3WZJA

Crystal structure of human mps1 catalytic domain in complex with 4-(6-(cyclohexylamino)-8-(((tetrahydro-2h-pyran-4-yl)methyl)amino)imidazo[1,2-b]pyridazin-3-yl)-n-cyclopropylbenzamide
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
279
structure length
257
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Discovery of Imidazo[1,2-b]pyridazine Derivatives: Selective and Orally Available Mps1 (TTK) Kinase Inhibitors Exhibiting Remarkable Antiproliferative Activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 73
structure length 257
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wzjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wzjA01
4A9SA 3QYZA 3ORXA 2XKEA 5IA0A 2C6EA 1R39A 3OVVA 3NAYA 4KD1A 3PZHA 3MJ1A 2V62A 3IQ7A 3OUKA 4FSQA 3JVSA 2ITYA 4K0YA 3U6HA 4IZ7A 2J0MB 2AUHA 4RLLA 5HIBA 4F1OA 2ZYBA 3DXNA 4ZTSA 5EM7A 5DR9A 3MH0A 3OT8A 1PXKA 2ZVAA 3CJGA 2WMAA 4R8QA 3CEKA 4ZS4A 1KE7A 3EH9A 1G5SA 2VUWA 5L6PA 2YISA 4O7VA 5HVJA 4I5MA 3UYTA 1H25A 2BAQA 1OKYA 4JR7A 2PUIA 2WMSA 4RFMA 3FLSA 2B53A 3LXKA 3QD3A 4JRNA 4O0YA 5AX9A 4BDBA 3OY1A 3SRVA 1W82A 4ANNA 2EXMA 3MS9A 3RPVA 2WD1A 3V5PA 4R3PA 1UU3A 5HOAA 3V6RA 3TDVA 4CTCA 3I5ZA 1GJOA 5AUUA 5JT2A 4PP9A 3RVGA 4EZ3A 3ROCA 2ONLA 2VTTA 4BCQA 2BR1A 2QOHA 1WBNA 3P4KA 4E93A 3MESA 3GGFA 5E8UA 3R9DA 4DEEA 4QMNA 1Y6BA 3DKCA 3FYKX 4GYGA 5AAFA 3WIGA 4D4VA 5J5SA 2GSFA 4BVUA 1XH6A 4HJOA 5ANDA 3LFFA 4IX4A 4NJDA 3FMDA 5FBNC 5TO8A 3KVWA 2WMWA 3UP2A 5HNIX 1E1XA 4C4FA 5JZJA 1BI7A 3DBFA 4QQJA 4A9TA 3IDBA 4JQ8A 3L8XA 1U46A 5HBEA 3OF0A 4AFEA 4C02A 2C69A 3DQWA 2Q83A 2VO0A 1OECA 2X6EA 3HAMA 2WKMA 4TWNA 3K3JA 3NDMA 4YR8A 4J98A 2Z8CA 4G5JA 2DYLA 4MXXA 3BWFA 3F2AA 2PUPA 4Y83A 4YJRA 4HCUA 3FXWA 4BTMA 3RM7A 2VAGA 1Q97A 4FZFB 4EYMA 2CNQA 2PVRA 3PIYA 5BUJA 5IA1A 5C4KA 4CKRA 1BX6A 3QRKA 3KN5A 4FTRA 2GTMA 3HMIA 5HVYA 2Y4IC 3TEIA 3HUCA 3L9PA 4LMUA 2CHLA 2BPMA 3I6UA 3R71A 4QP2A 2VGPA 2XNEA 2UZWE 3QKLA 1YHVA 2FSMX 4GFMA 5KMJA 4UMRA 1VYZA 5GZAA 3O50A 1IRKA 3DXPA 4O84A 2WQEA 1ZMUA 3FC1X 3C4ZA 3OW3A 3KK9A 2PZIA 4U97A 2E9VA 3V5WA 1Q8ZA 3Q5ZA 2EB2A 4IJPA 5ANEA 1B6CB 3LJ2A 2W1EA 3P7CA 3BGQA 3RHXA 5L3AA 4GKHA 4FTKA 2JFMA 4Y5HA 4QPAA 3CPCA 5CU4A 3V3VA 3PY1A 4YBJA 5HTIA 5E8SA 2HW7A 4RMZA 4YLLA 3RK5A 4KINA 4OR5A 1IR3A 3OOGA 3PFQA 2IW6A 1H4LA 3V51A 2W1GA 2WXVA 4LOPA 4MXAA 3DK6A 1YI6A 5EYCA 3REPA 3VUHA 4MYGA 4ALWA 4CMTA 4CVAA 4XV3A 1EH4A 3ZRLA 3EWHA 3FJQE 4O0XA 5CF4A 3QAME 5KUPA 3VS1A 3FWQA 3KEXA 3FMKA 4KIOA 1JQHA 3F88A 5EK7A 3D14A 4O7ZA 1Q8WA 3PE2A 4ZK5A 1ATPE 4O7RA 4DH5A 2GNJA 3F82A 3NUPA 5EFQA 3TJCA 3IK3A 4CFNA 5J5TA 2C0OA 3DJ5A 3NEWA 4FNWA 3TTJA 4C2WA 4BCMA 3D4QA 4QYEA 2IW9A 1M7QA 2QLUA 4M68A 3VUDA 4BZNA 4UMTA 4C4JA 3HA8A 4YMJA 5JH6A 4GIHA 2R3PA 2WIPA 4AQCA 3QHRA 3FC2A 2UW7A 4AACA 2UZBA 3HVCA 4PTGA 4ZTMA 2ACXA 4RX9A 4YSMA 5E92A 5E8WA 3LCTA 4RX7A 4AS0A 4N6YA 2A2AA 3QTXA 1URCA 4H3PA 3UIMA 3GC9A 3RMFA 2XS0A 2BIKB 2J90A 4I24A 4PV0A 4PPAA 4L67A 2EXEA 5GNKA 5L8KA 2W1CA 2WQMA 2JDVA 2XIYA 4M97A 4QRCA 5HNBA 4LGGA 4DG2E 4IAIA 4BIDA 1WVYA 3ET7A 4CT2A 3RCDA 3R8PA 4K6ZA 4XCUA 5E8XA 3A2CA 1TKIA 2XNBA 4RC4A 2I0HA 3KMMA 3O8TA 3OCSA 4QMUA 1HCLA 3ZLYA 1ZXEA 4XBUA 2OKRA 3GC7A 4G2FA 3VF8A 5KZ0A 2Q0NA 4BZOA 4R7BA 3MI9A 3F66A 2OZAA 1ZYSA 1P14A 3F61A 4IAAA 5JN2A 3PRFA 4AN2A 4BDHA 3BYUA 3R7IA 2C5YA 3ZC5A 2WMUA 3FI8A 2BZKB 3CTQA 4IFGA 4X2JA 2O65A 3OP5A 3SOCA 3CS9A 3G9LX 4U42A 5AR4A 2ZJWA 4ZJVA 1KV2A 3P08A 3FQSA 3CQEA 3BU5A 4P5QA 2C3KA 2ZV7A 3CBLA 5HE2A 5LVMA 4ALUA 4LRMA 5A14A 2C3IB 4CV8A 3CGFA 4JJRA 3WARA 4DEIA 4GUEA 5KX8A 3HAVA 4FTOA 4F08A 4AT3A 1OM1A 2ITTA 3VRYA 3E63A 5LCKA 3D5XA 3MB6A 4ANOA 4EHEA 4D4SA 2W99B 4YGAA 2W1FA 1FVVA 2YLEA 4G16A 2J0LA 2XA4A 1JNKA 4O22A 4PDSA 3TZ7A 4CKIA 3DFCB 4F65A 2IG7A 4D4RA 3F5UA 1YHWA 3NW7A 5EW9A 4G3CA 4DFYA 4USDA 4E6CA 4RJ4A 1RW8A 2IVVA 5F9EA 2B55A 3PYYA 5AUTA 4MWHA 2E2BA 3OFMA 4YHFA 5JFWA 2P2IA 3NUXA 2I0YA 2OH4A 2OXYA 5HTBA 1PMVA 1JWHA 4NKSA 4BDDA 2W9ZB 5EW3A 1Q3DA 2BIYA 4G17A 3O7LD 2BUJA 4GMYA 5E91A 4IAFA 3GCUA 4TYHB 4AWIA 4FEXA 5FP5A 4O96A 2PZPA 4LMNA 4OT6A 3PE1A 4AGUA 2ZV8A 2OF2A 5CX9A 2GDOA 4ZTRA 5K9IA 4FOCA 3II5A 4AZVA 2P33A 4FL2A 4M12A 4J1RA 5HD7A 1SNXA 3KK8A 4BGHA 4QMZA 4N0SA 2PE0A 1MRUA 2UUEA 2YLFA 4FIIA 2PVYA 3VS3A 1Q8UA 2J6MA 4I6QA 4TWOA 4R78A 4FSRA 5EHOA 2VX3A 3IW4A 4LV5A 2XK8A 1M2RA 4JBPA 5F94A 4BDGA 4GG7A 2VTQA 4QYYA 3ZU7A 1J7IA 2PUUA 4MVFA 1Y8GA 4L46A 5ACBC 2X8IA 3AMYA 2Z2WA 1H1PA 3BGPA 3PA3A 3KXHA 3R21A 4FTIA 4PX6A 3QU0A 4RSSA 2NPQA 3COMA 4LRKA 3ZOSA 2QG5A 2UZDA 2PMNX 2V55A 3FL4A 4TY1A 3UVRA 5T3QA 4CQGA 5HX8A 1NVQA 4BF2A 2VTRA 5K5XA 4V04A 1XJDA 2R3JA 3QZHA 5AP7A 3PJ1A 4G6NA 4XMOA 4PNKA 2ESMA 2R3KA 2ZOQA 1PXIA 3QA8A 4FBXA 4BBMA 3NVKI 1YRPA 4JOAA 3KRLA 3PVGA 3EL8A 1PRYA 2ITPA 4NSTA 3C51A 5CXHA 5FQDC 4OAUC 5DMZA 4U45A 4XG6A 4XV2A 5ETCA 3COHA 4FV8A 4APPA 1KE6A 3AXWA 2WTJA 1OL1A 4OTGA 3QTIA 4N4SA 4H1JA 2FO0A 2B1PA 2YDJA 5AAGA 4QNYA 4MNEA 3VS6A 2X2KA 3FY0A 3HV3A 3Q9WA 4C0TA 4U79A 1A9UA 4OTWA 4FV1A 4WHZA 4D2WA 1GY3A 4L68A 5HU3A 3QUEA 4ZLOA 4FEWA 4RFZA 5LVPA 1XH4A 4O7WA 2P4IA 5IUHA 5JGBA 3ZDIA 3TDWA 1BYGA 1H24A 5L2WA 