 1OL7A 5L8JA 4MWHA 4UYAA 4FTCA 3ACKA 4ZZNA 3OVVA 2OF2A 4IB5A 2H96A 4FV5A 5A4LA 4EC8A 3ENMA 4F99A 1J7UA 4QMYA 5AR4A 5T68A 3HV6A 1XH6A 2WXVA 4O0XA 3VULA 3PFQA 3Q32A 4Q9ZA 4OTRA 1YI6A 4JDJA 2FVDA 5HIDA 3A99A 4AT5A 3P5KA 3BGQA 4KS7A 3F82A 4QP7A 4XHKB 2QCSA 5L6WL 2XNPA 3WIGA 5G6VA 3MVMA 4QTAA 5L2WA 3Q6WA 1M7QA 1H26A 4JG8A 4OGRA 3OXTA 5TT7A 3DLZA 3UIMA 4D4YA 4PPCA 5IQCA 4XUFA 1JSVA 4F0IA 2XYUA 3ORTA 3THBA 3L8PA 3BYOA 4IAAA 2XP2A 2HELA 3MFUA 5HVKA 4U45A 4XJ0A 4GJ2A 5CAQA 3H0YA 4XG7A 4CFVA 3QTRA 4FZDB 2C1BA 3WZJA 2JKQA 4AA0A 4I4FA 3VS5A 3HUCA 3HA8A 4DYMA 1MRUA 3RINA 4FTTA 4FV3A 4NFMA 4FV0A 4EOSA 3M11A 5J9YA 4GMYA 2A2AA 3FY2A 3D5WA 2B9IA 4A9RA 4CLJA 3PXRA 4XBRA 4FNXA 3ENHA 3SDJA 3FJQE 3MFSA 1LUFA 2XNNA 3MI9A 1MUOA 3UBDA 2YITA 3PRIA 3H9OA 2IO6A 2ZDUA 1G8SA 3GP0A 1RW8A 2EB2A 3VBQA 4RVLA 4UALA 2VRXA 3OT3A 3KFAA 3NUPA 3AT2A 4RC2A 2IN6A 3QCYA 4EBVA 5AV3A 4UMUA 2H9VA 3EH9A 3D7TB 3LCDA 3TACA 5LVMA 2Y7JA 3RAHA 4DE4A 1PXJA 3AD4A 3NWWA 3V8WA 2UZUE 4G3DA 3KY2A 4RLKA 3FLWA 3GQLA 4RIYA 3UG2A 4BB4A 3Q52A 1FPUA 1SNXA 5I9UA 1TQPA 4AXAA 1FGIA 2XK6A 4W8EA 1H1PA 2X8EA 2ITZA 4F9CA 3BLRA 3PPZA 4OW8A 1MQBA 4HNFA 5GZ9A 4JBPA 3ZRMA 4C57A 3Q2MA 5AJQA 3ZUTA 2ERKA 2XVDA 4WIHA 4HVGA 5K5NA 3QHWA 2PMOX 4NM3A 4Q5EA 1Y6AA 2FSLX 4KIOA 2GFCA 2QOIA 3FEGA 4ASEA 1QPJA 3OUNB 3DBEA 1G8AA 1U4DA 3CQWA 1OL1A 2XNGA 3QALE 4F1MA 5I0BA 2W1EA 3C51A 4IBMA 5CYIA 4ASXA 4CTCA 3MSSA 3R83A 3D5VA 3MW1A 4HGTA 4YJOA 1W83A 4O7RA 4DFYA 2JAMA 1SVEA 3QL8A 4FKIA 2WAJA 3F7ZA 5IQBA 5I9YA 4OTHA 1R3CA 4O7TA 3R30A 4M67A 3VRZA 3N9XA 5H2UA 3ZXZA 3G9LX 3GT8A 1CKJA 1ZYJA 2R3NA 4QPMA 4YPDA 3U87A 4FIHA 4E3CA 4U8ZA 4BDAA 3DKOA 1VR2A 5IA3A 4W4YA 3U4WA 1OBGA 2YWPA 4G5PA 2Z7QA 3FZRA 5IEVA 2E2BA 3MA3A 4UZDA 5DVRA 5HBHA 4FSNA 3EQCA 3E87A 4GEOA 1TKIA 1PHKA 4XG4A 1Q8UA 4YBJA 5HOAA 2XF0A 3JS2A 4V0GB 4WSQA 2VO7A 5DRBA 2GNHA 3AXWA 1PYXA 4AS0A 3FPMA 3MPTA 4ZP5A 3DXNA 4I22A 1M2RA 3OY1A 5A6NA 4WNKA 3CTHA 2IVTA 5CU6A 4EZ5A 2BTSA 2QOFA 3DLSA 5TE0A 1UU7A 2AC5A 2IWIA 3S2PA 2BILB 2B54A 2CCIA 3FDNA 2ZV8A 4H36A 2PZIA 1BL6A 3E62A 3ERKA 3GFWA 4KRCA 4L53A 3ZFMA 3S1HA 2QKRA 3LQ8A 2GHLA 3GXLA 2QLUA 2XCKA 4DEDA 3FE3A 3E8NA 5FLFA 2WD1A 4U5JA 4X2FA 2X81A 4MQ1A 4XS2A 3TT0A 3VUIA 4MYGA 3RPSA 4NL0A 3IOPA 3DZOA 4JQ7A 1YXVA 5IA5A 3TN8A 2ONLC 4AW0A 1GJOA 3DDPA 2ZVAA 2PVMA 5GJDA 5CEKA 3RTPA 4GFOA 5JQ8A 4IC7A 4EQUA 5FD2A 4PL3A 3DBDA 4ID7A 2RL5A 4CKRA 1YXTA 4M15A 1ZZ2A 4RFYA 4ANOA 4CFMA 5FQDC 3AG9A 4C33A 2XKEA 5DFPA 4HPUE 3SX9A 4Z7GA 2V22A 4IFGA 3QC4A 5CVHA 2BZHB 3CC6A 3R1SA 4IB0A 1QCFA 2G9XA 3H3CA 4MF0A 5KBRA 4K1BA 4QP9A 1XJDA 3Q4UA 4U6RA 3BU5A 5AR5A 2R3JA 3R8MA 1H1RA 2C68A 1OPJA 3NGAA 3Q53A 2QG5A 4L52A 4RJ5A 3R21A 2PUIA 1Q4LA 2XZSA 4TYIA 2FA2A 2WMUA 4A4LA 2J51A 3MFTA 4EQMA 