3WZJA

Crystal structure of human mps1 catalytic domain in complex with 4-(6-(cyclohexylamino)-8-(((tetrahydro-2h-pyran-4-yl)methyl)amino)imidazo[1,2-b]pyridazin-3-yl)-n-cyclopropylbenzamide
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
279
structure length
257
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of Imidazo[1,2-b]pyridazine Derivatives: Selective and Orally Available Mps1 (TTK) Kinase Inhibitors Exhibiting Remarkable Antiproliferative Activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
total genus 73
structure length 257
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3wzjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3wzjA01
3HUBA 3VUKA 1G8SA 2XJ1A 3HEGA 4MTAA 3R9OA 3HYHA 2Q0NA 4FIFA 1F5QA 3PP0A 4GFOA 2QHNA 4MXOA 2QR8A 4EUTA 4FKIA 4CYIA 4AGDA 2VWBA 3NRMA 3IW6A 2OU7A 4HCUA 4IWDA 5H3QA 4OAVB 2X2MA 3TV7A 1DI9A 2WNTA 2CLXA 3ZO2A 3SDJA 1K3AA 5DLSA 4TYHA 5IQFA 3AGLA 3CCNA 4GK3A 2HZNA 4QP8A 4ZJVA 4BDGA 1AQ1A 4U43A 2JAVA 3RZFA 4GKHA 4U42A 4J1RA 4TN6A 4TWNA 4TT7A 2C3JA 3D7ZA 3HRBA 3U55A 4R3CA 4KD1A 3D15A 2PZYA 3HECA 1YWNA 3R1YA 1Y57A 3NNWA 3NR9A 3PZHA 5BPYA 3QTIA 4OW8A 4RWKA 3DJ6A 5AUUA 4AW5A 3SRVA 3PDTA 4XG6A 4DC2A 4XEYA 1DAWA 2HK5A 2CKEA 4EHVA 3QLFA 4XMOA 1LUFA 4P5ZA 4AQCA 5B7VA 2E9VA 3EZVA 4XOYA 3AD5A 5AIRA 3CP9A 3E8DA 5ACBC 4I24A 3W33A 2CNUA 4HGEA 3SG9A 4FTTA 4O81A 4ZMEA 4RIXA 3QTRA 2C6EA 2EB2A 4M13A 5EQYA 2KTYA 4N70A 4JG8A 3DXPA 1Q99A 5CSWA 3OUNB 3HX4A 1BKXA 1FOTA 1H07A 2PHKA 3NDMA 4A4XA 5GZ9A 3FI4A 5E8UA 2X81A 3VNTA 4BDCA 1H0WA 2Y4PA 3OF0A 4FTCA 1O9UA 5DRDA 4MWIA 5IPJA 3PIYA 4OT6A 5M07A 5EM5A 5JT2A 4NUSA 1WBSA 2QHMA 2B9IA 4D5HA 4F7JA 3JXWA 3AMBA 4IX6A 4IJPA 1H25A 1SNXA 2ETRA 5GJGA 2W1DA 3V3VA 4JBVA 3C9WA 4E4NA 4F1TA 4FKUA 2A27A 2OLCA 2R3PA 3VUDA 4WO5A 3TN8A 3GC7A 3R8LA 3BZ3A 4EOQA 5JEBA 3VS4A 4QTAA 2J9MA 1YXVA 4Q2AA 3QQGA 4IZ7A 4FKVA 3VF9A 1U54B 4PY1A 3F2AA 4PP7A 1CKIA 1JOWB 3RK5A 4EBWA 3U51A 2JGZA 3AG9A 5M06A 4R7IA 3AOXA 2C1BA 5HG7A 4BCJA 2JDOA 4IB5A 1BLXA 3UC3A 4AG8A 2R3KA 4ZXTA 4FZ7A 4GJ2A 4AW2A 4HNFA 4M68A 4D2TA 5HG8A 4UMTA 4UYNA 5AUTA 3Q4CA 1GZNA 1ZY5A 4OTIA 3KULA 4BHNA 4BWKA 4CLJA 5ANDA 3ATTA 4DFNA 2WMBA 2W1ZA 3NPCA 4IM3A 5J5SA 2R0IA 3C7QA 4AACA 5LVPA 3I4BA 4H3PA 5IA2A 1W82A 4TYJA 3ZCLA 2DWBA 4BZOA 4ACMA 3FLZA 2PZPA 3NZ0A 3NAXA 1PXLA 2NO3A 4FGRA 4Q5EA 1IR3A 1YDTE 4EOSA 5DYJA 5E8SA 1WBOA 4EK6A 2QOFA 4F1MA 2B9JA 2C6TA 4GJ3A 3FSFA 4GIIA 4IVAA 4XOZA 4PL4A 4E6DA 4HVSA 5HTIA 3G9LX 4G1WA 1M17A 3GCPA 4LV5A 2NRYA 2QR7A 2ZDUA 4KAOA 4WT6A 3VWAA 5L2TA 3CTQA 4XG4A 4L01A 5CU0A 4ZIMA 1YW2A 3S95A 5A9UA 3C51A 4FT7A 5HO7A 2WMUA 3ZO1A 5JGAA 2X8DA 2ITVA 2IZTA 3VW6A 3FY2A 4FEUA 1PRYA 5ANJA 3PTGA 3H10A 5CQWA 2BKKA 3NCZA 3V51A 2B7AA 4TWOA 1YVJA 2HIWA 2I0VA 4X2GA 3UG1A 2PMOX 3TNPC 1J1CA 4BGGA 1M7NA 4K0YA 5AP3A 2BAJA 3QUDA 4F65A 4R7HA 3ZHPC 3MN3A 3TJDA 1WAKA 2BRGA 4MHAA 4HCVA 3CXWA 2W1IA 5CASA 1REKA 4RX5A 1URCA 1WFCA 2RFEA 4FVQA 3F69A 4S32A 4ACGA 4CZTA 3IOPA 1VJYA 4R77A 1PKDA 1U46A 5FTQA 5GNKA 3ZBFA 1Q8UA 4JS8A 4WSYA 3TNQB 3LQ8A 4DFYA 4Y73A 4YZ9A 5FEEA 5M51A 3E92A 3WF9A 4O0RA 2X9FA 3BE2A 5HVKA 5IQIA 2B52A 4E26A 3L8PA 4IANA 2CGVA 2FH9A 3AD6A 4H58A 2GHLA 1OKYA 3UIUA 3TT0A 2YIYA 4FTMA 4MYGA 3R1SA 1SVHA 1FBNA 2BILB 4IM2A 5IF1A 5D10A 4LOQA 3FMDA 5J9ZA 3PXQA 1GZOA 5DI1A 2VO0A 2BFXA 4W9WA 3FLQA 2X2LA 3F3WA 5HE0A 3P1AA 1UNLA 1IEPA 4UZDA 2IW9A 