3C9WA 5DA3A 5IQCA 3D5WA 5BX0A 2WIHA 3H0ZA 4E26A 3E93A 4MBIA 5J95A 1UWHA 4QYHA 3PJ8A 2QKWB 5D7AA 2G15A 4V05A 3BHTA 5LWNA 5BNJA 1RQQA 2VD5A 3EQCA 4FK6A 4UALA 4C4EA 2RL5A 1UU9A 3ZEWA 4F63A 3WYYA 4Q5HA 5DEWA 1ZMVA 5HE0A 4QMLA 5D7VA 3QXPA 5AV2A 3FQHA 2GCDA 3VNTA 4NFNA 3TT0A 4ASZA 4IQ6A 4RVKA 4OBOA 4KKEA 5DVRA 4BCNA 4L9IA 5FTOA 5JFXA 4FODA 1WZYA 2C6DA 3EN9A 4QTAA 1Q41A 3IW8A 4D0WA 3Q4UA 4FTQA 4Q9SA 3FKNA 3I7BA 3MSSA 4FKUA 4J97A 4R3CA 5FEQA 1OBDA 2CCIA 2QO9A 2XJ1A 2BDJA 4H39A 2X7FA 2A0CX 2VU3A 4A4XA 3C5IA 3FI2A 3KGAA 3KULB 1H1SA 5EQPA 4ASDA 3KXXA 3ORNA 2BKZA 4F0GA 4FA2A 1ZAOA 4PMMA 3PSBA 1OL5A 4IWQA 3S0OA 4RIXA 1S9JA 5IMXA 3AGMA 3DFAA 4IM2A 1H0WA 3LFAA 3BEAA 4AP7A 4IM0A 4BBFA 4F6UA 4KIKA 5CU6A 1OGUA 2RFSA 2DWBA 3GP0A 4EBVA 5JQ8A 4CFWA 5DRBA 1M7NA 5HG9A 2VTAA 5BPYA 3AC1A 2V5QA 5AUXA 1FMOE 2FGIA 2ZV2A 5E8ZA 4FKRA 5J7HA 4FGRA 4RJ6A 4RIWA 3S00A 2F7EE 2HZ4A 3F6XA 3PWYA 4JX7A 4OBPA 4FI1A 3QL8A 3TKUA 2R3GA 4KNBA 3E87A 3OBGA 3QCQA 4KBCA 4BI0A 4O86A 3DS6A 4QTDA 4IZAA 5HBJA 3I4BA 4WG3A 3TXOA 4L42A 4O0SA 3BU6A 5FDXA 1F5QA 2RG5A 2VTHA 3PXZA 4QP8A 4CTBA 2PUNA 4D9UA 4F99A 1RE8A 4QTEA 3EHAA 5KMLA 1ZOHA 3NX8A 4TNDA 5M51A 4XG2A 2Y4IB 3HLLA 3VS5A 5EKNA 3UPZA 2J5EA 2BCJA 4FTLA 4MQ1A 4UWBA 3TIZA 1P5EA 1JKLA 3SHEA 4JAIA 1XKKA 3R2BA 2PVMA 2YDIA 3R8UA 1KE5A 2JAVA 3LXNA 3NUUA 5DH3A 4WOVA 3A8WA 3UO6A 3Q3BA 5D9HA 4BGQA 4DTBA 3QTZA 1H1WA 1YWRA 2H8HA 3Q9XA 4NIFB 4BKJA 3JYAA 3ACKA 4FZDB 1URWA 4X3FB 3ZLXA 2HXLA 3DOGA 4DTKA 5J79A 3BI6A 3Q52A 1BKXA 3HZTA 4R7IA 3PVBA 4F7JA 1YXTA 4HW7A 2R3IA 3NIEA 5JMSA 2BILB 3D5VA 2WTKB 2B7AA 4Y5QA 5EKOA 2PVHA 3F9NA 2WEVA 3R8LA 4L7FA 5BUEA 3FV8A 4FSNA 5IKWA 2YJRA 4CYIA 3WZDA 4XEYA 1H27A 3TNIA 5GHVA 4IMYA 3FMEA 3DNEA 4GK3A 4MCVA 3GT8A 3K3IA 4FT5A 4H36A 2ITNA 4NM7A 4HVSA 4DG3E 5HVKA 2QU6A 3D15A 5CVGA 4GFOA 3NAXA 5IQIA 4K33A 4P5ZA 2VGOA 3AD5A 3GCPA 2R3MA 5TE0A 5LMKC 2CLXA 4NK9A 3EOCA 3NNXA 2F49A 3IO7A 5J9LA 1H07A 1Q24A 3D7TB 2R0UA 2C5NA 5TOZA 4EH7A 5M06A 4QP9A 5CVFA 4FTUA 2JGZA 3FQEA 3W55A 4XHKB 5KMMA 3KXGA 4J8NA 5EM6A 4AU8A 4QMOA 1OUKA 2YM3A 4FG7A 4TYJA 5H3QA 4O7NA 2BALA 5IH4A 2HCKA 3MGYA 4YJVA 4ANMA 2UV2A 4M3QA 2C5XA 4U43A 3W16A 5H9BA 3HX4A 1VYWA 3P0MA 3FMMA 1R1WA 4ZJIA 3DY7A 4KA3A 1H8FA 2QNJA 2I1MA 3L9MA 3IGOA 2ETKA 4QOXA 2J9MA 4ZIMA 3TKHA 3W10A 4C4GA 2JITA 3ZUVA 4Z3VA 4YJQA 3SVVA 2B9HA 3SD0A 4XRJA 3U8WA 2B4SB 4IAYA 3ZO1A 3ENHA 3LJ0A 3F5GA 5HNGA 4EOKA 4PWNA 2JBOA 2B0QA 3L8VA 2X39A 4RC2A 5HO8A 3QRJA 4NH1A 3TV6A 2OJJA 3KB7A 4I93A 4RZVA 3PTGA 4V0GB 4FIHA 4I23A 4BTFA 2JIIA 3AGLA 3O8PA 4XH6A 4ZY4A 4ZSLA 4ZS0A 4BR3A 4YNOA 1YHSA 1NY3A 5IH6A 3RAHA 3RNIA 4DEAA 4WKQA 2VTSA 1GNGA 5JRQA 3G15A 3DDQA 3GU7A 3PXFA 4FSWA 4CXAA 3TWJA 2WEIA 5FP6A 3LMIA 5HCXA 4FEVA 3KL8A 4O82A 4IX5A 4PY1A 4ZSGA 5DLSA 3UC3A 5HQ0A 1WFCA 2XCKA 2B9JA 2C6KA 2GNGA 4MXZA 4EBWA 3ORZA 2YN8A 5DYJA 4ZSAA 1PMNA 2ONLC 3GQLA 3ZFXA 4QO9A 3B8RA 4WNPA 3LPBA 3TUBA 4FTNA 4IB5A 5D11A 4I4FA 4JG6A 3DU8A 3OOMA 1WBOA 1FQ1B 3D2IA 4RJ8A 4FZ7A 4MWIA 3WF7A 5IQDA 1WAKA 3VBWA 2OGVA 2W4JA 4GS6A 5GJGA 4ACDA 1WVWA 4U7ZA 2YCRA 4ORKA 5HD4A 4CMUA 3NUYA 4RRVA 3AT4A 4KSQA 3BX5A 4XUFA 4YZMA 2WPAA 2WU6A 3F3VA 1OL7A 4J95A 5DI1A 5L2TA 3DZOA 3UOKA 3UYSA 2HK5A 3VBVA 2VO7A 3WZJA 3O23A 4JQEA 1Q8YA 5M53A 2C30A 3O96A 5CQUA 3KRRA 3K54A 3DK7A 3Q4TA 1VZOA 2W1ZA 3KCFA 2E9OA 2VTPA 2EXCX 3OC1A 4FIGA 3AD4A 1TVOA 4DEGA 3VC4A 2NRYA 2OLCA 2BDFA 4IVAA 4F1MA 1MRYA 1G3NA 3NSZA 4LRJA 2XP2A 4ALVA 4YU2A 3IGGA 5AP4A 4AA5A 3TUCA 2X8EA 3VS4A 3HDMA 5IDPA 4FV4A 2G1TA 3UPXA 5CF6A 3NZ0A 4DH7A 5IH5A 3M2WA 3FYJX 2A19B 5CQWA 5K3YA 1MP8A 5HE1A 2GS2A 5CAPA 2ETMA 5HX6A 4QD6A 2WQOA 5J8IA 3LCOA 1WBTA 4BGGA 3R1NA 1PYXA 2XIKA 3FMLA 5L4QA 5H8EA 3O7LB 4J7BA 3UIBA 4R3RA 5HI2A 4NTTA 5M4FA 3KRWA 5HHWA 3P5KA 3BCEA 2PZYA 3FKLA 3QCXA 4IW0A 3LFQA 4C2VA 4LUEA 1YXUA 4XG7A 4JL9A 4MKCA 3W2CA 2XK6A 1Y57A 4H3QA 2QG7A 2BZHB 4PDPA 1XO2B 5FXRA 2WTIA 4E6QA 4YJTA 1K9AA 4PPCA 3VJOA 4BCIA 3GUBA 3QHWA 4FSYA 2OFVA 3JR1A 4PDYA 2UW8A 2JDTA 3W2OA 4UN0C 2ITVA 2QOBA 2WOUA 2G2HA 3F5PA 4D1SA 3V5TA 2FSTX 3MVHA 3ZTXA 3IG7A 4YUQA 3TZMA 3UG1A 4S34A 4F7NA 1UKIA 4IVCA 4JI9A 2ITQA 3IECA 3EYGA 4C3PA 3NMUF 3VUKA 4WA9A 3UVPA 5FBOA 4AF3A 1DS5A 2J7TA 1Y8YA 4FL3A 4O27B 4BZDA 1OB3A 4YC6A 4XLVA 4X3JA 4A7CA 2QO7A 4FL1A 5DT4A 3A60A 1CKPA 3V5QA 4D28A 4RJ3A 2XCHA 4XLIA 3NGAA 3WE4A 4RFYA 3HGKA 1YKRA 3NUNA 5C8KA 4R6VA 5A6NA 3CSVA 2AC3A 4EQCA 4CFMA 2I0EA 1F0QA 1Q61A 3MB7A 3MDYA 4JDIA 4IIRA 4WSYA 4C59A 3OCBA 4GW8A 5A9UA 2X81A 4C33A 3MIAA 2WMTA 3AMBA 3C13A 3QA0A 3I5NA 3FMHA 2VX1A 1YWVA 5E1SA 4E3CA 5AADA 3KC3A 5GJDA 3W33A 2CMWA 2F57A 1ZOEA 2JFLA 3PP0A 2BFXA 4PUZA 1CKIA 4WUNA 4NW5A 3ZM4A 4FYOA 4FICA 3PVUA 3QX4A 5HE3A 4CSVA 2IZRA 2J50A 2IZUA 1WVXA 2BZIB 4NCTC 3TZ9A 3RWQA 2EWAA 4XP2A 3UODA 3RPYA 4FIFA 4Z9LA 3FEGA 4A4OA 1ZRZA 3KA0A 5HCZA 1DAYA 5BVFA 3DXQA 5C26A 1QMZA 4ANQA 2ERZE 4LG4A 3WILA 5CWZA 5AEPA 2CLQA 4L01A 1O6KA 4TYHA 4ID7A 4IWPA 3DLSA 3R1SA 4FV5A 4W8EA 3LAUA 2CNUA 2PU8A 3EQRA 4GIIA 3LQ8A 4UZDA 4JBVA 4LL5A 3E88A 1R0EA 5FG8A 4F1TA 3DB8A 2GNLA 2IVUA 2O8YA 2BRGA 3FSFA 2O5KA 3OHTA 4O2ZA 3LQ3A 4EC8A 4FVPA 3GU6A 1XWSA 3NYNA 