3BWFA 1A48A 1V1KA 2YCRA 4W9WA 4C0TA 4EH4A 4FKGA 2BRMA 2NRUA 3C4EA 3PPKA 3NCGA 2WTIA 4H39A 4RIXA 4ACGA 3U54A 3A7HA 2VNWA 3GFEA 4G6OA 5IA0A 5FEEA 3EQDA 2VTJA 2X39A 4YJSA 4U0IA 2QU6A 3DXPA 1UWHA 2QU5A 4KIQA 2WPAA 3OWKA 3IDBA 5FDXA 4G5JA 3GCPA 3VW8A 3MWUA 4EBWA 3F5UA 3UODA 4PF4A 2PE1A 2GNIA 4GK4A 4IX5A 1WBWA 3UO6A 1H8FA 5G1XA 4RZVA 4FSRA 2X2LA 3VBTA 3F5PA 3LCKA 3VS1A 4CFNA 2XMYA 2R2PA 3U6JA 2C3IB 3K5UA 4ONAA 5AM7A 5EM5A 4KINA 3OP5A 5L2QA 5LXMA 5C01A 2JAVA 2C6KA 3R7VA 3PZEA 3UE4A 4TYGA 1XBBA 5KHXA 5E8UA 1P4OA 3FAAA 2VTAA 4XH6A 3NYVA 4AZTA 4NW5A 1LEWA 1E9HA 2UW4A 1P5EA 2YIRA 4FIEA 5HLNA 3R8ZA 2Y4PA 4AWIA 1FMKA 1H24A 4M68A 2PWLA 3Q6UA 3A7GA 1WZYA 4OAVB 2CDZA 3MVJA 4ALVA 3ZLYA 4EOKA 2CNUA 2W5HA 4WA9A 4JBVA 1ZMWA 2OI4X 5CEOA 4JDKA 3C4FA 3ZFYA 3LFEA 4JAIA 4RGJA 4IMYA 2C6MA 5LVOA 2FSTX 4OUCA 5BVDA 3O23A 3VHKA 3G9NA 5CENA 5FM3A 3G0EA 1SM2A 2XRWA 3RWPA 3KXHA 5L8LA 5JQ5A 4H05A 5CSWA 4FG8A 5C8MA 2GQRA 3EN4A 5AA9A 5IMEA 3ALOA 4UXLA 4EZ3A 4UXQA 4XOYA 2YZLA 5F1ZA 2C1AA 4CNHA 3DAJA 5TKDA 4R3RA 3HMPA 5AUUA 4MNEB 3UZPA 1JQHA 3QHRA 1GIHA 2C5XA 4DAWA 2FH9A 3P79A 5AMNA 2ITYA 5C8KA 4WNPA 5LMKC 3WF6A 1URCA 3F66A 4F0GA 3ZZWA 3ORPA 4UYNA 3PJ1A 1OGUA 3RJCA 4EK4A 3L9MA 4V05A 4I0TA 4MH7A 5M56A 3UQCA 3DBCA 4DEEA 4X3FB 5EW8A 4ANSA 3OTUA 3NIZA 3CPBA 2ETKA 4RJ3A 4YTIA 4CFUA 2WMRA 2JIUA 4QMNA 1E1XA 2XKCA 4XG8A 3UP7A 3PG1A 3EB0A 2O5KA 5A14A 3GC0A 5EOBA 3EL7A 1YXUA 3E3BX 4LOPA 4CYJA 4M8TA 4MBJA 2YIWA 2JIIA 3DT1A 2GQGA 5L2SA 4MQ2A 3TJDA 5ANKA 2OICA 5K5XA 3EFWA 5GIPE 2WOTA 2Y0AA 4JR7A 5EI8A 3AMBA 4ZTLA 3F5XA 3VUTA 4X2NA 4BY9E 2JITA 2PZYA 1PMVA 1Z5MA 2YDKA 3FZ1A 1W8CA 4LOQA 4PL5A 4U41A 2JDOA 5L4QA 2JDVA 4GW8A 3BEAA 3IPHA 4ZTSA 4J1RA 3IK3A 3QZGA 4RBLA 3KK9A 1YI4A 4UEUA 4AG8A 4X3JA 4I5HA 4M7IA 3OWJA 4GG7A 4WO5A 1ATPE 3HDNA 1YWNA 3PWDA 4FV7A 3R9OA 3WZUA 3N51A 4FT9A 4FX3A 3KGAA 2PE0A 3Q4CA 3NW6A 4X6RA 2R4BA 3DU8A 4A7CA 4C3FA 3CR0A 4GT3A 3I1AA 1YKRA 5EDRA 4R78A 2O65A 3ACJA 2C0IA 3WI6A 3WZDA 3AT4A 4K33A 4LRKA 4F4PA 2WMQA 2BHEA 2P4IA 2JDRA 3A8WA 4HOKA 4KB8A 5L8KA 4N70A 3VS0A 3ID6C 4UWBA 1WMKA 5AR2A 2CGUA 4M0ZA 1XHAA 2WO6A 3CTQA 4LRJA 3V3VA 2IPXA 1Y57A 3BYUA 5DIAA 3RGFA 2W4JA 4J7BA 3OMVA 4O1OA 4W4VA 5HESA 4TPTA 4IM0A 1HCKA 3B8QA 4LM5A 4C4HA 3KRJA 4MXZA 2QD9A 3FL5A 2C6OA 3E7OA 5BNJA 2C6EA 3DOGA 1OPLA 4L7FA 4DT9A 4IZ5A 4XOZA 2X7FA 3UTOA 4FUYA 1CKPA 4W4WA 4YURA 4PP9A 2VO0A 2QQ7A 2YISA 3JR1A 4EL9A 3F3TA 5IQFA 4CZUA 5CF4A 2R64A 2UZDA 1J1BA 2CNQA 1R1WA 2R3MA 4D5KA 5AEPA 2PUPA 3KN6A 2G2FA 3ROCA 2JDSA 2WHBA 3V5TA 3KXNA 2Z02A 1KE9A 5KCVA 4FIJA 5JFXA 3I7BA 4PMSA 3AC1A 3HAMA 3D4QA 4FTLA 1WBOA 5BVEA 3VS6A 2JKKA 3QTSA 3KVWA 5CU3A 2WMSA 4Z9LA 2OLCA 4G1WA 3AGMA 2UZEA 4Y73A 1A9UA 4TTHB 4FKOA 4IJPA 1Q99A 5E92A 3ZSIA 4B99A 5JFWA 