3UQCA 4V01A 4NTTA 3E7OA 4EH3A 4NEUA 2DQ7X 3ZMMA 3N4UA 4L3PA 3FQSA 3AMAA 4EOOA 4ARKA 5BVDA 3HL7A 5CYIA 3T3UA 2XM8A 4A9YA 3ANRA 3BU6A 1JLUE 4UY9A 4XP3A 1Y91A 4BBEA 2OZOA 3EQGA 1H01A 4DAWA 4X6QC 2FYSA 3R6XA 4L68A 4BI2A 3Q32A 3RPVA 4YC8A 4H1JA 4K11A 5ETFA 4DF3A 4TL0A 3UP2A 3G6HA 3F7WA 1Q5KA 3GU8A 2C3KA 2OGVA 3M1SA 2QU6A 1ND4A 3V8TA 5H8EA 3SXRA 3W8QA 5E7RA 5CAVA 4ITIA 2R3RA 2WB8A 5FRIA 1ZYJA 5DFPA 4BDKA 4L43A 1OPJA 2CCHA 4BWXA 2XKDA 2WXVA 4AN2A 3H9FA 4EK8A 1P2AA 2BHEA 4V0GB 5HE1A 5C8NA 3QQHA 2FB8A 2B53A 4O0TA 4KSQA 3ODYX 4G3EA 3I0QA 3IOKA 4M12A 4MNFA 4YZDA 2NRUA 2QI8A 5ETAA 2GNGA 3KKVA 3WZKA 4USDA 4CD0A 2B55A 4FF8A 5E92A 2HAKA 1QL6A 2BZKB 4BL1A 5JFXA 4TYHB 1FVVA 5LJJA 3ZTXA 4O2ZA 3VIDA 2QOCA 1SZMA 5IDNA 4EC9A 1OL6A 5DT4A 1TQPA 3AT2A 2Z60A 4D4SA 3VO3A 3DTCA 3CPCA 4O7VA 4JDJA 3UVPA 2W99B 1SNUA 4ZZOA 3QGYA 1QPCA 4G5JA 4IQ6A 1PXOA 2H8HA 4FTQA 2CGXA 3OW4A 4LOPA 5IA0A 3NNXA 3QTZA 4KIOA 4NT4A 3DLSA 1Q97A 3IK3A 3KK9A 4J52A 3RHKA 4EH8A 4F7NA 1AGWA 5AP6A 5EK7A 3PE2A 3I79A 3MH2A 3OP5A 3PJ3A 4CQEA 4Z3VA 3BQRA 2ETMA 2VTSA 5LQFA 4BDFA 4AF3A 4JI9A 5J1VA 1HOWA 4OTWA 5LMKC 2XS0A 3DJ7A 2PVLA 2WQMA 2IVSA 3AC2A 2LAVA 2ZM3A 5CEMA 3F2NA 5EHLA 3KXXA 5I3RA 2PUNA 4NFNA 3R1NA 3P86A 3UZPA 4U97A 3FV8A 4M8TA 3MH0A 3DKCA 4GK2A 2WMVA 2UZLA 2Y6MA 4YLKA 2QOLA 3MVHA 3BU5A 4R3PA 4AA5A 5IQBA 2XM9A 2GS6A 2A4LA 2ITWA 4WNPA 3G90X 2X7FA 5GJDA 5M09A 3UOHA 4I5PA 3Q96A 3G51A 3LFQA 3AXWA 1XH9A 3QHWA 4XBRA 4FOCA 4N57A 5FEQA 4IWQA 5I3OA 3FL4A 4ZZNA 5JN2A 3CD8A 2Y8OA 3OROA 3CGFA 2ACXA 2XBJA 4I0RA 3ROCA 2BR1A 3P7CA 4FEWA 4JVGA 2XKCA 5IU2A 2UW0A 5EQEA 3BYUA 2WMRA 3QF9A 4H3BA 5CENA 4CFMA 5AWMA 5A4LA 5KMJA 1CMKE 3A99A 2QD9A 3KN5A 3NUXA 2UZDA 5C03A 5BVOA 4FEVA 4TWPA 2F57A 4HYSA 1JAMA 4GT5A 3SGCA 1FVRA 4AAAA 4K2RA 5IQHA 3FQHA 3F3UA 4JIAA 5FD2A 3V04A 4R7BA 2O8YA 2O3PA 4QOXA 3FLYA 4WHZA 1S9JA 5AJQA 3ZZWA 5IMXA 2I0YA 3CQEA 3PUPA 4DEIA 3DU8A 4EHGA 5L2SA 2HELA 2FVDA 2ZM4A 4BKZA 4PDOA 4RGJA 3D2IA 1UA2A 3FLNC 3PY3A 2ERZE 3OMVA 2EVAA 1V0OA 4GT3A 2YM4A 3PA5A 4JRVA 4XG2A 4GS6A 2JC6A 2WIPA 1H0VA 1ZYLA 1Z9XA 3KRWA 3QKMA 4GH2A 4ZLZA 3KRJA 4TKSA 4ANSA 5EDPA 3KVXA 2VNYA 3HVCA 5HNIX 3MBLA 5HX6A 4XLVA 4KBAA 4X0MA 2RL5A 3VN9A 3U9CA 3TV4A 2GNLA 3FSKA 4RLKA 3DTWA 1OKWA 1X8BA 3KF7A 4DYMA 2I1MA 1UV5A 4L7FA 4NTSA 1W7HA 2GQGA 3DBFA 1PHKA 2W4OA 3UVRA 1U4DA 1F3MC 4YP8A 2VWXA 4E20A 2Y4IB 5LMBA 3TCPA 2FSOX 3LPBA 1Y8YA 2YDIA 3DXQA 1NXKA 1YOJA 4D0XA 3TIYA 4EK5A 2JDTA 4OBPA 2ITUA 1ZZLA 5KBQA 2BRBA 3GU7A 1W0XC 2GFSA 2IZSA 2RFDA 2VO7A 4GCJA 4QMOA 2WMAA 4K8AA 3PG3A 4WOVA 1J91A 4QMWA 2FO0A 4F4PA 5I9WA 4UWYA 2A2AA 3KCKA 3TNWA 4EZ5A 1STCE 2Z2WA 5HG5A 1URWA 3DV3A 5JH6A 4UMRA 5F1ZA 4FVRA 3IONA 4O0SA 2F2UA 3UQGA 1ZYDA 4QTBA 4QMNA 4XJ0A 4C4FA 4PMSA 2YM5A 4AWIA 4IJ9A 3EQIA 4JDKA 4YHFA 4BCHA 2CHLA 1H1QA 2XYNA 4BDJA 4QP6A 4BN1A 4KRDA 2HWOA 4RIYB 3BHVA 5L6WL 2VTHA 4OT5A 3GU5A 2BROA 3H9RA 3LFBA 5AA8A 3RWPA 3MJ2A 3ZS5A 5C4KA 3BHUA 4FV1A 2VX0A 2JBPA 1SVGA 4EKKA 2BRHA 2F7EE 2XA4A 5HORA 4IDTA 3FBVA 3LJ1A 4MXZA 2E9PA 1FQ1B 1XJDA 3M11A 3ZSHA 4K33A 3U6HA 3QTXA 1CTPE 5KMNA 4Q9ZA 3OW3A 4LFIA 4EHEA 1BI7A 3ALOA 4IXPA 5E8YA 3QALE 5I5ZA 4E93A 1UU3A 1KE9A 4YHTA 5C01A 2VN9A 3EFKA 3TL8A 4AZSA 3MTLA 4Y72A 4FTIA 1XWSA 4KBKA 4FTOA 3TV6A 3VHEA 2XK6A 1M2QA 1XH4A 3QZIA 1Y6BA 3MW1A 3R7EA 3FZTA 5J9LA 3PFQA 5FM3A 5AR4A 4FTRA 3PA4A 1PMEA 4LMUA 2CGWA 2W1GA 4IAIA 2DYLA 3AQVA 3QTSA 