3M11A 1KOBA 4YZCA 3E64A 3EFJA 5CAUA 1M17A 4ZSEA 3ZSHA 5KHWA 4DT9A 3G51A 2UZLA 1ZZLA 3R7EA 3F2RA 2FH9A 3ZBXA 3L1SA 5EYKA 3K2LA 3W2PA 1GZNA 3NYXA 4DH8A 5FM2A 1OZ1A 3AQVA 2OI4X 2OIBA 4MF0A 3BU3A 2CGUA 4OW8A 1ZYDA 4RWLA 2B54A 4YC8A 4YHTA 5J87A 4F6WA 5CEMA 2RG6A 5K0KA 5I5ZA 5ANJA 2YIQA 4EH4A 3O2MA 2UVXA 4FKIA 2UW3A 4FNXA 3GCSA 4ZMFA 3I0OA 4FKTA 3KREA 3E92A 4C7TA 5E90A 4M0YA 1DM2A 3NS9A 2R2PA 1OVEA 3JXWA 4PQNA 4BCFA 3NW5A 2J5FA 2Y4PA 2XNMA 3M1SA 3R83A 3PLSA 5L6WL 4O7YA 2HXQA 3LLAA 5M4UA 3PJ2A 3NWWA 4GKIA 1GZKA 2VNYA 2VTLA 4O7TA 1SYKA 4FKLA 5M07A 4G3FA 3ZH8A 4AOTA 1W0XC 3R63A 2XYUA 4L6QA 4B8MA 2HZIA 1WCCA 5AP3A 2YCSA 3R1QA 2QHNA 4NUSA 5H8GA 5HKMA 4W4YA 3RPRA 4BKYA 4ERWA 3OWKA 3QZGA 4ZEGA 3ACJA 4CKJA 2E9PA 2PULA 3QTQA 3WYXA 3G6GA 3BLQA 3ZRMA 2C3LA 2QLQA 3FI3A 4DH3A 3WOWA 1FPUA 4AUAA 4L45A 5FGKA 3R7YA 1GZ8A 1YDSE 3BV2A 3T8OA 5CSPA 1IG1A 3V01A 5A4QA 4B9DA 3MWUA 4S33A 3LMHA 3PY3A 3IOKA 4YJOA 1CDKA 4UBAA 4ACCA 4FKPA 2GNFA 3RAWA 2YCQA 4G3DA 3H9OA 5AAEA 2WMQA 2XH5A 4GT4A 5CLPA 4Z7GA 4JT3A 2LGCA 3TM0A 4F6SA 3FLWA 3HEGA 5HG7A 2W96B 4IVDA 3P9JA 3ORTA 4O7SA 3PY0A 3MY5A 4PTCA 5FWKK 5DG5A 5HTCA 3FZRA 4RA4A 3NYVA 3TN8A 1YQJA 3E8DA 1RJBA 3LFSA 5DIAA 3LKMA 2XJ0A 3QD4A 4I94A 3VUGA 2PVFA 3ORLA 1REKA 3QQGA 1OPLA 5ACKA 1Z57A 2UVZA 3QUDA 3T3VA 4YJNA 4S31A 5ANKA 2IN6A 4QMSA 3RPOA 4BDAA 2XKDA 2YM5A 3VO3A 4X21A 1W8CA 5H2UA 2QOFA 1T46A 3U4WA 1IA9A 4EOOA 2C47A 1K2PA 3KULA 1M14A 4KB8A 1MUOA 4YZBA 5I4NA 5D1JA 3R8ZA 4IB0A 3TV7A 4DG0E 4D2VA 3MFUA 4ZTNA 1U54B 4EH8A 4W4VA 1A48A 3W32A 5CSHA 4QMXA 4RPVA 3CLYA 4JBOA 3A8XA 4XP0A 3U55A 2Z7LA 1ZYCA 3QZFA 4W4WA 4HGLA 3A7IA 4MQ2A 2XVDA 3BIZA 3DB6A 3TNWA 3QZIA 4CCBA 3V5LA 3DBQA 5FD2A 5K4IA 2VTMA 4N6ZA 2WMRA 3PDTA 4WT6A 4AG8A 4FGBA 4C35A 3DTCA 3WZUA 5F95A 1YOMA 3QD0A 5CI7A 3PXKA 1Q5KA 4EOIA 2Z7SA 1SZMA 3G9NA 3DAEA 4L53A 2X4ZA 3RJCA 2E9NA 4IANA 3EQDA 1ZWSA 2PL0A 1E1VA 4UYNA 3A7FA 3TTIA 4XV9A 1QPEA 4EK3A 3TIYA 5IUIA 4BCHA 2GS6A 2YM7A 1AQ1A 4N70A 2OK1A 2PHKA 5E8YA 4PF4A 3GFEA 4C8BA 1JKTA 2XM9A 3LFBA 4GFGA 4NU1A 3S3IA 2YFXA 4YNEA 3IDPA 4FSZA 4U3ZA 2VWXA 3FHRA 5M09A 4KKHA 4J8MA 3O17A 4FIJA 3ETAA 4JVGA 4YHJA 5CENA 3U87A 3UC4A 3VRZA 3U54A 4IEBA 5GIOE 5DWRA 1CTPE 3SRVB 4LV8A 3UOHA 4RJ7A 4IXPA 4CFXA 5AR8A 4EOLA 5HU9A 1U5RA 4A9YA 3EQFA 4DBNA 1YVJA 2X8DA 3FE3A 2W1HA 3D9VA 3SG8A 3LOKA 1JLUE 3DK3A 2VWVA 4G3EA 4ANBA 1NW1A 3AT2A 3BWJA 3OCTA 4EC9A 4EWQA 4UY9A 5AA9A 5IEYA 4JS8A 5HBHA 5I9YA 1WMKA 1OITA 5CVHA 2E9UA 2YWVA 1W98A 4E7WA 4X3FA 4O1OA 3DKGA 5LCJA 4C4IA 5FXSA 3C4XA 5EDQA 4TYEA 3EN5A 3HKOA 4GU6A 5AP6A 2IW8A 3S1HA 4C38A 4DINA 5BYLA 2OXDA 4O38A 2H6DA 2QOQA 4GVJA 1KSWA 2WMVA 4A07A 5CNNA 5L2IA 1O6YA 4OUCA 2BRBA 2C1AA 2FSOX 4O1PA 4RVTA 2BHEA 3ORKA 5JKGA 3EJ1A 2IZSA 3PJCA 3QQFA 5TF9A 4TZRA 3ZS5A 1YI4A 5H8BA 5I3OA 1S9IA 3P7AA 4BDCA 2BDWA 3GVUA 4FKGA 4BI1A 4BIEA 5JGAA 2GHMA 2W4OA 4ZOGA 3OWPA 3G6HA 1YXSA 4HNFA 4OTFA 4HVGA 4QMPA 4K8AA 5LMBA 1UU8A 3D7TA 4O91A 4WO5A 3AC8A 3P79A 3CKXA 2XM8A 5J7BA 2JDSA 5CSWA 3F3ZA 3GU8A 1L8TA 4TRLA 3ZO4A 4RJ5A 4M8TA 1YDRE 2C5OA 3OXTA 2F7ZE 5AP0A 3R9HA 3R9NA 1JSTA 2XEYA 3V8TA 5AR7A 4JLCA 4RWKA 3W1FA 4DF3A 5HEZA 2HWOA 2YIWA 2ITOA 4I6BA 4FUXA 3POOA 5LMAA 5CU0A 2PYWA 4RBLA 4NEUA 3S95A 3SAYA 3I6WA 2DQ7X 3ZLSA 3ZM9A 4CGAA 3G2FA 2YERA 5CY3A 3UE4A 3MVJA 3PSDA 3UZPA 2PTKA 2I0VA 4EL9A 2C6MA 3HV7A 4A06A 4A9RA 4R5SA 3UOLA 4E5BA 1G8SA 2HY0A 4E6AA 4AGDA 3P86A 3QLFA 3C50A 2W7XA 3F69A 4AZSA 3L9NA 4ZTQA 3ANRA 4CZUA 1XBAA 4F64A 1BMKA 3KU2A 3HUBA 4X2GA 5DBXA 1PXNA 4BYJA 3LXLA 4MF1A 3GXLA 4I92A 4V0GA 5M44A 3MH3A 2OWBA 1PXJA 2GQGA 4AGCA 3CP9A 3D0EA 3TUDA 3FXXA 1KE8A 5KE0A 4PRJA 3VUTA 1W84A 3VHKA 2FYSA 3VHEA 2JKQA 4EH9A 2RGPA 3KXNA 4XRLA 5CU2A 4QMYA 4C57A 3OS3A 2XNPA 3HMNA 3GB2A 3HRCA 3I0QA 4EUUA 3F3TA 3TJDA 4NW6A 3EFWA 1I44A 4O6EA 5DOSA 3UVQA 1BL6A 3DTWA 4F7SA 1GAGA 5BVKA 3E5AA 4HYSA 3EFKA 3W2QA 4QQ5A 2CKQA 4XG4A 2QOOA 2G9XA 2RSVA 2XIXA 3UQCA 4ZAUA 5L8LA 2J0KA 3LCDA 4I0TA 3UO4A 5BQ0A 3QQUA 4IC7A 2YZAA 4CLIA 3SV0A 5EYDA 4FSTA 4DLJA 4I20A 2I7QA 5HLPA 4AA0A 1KOAA 4DEHA 4P90A 3BYVA 1IASA 1OPKA 4EHVA 5CI6A 3A99A 4MD7E 2C5VA 2WTWA 5I9XA 4TW9A 3KXZA 4JR3A 3RZBA 3QKKA 1CMKE 4RVMA 1DI8A 4GEOA 1PHKA 4HGEA 1R0PA 4YZNA 3BE9A 5AUZA 4E4MA 4M69B 3R2YA 1M2QA 4EQMA 4G34A 4ASXA 1B39A 3OMVA 4I41A 2OJIA 2YACA 4AXAA 2WMBA 3R04A 3BYMA 1OIRA 3GCVA 3QF9A 4TYGA 1QCFA 3DGKA 1J1BA 3SX9A 4HVDA 1YWNA 3PUPA 2VN9A 4G31A 4X6QC 3EZVA 2A1AB 3NNWA 4O2PA 2NO3A 4P2KA 5F1ZA 1H26A 4FEQA 2X9FA 2OZAB 3B2TA 3PLAE 4WG4A 4UMUA 5KNJA 5G1XA 4ZY5A 3AC2A 4FV0A 5HIDA 2VWZA 3OTUA 4ONAA 1PJKA 3MH2A 5JFVA 2EVAA 3JY9A 3E3BX 4WD5A 3RZFA 3C0GA 5IF1A 3CCNA 3TACA 1DI9A 4O0RA 2F7XE 5E8VA 3V8WA 5A54A 2IVTA 4RVLA 5C03A 3B8QA 4W4XA 4KKGA 3LCKA 4PL4A 4WBOA 2OIDA 4BY9E 4TTHB 3H0YA 4H1MA 3N4UA 1XQZA 3H4JA 3A7GA 1TQMA 3DNDA 3O0GA 4OTPA 1BL7A 2HELA 4YO6A 4DN5A 5FUTA 4DCEA 2R3FA 3VVHA 4RZWA 4XBRA 5I9UA 3FLNC 4BDIA 1JSVA 2R3RA 4YZDA 2QKRA 4PMTA 4QMWA 4WG5A 3UJGA 1V0OA 3VQUA 4CT1A 3TNQB 4HVIA 3KKVA 2BAKA 1T45A 2VX0A 4LOOA 5J1WA 3KMWA 3E3PA 4GSBA 4GH2A 2Z7QA 3QWKA 2IJMA 5TT7A 3FLQA 3MA6A 4L43A 4G6LA 4P7EA 5T68A 4S2ZA 3TKIA 2ITWA 