2F7XE 2FB8A 3LKMA 2QKWB 3FMNA 1YW2A 3TV6A 4E4NA 3QQJA 3BQRA 2YERA 4DGNA 4BR3A 1YDTE 1FVRA 4L01A 1H28A 5ANOA 4FSMA 4BGGA 4L68A 4YC6A 2W0JA 4D4RA 1ZMVA 4F9AA 5DYJA 1H1SA 2G15A 3AD5A 4XCUA 2UZTA 2VUWA 3TZMA 1OUYA 1KWPA 5DMZA 2W99B 3FXZA 3POOA 5EI2A 4FMQA 4X2JA 3R1QA 5M4FA 3CGFA 5M09A 4S32A 2CN5A 3PA4A 4O0UA 3EIDA 3TG1A 4GUEA 3CCNA 5CLPA 4IZ7A 4RFMA 4QP8A 3REPA 5HI2A 4P5ZA 4DH8A 4LV8A 4AA4A 2VTRA 1OL2A 2F2UA 4J96A 4YNEA 3R6XA 4ITJA 4PDOA 1ERKA 4PY1A 5LCKA 3EQBA 4MD8E 4PNKA 2UW7A 5AR7A 3ZO1A 3GVUA 3N4UA 3UGCA 1LP4A 2A0CX 3MV5A 4OTPA 4W8DA 5KMKA 5JK3A 3NYOA 2V62A 3UMXA 2XNBA 3ZONA 4ORKA 3EN7A 1J91A 3QUEA 2ZM4A 3PSCA 3OW4A 4DEHA 2B1PA 2BHHA 2PYWA 4Y83A 4HGLA 5M4CA 4EYMA 2DQ7X 3NUUA 3NSZA 1R0EA 3B2TA 5CZHA 3FMJA 5DHJA 4Y95A 3KXGA 4LOOA 3EQGA 5AUZA 2BAJA 4QP2A 5DWRA 3KMMA 3UOJA 4BKZA 1M2PA 4DCAA 3QF9A 3HMMA 3W10A 4AGCA 2A27A 4G16A 2C5VA 2X2KA 4ITHA 2P3GX 3LZBA 4D4VA 3BHHA 1GOLA 5AIKA 1PW2A 3GC8A 4CMTA 4C02A 4O0WA 1TQIA 4YHFA 3PE1A 3WZEA 4EJNA 4H3QA 4AU8A 3HMNA 3L8VA 3RPOA 2BKZA 3MH0A 4IM3A 4CKJA 2RFDA 4YP8A 2R3GA 2PUUA 3BWJA 3O96A 4FF8A 2WQNA 3OZ6A 1CKIA 4O38A 2WIPA 5JKGA 3UO4A 2BDJA 4RQVA 5K4IA 1UWJA 1EH4A 4NZWB 2JIVA 1BKXA 4IX4A 1UNGA 2C69A 1XH4A 5DI1A 4DGOA 4HGEA 2LAVA 3TUBA 5M44A 4I4EA 4BIDA 1UKHA 1T46A 1MP8A 3F5GA 4PPAA 3F3VA 3TNHA 4BDDA 4C61A 2AYPA 3QRUA 4JRVA 1K2PA 4RX5A 3EZRA 3ORMA 4YLKA 3EYGA 5GNKA 4AN3A 3TKIA 2JKMA 3AOXA 4IAFA 2DWBA 5IA2A 4RIYB 4EWHA 2O64A 3HV5A 3SG8A 3RAKA 4MX9A 2WQEA 5AP5A 3OEFX 3PXKA 1BUHA 4IVAA 5CT7A 3UPZA 3ZDIA 5KNJA 4YZNA 2WMTA 4FICA 3SD0A 2W96B 2WQBA 3KCFA 1I09A 4JJRA 2QI8A 4C4GA 4J53A 2BZIB 3LJ1A 5CAPA 3BLQA 3RK9A 3KCKA 4E5AX 4IB1A 2OF4A 1J1CA 2ETMA 4H1MA 3UNKA 3VF9A 2WMBA 3L8XA 5EW3A 4F7JA 3ZO4A 5LVLA 3PJCA 5HE0A 3VS3A 4O7SA 2WEIA 3PJ3A 5HVYA 4IDVA 4D9UA 3ATSA 2HW7A 2F9GA 2ZAZA 3FLYA 4WKQA 5BUIA 4I3ZA 2VWBA 1KE8A 5ANGA 4EOPA 4FTMA 1JSUA 4O2PA 4CTBA 3HNGA 2OG8A 5IQAA 4KIKA 3UJGA 4BCMA 4FIGA 5A9UA 5HE3A 1WBNA 3FY0A 2EXMA 4G6LA 4CZTA 5EG3A 3L9LA 4IW0A 3GI3A 4P5QA 4YBKA 3FWQA 3COHA 4ZK5A 3T9TA 2SRCA 2C3JA 3HECA 3UQGA 3DFCB 4EH8A 5IEYA 3MH1A 3V8TA 3OCGA 3KXXA 3M1SA 3DKFA 4BIEA 3SLSA 5EYDA 3ZRKA 4RWLA 4AZFA 5KMLA 4EKLA 1GY3A 2VTTA 3MIAA 1OL6A 1Y8GA 3FLQA 2CKOA 4Q5HA 4JOAA 1U54A 4FUXA 2OJGA 3FC2A 4CRLA 5AR3A 3ODZX 3W2OA 4KKEA 1PMUA 4LV5A 3CKWA 4FVQA 4MTAA 1O6YA 4PTCA 3V5PA 2VX3A 2XNOA 4E73A 4HCVA 3NX8A 3OWLA 4DITA 4P7EA 3OD6X 5HIEA 1B39A 3I4BA 4J95A 3TNIA 2GSFA 4TYHA 4AE9A 4EUTA 4FZ6A 5FP6A 3QWJA 3GU7A 4EH2A 2PK9A 4BN1A 4FOBA 2OWBA 2B4SB 4H1JA 3IGGA 4QYFA 2GHGA 5FGKA 4I21A 3R9HA 3S4QA 1XQZA 4QP4A 4QYYA 4EI4A 1IAJA 4ALUA 2BDWA 4O0RA 3WF5A 2ZOQA 5F94A 3ALNA 3TM0A 4CD0A 4IVBA 3W2CA 5HQ0A
chains in the Genus database with same CATH superfamily