4TYEA 3UYTA 2WQEA 1DM2A 3VS0A 4D9UA 5B2MA 1UKHA 5J7HA 4JXFA 3UNJA 4B8LA 3V5LA 2GTMA 3LMIA 4G34A 4FIJA 4W4WA 3RCJA 3TXOA 4CQGA 3CQUA 2QO2A 4B4LA 3V5PA 3L8XA 1YKRA 2R9SA 3UMXA 1HCKA 3QWKA 2RG5A 3NNUA 5L6PA 2R64A 4RC4A 3GXLA 1FVTA 3OT8A 4QMSA 5TOZA 4MAOA 3Q52A 4FV2A 3NUYA 3EQHA 2YM6A 2UW7A 5CSPA 3FPQA 4DBXA 5AR8A 1YHWA 2UVZA 1W83A 4JQ7A 3TNIA 3FMJA 4D2SA 1YQJA 4LQMA 2RIOA 3PXKA 1GIJA 3FXWA 5CZHA 3R28A 2IG7A 2X8EA 2WMTA 2YN8A 1JPAA 2WTJA 4D4RA 3TJCA 3EIDA 3FZ1A 3RAHA 4DFBA 1GNGA 5E8VA 1IASA 2UUEA 1Q8WA 3C0HA 3DB6A 3W10A 5AAEA 3D94A 4QNAA 4YUQA 2GTNA 3OY1A 4FSTA 5CU4A 5FLFA 3TI1A 4CMOA 3FL5A 4L67A 4GSBA 4I92A 3LJ2A 5A14A 4FSRA 2BUJA 3LFFA 3MTFA 3NYOA 3M42A 3H3CA 3JVSA 4JQ8A 1BI8A 5F95A 3R8VA 4AT3A 2HYYA 2YDKA 3F88A 4YHJA 5HG9A 1H4LA 4OBQA 3KEXA 2BIKB 3P4KA 1XBCA 2BZJA 4NJ3A 1XH8A 2ITNA 4O7RA 3QZGA 4C4IA 5KZ0A 3F5XA 3NW5A 3CS9A 5IUGA 1OI9A 2HZ0A 3QC4A 3DDQA 4NL0A 3B8RA 3A4PA 1CM8A 1TVOA 5M44A 2A1AB 2XNEA 2REIA 3E64A 4EOJA 2OJIA 2VRXA 4N6YA 5EFQA 1KV1A 3G15A 2YLFA 4HGTA 5FGKA 3UIXA 4BVUA 4G3DA 2IJMA 3PSDA 4E4MA 3FPMA 2H9VA 2C6LA 1JBPE 3ORXA 5AMNA 4DFLA 4E4LA 3QU0A 3ACJA 3BLHA 3F7ZA 2UZWE 3EFLA 3UE4A 4FGBA 5CSHA 2VTJA 3R8ZA 4HVIA 4NKAA 2PVNA 3K5VA 3ULZA 4FV5A 4UBAA 4WG4A 5K9IA 4ID7A 4J95A 2B9HA 3EN9A 3P08A 2J0IA 3RZBA 5AUVA 1LEWA 3ROYA 4QP1A 3LCDA 4R1VA 2XIZA 3QBNA 2J5EA 4O91A 4LM5A 5K5XA 3WZDA 4E3CA 5ETIA 2IVTA 1MQBA 5DRBA 5ANGA 4EOMA 1APME 2WGJA 1XQZA 2V62A 3HMNA 2C6OA 5EI6A 1E1VA 3F9NA 3ORTA 4QP3A 3D2KA 3UIBA 5KBRA 1MRYA 5DBXA 3EL8A 1ZXEA 5D12A 2VTLA 2C0IA 5G6VA 4C3FA 5JRQA 5HI2A 4D0WA 4YJRA 4CXAA 3FZPA 2J4ZA 3FEGA 2J2IB 5HLWA 2O64A 4D2RA 5FP6A 3FI3A 3KXNA 5JSMA 4R3RA 3RAIA 4IMYA 5K0KA 5GZ8A 4HPTE 4PPCA 4WKQA 4XRJA 4DLIA 4P4CA 5J87A 4BDHA 3VBVA 3HP2A 3W55A 2QOQA 2W7XA 3CGOA 3QRIA 4J98A 1H27A 3CKXA 4M69B 5HD4A 5M4UA 3QZFA 4YR8A 2VX3A 4W8DA 4O96A 2G2HA 4IEBA 3EWHA 3DAEA 3EQFA 2YWPA 3OY3A 2JD5A 2XB7A 5EM7A 3RVGA 5FUTA 5H8BA 1V1KA 2X2KA 2XJ0A 2CNVA 3W1FA 1R0EA 3HAVA 4ZTHA 3DS6A 4UMPA 5AAFA 1H00A 3CY2A 1Z5MA 3QRJA 3A61A 2OF2A 3BE9A 3W2SA 4FT9A 3VS2A 3UPZA 3LMHA 3CIKA 3ZUTA 1V0PA 3MA3A 4CFUA 4DCAA 3O2MA 1Q8ZA 3EFWA 3Q5ZA 3T8OA 4ZSLA 4D9TA 2VTIA 2I7QA 3BV2A 1MP8A 2YIQA 3C4CA 3QQLA 3QD3A 4PL3A 1R78A 2P2HA 2W05A 2EUFB 2YAAA 3FHIA 3OEFX 4RJ6A 4Y83A 4HYUA 3MFUA 4D4VA 3Q2JA 4FNXA 4UX9A 4Y85A 4GG7A 3QCQA 3QTQA 3PVUA 1YOLA 1ZYSA 2J5FA 4RA4A 2OKRA 3NSZA 4ONAA 3SAYA 4YTCA 1YOMA 3DNDA 3C5IA 1PXJA 3LFAA 5HO8A 1TQMA 4YJNA 2C6DA 4C0TA 1OITA 3OWJA 3C0GA 3K2LA 5EYKA 3WE4A 1WBVA 2YFXA 4FICA 3N4VA 3P9JA 1YHVA 4EC8A 2XVDA 3TZ9A 4D4YA 4YJPA 3MIYA 4DG0E 2UW9A 1O6LA 4O82A 4IVDA 4PWNA 3HV3A 2GNFA 3FC2A 1RDQE 3QRTA 1XKKA 3OOMA 4JBQA 4Q5HA 5EHOA 4YSJA 2PU8A 4ZS0A 3QKLA 1XH6A 3KCFA 1OMWA 4FNZA 3P79A 4FSNA 3GCUA 4FTAA 2PPQA 4YSMA 3WZUA 4OR5A 4ZTSA 5AP2A 2GHGA 2DUVA 2OXXA 4TYGA 1JKKA 2PVYA 2X6DA 3A2CA 3CC6A 4FK6A 4X2NA 5DPVA 5TE0A 4X3FB 3RINA 3UODA 5C8MA 4WNMA 4ZSGA 3VBXA 3FJQE 4JJRA 4FKJA 2Z8CA 5FBNC 4ACCA 1E1XA 4RG0A 4C34A 4DEAA 1J7LA 3S1HA 2C4GA 3R8PA 2ZB0A 4EJNA 3O7LB 4AE6A 4BIBA 3KA0A 3DT1A 3OBJA 3F61A 4FTJA 1R0PA 5CEOA 3RPSA 5M08A 2BKZA 1ERKA 2O65A 3ERKA 3QZHA 2B1PA 4FEQA 3PJ8A 5M57A 1QCFA 3GENA 2JDRA 5GZAA 3EH9A 2C5YA 4O1OA 4DEDA 3Q4ZA 4QYEA 3QD2B 5IUIA 2WQNA 4IADA 4F09A 2B9FA 4FG7A 5BYYA 5IA1A 3IGGA 1Q4LA 3CKWA 3RJCA 1OIRA 4EOIA 4KIPA 4P2KA 2PMNX 3V6SA 4B9DA 3FDNA 3TKIA 3OTUA 3VULA 2GQSA 