3SA0A 3LVPA 4QMMA 4P4CA 4GL9A 4JDHA 2SRCA 5JZNA 4OTQA 3GFWA 1XBCA 3U6IA 2ZB1A 2C68A 2HZ0A 3C1XA 3GEQA 3NLBA 2QD9A 4JIAA 4RG0A 3R30A 3V5JA 4BWPA 4BWXA 4O83A 1FINA 1SVHA 4HPTE 3FZPA 4EH5A 4O0WA 5EI8A 4QPMA 4ACHA 2JD5A 3CKWA 2OSCA 5KMNA 2OZOA 4XJ0A 4DGOA 2W5BA 1IA8A 3MIYA 4FKQA 1PXMA 2C3JA 4DFLA 1VJYA 2UZOA 3F5XA 3HMOA 3K5VA 2W0JA 4EUTA 4F9CA 4FTJA 4QQTA 3H9RA 4ZLYA 5AUYA 4HVHA 5IISA 5DPVA 4DFXE 3ERKA 2QODA 4YBKA 4ZY6A 4D1XA 4IHPA 1J7LA 1ZY4A 2QC6A 1Q4LA 4AZWA 3AD6A 3OCGA 5KBQA 4HPUE 5DGZA 3JUHA 4K11A 3UQGA 1STCE 2VWIA 1TQIA 4MXYA 4EJNA 4GV1A 2J51A 3CJFA 3PJ3A 4FTCA 4O81A 5EHLA 3DLZA 2X9EA 5A4CA 3SXRA 1LEWA 4C37A 2HIWA 1OBGA 1XHAA 4FSUA 2JLDA 5C01A 4BTJA 2W1IA 2XRWA 2H34A 3N4TA 3BZ3A 4CRLA 1NT2A 2V7OA 3D5UA 5K4JA 5J9ZA 5ETIA 4G9RA 2CN5A 3UP7A 2PVLA 4F9AA 4AW5A 1YOJA 3FXZA 2XJ2A 2OBJA 3UBDA 3NCZA 2OJGA 3QCSA 3NIZA 4TYIA 2IZTA 4ZP5A 4RX8A 3LHJA 4EZ5A 1R3CA 2Y0AA 1W7HA 3V6SA 4EOJA 5BUIA 4WNKA 5AIKA 4ARKA 2UZUE 1PXLA 4ASEA 4E4NA 2HW6A 4FUYA 4ACGA 4E6DA 4RC3A 3EZRA 3MFSA 4MNEB 4OTHA 3ORMA 3TCPA 5CEPA 3PPJA 4DEDA 3UMXA 2JAMA 3VBTA 3ZCLA 3RPSA 5E7RA 3UIXA 2H96A 3CIKA 3DJ7A 1NVRA 4JNWA 4X2FA 4EJ7A 2WQBA 4IDVA 4V01A 4DFNA 4YTIA 4AZEA 3ZO3A 3R28A 5FTQA 4I1ZA 5DT3A 3R1YA 4QP7A 3QTWA 3PPKA 5J9YA 2XF0A 1H0VA 3C5UA 4FTTA 5BVDA 4GYIA 4LGDA 3RWPA 4I6HA 5IA4A 3QQJA 4DGMA 4DHFA 2YDKA 3EQPA 2G2IA 3NYOA 1MQ4A 4KS7A 1W83A 4A9UA 3D2KA 3VIDA 4HZSA 3C4FA 5AV4A 2J2IB 5E1EA 3SW4A 4CCUA 5E9EA 2OG8A 2F2UA 5I9WA 4GJ2A 2WNTA 5LJJA 3BRBA 3LCSA 3QRUA 3RM6A 3ULZA 3GNIB 2EUFB 2OJ9A 2Y7JA 5AP1A 3ZRKA 2PMIA 3BHVA 4IC8A 1J91A 3DBCA 5EOLA 2AC5A 5KZIA 2QR8A 2YM8A 3I60A 2YZLA 3UDBA 4JBQA 4H3BA 2XK9A 4J53A 1WBVA 4F09A 1LEZA 1OI9A 2JEDA 3EL7A 4Q2AA 3Q2JA 4J99A 3T9IA 1UA2A 3IONA 3Q53A 4FSMA 1Q8TA 4O0VA 5HO7A 4FC0A 1MQBA 1I09A 2B9FA 2CN8A 2WTCA 3R02A 2OH0E 1JPAA 4X7QA 4WRSA 4YZ9A 2WFYA 5A4LA 1J7UA 3ANQA 2XUUA 5CU3A 2VV9A 4CQEA 4DBXA 5BVNA 3P1AA 1UU7A 5EDPA 4FTAA 4MH7A 2NRUA 4BDEA 2CKPA 1UNGA 3G90X 2QURA 4FT0A 2XKFA 3UTOA 4PP7A 1Q3WA 1FMKA 5E8TA 1H1QA 2HYYA 4FV9A 3MYGA 2WZJA 3AMAA 1PY5A 1F3MC 2ITXA 2O63A 2XK3A 3ENMA 3M42A 3MFRA 5M55A 2YIYA 4YO4A 4MXCA 1FVRA 2PMLX 3MH1A 5CASA 4G9CA 5BVOA 3ITZA 1BI8A 2KTYA 3BBWA 3PIXA 5L2SA 2C0IA 2JIVA 3GBZA 4RIWB 1GIHA 4G6OA 1GIJA 2RFNA 4E5AX 4HOKA 2JDOA 4LM5A 1NA7A 1OL2A 1LP4A 5ICPA 3FY2A 3NR9A 4IH8A 4EYJA 4FKOA 4BTKA 4EOMA 4XYFA 2BRMA 4ZJJA 4XV1A 3C4CA 4KRDA 4MBJA 3TZ8A 4F0FA 5CSXA 5AM6A 3MTFA 4YJPA 5A3XA 3SG9A 4AGWA 3THBA 3DAKA 4FV3A 4TPTA 3CQWA 2PE2A 3CTJA 3ZUTA 1NVSA 4X2NA 4FF8A 4Y95A 4TWPA 1M52A 3RKBA 4KIPA 4YURA 4HYIA 4CFVA 4D2PA 4D4YA 3U9CA 4FKJA 3VUMA 3FZTA 3KXMA 4QT1A 4XP3A 3QXOA 4D1ZA 5AJQA 2PVNA 5KMKA 2R3HA 3H10A 2VO6A 3MJ2A 4OTDA 3SQQA 4YSJA 4JRVA 3VW6A 3KQ7A 3GU5A 4UV0A 1KWPA 4S30A 5AV1A 5CAOA 5D41A 4MNFA 1FBNA 4FTMA 4CZTA 3C4EA 3RINA 1UKHA 2W5AA 4DE4A 3FMNA 2ZM3A 4FNYA 4RIYB 1SVGA 2R7IA 4DGLC 4GRBA 4EKLA 1YDTE 4FMQA 2ITZA 1O6LA 5CEOA 1PKGA 4I0RA 3BYSA 4D2TA 1YI3A 3ORPA 4NZWB 5LOHA 2BFYA 2W06A 4D2RA 2OXXA 4M13A 1PF8A 4PL3A 4C58A 3RCJA 3D94A 1Q99A 4HNIA 3VJNA 2H9VA 3CC6A 3I81A 3RAKA 5EQYA 2QI8A 4C62A 4BKZA 4FT3A 2F2CB 5BMSA 4BN1A 4FX3A 2YIXA 2Y6OA 3ALNA 4L8MA 4MX9A 5KKRC 3HYHA 3ZBFA 3HNGA 3F2NA 1JSUA 4IVBA 2JDRA 2O2UA 3WI6A 4DLIA 4LL0A 3NUAA 3PPZA 3Q04A 4RWIA 4E20A 3CY3A 3HA6A 3K5UA 4EZ7A 3UO5A 4CLJA 4OGRA 4EI4A 3QC4A 5IA5A 4B6LA 4DA5A 5B2MA 4MD9E 5HGIA 3KVXA 3BHYA 4IDTA 3ZEPA 3QYWA 5LQFA 2X6DA 2CKEA 3LFDA 3Q2MA 4IACA 3Q60A 2IWIA 3HMMA 5M4CA 1Y91A 3SW7A 3RTPA 3R0TA 1V0PA 1OIYA 2BAJA 3GOKA 3KF7A 5CTPA 3V04A 3R8VA 2W5HA 3COIA 5KMIA 3HECA 1GOLA 3LJ1A 4NM5A 4ZLZA 1ERKA 2GQSA 2PZRA 3ZXTA 5AIRA 3L8PA 3PA5A 1BUHA 4EK8A 2IO6A 4BDJA 2W9FB 1PXOA 2RIOA 2VTNA 3DPKA 1H1RA 2ZDUA 1ZY5A 2GQRA 3QRTA 3IW7A 2QQ7A 4D0XA 4EK6A 5AFVA 3DCVA 2Q0BA 4XS2A 3N4VA 4FKWA 1Z9XA 4YP8A 3FDNA 5FRIA 5J1VA 4Y46A 3TL8A 2HY81 3A4PA 4BWKA 4PDOA 4ZSJA 1HOWA 3OUNB 4DH1A 3IOPA 3BHUA 3C0IA 4F70A 4BICA 2R7BA 5ANOA 1WBWA 3PG1A 4CMOA 2BZJA 4LI5A 3ZLWA 2UZNA 2GMXA 3WIKA 3L9LA 4S32A 3MVMA 2R9SA 3NNVA 5AR3A 1B38A 2ITUA 4G1WA 3CE3A 4YPDA 3CXWA 4I5CA 3JY0A 5AR2A 3R9RA 4E8AA 4CNHA 3CR0A 2Z60A 3QBNA 4O7LA 4W9WA 5F20A 3KY2A 3BQRA 4I4EA 4R5YA 1CKJA 3I79A 5I9VA 5C4LA 5IA3A 3ZHPC 4QP1A 2GNIA 3BHHA 4D2SA 2HOGA 2CGVA 3W18A 2CDZA 3DBDA 3QALE 2WU7A 5BVEA 5LVLA 5CEIA 5TKDA 4GUBA 4Y73A 5FDPA 1OUYA 2C1BA 4X6RA 3R7OA 3ZZWA 4Z16A 3NNUA 3NRMA 4PTEA 5LXMA 4OLIA 1AD5A 1L3RE 4UMQA 3F7ZA 3R7GA 3FPMA 4X3FC 2X7OA 2GFSA 2BRNA 2XK7A 2Y6MA 4D9TA 1XBBA 1ZOGA 4ERKA 5GIPE 3S2PA 2C6LA 4B4LA 5BYYA 3R7VA 1PXPA 2WTKC 4L3PA 2GTNA 2F9GA 4PL5A 3VAPA 1NXKA 4IJ9A 4IZYA 4AOIA 3VBXA 5GZ8A 4F4PA 5CZIA 4NTSA 3RI1A 4XNEA 5D10A 2GHLA 2YABA 4UWCA 2P0CA 4YJSA 3O8UA 1SNUA 2PVJA 3AC5A 2JIUA 4JDKA 4F9YA 3HV6A 5LWMA 2VRXA 4YTCA 5M08A 4Y85A 3PIZA 4G3GA 2QONA 4U0IA 1LUFA 4QTBA 4QYFA 4DT8A 2BKKA 2XNOA 2QOCA 1UVRA 4WBBB 2HENA 4DITA 4CFUA 4U8ZA 2VWYA 2YAAA 3EQGA 4XX9A 4TKSA 5ETFA 3Q6UA 3HV5A 4FIEA 4YPSA 4GU9A 2X0GA 3QRIA 3KCKA 4LFIA 1CM8A 4D55A 5CYIA 3MN3A 5DHJA 5KMOA 3QX2A 1H28A 3H9FA 5EHYA 3P78A 4MK0A 3FL5A 4E1ZA 4EQUA 4FV6A 4UX9A 5B2KA 5JRSA 1YOLA 5IUGA 