1REKA 4K8AA 3COMA 3MN3A 1AQ1A 3FLZA 4MXOA 3E92A 4G9CA 3EQIA 3HV7A 2QOOA 5DEWA 5HBEA 5LOHA 3ANQA 4C8BA 3O8TA 4YJQA 3OBJA 4RSSA 1P14A 3PXYA 2WTVA 4FGBA 4BCOA 5EKNA 3LMIA 5IQHA 5DRDA 3NS9A 3EMGA 4N0SA 5F9EA 1URWA 3V5WA 5IA4A 2NYAA 1XO2B 5KZIA 2QOCA 3WYXA 5EM7A 4USFA 3DA6A 5E8ZA 4ZTQA 2OXDA 2B7AA 3RCDA 1AGWA 2VX1A 4O0YA 1R39A 1DI8A 5ETAA 1ZYLA 3R7UA 4WNMA 2YM6A 4FKTA 4PDSA 2REIA 2I6LA 2PMLX 2R3HA 4OTQA 2IZTA 3GOKA 5C4KA 3MS9A 3CEKA 3PVUA 1Y8YA 2ZJWA 1O6LA 3KU2A 4B7TA 4RIXB 3CY2A 1NA7A 2HWPA 1HCLA 5BVNA 3AC2A 5CSVA 4A9UA 4I92A 1GZOA 2V0DA 3W0QA 4DG3E 3DGKA 1LPUA 2OJ9A 1WVXA 4X3FC 5EYMA 3DB6A 3TIYA 4FEXA 1NY3A 5D7VA 1NVQA 4D2RA 2EUFB 2RG6A 2YM3A 5IQIA 1W98A 2G1TA 4HCUA 4FSQA 2ACXA 3DNEA 1Q62A 3U4UA 4BFMA 4JI9A 3O51A 2YWVA 2XIKA 4O7ZA 1XBAA 4PTGA 4S30A 3V5LA 3OT8A 4AW5A 4I6FA 3TZ7A 4WHZA 1ZOGA 5I9ZA 3I81A 3ETAA 4LYNA 3QQKA 5D7AA 2WOUA 5HIBA 4RWJA 4L3PA 2HZNA 5IUHA 2PZRA 4XG9A 3PWYA 2J5FA 3DAKA 4G3EA 1BMKA 5K3YA 3BHTA 4BWPA 1YRPA 2R3KA 1XH9A 4BHNA 4PRJA 2YIQA 5LMBA 3O50A 4UMPA 1G5SA 3CKXA 2H34A 2ZDTA 3IW5A 3LFFA 2J0KA 5HNGA 2ITNA 3EKKA 3NIEA 5C27A 3R7EA 3CP9A 2A1AB 3EN5A 2ZYBA 3LCSA 3SC1A 3RHXA 1XH5A 3NUNA 4FZAB 5ANJA 2QR8A 1ZYSA 4PMPA 3I0QA 2ONLA 3VNTA 2F49A 3R1YA 4B8MA 3VUMA 5KMJA 4HW7A 4D2TA 4DGLC 4KKGA 4USDA 1YXSA 2ITPA 4HZSA 5I3OA 4D2WA 4EUUA 3G6HA 4CMUA 3LVPA 4M0YA 4RIWA 3VUKA 4XBUA 4I0RA 3UOHA 3MPMA 5HE2A 1Q97A 5HORA 3K3JA 1PXIA 3QTZA 3NNVA 2BRGA 4EK6A 1RQQA 3BKBA 2J0LA 2CCHA 1JNKA 2XKDA 3HRBA 4AZEA 4S33A 5ICPA 2WKMA 5CY3A 1YWRA 1YOMA 4D4SA 5HU9A 4FEQA 3AGLA 3CD3A 3NUSA 4DLIA 4IVCA 5TF9A 5JRQA 2IZRA 2E9NA 3HP5A 3CQEA 3FMHA 4Q9SA 4X6QC 3VWAA 1JBPE 4O83A 4GSBA 1UKIA 4BDJA 2CMWA 3I5NA 5J5SA 5TO8A 4FTRA 4CVAA 2PZPA 2YLEA 5A4CA 1IR3A 4XRJA 4DH7A 4K77A 4CG9A 3TL8A 1NVRA 2F4JA 4EORA 4JR3A 2OJFE 3D83A 1IA8A 3RVGA 4KWPA 4E4LA 4EJ7A 3BIZA 2BAQA 4D5HA 3VW6A 2BMCA 4M3QA 4MNFA 3QZFA 2EWAA 4U9AA 4YC3A 4C4IA 4BCPA 1WCCA 2NPQA 3HRCA 5J9ZA 2ZB1A 4H58A 4MVFA 3M2WA 1E1VA 4G17A 5IDNA 3A61A 3KF4A 4A07A 3F3UA 3A4PA 3SOCA 2VWUA 2WELA 3UVQA 4DEAA 4XV2A 2FO0A 1H1WA 3T3VA 5CF8A 2IW6A 2E9UA 3A62A 1WBSA 4NH1A 3FI2A 1UVRA 3ULZA 4EWQA 4DBXA 3CLYA 2WEVA 3NAYA 4GFMA 5HBJA 4II5A 3QQFA 3TKUA 4TL0A 2W1DA 4QO9A 3KULA 3OF0A 4UZHA 4FA2A 2R3QA 2VTSA 3MTFA 4D58A 4QP1A 3KRWA 1M7NA 5EDQA 4F9BA 4FV8A 3BZ3A 4YJRA 1YI3A 3QTWA 4JBQA 2E9PA 4EONA 1Z9XA 3VONA 1VYWA 3BL7A 1MRVA 4E7WA 1KSWA 1I44A 2BZKB 4FKUA 5K0KA 3QLFA 5KHWA 3Q04A 1YDRE 2FSMX 4I6HA 2C6LA 5EQYA 3MY5A 1PKGA 2IJMA 4BCFA 2X7GA 1UNLA 2BROA 4RFZA 4I5MA 2BVAA 3G90X 4EHGA 5HU3A 3KMUA 5HCYA 4OT6A 5KZ0A 3UPXA 3UDTA 1PXNA 1QPCA 1X8BA 3GNIB 4OBQA 4XLIA 1IEPA 4X21A 4CEGA 3E8CA 5IQEA 4O21A 4QMWA 2X0PA 4M69B 3V8SA 2F57A 2WTKB 3OOMA 4LG4A 3WILA 4AFJA 5LMKA 2VTMA 