4L3LA 2B4SB 4LL0A 4A9SA 2YISA 2WFYA 3UDBA 4EOLA 4F70A 5M4FA 4EOKA 5I9YA 4IZYA 3KREA 1CSNA 1JSUA 2G1TA 2C5OA 3UMWA 2UW4A 2PMLX 1PYXA 4KUJA 2P55A 2YM3A 5FXSA 3TKHA 4UB7A 1GOLA 5EM8A 3V6RA 2BTRA 3KRLA 3L9NA 3UZTA 5JQ8A 2QONA 4JR7A 3L8SA 3MSSA 4LGGA 2BCJA 4GU9A 4I21A 4EKLA 2YDJA 5B2KA 3HRCA 3P23A 4RQKA 3NUPA 3QGWA 1G5SA 4CKJA 3S4QA 5KHXA 1H8FA 3IW8A 3OWLA 1EH4A 3EN4A 2ZJWA 4RC2A 5E91A 3E8NA 4EQMA 4UALA 5F4NA 1KE5A 1OIUA 2QC6A 2R3JA 2FGIA 4WBBB 4C61A 3AC1A 3KGAA 4Y46A 2PYWA 4ZS4A 4BI0A 2IVVA 2YAKA 5CT7A 4ALVA 4MQ2A 4EHZA 1GY3A 4Z55A 2R4BA 5JFSA 2F4JA 3IW5A 2VTMA 4JDIA 3DZOA 4FUXA 3QTUA 4F08A 3NUAA 4CEGA 2PVRA 4FX3A 3LQ3A 3EQPA 3Q60A 2AYPA 4GRBA 2PUIA 1PXPA 2V55A 4RPVA 4BTJA 2XNBA 5BVEA 2JBOA 3U87A 3II5A 3BGQA 2RG6A 4O0UA 5IZFA 3MFSA 3KB7A 4Y95A 4AE9A 4NM5A 4I41A 3Q5IA 4NYEA 2VU3A 3EQCA 4BYIA 5GJFA 3U4UA 3BX5A 5IQAA 1OPLA 1L3RE 4YURA 2ITXA 2BZHB 2VWVA 4EH7A 3SLSA 2YIRA 3L9PA 2PVHA 1KE8A 2WPAA 2XNOA 3R7GA 3OOGA 2P0CA 4FZ6A 4IH8A 2PVMA 4CSVA 5AP0A 2EU9A 2WTWA 1PXNA 3C1XA 3CJFA 4LG4A 3LFEA 3V5JA 5F94A 3LLAA 3L9LA 4BCNA 4IFGA 2PUUA 4U80A 1G3NA 3BHTA 4I6HA 4YBJA 4E5AX 4O7ZA 4XV1A 4F1OA 4LRKA 2JITA 1JWHA 2CSNA 2FSTX 3C4EA 3FXXA 4UZHA 2IW6A 4GMYA 3RI1A 5E1EA 4EWQA 4IDVA 5HEZA 4QRCA 1R39A 1WBWA 4CZUA 5BMMA 1BMKA 4JNWA 3ZFMA 4I6QA 3RPYA 5M4CA 2JDSA 2HENA 4QMXA 4CRSA 3NIEA 3ENHA 4DG2E 3MVLA 2O0UA 4EWHA 3Q9YA 4RWJA 2ESMA 3TM0A 4PPAA 5L4QA 3ORLA 2XNGA 5EI8A 5HE2A 3CY3A 3QQJA 4EQCA 2QKRA 5L3AA 4DH5A 4RFYA 3WARA 3ZLYA 1SM2A 3O8TA 2KULA 4JX7A 4E6AA 1WVXA 3SX9A 3EZRA 4MD7E 4CMTA 3QD4A 5HE3A 4IX5A 4HZSA 4XV3A 3EN7A 5DH3A 2V0DA 4F7SA 2JKOA 4HYHA 5JK3A 4I3ZA 5CEPA 2ZV9A 5HICA 3PA3A 1AD5A 4YJUA 5JGBA 5E1SA 4W9XA 4XHKB 5AP4A 4DT9A 2OJ9A 5IA3A 2XCKA 5C9CA 4CT1A 4HGSA 4DGMA 3PXYA 5ETCA 4O7YA 5GIPE 4L7SA 1ATPE 4M66A 5AM7A 3UTOA 4BDDA 4O38A 5EYDA 4TZRA 2CLQA 3MPMA 4E4XA 5HU9A 4CZYB 1T46A 3ITZA 5J1WA 3QD0A 5L2IA 2GCDA 2OH0E 4EORA 2WMQA 3K3JA 2EXMA 3EOCA 3LVPA 3LXNA 4ZTMA 4BF2A 3DCVA 4MD8E 1OM1A 1KE6A 4RVLA 4YJTA 4YPSA 5KMIA 5JRSA 4IAYA 3PJ2A 2JAMA 5D1JA 2A0CX 4FKRA 4DG3E 3LIJA 5CF5A 5KMKA 2VNWA 5CI6A 3BBTB 4HZRA 4KKGA 3DXNA 3QCSA 3CQWA 4DT8A 2BAKA 2C68A 3DKOA 3LZBA 4YBKA 3FYKX 1H1WA 2CMWA 2NPQA 3G5DA 4YJQA 3QQUA 3CTHA 4YZBA 3EQRA 3ZUVA 4YZMA 5D11A 4KNBA 3AC5A 5E8XA 1CDKA 2VWYA 2XIRA 2G2IA 3GEQA 3KFAA 4GFMA 4D2PA 4BFMA 2ITZA 3IS5A 3ZXTA 4ZTLA 5KX8A 3KF4A 1J7IA 2PE2A 1E9HA 1ZY4A 2R3GA 1MRUA 4I6FA 4IVBA 3LJ0A 4IX3A 2VWUA 2W1FA 1W84A 3HKOA 3PPKA 4UWBA 5DNRA 2C30A 4AT5A 3R8MA 4EL9A 4U8ZA 2YCQA 3VBWA 2ZMCA 4NIFB 3RGFA 1ZRZA 2VV9A 3LCTA 4O1PA 3T3VA 4C7TA 3OFMA 1ZMVA 2HCKA 3A62A 5HHWA 5A4EA 5CAQA 2VTAA 4QP2A 2PZRA 4F7LA 4I0TA 4AGUA 3ORPA 2OZAA 5HIBA 3HUCA 1IAHA 5IQCA 2IWIA 3ULIA 2YWVA 3D9VA 1PW2A 2XF0A 4AOIA 3C4ZA 4BB4A 2JIUA 5HNBA 4BHZA 5BVFA 4HYIA 3E8EA 3RMFA 2GNIA 1M2PA 3B2TA 3EYHA 4IVCA 3RCDA 5EDRA 4BC6A 4IAZA 3GQLA 3O51A 3VS5A 4PNKA 4ASZA 3C4FA 3NYXA 1BX6A 2NP8A 2E9NA 1VYWA 4F0FA 1OBDA 3ET7A 2XKEA 3E63A 5A4QA 3LM0A 4ZK5A 3QA8A 4CNHA 2BDFA 3F82A 1OL1A 4WA9A 5C27A 4JOAA 2WTIA 4M84A 4WNKA 1S9IA 3DDPA 1FMKA 1VZOA 3C13A 4U9AA 4YNOA 5FP5A 4XH6A 1YXSA 4V05A 3R9DA 1BL6A 3ZU7A 4BWPA 4DHFA 4DEEA 3VRZA 3WBLA 1H1PA 4QMQA 3A7IA 2PVKA 4L52A 1B39A 4L45A 1M2RA 4AOTA 4DE4A 2OO8X 2ZAZA 3UBDA 5JMSA 3OEZA 3D5VA 4I5MA 3E87A 2UV2A 4RQVA 4BGHA 3SW4A 3RNYA 1J1BA 1LP4A 5IH6A 4CLIA 4OAUC 3V8SA 2XEYA 2XH5A 3MVMA 