3B2WA 3V8SA 2UW4A 1JKKA 5M4IA 4FV7A 3ZONA 3BE2A 2WTDA 5HESA 5EW8A 5DRDA 3MA3A 4ITIA 4FE2A 1UV5A 4U6RA 5AP2A 3ZFYA 2FA2A 4HGSA 2OF4A 4MAOA 5HO6A 3ZFMA 5IEVA 1P2AA 5HG8A 3R22A 3CTHA 2LAVA 4DAWA 1IAHA 1XH5A 3EB0A 2RKUA 2OJFE 2UW0A 4K2RA 1QPCA 3QCYA 2C6IA 4I3ZA 5ANGA 5IQEA 2NP8A 4D5KA 3GENA 3FKOA 4M69A 4QYGA 4IX3A 4YTHA 3UOJA 2XK4A 3UGCA 4ACMA 4MD8E 4NM3A 1OKZA 1LR4A 3WBLA 4J96A 4BBEA 4NCTA 3CGOA 3NW6A 3IPHA 4NT4A 4R1VA 3OROA 1ND4A 3QUPA 3VQHA 4PMPA 2PZ5A 4AN3A 2X4FA 5IZFA 4EONA 2KULA 4Q5EA 2QO2A 5E4HA 3QC9A 2PE1A 3EKNA 4ZZMA 5LVOA 4U80A 2XB7A 1XH7A 3QTRA 2XKCA 2YEXA 4KWPA 5LARA 1AGWA 4EH6A 4GG5A 2YM4A 3OG7A 5C8NA 3DBEA 4L3LA 3WF6A 2QVSE 1WBPA 2CNVA 1SVEA 1Y6AA 4NFMA 4AZTA 3GCQA 1H08A 1Q62A 3OD6X 3Q96A 4C3FA 4UYAA 1U4DA 3ZUUA 4JG7A 2R0IA 3EN6A 1OIQA 4EK4A 3IS5A 5IQAA 2I40A 4U44A 5IQGA 4C3RA 4II5A 1FOTA 5CNOA 2ZV9A 1O9UA 2WMXA 1U5QA 2QOIA 3LFEA 4QMVA 3QGYA 1APME 2WOTA 3JVRA 4PPBA 5A6OA 4BYIA 2FVDA 3HMPA 3OXZA 4ZXTA 4ZZOA 4X2KA 5CSVA 1E9HA 4EK5A 3RHKA 2V0DA 5HLNA 3UZTA 2XYNA 2BTRA 4DEBA 3N51A 3FLZA 4QTCA 2REIA 4RT7A 2J0IA 4J71A 3VS0A 5FXQA 4ANLA 5K0XA 3ODZX 4IBMA 4ZTHA 3U9NA 4NIFA 5IU2A 3HRFA 4K77A 4W8DA 4YLJA 4NM0A 4OAVB 5CXZA 3ZO2A 3H3CA 3MBLA 5IDNA 2JC6A 1YXXA 3BGZA 5FEEA 1V0BA 3LXPA 3RNYA 1Z5MA 2I6LA 3QKMA 5CALA 1CSNA 4CG8A 2VZ6A 1LPUA 3R8MA 3R00A 3KRXA 4F7LA 3W8QA 3LZBA 1ZZ2A 4BDFA 2VO3A 3RP9A 3OTVA 2IPXA 3A7JA 2YWPA 3EIDA 4U81A 3VWAA 4GT5A 5IMEA 4ZMEA 2YM6A 4Q9ZA 2PK9A 1PMUA 4BDKA 5F4NA 2BMCA 2QR7A 3DKFA 3DQXA 4MEDA 2A4LA 3FBVA 3WF9A 4HCVA 2FB8A 3LM5A 5L6OA 2W05A 2WO6A 4CV9A 4I6FA 4FK3A 2A27A 5KO1A 4QP3A 3KN6A 1H01A 4C61A 2BHHA 2RFEA 3VULA 4BI2A 3BQCA 3OEZA 5DFPA 3ALOA 4C36A 2GHGA 2QU5A 4OTRA 4UXLA 4FV2A 3BKBA 1QPDA 2XNGA 3G5DA 4AT4A 2AYPA 2QHMA 3A62A 5DR6A 5B0XA 3VUIA 3EQBA 4RWJA 3RGFA 2X7GA 4DTAA 1HCKA 1P4OA 2GPHA 3F7WA 3WE8A 4PMSA 2XRUA 1XH8A 2O3PA 3QQLA 2JKMA 4H58A 3VN9A 3ZSGA 3G0EA 3ULIA 3UG2A 4QP4A 3R7UA 5ITAA 5CF8A 3ORIA 1V1KA 4MTAA 2WTVA 4CD0A 3TNPC 2QOKA 4JG8A 1U59A 3P23A 4TNBA 5AMNA 4B0GA 4AX8A 1PMEA 5M56A 4DCAA 3BELA 3A4OX 2CPKE 5DNRA 1J3HA 2G2FA 2WELA 4U9AA 2FUMA 4I5HA 3BBTB 3GC0A 4K1BA 5EI2A 5JSMA 3T9TA 4WIHA 1JAMA 3LMGA 4ANSA 4L7SA 1QL6A 3IW5A 3PA4A 3CY2A 2GNHA 5A4EA 3MW1A 5C8MA 1PYEA 5AA8A 5KCVA 2PY3A 2W4KA 1J1CA 3HV4A 3QWJA 3MPTA 5HICA 4F9BA 5IA2A 4DFUA 5HZNA 3FSKA 4FKVA 3QQHA 4JQ7A 5DN3A 3LFCA 4CFFA 2VWWA 3JPVA 4M7IA 5C1QB 4I0SA 3Q32A 4HZRA 4UMPA 3G33A 3LQ5A 3SXFA 3RAIA 3D83A 2ZM4A 2OO8X 5B7VA 2XNNA 1A06A 4KUJA 4U40A 4XG8A 5FEDA 4USFA 4L00A 3PRIA 3OWLA 5CEKA 3QD2B 4B7TA 2YCFA 4NWMA 3D7ZA 4FZ6A 4IAKA 1JKSA 1REJA 3E8EA 4RX5A 4YC3A 4YTFA 2GS7A 2XEZA 3TNHA 4QMTA 3CD8A 3OZ6A 4O6LA 5EM5A 4EORA 4CEGA 2X1NA 3LM0A 4XG9A 3H30A 5EOBA 2HAKA 3BYOA 4UXQA 3FZSA 5GINE 5KKRB 4HYUA 2C6OA 2PVKA 2VTIA 4IB1A 4NYEA 4N57A 3EKKA 4JAJA 1YW2A 4L52A 5BVWA 5TR6A 4RQVA 5IQBA 4U41A 2ZAZA 3FMJA 4WRGA 5JK3A 4IB3A 3WF8A 2P2HA 2O0UA 2GFCA 3VBYA 4BCJA 2UW9A 5GZ9A 2VTOA 3F3UA 5AP5A 4PNIA 2BROA 3FZ1A 3FUPA 5T6KA 3SDJA 4QMQA 2PPQA 3HL7A 4DGGA 2HZNA 2XIZA 4ITJA 4JDJA 2W1DA 4BHZA 3T3UA 5IQHA 5EDRA 4FR4A 4A4LA 2XIRA 3ROYA 3UZRA 4LYNA 3FZOA 4FG9A 4RA5A 4EWHA 3U4UA 4NJ3A 3A7HA 2DS1A 1KE9A 2ZM1A 4CG9A 3MY1A 3QGWA 1GZOA 1VR2A 2Y8OA 3QTSA 4W9XA 3U6JA 4C4HA 2G01A 2R3NA 2VTJA 4UWYA 4F9WA 5HCYA 5A4TA 2YHVA 2QCSA 5G6VA 4GK2A 4R7HA 2WAJA 3HDNA 3EYHA 3O71A 4TL0A 3ATTA 2WHBA 4XG3A 3UNJA 4C34A 3R9OA 3EQIA 4AN9A 1KUTA 3IDCA 4KIQA 4K9YA 3AG9A 4MHAA 2P3GX 4FVQA 4M66A 2F4JA 3FPQA 5IEXA 3PXQA 4J52A 4O0UA 2YJSA 4M15A 3PSCA 3QFVA 5L2QA 1JVPP 3DAJA 3HRBA 3PG3A 3RK9A 2UVYA 5CAVA 3CQUA 4BL1A 4BRXA 4X0MA 3Q6WA 2UW6A 3GQIA 1G8AA 2W17A 4B8LA 2CCHA 4FYNA 2YITA 4K18A 2P55A 1SMHA 5AV0A 5LVNA 3SLSA 3VS7A 4JXFA 3QQKA 3NUSA 4CRSA 3SXSA 2V7AA 4RIYA 4BCGA 1FGKA 2WB8A 4OTIA 4UB7A 3UMWA 2CSNA 3DV3A 2R3LA 4UZHA 3OWJA 4GT3A 1YXVA 2ZMDA 5EI6A 5I0BA 4IZ5A 3E62A 4KRCA 4AFJA 1RDQE 5HIEA 5EQEA 4QNAA 1KV1A 2YIRA 2PWLA 2RFDA 3C0HA 4BB4A 4EOPA 2XBAA 2WQNA 3DA6A 2ZB0A 4E4XA 1R78A 4KBAA 4GCJA 4XOYA 3DZQA 5CT7A 2CGWA 2BTSA 5JFSA 3KF4A 3ZDUA 2XMYA 4QP6A 3FI4A 3R01A 1OMWA 3ELJA 3LLTA 5CAQA 4YLKA 4RGJA 1OKWA 5ETAA 5EH0A 3OY3A 4Y72A 1FGIA 2CGXA 2V22A 5IG1A 4JIKA 3ZC6A 4AOJA 2OU7A 4E4LA 2DUVA 5DEYA 3E7OA 4NKAA 4DC2A 5BMMA 3F3WA 1ZYJA 3P7BA 4KS8A 3S4QA 3WZKA 5EG3A 1P4FA 4RQKA 4R77A 2J4ZA 3FHIA 4R1YA 3TV4A 2ERKA 3OT3A 4FT9A 3UNZA 3O51A 4WSQA 3TI1A 3NCGA 3A61A 3RK7A 4EH2A 3JS2A 3PZEA 3EMGA 4O0TA 1UWJA 4KABA 1UNHA 2C4GA 1JBPE 4LUDA 3TG1A 4B99A 1XH9A 2OIQA 2X2MA 3MFTA 3MY0A 4CZYB 5CANA 3WZEA 3ATSA 4BIBA 1VEBA 4FT7A 4MXOA 5ANIA 1ZARA 3Q4CA 3EN7A 5IPJA 4AW1A 4DFZE 3WF5A 4EHGA 3VS2A 2R5TA 5I9ZA 2JKOA 4DFBA 4EEVA 3LFNA 4D5HA 4O21A 5JEBA 3GI3A 4HCTA 2ETRA 4DGNA 2CJMA 5AM7A 2IVSA 4USEA 4L44A 4L3JA 2ZDTA 2PMOX 4BHNA 2R3QA 3HP5A 2UW5A 2PSQA 1JOWB 1ZLTA 2WGJA 3ODYX 3ZZEA 5B2LA 4RIOA 4WNMA 3NPCA 3Q9YA 4M84A 4GVAA 2R3OA 2EB3A 5A46A 5CF5A 3LE6A 3UQFA 4ENXA 3C7QA 4CYJA 1K3AA 4EH3A 4OT5A 3EQHA 2EU9A 4LQMA 5AUVA 3U51A 3W2SA 3Q9ZA 1DAWA 3E8CA 4IWDA 4BCPA 5IQFA 5GJFA 3KFAA 1X8BA 2Z02A 1OKVA 2BRHA 4KAOA 4TWCA 4IWOA 4TXCA 1H00A 3VF9A 3N9XA 4Z7HA 2RF9A 