3W0NA 3UNJA 3TDVA 4F1OA 4MEDA 5AUTA 4ZY4A 3IW7A 1KE6A 1UV5A 4CYIA 2UVXA 1PXOA 3HP2A 2ITOA 3ELJA 4FL1A 4IX3A 3FHRA 4QQJA 5CSXA 1J3HA 5T3QA 3ZS5A 4C7TA 3NNXA 1M17A 1ZYDA 2ITVA 3PVWA 4FG7A 2WFYA 2PSQA 2CN8A 3BE9A 4J8MA 4WSYA 3U9NA 4C2VA 4DG0E 5JFVA 2UW5A 5M07A 4F64A 1H4LA 4JIAA 1PKDA 2JBOA 3D5UA 4NYEA 4BHZA 2HYYA 4L9IA 3L9NA 4BRXA 4FEVA 1KV1A 2VO3A 4NT4A 4QRCA 3H30A 4ASDA 2BIYA 3QXOA 2Y4IB 4RLLA 3RZFA 4F6WA 3GU8A 4TYJA 5IH6A 3G6GA 4FT5A 1BI8A 3CJGA 2WU7A 2VWWA 1OIYA 3BQCA 3JVSA 3PIYA 4UBAA 2IZSA 4GUBA 5HCXA 3BGZA 3C0IA 4BYIA 3R04A 4GVAA 3BLHA 1UNHA 2XJ1A 4R6VA 3BGPA 4U40A 3E64A 5AIRA 5E8TA 5KBQA 4AF3A 4HYHA 4IWQA 4FSZA 4I5PA 2ITXA 4W4XA 4AQCA 3DV3A 4IM2A 4EOLA 1APME 3BELA 4TY1A 3P0MA 1OGYA 5AV0A 4RMZA 3RWQA 2J9MA 2CLQA 5J79A 4KBKA 5H8GA 4J99A 5JGBA 5CNOA 4R3CA 4G9RA 1JWHA 5CASA 2XANA 2V55A 3Q9ZA 3LCOA 5A54A 2VAGA 2AUHA 3LXKA 3VAPA 4BWXA 1NXKA 1CDKA 3GCVA 5DLSA 4EKKA 3SG9A 3SRVA 4M66A 4PWNA 4MAOA 2VN9A 1YXXA 4J8NA 5CANA 2P55A 1JKLA 5LARA 1FOTA 1OVEA 2HY81 3FKNA 4J98A 4QMLA 1GNGA 5DT3A 4LMUA 5CQWA 2C4GA 3WARA 3WBLA 3EYHA 4DFXE 5JH6A 4L7SA 4FV6A 4B9DA 5K0XA 5E9EA 2HCKA 3IW8A 3KQ7A 4G3FA 5GIOE 1XBCA 2R9SA 4AW2A 5HTIA 2FSOX 4ZEGA 2J0IA 3BYVA 5JMSA 4ANLA 2BIKB 3BV3A 3QA8A 3PXFA 2VTIA 3PA3A 2GPHA 3NNUA 3FYKX 2JD5A 3R22A 4YSMA 3Q96A 5J95A 1K9AA 4BGQA 3P9JA 1DAYA 5M57A 4BCNA 3PG3A 4OAUC 4FSWA 4CFWA 2RF9A 3QA0A 3QD3A 3QD4A 4Z3VA 4KD1A 3W0RA 2R7IA 4GV1A 3DK3A 3D7ZA 1MRYA 3KB7A 2XNMA 5AX3A 2QLQA 3W33A 1ZOHA 4YC8A 4AT4A 4AW1A 4F6UA 2CKQA 1H07A 4RVMA 4N57A 3FMDA 4O0SA 4CV9A 3I79A 4FYNA 4P4CA 5L3AA 5BVWA 3VUGA 4ZJVA 3ZBXA 3FXWA 1KE5A 3KIOC 4G2FA 3ZM4A 2BFYA 3EQRA 5A46A 3ORLA 1IG1A 4UN0C 3C4CA 4IHPA 2OFUA 4O7LA 5H3QA 5J5TA 1DI9A 4AZWA 4XV3A 3O2MA 4KSPA 2XYNA 3ZCLA 4MD9E 1JKKA 1GZNA 3QWKA 5CEMA 4L46A 5EM8A 3ZBFA 5DNRA 5H8EA 4BDKA 3COKA 2PE2A 3F88A 3KC3A 4QMTA 5FP5A 3VJOA 3I7CA 4F63A 3CTJA 5BPYA 3MH3A 3CD8A 1R78A 2XJ2A 5E4HA 3Q9YA 4GU9A 4NTSA 4HVDA 3AC3A 3FI3A 3ROYA 3TV7A 4DHJA 1YQJA 3FC1X 4ZTRA 4O91A 4XV1A 3D7TA 4EHZA 5K9IA 5H8BA 4EK3A 2BKKA 1H27A 4HVHA 3LFQA 4MXYA 3KRLA 5C1QB 1OKYA 3VS2A 2RG5A 3QKMA 2GNJA 4IADA 5CWZA 2JGZA 2NP8A 3MESA 3IONA 3D14A 5J9LA 4RWIA 3W2RA 4EH5A 3LE6A 3PVGA 1JVPP 5EHLA 2C6TA 2CKEA 2QC6A 1V0BA 1KOAA 3PSDA 3LXLA 4CQGA 5JGDA 5CI6A 4NFNA 2P0CA 2YN8A 4FV2A 2OFVA 5IKWA 4D0XA 3GB2A 2YM4A 3HLLA 3UIBA 5E1SA 3LJ0A 3NNWA 2XBJA 2RIOA 2BRNA 2R3OA 4E93A 2XH5A 4O7YA 3QGYA 3FQSA 1L8TA 5DT4A 3L1SA 2X4ZA 3O17A 3LLTA 2HZ4A 2V5QA 4E6CA 4F70A 3LFNA 3NZ0A 5HKMA 1Q8ZA 4EOMA 2KTYA 4JX3A 4QMXA 3WF8A 4CV8A 3ZYAA 3KREA 3MYGA 3QCSA 4JX7A 4KIKB 2VTQA 4XNEA 1DAWA 5E8SA 5AAFA 4IJ9A 1SZMA 2HAKA 3DBQA 3E3PA 3PY1A 4HYIA 4NUSA 4QQCA 4U42A 5ACBC 4AA5A 4ANMA 1YOLA 4K9YA 3VO3A 4IH8A 4A9TA 