2UW3A 1XHAA 2EB3A 4J8NA 4YC6A 3TWJA 2UW6A 3PPJA 3BELA 1QPJA 1ZOGA 4G9CA 3PRIA 4NKSA 4G6NA 1V0BA 5GHVA 4DLJA 1VR2A 2IPXA 4OUCA 4QQJA 4HJOA 4A7CA 1Q8TA 2XK8A 4ITHA 1P5EA 3JYAA 1I09A 5JFWA 5KNJA 4O0YA 4FTNA 4OTGA 3ZSGA 2Y0AA 2WMXA 3I0OA 3JPVA 4RJ4A 4DH1A 1OBGA 3DK3A 3I7CA 4LV8A 4C38A 5HCZA 2PK9A 4RMZA 5KE0A 3R63A 1OKZA 2OF4A 1DS5A 2JLDA 5A4TA 2J0JA 3QUEA 5AP1A 4NK9A 3UP7A 3WZEA 1XBAA 5TKDA 3Q6UA 1UU8A 2VGOA 4J7BA 4ERWA 4CVAA 1Y6AA 4FIEA 4DEHA 3PE1A 2OFVA 3ORMA 3PXRA 4FOBA 4R1YA 4RJ5A 5HCYA 4YTIA 4X6RA 3FMLA 3MFRA 3A7JA 2A19B 3ATSA 3LMGA 1NVQA 4DTBA 2J7TA 4MF0A 3ZFXA 5BX0A 5H9BA 2W9FB 3ZM9A 4WUNA 4BDEA 1YI4A 3Q4UA 4C59A 4AZVA 2ZM1A 3OTVA 5CF8A 4PTCA 4ZZMA 4RLLA 4MXAA 4EZ3A 1JKSA 3L8VA 4OTRA 3FZOA 4JR3A 4BCFA 4FZFB 1P4FA 5AAGA 2VZ6A 2YM7A 2UW5A 4R8QA 4RIXB 4CMUA 2W5AA 1Q62A 3CSVA 4TYIA 4L6QA 2DS1A 3E88A 1R3CA 2R5TA 2VX1A 3KMMA 4M0ZA 3R9RA 4FG9A 5JFVA 4O7LA 3BYOA 4U40A 4R5SA 2X4FA 3W2OA 3PWDA 3ZUUA 3V5QA 4FZAB 4HPUE 2PE0A 4X3JA 5CEKA 4AUAA 3GCQA 4ZLYA 4FSMA 3P78A 2HXQA 1YI6A 4QMUA 3R00A 2QLUA 1YWRA 2G2FA 3WIGA 1KE7A 4JIKA 3E8CA 1A48A 1OIQA 5FM2A 5CWZA 4O86A 4QT1A 5LWMA 1W8CA 3U4WA 2GU8A 3PJ1A 5KMLA 2OI4X 5K4JA 2Z7SA 1M52A 2QOHA 3GGFA 4CFFA 5CAPA 3FQEA 2XNPA 2YCRA 4F0IA 5T3QA 3C5UA 3H0ZA 4FNYA 4NZWB 4PP9A 4RRVA 5DE2A 5EI2A 4I1ZA 5HLNA 3LW0A 3R71A 4U5JA 5M53A 5K4IA 1BUHA 4DINA 4LOOA 4USFA 4FUYA 4CT2A 3C4WA 2UVYA 4E6CA 4QMVA 3RHXA 4PTEA 4IX4A 4FV8A 1U59A 4RT7A 1XBBA 5HX8A 3FMEA 4AXAA 4K9YA 4HNIA 1WZYA 1RQQA 4ZJIA 2OICA 4O7NA 4I20A 1RJBA 1FINA 1OL7A 3O23A 1Q41A 1LPUA 4WNOA 3OCTA 4FL3A 2CJMA 2E2BA 5HOAA 3FWQA 5CY3A 3O50A 3R2BA 4C02A 3FMKA 2YA9A 2GFCA 4E7WA 5AEPA 2BHHA 1O6KA 4YU2A 4DTAA 4MVFA 2CKQA 1BYGA 3G0FA 3TTIA 3LE6A 1GIHA 3QL8A 4IM0A 3NYNA 3BI6A 2ONLC 3I60A 4QP9A 1GJOA 1QMZA 4I6BA 5LVOA 4JG6A 3TIZA 2XJ2A 2VTNA 3ZFYA 5IDPA 3FXZA 5AUZA 2X1NA 4MBIA 5AM6A 4ACHA 2YACA 2XIYA 4BGQA 5FBOA 2I0EA 5KMMA 4M3QA 2F9GA 4D5KA 1PY5A 5AV0A 2JKKA 1XH7A 4C2VA 5EDQA 2CCIA 3NAYA 1IG1A 1H28A 3W16A 5HTCA 4FV4A 5KHWA 3UJGA 4JRNA 1NT2A 4YZCA 4B99A 1Q24A 4AOJA 2R3NA 2I6LA 4CRLA 4U6RA 4F9BA 4WRGA 4IWPA 3OUKA 4XG7A 3WE8A 3M2WA 3Q4TA 3O17A 3ZSIA 3G0EA 5I9XA 1F0QA 3UNZA 2BAQA 3R7OA 5DG5A 5F9EA 2OJFE 2QOIA 1XO2B 3GVUA 2Y4IC 4ANLA 4MEDA 4A07A 4G16A 4HGLA 1REJA 2Y9QA 5AX3A 4AZWA 4AZEA 4WIHA 2FA2A 5E4HA 3O96A 4GUEA 5A6NA 5IISA 2IVUA 4O0WA 2F2CB 3BYVA 4HVDA 4CFXA 5A46A 2V7AA 2PVFA 3D5UA 3AMYA 5BVWA 4CG8A 4CG9A 5BUIA 3KL8A 1R1WA 5KO1A 2HY0A 3FHRA 3JY9A 4M0YA 4O21A 4UXQA 2AUHA 4J8MA 3LAUA 3MV5A 5FXRA 5TO8A 4D1SA 1YRPA 1YDSE 3UQFA 2PZ5A 2C1AA 4QYFA 4MNEB 5DOSA 3HMMA 3U9NA 3GC8A 2PY3A 3Q9XA 4QQCA 4QMZA 1RW8A 2B54A 2HOGA 2HWPA 3A7GA 3GOPA 4LMNA 5I9UA 4O2PA 3ZC6A 3LCSA 4D2VA 2GHMA 5HBJA 3U54A 3EQBA 3ORNA 5BUJA 3MIAA 5K3YA 2H6DA 1ZOHA 1UWHA 4RX7A 2C6KA 3K5UA 1UU9A 4C58A 3G33A 3A4OX 1WVWA 2BIYA 3ACKA 2WMWA 4PV0A 5CU2A 5LMAA 4D1ZA 4DH7A 4PQNA 5BQ0A 3CPBA 5CF6A 2VO3A 1SYKA 4LGHA 4DGGA 4EH2A 3W8LA 2BRNA 2JFLA 4B8MA 2UZTA 3R1QA 5BYZA 2O63A 3WZJA 4BCIA 3LXKA 3MWUA 3PZEA 3IDBA 4FMQA 2HZ4A 4G31A 4TNBA 2RFNA 1O6YA 3DKFA 3OT3A 3QTWA 4XLIA 3DK7A 3WYXA 4I94A 5ACKA 3ZH8A 4E6QA 3L9MA 2YCFA 4M67A 4U3ZA 1NVRA 2WTCA 4ZAUA 4Z7HA 4AZFA 2R3HA 2R7IA 3BEAA 5HNGA 3UIMA 4AGWA 1OGUA 2C3IB 2RF9A 3KXZA 4FT0A 2ONLA 2QOKA 5TT7A 4OLIA 4FT5A 3BHYA 4RVMA 4NH1A 3RPOA 4QPSA 4X2FA 2IW8A 2XZSA 4DEBA 3R04A 3UNKA 3BV3A 2ITYA 5HD7A 4LRMA 2W1CA 