3E8NA 4E5WA 1SM2A 1OPJA 3DJ6A 3RALA 4BC6A 3SKCA 4LGHA 4TT7A 5BYZA 3ZYAA 3HP2A 4AT5A 1MRVA 2FSLX 3POZA 2X2LA 4AAAA 1PW2A 2Z7RA 3C4WA 3R73A 1OL6A 1IEPA 4FG8A 2R4BA 4ZTLA 1WBSA 5AUWA 4FKSA 3LIJA 3L8SA 3OW4A 2YAKA 3Q5IA 3R6XA 4QPSA 2BVAA 3SC1A 1BLXA 4WUAA 3W2RA 5M57A 5JGDA 1TQPA 2UZVA 3VW8A 1XR1A 4IFCA 4BCKA 2O64A 3CPBA 3MTLA 3KMUA 3FAAA 3COKA 2JBPA 4IADA 5JQ5A 4AE9A 3MVLA 3DDPA 4I22A 4M14A 4RIXB 4BFMA 3VBQA 4IE9A 3BV3A 3I1AA 3RBWA 5C27A 3AC4A 4NL0A 5AV3A 4FVRA 4EOQA 5AX3A 2YA9A 2NNWB 2B9IA 1M2PA 3PXRA 4KIKB 3FLYA 4WNOA 3ZXZA 4AA4A 4Y8DA 5KBRA 5CT0A 1ZYLA 4FOBA 2CKOA 3QTUA 3LW0A 1OIUA 4AW0A 3ZMMA 1FVTA 4Z55A 3BEGA 4D58A 4XOZA 4F0IA 1PKDA 3I7CA 2UZTA 4AE6A 3G0FA 3OBJA 4IAZA 3EFLA 5D12A 3MPAA 3PP1A 4FNZA 4EOSA 5HORA 4HGTA 2QOLA 3OXIA 4AW2A 4GK4A 5DE2A 3MV5A 1ZMWA 3UIUA 5L8JA 2J0JA 4I21A 4KSPA 3ID6C 4IM3A 4GJ3A 5EYMA 4JX3A 3GC8A 4U5JA 3Q4ZA 2C0TA 4EHZA 3ZSIA 4APCA 4DYMA 2VNWA 4EKKA 5HLWA 4H05A 3IW6A 1GIIA 3DT1A 4FEUA 3BPRA 3AOXA 3OEFX 3BLRA 4UEUA 5DR2A 5KHXA 3W8LA 5LMKA 5HG5A 3SGCA 5K5NA 2Y9QA 2R64A 4ZZNA 4G5PA 4BCOA 2JKKA 2VWUA 4U3YA 5FLFA 3MPMA 4QQCA 2XZSA 3DKOA 1U54A 3PVWA 4M67A 4TN6A 3AC3A 5AR5A 1UNLA 4HYHA 5CS6A 5FM3A 2OICA 4ENYA 3EN4A 3PXYA 4FZAB 5FTGA 3GOPA 3IKAA 4E73A 2OFUA 3BLHA 2B52A 5EM8A 4AZFA 4IX6A 5C9CA 4ITHA 3CD3A 3KRJA 4RLKA 4YJUA 3PWDA 3GU4A 2GU8A 4I5PA 4M0ZA 2VWBA 2ZMCA 4MBLA 5AWMA 1IAJA 1QPJA 3NVMB 2UZEA 3UNKA 2C6TA 4OBQA 4KBKA 5CEQA 3AT3A 5CZHA 3E7VA 2XBJA 2HWPA 3QLGA 5DT0A 2OW3A 5I3RA 3SOAA 4LOQA
chains in the Genus database with same CATH superfamily
4A9SA 3QYZA 3ORXA 2XKEA 5IA0A 2C6EA 1R39A 3OVVA 3NAYA 4KD1A 3PZHA 3MJ1A 2V62A 3IQ7A 3OUKA 4FSQA 3JVSA 2ITYA 4K0YA 3U6HA 4IZ7A 2J0MB 2AUHA 4RLLA 5HIBA 4F1OA 2ZYBA 3DXNA 4ZTSA 5EM7A 5DR9A 3MH0A 3OT8A 1PXKA 2ZVAA 3CJGA 2WMAA 4R8QA 3CEKA 4ZS4A 1KE7A 3EH9A 1G5SA 2VUWA 5L6PA 2YISA 4O7VA 5HVJA 4I5MA 3UYTA 1H25A 2BAQA 1OKYA 4JR7A 2PUIA 2WMSA 4RFMA 3FLSA 2B53A 3LXKA 3QD3A 4JRNA 4O0YA 5AX9A 4BDBA 3OY1A 3SRVA 1W82A 4ANNA 2EXMA 3MS9A 3RPVA 2WD1A 3V5PA 4R3PA 1UU3A 5HOAA 3V6RA 3TDVA 4CTCA 3I5ZA 1GJOA 5AUUA 5JT2A 4PP9A 3RVGA 4EZ3A 3ROCA 2ONLA 2VTTA 4BCQA 2BR1A 2QOHA 1WBNA 3P4KA 4E93A 3MESA 3GGFA 5E8UA 3R9DA 4DEEA 4QMNA 3UDSA 1Y6BA 3DKCA 3FYKX 4GYGA 5AAFA 3WIGA 4D4VA 5J5SA 2GSFA 4BVUA 1XH6A 4HJOA 5ANDA 1W2DA 3LFFA 4IX4A 4NJDA 3FMDA 5FBNC 5TO8A 3KIOC 3KVWA 2WMWA 3UP2A 5HNIX 1E1XA 4C4FA 5JZJA 1BI7A 3DBFA 4QQJA 3TYKA 4A9TA 3IDBA 4JQ8A 3L8XA 1U46A 5HBEA 3OF0A 4AFEA 4C02A 2C69A 3DQWA 2Q83A 2VO0A 1OECA 2X6EA 3HAMA 2WKMA 4O4FA 4TWNA 3K3JA 3NDMA 4YR8A 4J98A 2Z8CA 4G5JA 2DYLA 4MXXA 3BWFA 3F2AA 2PUPA 4Y83A 4YJRA 4HCUA 3FXWA 4BTMA 3RM7A 2VAGA 1Q97A 4FZFB 4EYMA 2CNQA 2PVRA 3PIYA 5BUJA 5IA1A 5C4KA 4CKRA 1BX6A 3QRKA 3KN5A 4FTRA 2GTMA 3HMIA 5HVYA 2Y4IC 3TEIA 3HUCA 3L9PA 4LMUA 2CHLA 2BPMA 3I6UA 3R71A 4QP2A 2VGPA 2XNEA 2UZWE 3QKLA 1YHVA 2FSMX 2XARA 4GFMA 5KMJA 4UMRA 1VYZA 5GZAA 3O50A 1IRKA 3DXPA 4O84A 2WQEA 1ZMUA 3FC1X 3C4ZA 3OW3A 3KK9A 2PZIA 4U97A 2E9VA 3V5WA 1Q8ZA 3Q5ZA 2EB2A 4IJPA 5ANEA 1B6CB 3LJ2A 2W1EA 3P7CA 3BGQA 3RHXA 5L3AA 4GKHA 4FTKA 2NYAA 2JFMA 4Y5HA 4QPAA 3CPCA 5CU4A 3V3VA 3PY1A 4YBJA 5HTIA 5E8SA 2HW7A 4RMZA 4YLLA 3RK5A 4KINA 4OR5A 1IR3A 3OOGA 3PFQA 2IW6A 1H4LA 3V51A 2W1GA 2WXVA 4LOPA 4MXAA 3DK6A 1YI6A 5EYCA 3REPA 3VUHA 4MYGA 4ALWA 4CMTA 4CVAA 4XV3A 1EH4A 3ZRLA 3EWHA 3FJQE 4O0XA 5CF4A 3QAME 4DDGA 5KUPA 3VS1A 3FWQA 3KEXA 3FMKA 4KIOA 1JQHA 3F88A 4BJJA 5EK7A 3D14A 4O7ZA 1Q8WA 3PE2A 4ZK5A 1ATPE 4O7RA 4DH5A 2GNJA 3F82A 3NUPA 5EFQA 3TJCA 3IK3A 4CFNA 5J5TA 2C0OA 3DJ5A 3NEWA 4FNWA 3TTJA 4C2WA 4BCMA 3D4QA 4QYEA 2IW9A 1M7QA 2QLUA 4M68A 3VUDA 4BZNA 4UMTA 4C4JA 3HA8A 4YMJA 5JH6A 4GIHA 2R3PA 2WIPA 4AQCA 3QHRA 3FC2A 2UW7A 4AACA 2UZBA 3HVCA 4PTGA 4ZTMA 2ACXA 4RX9A 4YSMA 5E92A 5E8WA 3LCTA 4RX7A 4AS0A 4N6YA 4QEBA 2A2AA 3QTXA 1URCA 4H3PA 3UIMA 3GC9A 3RMFA 2XS0A 2BIKB 2J90A 4I24A 4PV0A 4PPAA 4L67A 2EXEA 5GNKA 5L8KA 2W1CA 2WQMA 2JDVA 2XIYA 4M97A 4QRCA 5HNBA 4LGGA 4DG2E 4IAIA 4BIDA 1WVYA 3ET7A 4CT2A 3RCDA 3R8PA 4K6ZA 4XCUA 5E8XA 3A2CA 1TKIA 2XNBA 4RC4A 2I0HA 3KMMA 3O8TA 3OCSA 4QMUA 1HCLA 3ZLYA 1ZXEA 4XBUA 2OKRA 3GC7A 4G2FA 3VF8A 5KZ0A 2Q0NA 4BZOA 4R7BA 4I6LA 3MI9A 3F66A 2OZAA 1ZYSA 1P14A 3F61A 4IAAA 5JN2A 3PRFA 4AN2A 4BDHA 3BYUA 3R7IA 2C5YA 3ZC5A 2WMUA 1G8KA 3FI8A 2BZKB 3CTQA 4IFGA 4X2JA 2O65A 3OP5A 3SOCA 3CS9A 3G9LX 4U42A 5AR4A 2ZJWA 4ZJVA 1KV2A 3P08A 3FQSA 3CQEA 3BU5A 4P5QA 2C3KA 2ZV7A 3CBLA 5HE2A 5LVMA 4ALUA 4LRMA 5A14A 2C3IB 4CV8A 3CGFA 4JJRA 3WARA 4DEIA 4GUEA 5KX8A 3HAVA 4FTOA 4F08A 4AT3A 1OM1A 2ITTA 3VRYA 3E63A 5LCKA 3D5XA 3MB6A 4ANOA 4EHEA 4D4SA 2W99B 4YGAA 2W1FA 1FVVA 2YLEA 4G16A 2J0LA 2XA4A 1JNKA 4O22A 4PDSA 3TZ7A 4CKIA 3DFCB 4F65A 2IG7A 4D4RA 3F5UA 1YHWA 3NW7A 5EW9A 4G3CA 4DFYA 4USDA 4E6CA 4RJ4A 1RW8A 2IVVA 5F9EA 2B55A 3PYYA 5AUTA 4MWHA 2E2BA 3OFMA 4YHFA 5JFWA 2P2IA 3NUXA 2I0YA 2OH4A 2OXYA 5HTBA 1PMVA 1JWHA 4NKSA 4BDDA 4F78A 2W9ZB 5EW3A 1Q3DA 2BIYA 4G17A 3AKJA 3O7LD 2BUJA 4GMYA 5E91A 4IAFA 3GCUA 4TYHB 4AWIA 4FEXA 5FP5A 4O96A 2PZPA 4LMNA 4OT6A 3PE1A 4AGUA 2ZV8A 2OF2A 5CX9A 2GDOA 4ZTRA 5K9IA 4FOCA 3II5A 4AZVA 2P33A 4DHJA 