3C5UA 2B0QA 4GCJA 4I0SA 4MBLA 3OS3A 3MFRA 1WVYA 3MVHA 2PTKA 3R71A 2FYSA 3OWPA 4XG2A 5B2KA 3VC4A 4GH2A 4JT3A 4XG6A 5GZ8A 1BLXA 4KRDA 4IAYA 4O1PA 5FWKK 4ZSEA 1JSTA 3V01A 5C26A 5L2IA 1U54B 3LXNA 5LVPA 2P33A 2BUJA 3ZUVA 4ZSJA 2HENA 5AP1A 4G3GA 5BV3A 4AXFA 3NUYA 3ZOSA 5E90A 5CNNA 2F2CB 4OBPA 2ITWA 3A2CA 3OBGA 1Q5KA 5ETCA 3VBWA 4TYHB 3DK6A 2JDTA 5J8IA 4A9YA 2R5TA 2HWOA 4AGUA 4GS6A 2CGXA 4I94A 4BCGA 5AP4A 5FEQA 4CGAA 4OBOA 3ZSGA 2EXCX 2HIWA 2VD5A 3PJ8A 2EU9A 4V01A 3RAWA 3K3IA 4OT5A 4QTCA 1QMZA 2XKFA 1ZMUA 3DK7A 4PTEA 1FBNA 2CNVA 3G5DA 3ZEWA 2J90A 4O96A 1SVHA 4WG5A 4JG6A 4CKIA 2R3FA 4MBIA 5B2LA 3GUBA 4KKHA 4WRSA 3ET7A 2IZUA 2H6DA 4KUJA 4FKWA 2XIYA 5D10A 4EOOA 3PDTA 2PVLA 3OUKA 4YNOA 3MB6A 1KUTA 2F7EE 4IAIA 5J87A 1XMLA 4OTDA 4ZLYA 5LCJA 5DR9A 4XP0A 4ZAUA 3F61A 3ORXA 4FZ7A 3E93A 4YLJA 4GL9A 4RIOA 4QYEA 3PP0A 3DQXA 3NUAA 1H1QA 3DCVA 1GIIA 4DDGA 3FLNC 4RC3A 3L8SA 5FEDA 2VV9A 4DGGA 5C8NA 3A7FA 3CPCA 3ZDUA 2IVSA 4GU6A 4JLCA 4MD7E 3NMUF 5FTOA 2W9ZB 3QTQA 4U3ZA 4O86A 3IECA 2C30A 2ZV9A 4QDEA 3P7CA 2JLDA 3EFKA 5DR6A 4JDIA 4ZTNA 1IA9A 1QPDA 3R02A 4QQTA 4QOXA 3IDCA 1WBTA 4FKPA 3MJ2A 4CFXA 1CTPE 3ORNA 3HMIA 4ZOGA 4RJ8A 5ETFA 4ZMEA 1U5RA 4GKIA 2LGCA 3UG1A 3C4ZA 2G2IA 2KULA 2OIBA 4R77A 3P1AA 3QTIA 4G6NA 4OTFA 1RE8A 3ZTXA 4E5BA 5IU2A 5DPVA 2UZVA 3QAME 4NKSA 3EFLA 2YM8A 3EKNA 2NRYA 4IZYA 4QP6A 1Q3WA 2BCJA 4FTUA 4O0VA 3W55A 3RAIA 2I7QA 4D1XA 4D55A 2JBPA 3VQHA 4HPTE 3M42A 3H10A 2Y6MA 4G34A 4E1ZA 3T3UA 1VZOA 3II5A 3NFGB 1FMOE 1PXPA 4S2ZA 4WNOA 2JEDA 4L3LA 3IG7A 1R0PA 2W1ZA 4AOTA 4R5YA 4BTFA 4EEVA 2R3RA 1H01A 3QRJA 4N4SA 3IW4A 2J0MB 4FGRA 5E7RA 5C4LA 2OH4A 4FTJA 2XK7A 2I0HA 2BRHA 4PQNA 2W1GA 3P86A 1H08A 3EOCA 3EFJA 4K0YA 4RIWB 2OKRA 5EHYA 3KVXA 5D41A 5B7VA 4DTBA 4CG8A 2BRBA 4GT5A 4IX6A 5CF5A 4KNBA 3VVHA 3W18A 4MF1A 4AAAA 3Q5IA 3PTGA 1RJBA 1BX6A 2XEYA 4IWDA 3R01A 5ACKA 3UIUA 1XH7A 2XNEA 1Y91A 3DNDA 2O63A 3KEXA 3PXZA 5AV1A 4O7NA 4UB7A 2DS1A 4DT8A 2VWIA 1OKZA 4PMTA 4F9YA 1H25A 2W17A 1GIJA 4DEGA 4YHTA 3OOGA 3VF8A 2WU6A 4DC2A 4EH9A 3NYNA 1K3AA 3GQIA 2V7AA 3E88A 4RJ4A 2OIDA 2QO7A 1XWSA 3QUDA 1KV2A 3MDYA 3DXQA 2Z2WA 1KOBA 4PP7A 5JEBA 3QRKA 2W1FA 4YPSA 4E6QA 3VUHA 2UW0A 3QQHA 4IAZA 4TWPA 3AT3A 3QBNA 4E26A 2YJRA 5JFSA 4U81A 4P2KA 2PL0A 4F08A 3BYSA 4BIBA 4Y72A 5H9BA 4O0TA 5LWNA 3HRFA 1WBVA 3O0GA 1ZAOA 3TEIA 5IH5A 4E4XA 2A98A 3C13A 5GJGA 3HMOA 4NM7A 4QMZA 4DTAA 5HZNA 4IEBA 4AX8A 4UMQA 1OITA 1FQ1B 4L45A 4AXEA 2X6EA 2BDFA 4BL1A 2Y4IC 4X7QA 4U3YA 1PYEA 3G2FA 2H8HA 2XK9A 2O3PA 3BBTB 3QTUA 5HNBA 3R28A 3G15A 5AUVA 4RX7A 2XCHA 4DG2E 2WNTA 4YUQA 2GFSA 4MXAA 3DFAA 2R3PA 2QHNA 3V51A 5ANDA 3C0GA 4J52A 4FV4A 5CSHA 3V5QA 4NK9A 2PVFA 4BCIA 3ODYX 4NTTA 4P90A 1Q41A 5I4NA 1UA2A 1DS5A 3EL8A 5HEZA 2QG7A 4CCBA 2PVNA 5FRIA 