3Q2MA 3GI3A 4MKCA 4MX9A 2R2PA 4BICA 2WKMA 3NIZA 4IC8A 5LVMA 4FIHA 5F20A 2XYUA 3TKUA 3LM5A 3AD4A 4L9IA 4JDHA 2YZLA 2BDJA 3ORKA 5HVJA 4K18A 4KWPA 4A4LA 2ITTA 3SKCA 3A8XA 3P0MA 3I81A 4ZTQA 2OBJA 2XK9A 2YJRA 3TEIA 4AFEA 5C8KA 3QRKA 4V0GA 3UOJA 2JEDA 5HU3A 5E8WA 3W18A 3GOKA 3BEGA 4J99A 2BPMA 5FTOA 5T68A 3VBYA 4ZSAA 3LFCA 4GW8A 4CKIA 2OIDA 2GS2A 4BKJA 4O7WA 3POZA 5CU6A 4F99A 3U6JA 2GNHA 5EW3A 5ANOA 3IKAA 3D7TA 3QC9A 3QXOA 1JSVA 4QMLA 1GAGA 4RFMA 2J90A 4X2JA 3A60A 5IH5A 5JKGA 3VJNA 5L8LA 3R22A 2O5KA 3RP9A 4FG8A 4H1MA 4ZJJA 3V01A 3MY0A 3IG7A 4K77A 3ZRLA 5CSVA 4CGAA 2GQRA 3IECA 5EOBA 2UZOA 4A9TA 3DLZA 2IZRA 2UZNA 3OBGA 3NYVA 2X4ZA 4FV9A 4F63A 3W2QA 4BZDA 4ASXA 3KMUA 4AA0A 5IEVA 1FPUA 2XNMA 3IO7A 4RSSA 4OTQA 2VWZA 4RIOA 5L2QA 3BWFA 4GG5A 4AX8A 3SHEA 3HMIA 3GNIB 3UGCA 3OD6X 3UVQA 4GL9A 4CTBA 3FLSA 2XRWA 3QUPA 5BVNA 3CR0A 4PX6A 3E3PA 5CEQA 3GT8A 2VTTA 3EHAA 3N9XA 2CN8A 2X6EA 2ITPA 3TTJA 4V04A 4WBOA 2OXDA 4EI4A 4ZTRA 2XK7A 4O0XA 1PXMA 4JL9A 4M7IA 3I7BA 4WG5A 4AFJA 4DITA 4NM3A 4C2WA 5AR2A 1JSTA 4W4XA 4FK3A 3RK7A 3MY1A 4EJ7A 2WQOA 4JQEA 5I4NA 2C69A 4C57A 3DKGA 4BCPA 2PMIA 4GKIA 4UXLA 3FMHA 3OS3A 4C4EA 1G8AA 3GCVA 2CKOA 3NUSA 3VQUA 3OVVA 4U45A 4FKWA 3ZBXA 4O83A 3QKKA 1KUTA 2QLQA 5CSXA 1WBPA 3B2WA 5CVHA 3GBZA 4FL2A 4F64A 2GDOA 3A7HA 4WUAA 3W2RA 2GPHA 3D5XA 4JBPA 5I9ZA 4LI5A 3O71A 4A06A 2BFYA 3PIXA 4F6UA 5C26A 2WAJA 4FIIA 4WRSA 5IA5A 3TZMA 5AP7A 3V5WA 4ZLOA 4BIDA 4EYMA 4NW6A 4C4JA 2J0MB 5A6OA 3PXZA 4FIGA 4UWCA 5KKRB 1UWJA 4Z16A 1J3HA 2OSCA 3ETAA 2OIBA 5EYMA 2P2IA 3VUHA 3QYZA 5CNNA 4RJ3A 3TUCA 3N4TA 3WF8A 4G2FA 3I5NA 3TUDA 3MA6A 4O6LA 2WU6A 1OIYA 3OG7A 1QPEA 4YLLA 3GP0A 3VS1A 5BUEA 2R3OA 3ZC5A 2UZUE 2XP2A 3W2CA 4E5WA 5FEDA 3FE3A 4TY1A 4RVTA 3K3IA 5J7BA 4GUBA 1FGIA 4JG7A 4XNEA 4TNDA 5CF4A 2G01A 4QMMA 3ZRKA 2XBAA 5H8GA 3PVBA 4II5A 4JX3A 3ZDIA 3DQXA 4OTFA 4MNEA 4ANMA 3HLLA 3EYGA 4N4SA 4WSQA 4EK3A 2WD1A 5HQ0A 4PDYA 2BZIB 2XIXA 2ZV7A 4XYFA 3R7IA 4AT4A 1LEZA 1ZMWA 3ANQA 4QMPA 5K5NA 4M15A 4B7TA 1PJKA 4FKLA 3F5PA 2SRCA 4QTDA 4QPMA 3ZLXA 4ZMFA 3SVVA 5AV1A 2W06A 2ZMDA 5LOHA 3CD3A 1CKJA 2VWWA 4MBLA 1K2PA 2WQBA 5TR6A 2OIQA 2R3LA 3I5ZA 3DGKA 2HY81 4EQUA 4Z7GA 2JKQA 1MQ4A 3DNEA 3R02A 4PTGA 2YITA 5CI7A 4DEGA 4DFUA 5LMKA 4O0VA 5AR7A 4LGDA 5DR2A 3IDCA 5EKNA 2W96B 3S0OA 2QG5A 3MFTA 3UYSA 2P33A 3W2PA 2CNQA 4DBNA 1Q61A 4PMMA 4PMPA 2NNWB 3C4XA 4BCOA 2F49A 1KOAA 4I22A 3P5KA 2JDVA 2OJJA 3OC1A 1YHSA 4FL1A 3VUTA 3BRBA 3HV6A 4EZ7A 4FR4A 4F6WA 1GIIA 4H05A 2PSQA 5IA4A 2PZIA 2J0LA 2OG8A 4KABA 4QP7A 4XX9A 5D7AA 3VHKA 4CTCA 3P7BA 4H3QA 3FI2A 1YXXA 2QQ7A 5KUPA 4G6LA 4C3RA 5CVGA 4F0GA 1UVRA 2W17A 4AN9A 1FMOE 2BDWA 4MBJA 3POOA 1TQIA 4XS2A 4DGOA 4BYJA 1H24A 1YDRE 1DAYA 2WELA 3PPZA 1PXKA 5HZNA 5IQGA 3TNHA 3AT4A 4ZSEA 2OZAB 3FC1X 5AV4A 3QLGA 4I5HA 2ITQA 4FSZA 4YO4A 4O84A 5M4IA 5CAOA 4QYGA 4HW7A 3LHJA 4HOKA 3WILA 1XH5A 4PL5A 5I0BA 4TRLA 4NSTA 2IZUA 3R7VA 3U8WA 5CX9A 3ORZA 3UOLA 2QG7A 2YIWA 3IQ7A 5HGIA 5JZJA 3SRVB 3TDWA 5HIEA 2BTSA 3DZQA 4ITJA 3EB0A 2R3QA 2CGUA 3RM6A 3SOCA 3NLBA 2P3GX 2I40A 3GQIA 3QQKA 3T9TA 3HGKA 4IHPA 3FMMA 2ITOA 3KXMA 3PLAE 4P7EA 4K6ZA 3NX8A 5A3XA 5HKMA 4YPDA 3RKBA 5IEYA 2PUPA 1ZZ2A 5DWRA 1FGKA 4A9RA 3QCXA 1L8TA 4FT3A 2WOTA 2AC5A 2PE1A 3ALNA 4PPBA 4ALWA 2E9UA 5J95A 4XV2A 3D14A 3VUMA 5CQUA 3ZXZA 1MUOA 4MCVA 5J9YA 4Y5HA 4FI1A 3GCSA 2VUWA 3CEKA 3G2FA 3QXPA 4BDAA 4X3FA 2W1HA 4E73A 2YJSA 3DFCB 