4FL2A 4M12A 4J1RA 5HD7A 1SNXA 3KK8A 4BGHA 4QMZA 4N0SA 2PE0A 1MRUA 2UUEA 2YLFA 4FIIA 2PVYA 3VS3A 1Q8UA 2J6MA 4I6QA 4TWOA 4R78A 4FSRA 5EHOA 2VX3A 3IW4A 4LV5A 2XK8A 1M2RA 4JBPA 5F94A 4BDGA 4GG7A 2VTQA 4QYYA 3ZU7A 1J7IA 1TFFA 2PUUA 4MVFA 1Y8GA 4L46A 5ACBC 2X8IA 3AMYA 2Z2WA 1H1PA 3BGPA 3PA3A 3KXHA 3R21A 4FTIA 4PX6A 3QU0A 4RSSA 2NPQA 3COMA 4LRKA 3ZOSA 2QG5A 2UZDA 2PMNX 2V55A 3FL4A 4TY1A 3UVRA 5T3QA 4CQGA 5HX8A 1NVQA 4BF2A 2VTRA 5K5XA 4V04A 1XJDA 2R3JA 3QZHA 5AP7A 3PJ1A 4G6NA 4XMOA 4PNKA 2ESMA 2R3KA 2ZOQA 1PXIA 3QA8A 4FBXA 4BBMA 3NVKI 1YRPA 4JOAA 3KRLA 3PVGA 3EL8A 1PRYA 2ITPA 4NSTA 3C51A 5CXHA 5FQDC 4OAUC 5DMZA 4U45A 4XG6A 4XV2A 5ETCA 3COHA 4FV8A 4APPA 1KE6A 3AXWA 2WTJA 1OL1A 4OTGA 3QTIA 2IF8A 4N4SA 4H1JA 2FO0A 2B1PA 2YDJA 5AAGA 4QNYA 4MNEA 3VS6A 2X2KA 3FY0A 3HV3A 3Q9WA 4C0TA 4U79A 1A9UA 4OTWA 4FV1A 4WHZA 4D2WA 1GY3A 4L68A 5HU3A 3QUEA 4ZLOA 4FEWA 4RFZA 5LVPA 1XH4A 4O7WA 2P4IA 5IUHA 5JGBA 3ZDIA 3TDWA 1BYGA 1H24A 5L2WA 3C9WA 5DA3A 5IQCA 3D5WA 5BX0A 2WIHA 3H0ZA 4E26A 3E93A 4MBIA 5J95A 1UWHA 4QYHA 3PJ8A 2QKWB 5D7AA 2G15A 4V05A 3BHTA 5LWNA 5BNJA 1RQQA 2VD5A 3EQCA 4FK6A 4UALA 4C4EA 2RL5A 1UU9A 3ZEWA 4F63A 3WYYA 4Q5HA 5DEWA 1ZMVA 5HE0A 4QMLA 5D7VA 3QXPA 5AV2A 3FQHA 2GCDA 3VNTA 4NFNA 3TT0A 4ASZA 4IQ6A 4RVKA 4OBOA 4KKEA 5DVRA 4BCNA 4L9IA 5FTOA 5JFXA 4FODA 1WZYA 2C6DA 3EN9A 4QTAA 1Q41A 3IW8A 4D0WA 3Q4UA 4FTQA 4Q9SA 3FKNA 3I7BA 3MSSA 4FKUA 4J97A 4R3CA 5FEQA 1OBDA 2CCIA 2QO9A 2XJ1A 2BDJA 4H39A 2X7FA 2A0CX 2VU3A 4A4XA 3C5IA 3FI2A 3KGAA 3KULB 1H1SA 5EQPA 4ASDA 3KXXA 3ORNA 2BKZA 4F0GA 4FA2A 1ZAOA 4PMMA 3PSBA 1OL5A 4IWQA 3S0OA 4RIXA 1S9JA 5IMXA 3AGMA 3DFAA 4IM2A 1H0WA 3LFAA 3BEAA 4AP7A 4IM0A 4BBFA 4F6UA 4KIKA 5CU6A 1OGUA 2RFSA 2DWBA 3GP0A 4EBVA 5JQ8A 4CFWA 5DRBA 1M7NA 5HG9A 2VTAA 5BPYA 3AC1A 2V5QA 5AUXA 1FMOE 2FGIA 2ZV2A 5E8ZA 3BL9A 4FKRA 5J7HA 4FGRA 4RJ6A 4RIWA 3S00A 2F7EE 2HZ4A 3F6XA 3PWYA 4JX7A 4OBPA 4FI1A 3QL8A 3TKUA 2R3GA 4KNBA 3E87A 3OBGA 3QCQA 4KBCA 4BI0A 4O86A 3DS6A 4QTDA 4IZAA 5HBJA 3I4BA 4WG3A 3TXOA 4L42A 4O0SA 3BU6A 5FDXA 1F5QA 2RG5A 2VTHA 3PXZA 4QP8A 4CTBA 2PUNA 4D9UA 4F99A 1RE8A 4QTEA 3EHAA 5KMLA 4AXEA 1ZOHA 3NX8A 4TNDA 5M51A 4XG2A 2Y4IB 3HLLA 3VS5A 5EKNA 3UPZA 2J5EA 2BCJA 4FTLA 4MQ1A 4UWBA 3TIZA 1P5EA 1JKLA 3SHEA 4JAIA 1XKKA 3R2BA 2PVMA 2YDIA 3R8UA 1KE5A 2JAVA 3LXNA 3NUUA 5DH3A 4WOVA 3A8WA 3UO6A 3Q3BA 4O4EA 5D9HA 4BGQA 4DTBA 3QTZA 1H1WA 1YWRA 2H8HA 3Q9XA 4NIFB 4BKJA 3JYAA 3ACKA 4FZDB 1URWA 4X3FB 3ZLXA 2HXLA 3DOGA 4DTKA 5J79A 3BI6A 3Q52A 1BKXA 3HZTA 4R7IA 3PVBA 4F7JA 1YXTA 4HW7A 2R3IA 3NIEA 5JMSA 2BILB 3D5VA 2WTKB 3UDTA 2B7AA 4Y5QA 5EKOA 2PVHA 3F9NA 2WEVA 3R8LA 4L7FA 5BUEA 3FV8A 4FSNA 5IKWA 2YJRA 4CYIA 3WZDA 4XEYA 1H27A 3TNIA 5GHVA 4LV7A 4IMYA 3FMEA 3DNEA 4GK3A 4MCVA 3GT8A 3K3IA 4FT5A 4H36A 2ITNA 4NM7A 4HVSA 4DG3E 5HVKA 2QU6A 3D15A 5CVGA 4GFOA 3NAXA 5IQIA 4K33A 4P5ZA 2VGOA 3AD5A 3GCPA 2R3MA 5TE0A 5LMKC 2CLXA 4NK9A 3EOCA 3NNXA 2F49A 3IO7A 5J9LA 1H07A 1Q24A 3D7TB 2R0UA 2C5NA 5TOZA 4JMQA 4EH7A 5M06A 4QP9A 5CVFA 4FTUA 2JGZA 3FQEA 3W55A 4XHKB 5KMMA 3KXGA 4J8NA 5EM6A 4AU8A 4QMOA 1OUKA 2YM3A 4FG7A 4TYJA 5H3QA 4O7NA 2BALA 5IH4A 2HCKA 3MGYA 4YJVA 4ANMA 2UV2A 4M3QA 2C5XA 4U43A 3W16A 5H9BA 3HX4A 1VYWA 3P0MA 3FMMA 1R1WA 4ZJIA 3DY7A 4KA3A 1H8FA 2QNJA 2I1MA 3L9MA 3IGOA 2ETKA 4QOXA 2J9MA 4ZIMA 3TKHA 3W10A 4C4GA 2JITA 3ZUVA 4Z3VA 4YJQA 3SVVA 2B9HA 3SD0A 4XRJA 3U8WA 2B4SB 4IAYA 3ZO1A 3ENHA 3LJ0A 3F5GA 5HNGA 4EOKA 4PWNA 2JBOA 2B0QA 3L8VA 2X39A 4RC2A 5HO8A 3QRJA 4NH1A 3TV6A 2OJJA 3KB7A 4I93A 4RZVA 3PTGA 4V0GB 4FIHA 4I23A 4BTFA 2JIIA 3AGLA 3O8PA 4XH6A 4ZY4A 4ZSLA 4ZS0A 4BR3A 3UDZA 4YNOA 1YHSA 1NY3A 5IH6A 3RAHA 3RNIA 4DEAA 4WKQA 2VTSA 1GNGA 5JRQA 3G15A 3DDQA 3GU7A 3PXFA 4FSWA 4CXAA 3TWJA 2WEIA 5FP6A 3LMIA 5HCXA 4FEVA 3KL8A 4O82A 4IX5A 4PY1A 4ZSGA 5DLSA 3UC3A 5HQ0A 1WFCA 4DHIB 2XCKA 2B9JA 2C6KA 2GNGA 4MXZA 4EBWA 3ORZA 2YN8A 5DYJA 4ZSAA 1PMNA 2ONLC 3GQLA 3ZFXA 4QO9A 3B8RA 4WNPA 3LPBA 3TUBA 4FTNA 4IB5A 5D11A 4I4FA 4JG6A 3DU8A 3OOMA 1WBOA 1FQ1B 3D2IA 4RJ8A 4FZ7A 4MWIA 3WF7A 5IQDA 1WAKA 3VBWA 2OGVA 2W4JA 4GS6A 5GJGA 4ACDA 1WVWA 4U7ZA 2YCRA 4ORKA 5HD4A 4CMUA 3NUYA 4RRVA 3AT4A 4KSQA 3BX5A 4XUFA 4YZMA 2WPAA 2WU6A 3F3VA 1OL7A 4J95A 5DI1A 5L2TA 3DZOA 3UOKA 3UYSA 2HK5A 3VBVA 2VO7A 3WZJA 3O23A 4JQEA 1Q8YA 5M53A 2C30A 3O96A 5CQUA 3KRRA 3K54A 3DK7A 3Q4TA 1VZOA 2W1ZA 3KCFA 2E9OA 2VTPA 2EXCX 3OC1A 4FIGA 3AD4A 1TVOA 4DEGA 3VC4A 2NRYA 2OLCA 4LDTA 2BDFA 4IVAA 4F1MA 1MRYA 1G3NA 3NSZA 4LRJA 2XP2A 4ALVA 4YU2A 3IGGA 5AP4A 4AA5A 3TUCA 2X8EA 3VS4A 3HDMA 5IDPA 4FV4A 2G1TA 3UPXA 5CF6A 3NZ0A 4DH7A 5IH5A 3M2WA 3FYJX 2A19B 5CQWA 5K3YA 1MP8A 5HE1A 2GS2A 5CAPA 2ETMA 5HX6A 4QD6A 2WQOA 5J8IA 3LCOA 1WBTA 4BGGA 3R1NA 1PYXA 2XIKA 3FMLA 5L4QA 5H8EA 3O7LB 4J7BA 3UIBA 4R3RA 5HI2A 4NTTA 5M4FA 3KRWA 5HHWA 3P5KA 3BCEA 2PZYA 3FKLA 3QCXA 4IW0A 3LFQA 4C2VA 4LUEA 1YXUA 4XG7A 4JL9A 4MKCA 3W2CA 2XK6A 1Y57A 4H3QA 3ATTA 2QG7A 2BZHB 4PDPA 1XO2B 5FXRA 2WTIA 4E6QA 4YJTA 1K9AA 4PPCA 3VJOA 4BCIA 3GUBA 3QHWA 4FSYA 2OFVA 2X0OA 3JR1A 2UW8A 4PDYA 2JDTA 3W2OA 4UN0C 2ITVA 2QOBA 2WOUA 2G2HA 3F5PA 4D1SA 3V5TA 2FSTX 3MVHA 3ZTXA 3IG7A 4YUQA 3TZMA 