5EH0A 5FTQA 2JC6A 1TQMA 4FVRA 1IRKA 1PJKA 4JDHA 2JKOA 4K18A 4ACHA 4CXAA 2E9VA 5CAOA 3MGYA 1ND4A 3FMMA 2WTCA 4NW6A 2CKPA 2OW3A 3P08A 3MJ1A 3SQQA 5EYCA 4BCJA 3T9IA 5IH4A 5JN2A 1ZWSA 4FT7A 4FTAA 5ETIA 3F2NA 3ZFXA 3FL4A 3ZZEA 4EH3A 4EOIA 2NNWB 5K4JA 3FHIA 4FEWA 5CAUA 2P2HA 1U46A 3PUPA 1W2CA 2XIXA 3E8DA 3WOWA 3G0FA 4PDYA 4E6AA 5HICA 5M06A 5CVGA 4U43A 4FZFB 5F4NA 4TRLA 3LMGA 3LIJA 2Y9QA 2RGPA 3NYXA 3GU6A 3B8RA 3CE3A 3EN9A 3MBLA 3NW5A 3SV0A 3ZMMA 4A9SA 4AT3A 3TUDA 4EH7A 5HLPA 3HAVA 4FNWA 4QMSA 2IVVA 4BICA 2QOKA 2X9EA 4TW9A 2GS6A 2QOBA 2YCQA 4XEYA 5LWMA 3P4KA 5CX9A 4PMMA 3ANRA 5ANEA 2FUMA 3W0MA 5IF1A 4ZMFA 3OFMA 4FBXA 4L43A 4BCQA 2WGJA 3U6HA 4AN2A 4APPA 2Q0BA 2PVKA 2VWYA 4YTFA 3QX4A 3TI1A 3CQUA 3F2AA 5LQFA 3PPJA 2J4ZA 4YGAA 2VO6A 3F69A 4HYSA 5B0XA 5L6PA 5HHWA 4IWOA 3FPQA 2W4KA 4C2WA 4UWYA 4JQEA 2RSVA 5KMIA 4HJOA 2A19B 2B53A 4G3CA 4GVJA 5AFVA 3OCTA 3SXFA 4DLJA 3CY3A 5DG5A 1QL6A 5AP2A 3A7IA 3EWHA 3UP2A 3ZC6A 2QURA 4XP2A 5D12A 4YSJA 5I9VA 3LFDA 4AAYA 4QYHA 4C35A 2GS2A 4AN9A 4BF2A 5IEXA 3D94A 1VJYA 1ZY4A 3BX5A 3NR9A 4YZBA 3D9VA 4X2KA 1OIUA 3PYYA 4KA3A 4KABA 2XJ0A 4QNAA 4I23A 3GC9A 1PXLA 2R0UA 3SRVB 4FKQA 4FL2A 3R8UA 4RQKA 3KA0A 5IG1A 4ANNA 4Y8DA 4YHJA 4NSTA 2ITTA 4RRVA 1BI7A 3F3WA 3QYZA 1YHSA 4WG3A 5J7BA 1NT2A 2X4FA 1YHVA 3HUBA 4M14A 4LV7A 3K5VA 2J6MA 3U55A 3LPBA 2I0EA 3O7LD 3RBWA 2VWZA 3HVCA 3BV2A 4M97A 1SYKA 4NM0A 3UVRA 3ATTA 3PLAE 2YM7A 4MUQA 3F7WA 4BCKA 3ZEPA 4YTHA 3UZTA 3D15A 3MIYA 4S31A 5DN3A 3TZ9A 3N4TA 3W16A 2W5AA 3QKKA 3QLGA 4WD5A 4ZTHA 3OROA 5EHOA 5IPJA 3W2PA 2PZ5A 1VLRA 2PVRA 1G3NA 3R8PA 4YZMA 4BI1A 4C58A 4YMJA 2I0YA 4PPBA 3OXZA 2UZWE 3KKVA 5CEIA 2ZMDA 3V5JA 3BLAA 5DOSA 3CIKA 4PV0A 4GRBA 4C4EA 3BHYA 3OCBA 4QMOA 4O22A 2HZ0A 4O4DA 4F65A 4ZSGA 5AADA 5CALA 5HTBA 2V7OA 5FG8A 4DCEA 4WUAA 5M55A 3PIXA 1OM1A 4PDPA 2W1IA 5GZAA 5HO7A 1REJA 2B9FA 4K11A 4R7BA 2UZNA 3TNQB 2OK1A 2OSCA 4HCTA 5DGZA 4FKRA 1OBDA 4FSUA 3KMWA 3R63A 5LMAA 4ZLOA 3LFCA 4L3JA 3O8UA 3FMLA 1M14A 2QR7A 4TWOA 4YR8A 4RJ7A 4F1TA 4BDIA 4R1YA 2OO8X 3PY0A 4CLIA 2PVJA 2UZOA 4I5CA 2OZAA 2XB7A 2YDIA 2GCDA 3BYMA 5AAEA 1LEZA 2EB3A 3QQUA 4LL0A 4DH5A 4O7VA 4QNYA 1IAHA 2QVSE 1Z57A 5AWMA 4BI0A 2XUUA 3TMOA 4NEUA 5EKOA 4D28A 3UQFA 3GU5A 1Q24A 4EHVA 3UYTA 1F5QA 5AUXA 4FTOA 4D2PA 3LQ3A 4QEBA 3OXIA 4ZSAA 2OGVA 3NPCA 1M52A 5IUGA 3OC1A 3C7QA 4NCTC 3A4OX 3CS9A 3GCQA 3LQ5A 3Q4ZA 4A4OA 2GNLA 2XA4A 3FQEA 3NW7A 4MK0A 3TTIA 4IZAA 4AE6A 5AAGA 5FM2A 4CQEA 4BGHA 1P2AA 5HX8A 4B4LA 2WMWA 3F9NA 4RVKA 2VGPA 5HLWA 4ENXA 3R9RA 3HYHA 3R00A 4EK8A 3E63A 5FDPA 3NVMB 1NVSA 4C38A 4JRNA 3DTWA 3DTCA 3UYSA 4LUEA 4BVUA 2G01A 5GJFA 3V04A 1XR1A 5I3RA 3BBWA 3FSKA 4UMRA 4O84A 5L2TA 4ZJJA 2YZAA 4C3RA 1H0VA 3W2SA 5AV4A 4MCVA 3TNPC 3QC9A 3AC8A 4H3BA 1OI9A 