2YCSA 3OCSA 3BIZA 3UZRA 4IC7A 3MGYA 3KU2A 4TXCA 5E8TA 4BCKA 2C5NA 2QKWB 3DY7A 4X7QA 2P4IA 4BI1A 4MWHA 3ELJA 3NGAA 4AP7A 4ERKA 1UNGA 3BGZA 2ETKA 3MB7A 3QQFA 4FSQA 4MQ1A 5DEWA 2Z7LA 5IH4A 3COKA 5D9HA 3E62A 4FYOA 3F5UA 4C35A 2XUUA 3KN6A 4JBOA 2XRUA 5HTBA 3ORIA 3MVJA 5EW9A 4FKTA 3JR1A 4UV0A 5IMEA 3ID6C 4P5QA 3N51A 4WG3A 4BDBA 3PLSA 1K9AA 3DQWA 3JVRA 5LVLA 4BDIA 5GIOE 3LXLA 4JAIA 4ZY4A 3HZTA 4S34A 4BIEA 4L42A 5IQEA 1YWVA 3F3ZA 4YNEA 4FSWA 1UNHA 2YERA 1KSWA 2C0TA 3DPKA 3WF6A 4QO9A 4GFGA 3MS9A 3SC1A 4QMYA 4KIKA 3WYYA 2PTKA 4NJDA 5HBEA 4ZEGA 2Q0BA 3OWPA 5AX9A 5FWKK 2YM8A 2X8IA 2UZVA 3BU3A 1QPDA 4L44A 2AC3A 1KV2A 2C6IA 4JLCA 3BKBA 4XG3A 4NCTA 5FDPA 2B0QA 2H96A 4D58A 2GMXA 4D1XA 4QMTA 4CFNA 4CFVA 4QYHA 1PMNA 1TKIA 3A8WA 4IAFA 4IFCA 5J79A 4KS7A 3WIKA 4RX9A 4IB0A 5GINE 3RM7A 5ANKA 5EYCA 5AA9A 5CLPA 4QPAA 4LYNA 2XCHA 3OCGA 4ANBA 4RWIA 4M69A 4G3FA 2HW7A 3LLTA 2X9EA 2WTVA 2XK4A 2QVSE 3SXFA 4QD6A 3MY5A 4APCA 4L00A 3R2YA 4G3GA 3GFEA 3GUBA 3OWKA 1XR1A 1IAJA 4Y5QA 2X7OA 3VS6A 4YLJA 3BYMA 3KC3A 4FTLA 4IE9A 2RKUA 4RFZA 2J51A 5DN3A 3VS7A 3BQCA 3VUGA 3O8PA 3AC4A 4QTCA 4USEA 2QOBA 4FKGA 3TDVA 4D28A 4NW5A 2G9XA 3UG2A 5CANA 3U6IA 4XP0A 5KMOA 3PVWA 4R78A 4GYGA 4RJ7A 5EHYA 3HA6A 3IGOA 5CEIA 1OKVA 3H0YA 4KBCA 3I6WA 3ODZX 4C37A 5DEYA 3MYGA 4UMQA 4AW0A 3HP5A 4RZWA 4J97A 5EOLA 5HIDA 4MF1A 4NFMA 4XG9A 1IRKA 3LFNA 4CFWA 4OTPA 3R9HA 2V7OA 4MXYA 3Q53A 3R73A 4FBXA 5KCVA 4FE2A 1IA9A 3ENMA 2EXEA 5TF9A 5ANIA 4U41A 4OGRA 3REPA 3UO4A 5BYLA 3R83A 3GC0A 5DVRA 4FTKA 1A9UA 4YJOA 2O2UA 4Z9LA 4DH8A 5FG8A 1P4OA 2HXLA 3UPXA 3QHRA 4B0GA 3B8QA 3G6GA 3VBQA 4FA2A 2QO9A 4F9YA 1JQHA 3S2PA 4AN3A 3F2RA 3IW7A 4MH7A 4ORKA 2R7BA 3OHTA 4MD9E 3SXSA 3UC4A 5DR6A 3GU4A 3D83A 4GV1A 3RTPA 3K54A 4BTMA 1NA7A 4I0SA 4E8AA 1I44A 3NNVA 3HV7A 3VW8A 4HVHA 2QURA 4IAKA 5DGZA 2VTRA 3O8UA 2VO6A 5E90A 4MK0A 1H1RA 2QU5A 3SG8A 3DK6A 5ICPA 3SW7A 5DIAA 5DMZA 2W4KA 2XMYA 2ZVAA 3HMOA 3OXTA 3TZ7A 3LKMA 3IW4A 2V22A 2XK3A 3FKOA 3G9NA 3H30A 3LOKA 3A7FA 3OXZA 3QA0A 4G5PA 3VS3A 3WF7A 5HLPA 4I5CA 3QYWA 4KINA 4FKPA 3PJCA 4DCEA 3ZO3A 3ZZEA 2XKFA 5EH0A 3BLQA 5IKWA 2IO6A 4U3YA 2WTKC 2VWIA 5HCXA 5ITAA 4BZNA 2HZIA 3PRFA 3KRRA 1YXUA 3DAJA 3HA8A 4DFZE 1U5RA 2QOOA 4LRJA 2VTPA 5LCKA 1VEBA 2X7GA 2R3IA 3RWQA 4YTFA 5A4CA 3BLRA 1ZYCA 4HVGA 5J5TA 2LGCA 3RNIA 1A06A 5LWNA 4W4YA 4S31A 4FEXA 3R9NA 3S3IA 2R3MA 3NW6A 1J7UA 4M97A 4FKOA 4KKHA 4W4VA 5DT3A 4EK4A 1GZ8A 3HNGA 3PY1A 4GU6A 5L8KA 5LXMA 4IWOA 4QQ5A 2OXYA 3VUIA 1YI3A 5CXZA 3WOWA 2X0GA 3SV0A 3ZRMA 2GS7A 5T6KA 4DGLC 5E9EA 4AA4A 4PMTA 3IPHA 3QFVA 3DBDA 3TZ8A 2W4JA 3CTJA 3PY0A 5JGDA 5CTPA 3R21A 4C62A 4ENYA 1WBTA 3PG1A 4TPTA 4XRLA 4FC0A 4FZDB 4L8MA 3BHHA 2C0OA 4FV7A 4U7ZA 1P14A 3BYSA 1ZAOA 3FLWA 2ZB1A 3QWJA 3EKKA 4RX8A 4U0IA 3E3BX 2XEZA 3D7TB 2BVAA 2WTDA 3KRXA 4HCTA 4LUDA 5LCJA 2ZOQA 3F66A 4RVKA 5AADA 5CZIA 3T9IA 3VJOA 4A4OA 4UMUA 2XNNA 4EH4A 5BNJA 2W5HA 4FV3A 2WIHA 1BL7A 2PL0A 4Q9SA 1CKPA 5L6OA 3EN5A 1PMUA 2QCSA 3C0IA 3FMNA 4J96A 3VBTA 4WD5A 2PWLA 2CDZA 2R0UA 3BGPA 4GVAA 2CPKE 4I23A 2RSVA 5H2UA 3RAKA 4MXXA 3EN6A 4O27B 1UKIA 3HDNA 3MI9A 3BWJA 4JAJA 2C5VA 1B6CB 2JIIA 4FVPA 4AU8A 4RZVA 4CCBA 2YABA 1UU7A 3ZEPA 2JKMA 1OZ1A 2WMSA 4GYIA 4YO6A 3R8UA 4XUFA 3THBA 4ASEA 4EH5A 5BMSA 3S00A 3NVKI 3E5AA 4KA3A 4C4HA 3AC3A 4G3CA 1JKLA 3PP1A 4RC3A 4ZY5A 3PIZA 3F6XA 2VTQA 4EEVA 2FSLX 3V8WA 2YZAA 4RBLA 4UEUA 4BBFA 4GK4A 4NU1A 4IW0A 5AV2A 