3UG1A 4S34A 2XALA 4F7NA 1UKIA 4IVCA 4JI9A 2ITQA 3IECA 3EYGA 4C3PA 3NMUF 3VUKA 4WA9A 3UVPA 5FBOA 4AF3A 1DS5A 2J7TA 1Y8YA 4FL3A 4O27B 4BZDA 1OB3A 4YC6A 4XLVA 4X3JA 4A7CA 2XAOA 2QO7A 4FL1A 5DT4A 3A60A 1CKPA 3V5QA 4D28A 4RJ3A 2XCHA 4XLIA 3NGAA 3WE4A 4RFYA 3HGKA 1YKRA 3NUNA 5C8KA 4R6VA 5A6NA 3CSVA 2AC3A 4EQCA 4CFMA 2I0EA 1F0QA 1Q61A 3MB7A 3MDYA 4JDIA 4IIRA 4WSYA 4C59A 3OCBA 4GW8A 5A9UA 2X81A 4C33A 3MIAA 2WMTA 3AMBA 3C13A 3QA0A 3I5NA 3FMHA 2VX1A 1YWVA 5E1SA 4E3CA 5AADA 3KC3A 5GJDA 3W33A 2CMWA 2F57A 1ZOEA 2JFLA 3PP0A 2BFXA 4PUZA 1CKIA 4WUNA 4NW5A 3ZM4A 4FYOA 4FICA 3PVUA 3QX4A 5HE3A 4CSVA 2IZRA 2J50A 2IZUA 1WVXA 2BZIB 4NCTC 3TZ9A 3RWQA 2EWAA 4XP2A 3UODA 3RPYA 4FIFA 4Z9LA 3FEGA 4A4OA 1ZRZA 3KA0A 5HCZA 1DAYA 5BVFA 3DXQA 5C26A 1QMZA 4ANQA 2ERZE 4LG4A 3WILA 5CWZA 5AEPA 2CLQA 4L01A 1O6KA 4TYHA 4ID7A 4IWPA 3DLSA 3R1SA 4FV5A 4W8EA 3LAUA 2CNUA 2PU8A 3EQRA 4GIIA 3LQ8A 4UZDA 4JBVA 4LL5A 3E88A 1R0EA 5FG8A 4F1TA 3DB8A 2GNLA 2IVUA 2O8YA 2BRGA 3FSFA 2O5KA 3OHTA 4O2ZA 3LQ3A 4EC8A 4FVPA 3GU6A 1XWSA 3NYNA 3M11A 1KOBA 4YZCA 3E64A 3EFJA 5CAUA 1M17A 4ZSEA 3ZSHA 5KHWA 4DT9A 3G51A 2UZLA 1ZZLA 3R7EA 3F2RA 2FH9A 3ZBXA 3L1SA 5EYKA 3K2LA 3W2PA 1GZNA 3NYXA 4DH8A 5FM2A 1OZ1A 3AQVA 2OI4X 2OIBA 4MF0A 3BU3A 2CGUA 4OW8A 1ZYDA 4RWLA 2B54A 4YC8A 4YHTA 5J87A 4F6WA 5CEMA 2RG6A 5K0KA 5I5ZA 5ANJA 1VLRA 2YIQA 4EH4A 3O2MA 2UVXA 4FKIA 2UW3A 4FNXA 3GCSA 4ZMFA 3I0OA 4FKTA 3KREA 3E92A 4C7TA 5E90A 4M0YA 1DM2A 3NS9A 2R2PA 1OVEA 3JXWA 4PQNA 4BCFA 3NW5A 2J5FA 2Y4PA 2XNMA 3M1SA 3R83A 3PLSA 5L6WL 4O7YA 2HXQA 3LLAA 5M4UA 3PJ2A 3NWWA 4GKIA 1GZKA 2VNYA 2VTLA 4O7TA 1SYKA 4FKLA 5M07A 4G3FA 3ZH8A 4AOTA 1W0XC 3R63A 2XYUA 4L6QA 4B8MA 2HZIA 1WCCA 5AP3A 2YCSA 3R1QA 2QHNA 4NUSA 5H8GA 5HKMA 4W4YA 3RPRA 4BKYA 4ERWA 3OWKA 3QZGA 4ZEGA 3ACJA 4CKJA 2E9PA 2PULA 3QTQA 3WYXA 3G6GA 3BLQA 3ZRMA 2C3LA 2QLQA 3FI3A 4DH3A 3WOWA 1FPUA 4AUAA 4L45A 5FGKA 3R7YA 1GZ8A 1YDSE 3BV2A 3T8OA 5CSPA 1IG1A 3V01A 5A4QA 4B9DA 3MWUA 4S33A 3LMHA 3PY3A 3IOKA 4YJOA 1CDKA 4UBAA 4ACCA 4FKPA 2GNFA 3RAWA 2YCQA 4G3DA 3H9OA 5AAEA 2WMQA 2XH5A 4GT4A 5CLPA 4Z7GA 4JT3A 2LGCA 3TM0A 4F6SA 3FLWA 3HEGA 5HG7A 2W96B 4IVDA 3P9JA 3ORTA 4O7SA 3PY0A 3MY5A 4PTCA 5FWKK 5DG5A 5HTCA 3FZRA 4RA4A 3NYVA 3TN8A 1YQJA 3E8DA 1RJBA 3LFSA 5DIAA 3LKMA 2XJ0A 3QD4A 4I94A 3VUGA 2PVFA 3ORLA 1REKA 3QQGA 1OPLA 5ACKA 1Z57A 2UVZA 3QUDA 3T3VA 4YJNA 4S31A 5ANKA 2IN6A 4QMSA 3RPOA 4BDAA 2XKDA 2YM5A 3VO3A 4X21A 1W8CA 5H2UA 2QOFA 1T46A 3U4WA 1IA9A 4EOOA 2C47A 1K2PA 3KULA 1M14A 4KB8A 1MUOA 4YZBA 5I4NA 5D1JA 3R8ZA 4IB0A 3TV7A 4DG0E 4D2VA 3MFUA 4ZTNA 1U54B 4EH8A 4W4VA 1A48A 3W32A 5CSHA 4QMXA 4RPVA 3CLYA 4JBOA 3A8XA 4XP0A 3U55A 2Z7LA 1ZYCA 3QZFA 4FJVA 4W4WA 4HGLA 3A7IA 4MQ2A 2XVDA 3BIZA 3DB6A 3TNWA 3QZIA 4CCBA 3V5LA 3DBQA 5FD2A 5K4IA 2VTMA 4N6ZA 2WMRA 3PDTA 4WT6A 4AG8A 4FGBA 4C35A 3DTCA 3WZUA 5F95A 1YOMA 3QD0A 5CI7A 3PXKA 1Q5KA 4EOIA 2Z7SA 1SZMA 3G9NA 3DAEA 4L53A 2X4ZA 3RJCA 2E9NA 4IANA 3EQDA 1ZWSA 2PL0A 1E1VA 4UYNA 3A7FA 3TTIA 4XV9A 1QPEA 4EK3A 3TIYA 5IUIA 4BCHA 2GS6A 2YM7A 1AQ1A 4N70A 2OK1A 2PHKA 5E8YA 4PF4A 3GFEA 4C8BA 1JKTA 2XM9A 3LFBA 4GFGA 4NU1A 3S3IA 2YFXA 4YNEA 3IDPA 4FSZA 4U3ZA 2VWXA 3FHRA 5M09A 4KKHA 4J8MA 3O17A 4FIJA 3ETAA 4JVGA 4YHJA 5CENA 3U87A 3UC4A 3VRZA 3U54A 4IEBA 5GIOE 5DWRA 1CTPE 3SRVB 4LV8A 3UOHA 4RJ7A 4IXPA 4CFXA 5AR8A 4EOLA 5HU9A 1U5RA 4A9YA 3EQFA 4DBNA 1YVJA 2X8DA 3FE3A 2W1HA 3D9VA 3SG8A 3LOKA 1JLUE 3DK3A 2VWVA 4G3EA 4ANBA 1NW1A 3AT2A 3BWJA 3OCTA 4EC9A 4EWQA 4UY9A 5AA9A 5IEYA 4JS8A 5HBHA 5I9YA 1WMKA 1OITA 5CVHA 2E9UA 2YWVA 1W98A 4E7WA 4X3FA 4O1OA 3DKGA 5LCJA 4C4IA 5FXSA 3C4XA 5EDQA 4TYEA 3W0QA 3EN5A 3HKOA 4GU6A 5AP6A 2IW8A 3S1HA 4C38A 4DINA 5BYLA 2OXDA 4O38A 2H6DA 2QOQA 4GVJA 1KSWA 4QDEA 2WMVA 4A07A 3W0MA 5CNNA 5L2IA 1O6YA 4OUCA 2BRBA 2C1AA 2FSOX 4O1PA 4RVTA 2BHEA 3ORKA 5JKGA 3EJ1A 2IZSA 3PJCA 3QQFA 5TF9A 4TZRA 3ZS5A 1YI4A 5H8BA 5I3OA 1S9IA 3P7AA 4BDCA 2BDWA 3GVUA 4FKGA 4BI1A 4BIEA 5JGAA 2GHMA 2W4OA 4ZOGA 3OWPA 3G6HA 1YXSA 4HNFA 4OTFA 4HVGA 4QMPA 4K8AA 5LMBA 1UU8A 3D7TA 4O91A 4WO5A 3AC8A 3P79A 5BV3A 3CKXA 2XM8A 5J7BA 2JDSA 5CSWA 3F3ZA 3GU8A 1L8TA 4TRLA 3ZO4A 4RJ5A 4M8TA 1YDRE 2C5OA 3OXTA 2F7ZE 5AP0A 3R9HA 3R9NA 1JSTA 2XEYA 3V8TA 5AR7A 4JLCA 4RWKA 3W1FA 4DF3A 5HEZA 2HWOA 2YIWA 2ITOA 2ZFYA 4I6BA 4FUXA 3POOA 5LMAA 5CU0A 2PYWA 4RBLA 4NEUA 3S95A 3SAYA 3I6WA 2DQ7X 3ZLSA 3ZM9A 4CGAA 3G2FA 2YERA 5CY3A 3UE4A 3MVJA 3PSDA 3UZPA 2PTKA 2I0VA 4EL9A 2C6MA 3HV7A 4A06A 4A9RA 4R5SA 3UOLA 4E5BA 1G8SA 2HY0A 4E6AA 4AGDA 3P86A 3QLFA 3C50A 2W7XA 3F69A 4AZSA 3L9NA 4ZTQA 3ANRA 4CZUA 1XBAA 4F64A 1BMKA 3KU2A 3HUBA 4X2GA 5DBXA 1PXNA 4BYJA 3LXLA 4MF1A 3GXLA 4I92A 4V0GA 5M44A 3MH3A 2OWBA 1PXJA 2GQGA 4AGCA 3CP9A 3D0EA 3TUDA 3FXXA 1KE8A 5KE0A 4PRJA 3VUTA 1W84A 3VHKA 2FYSA 3VHEA 2JKQA 4EH9A 2RGPA 3KXNA 4XRLA 5CU2A 4QMYA 4C57A 3OS3A 2XNPA 3HMNA 3GB2A 3HRCA 3I0QA 4EUUA 3F3TA 3TJDA 4NW6A 3EFWA 1I44A 4O6EA 5DOSA 3UVQA 1BL6A 3DTWA 4F7SA 1GAGA 5BVKA 4BJJB 3E5AA 4HYSA 3EFKA 3W2QA 4QQ5A 2CKQA 4XG4A 2QOOA 2G9XA 2RSVA 2XIXA 3UQCA 4ZAUA 5L8LA 2J0KA 3LCDA 4I0TA 3UO4A 5BQ0A 3QQUA 4IC7A 2YZAA 4CLIA 3SV0A 5EYDA 4FSTA 4DLJA 4I20A