5A6OA 2PVHA 3RNIA 4F78A 5ITAA 3UO5A 4Q2AA 4LGGA 5FUTA 3HX4A 4XMOA 4FE2A 1H00A 2HZIA 2O8YA 3FI4A 2J2IB 3BI6A 4LMNA 3SHEA 4FI1A 3ZLWA 3EZVA 3Q4TA 4QPAA 2A4LA 2X9FA 3KF7A 4FKSA 4JNWA 4A06A 5EQEA 1Y6BA 4WRGA 4GFGA 4DN5A 1F3MC 3WE4A 3QX2A 5I5ZA 3DJ5A 1JKSA 5GHVA 2J7TA 3W32A 2FGIA 4D0WA 4AXDA 5EW9A 4Z16A 4RPVA 4DFZE 3WIKA 4Y46A 2NO3A 4H3PA 2AC3A 5EFQA 3QFVA 4O6LA 5M4UA 2ZM1A 3LMHA 2I1MA 5KUPA 4C59A 3ZLSA 4FOCA 2WTWA 3S95A 2ZM3A 3VQUA 4GKHA 5BYZA 3PZHA 4NU1A 3UC3A 4D2SA 3GGFA 4CT2A 4S34A 5DE2A 1Q3DA 4EH6A 2VX0A 4L67A 3LW0A 4Y85A 1UU9A 4R8QA 4C62A 1XKKA 3P78A 4TNDA 3ZUUA 3R8VA 4WOVA 2XAMA 4JAJA 4CMOA 4N6YA 2UW3A 4OLIA 4U97A 4DHFA 4C34A 3SKCA 3ZM9A 4QT1A 3UVPA 1OIRA 4BDGA 4UX9A 3FZTA 2X1NA 2B55A 1F0QA 4FKVA 3HEGA 3OY3A 3VBVA 2VTLA 2XIZA 3C9WA 2WTDA 3IS5A 3CXWA 4EHEA 5J7HA 1W84A 5FBOA 3P7AA 3P23A 3R0TA 4IACA 3FQHA 4YJUA 5I9WA 1PY5A 2I0VA 2X8IA 4FKJA 3FI8A 2X0GA 4FR4A 3RM6A 2C5NA 4MHAA 3K54A 3QKLA 3QRIA 4L00A 5E8YA 3QCQA 2QONA 2W4OA 4ZZMA 4V04A 4APCA 5IQGA 3D2KA 3K2LA 2WMVA 4O6EA 5F95A 3IGOA 4FTQA 4I6BA 3O5AA 2YFXA 3QXPA 1YOJA 3JY9A 4YJNA 5HD7A 3HV4A 3UOKA 1PF8A 4KAOA 1V0PA 2WMAA 4RG0A 1P4FA 1SVGA 4PUZA 3TJCA 2BAKA 1W82A 4ZZOA 3TNWA 3ZO3A 4NIFA 3ML1A 2YIYA 4MXCA 5HTCA 1JPAA 2PMIA 2VWVA 4IAKA 5D11A 2RKUA 4M12A 3WF7A 5A4QA 2W9FB 4BBFA 5I9XA 3U6IA 3IW6A 3JVRA 2GQSA 4ACMA 1WAKA 2C0TA 2HXQA 3UOLA 4USEA 2XK8A 3QTXA 4HYUA 4IVDA 1OZ1A 3PY3A 3LHJA 1ZY5A 4FIIA 5A4EA 4C3PA 3Q2JA 5IMXA 2ITUA 2IG7A 1OIQA 4IANA 2WMXA 4EOJA 2VNYA 2Q0NA 4L44A 3KRXA 1ZXEA 3IOKA 2ESMA 2ERZE 2VWXA 3PP1A 2W1HA 5E91A 3VBYA 3W2QA 1ZZLA 3VHEA 4I93A 3LJ2A 3DKGA 2XIRA 2YHVA 1XH8A 2CGVA 3ORZA 4U44A 5HG8A 2UZBA 3IQ7A 4R7HA 3SA0A 2OBJA 3OCSA 2R3LA 2WTJA 4FNYA 4NJDA 5AV2A 3D5XA 3VS7A 5LVNA 4ITIA 3A7JA 4O4FA 4R1VA 2PUNA 4WBBB 4M13A 5TOZA 3O8PA 2GS7A 4X2GA 3FZSA 4PX6A 3DB8A 2QNJA 2WB8A 1Q8YA 3I60A 3PE2A 1J7LA 1A06A 4ERKA 4D1ZA 2OJJA 3MTLA 5EYKA 4BDEA 2JFLA 4GK3A 5AP0A 3N4VA 3H9FA 2C3KA 4GT4A 1GZKA 5HVJA 2Y8OA 3FBVA 3MPAA 5D9HA 5M51A 3RI1A 3TXOA 4ARKA 1V0OA 3C1XA 3LAUA 4A4XA 2Z60A 4DF3A 3NVKI 4ACCA 4YJVA 3GCUA 3I6WA 3UIXA 4BDFA 5E8XA 2B9HA 3DS6A 5M53A 4FG9A 2X2MA 5HD4A 4RA5A 1PXKA 4FT3A 3DAEA 5BUEA 4XRLA 5AM6A 3QYWA 3G33A 3I0OA 2WQOA 3W8QA 4U79A 4XG3A 1L3RE 5KX8A 2Z7RA 3UC4A 3I5ZA 1RDQE 3NLBA 3R9DA 3T8OA 3PJ2A 3PIZA 2BPMA 4BDHA 3R7OA 2Q83A 2UW9A 4KBCA 3POZA 4RX8A 4BKJA 1T45A 3PA5A 2PULA 2Z8CA 4BWKA 2YAAA 4TN6A 2J0JA 4JG7A 2P2IA 3FV8A 4MWIA 2GU8A 3FKOA 3L9PA 2PVYA 1HOWA 3AC4A 4XLVA 3ZH8A 4BDBA 5DR2A 3BU6A 5AP6A 5EM6A 3FSFA 4HGSA 4TYEA 5BQ0A 1Q61A 2UV2A 4TKSA 5FBNC 1UU3A 1O6KA 2RFEA 4AUAA 4CCUA 4CFFA 4YLLA 5M4IA 4WUNA 4FT0A 4QTEA 2OJIA 5KKRC 4JL9A 3AC5A 4FNZA 3FLSA 3DZQA 4LRMA 5HNIX 4YZ9A 1WBPA 3E8EA 5JGAA 1S9IA 5T6KA 3NDMA