2HW6A 2FSMX 2WU7A 4IIRA 5D7VA 4DN5A 1ZOEA 4PNIA 2OK1A 1WVYA 3NW7A 3VAPA 2PULA 3ZLSA 4ASDA 4AGCA 4APPA 5AR5A 2OH4A 4TW9A 4ENXA 4XG8A 4C8BA 4YZNA 5IUHA 4LL5A 4AZTA 3JUHA 4YJSA 5ANEA 5EQPA 4BKYA 1PXIA 5CALA 3BCEA 1W98A 3EKNA 5LARA 4KIKB 3CJGA 2BALA 2Y7JA 3I1AA 2X39A 4S2ZA 4C4GA 5AUWA 2YIXA 3KULB 2JIVA 4I93A 4ANOA 3MDYA 2CKPA 3NCGA 1T45A 4XV9A 4EYJA 4ZSJA 3MPAA 2JFMA 3COIA 2OJGA 3VRYA 3ZLWA 4D2WA 4FV0A 3R01A 4B6LA 1Y8GA 4F6SA 5L2WA 4KRCA 4RIYA 4EOPA 3VC4A 1NY3A 4NCTC 3HAMA 3NMUF 4CV8A 3H9OA 3ZONA 4IB1A 4OBOA 3QAME 3RALA 3VVHA 1OB3A 3FKNA 4EUUA 1M14A 2VAGA 3E93A 5DHJA 1OECA 2YLEA 3EL7A 4XCUA 3Q3BA 3HRFA 3PSBA 1U5QA 1WCCA 3FYJX 4L3JA 1OPKA 2EWAA 4CYJA 4BR3A 5HESA 2W5BA 3Q9WA 3R0TA 4L53A 5KZIA 3JY0A 4N6ZA 1PF8A 2VD5A 4KS8A 4XBUA 4DTKA 2PVJA 5DT0A 4RIWA 3KXHA 3MESA 3GFWA 3NWWA 1H1SA 2BMCA 3MH1A 4OTHA 5KKRC 3D4QA 3R7YA 3NEWA 1OL2A 5B0XA 4IZ5A 3AGMA 2QNJA 1OUYA 1KOBA 3MB6A 3DOGA 1KWPA 4FYNA 4KIQA 3VF8A 4U79A 4TTHB 2YEXA 3L1SA 2ZYBA 4QNYA 4C33A 4NM0A 2ZDTA 1Z57A 3SD0A 3FAAA 3ZO4A 5FTGA 5IQDA 4KB8A 2WTKB 3QX2A 3PYYA 4G6OA 5HBHA 2C47A 2J50A 4DA5A 5LVNA 1PMVA 5IEXA 1SVEA 3HV4A 5M56A 3TACA 4YTHA 4PDPA 5K0XA 5CS6A 2I0HA 1PKGA 3D5WA 5CT0A 4J71A 1RE8A 2G15A 3SQQA 3FZRA 4UN0C 3KQ7A 4NWMA 4CV9A 3DAKA 4YGAA 2UZBA 4UYAA 1Q3WA 4YC3A 5EM6A 3WF5A 5DR9A 3WI6A 2ERKA 4JT3A 4OTDA 4U44A 2WOUA 4EBVA 1GZKA 5B2LA 4QP4A 3TUBA 4IB3A 4RWLA 1ZLTA 1LR4A 2VGPA 3QX4A 2Z7QA 2E9OA 4XP2A 4O7TA 4RA5A 5JQ5A 3CE3A 3IDPA 4ZTNA 4EH9A 5AR3A 4L46A 4IACA 5L8JA 3RK9A 4EH6A 3CBLA 4RJ8A 3EFJA 3I6UA 4ANQA 3NVMB 2F7XE 4IZAA 5J8IA 3Q04A 4ZY6A 4O7SA 2EXCX 4FTUA 5I9VA 5CXHA 1HCLA 4W8EA 3SOAA 5DA3A 5C1QB 5FXQA 4I4EA 4M14A 3F5GA 3KXGA 4PDSA 4RIWB 4EONA 5AV3A 4J53A 4TWCA 2CN5A 1JVPP 3GU6A 4QTEA 4E1ZA 2C5XA 5AUYA 1OUKA 2WO6A 3FZSA 3HV5A 4X21A 2UZEA 3H4JA 4O22A 4NM7A 3VQHA 3RBWA 5C4LA 3Q9ZA 3HDMA 2V5QA 5FQDC 4AW1A 4DH3A 4KKEA 4BBMA 1SMHA 2RFSA 2C3LA 4FODA 3BPRA 5FDXA 5M55A 3RPRA 4QQTA 3LXPA 3AT3A 4ANNA 4YMJA 4ZP5A 3RAWA 3QRUA 5CNOA 5D41A 2Z02A 3MH3A 4ACDA 2YHVA 1B38A 5AUXA 1U54A 1WBNA 5HO6A 4CKRA 3FY0A 4FKQA 4G9RA 4S30A 3D0EA 3GC9A 3DA6A 2W0JA 3OXIA 2W1EA 3KK8A 2ZV2A 2F7ZE 4GEOA 5AFVA 3DBQA 4PF4A 3LQ5A 4ALUA 3SA0A 3COHA 2BRMA 3DBEA 4PUZA 4GIHA 5BVKA 3ZOSA 2J6MA 3FI8A 2RGPA 3LCOA 3PSCA 1DI8A 4CCUA 4FSUA 3DBCA 3TG1A 1MRVA 1NW1A 3NS9A 4BCGA 4F9WA 3PWYA 4ZOGA 4O6EA 4DGNA 4H39A 4PRJA 5A54A 3UO6A 4D55A 3KVWA 5CU3A 5IG1A 1H08A 3W32A 2GSFA 3BBWA 4I4FA 2WZJA 4C36A 3HMPA 3PVGA 3LFSA 4H36A 3ZM4A 2WHBA 3MJ1A 3P7AA 2VTOA 3FUPA 5EG3A 2C6MA 2OFUA 1NVSA 3QCYA 4IAAA 3ZEWA 2J0KA 4FSYA 4E5BA 3EMGA 2R3FA 4DFXE 4MXCA 1ZARA 4F9AA 2UW8A 1WMKA 4C3PA 3Q6WA 3KMWA 1OL5A 4X2KA 3R30A 3LCKA 4R5YA 3R7UA 4GVJA 2OWBA 3KY2A 2IN6A 3COMA 5E8ZA 5HVYA 1Q8YA 3F3VA 3OZ6A 4BRXA 4KSPA 1YXTA 3V5TA 4R6VA 4BCQA 4K1BA 3ZDUA 3UO5A 2Z7RA 5EKOA 4AS0A 5CVFA 3O0GA 5AIKA 5EW8A 4Y8DA 2ZV8A 3NUNA 1IA8A 3GB2A 4U81A 5AP5A 4S33A 3AC8A 3UOKA 3NUUA 4BY9E 4BTKA 2WEIA 3EQDA 4YJVA 1M7QA 1JKTA 4P90A 1OVEA 1ZWSA 2QO7A 4LUEA 3EJ1A 4N0SA 5JZNA 4A9UA 3DJ5A 2XIKA 3CLYA 3O7LD 4GT4A 5CAUA 3DB8A 4FNWA 1VYZA 3DFAA 1PYEA 3ZYAA 1JNKA 4NIFA 2OW3A 2Y6OA 3LFDA 1ZMUA 4BCMA 2H34A 2FUMA 3C50A 3PXFA 3FKLA 4F9CA 2GNJA 2UVXA 3MPTA 3JS2A 4IBMA 3OCBA 2WEVA 1H26A 4FV6A 3E7VA 4G17A 2Q83A 3F3TA 4X3FC 4FKSA 5G1XA 2W9ZB 4QYYA 4BTFA 2QODA 1Q3DA
chains in the Genus database with same CATH superfamily
3HUBA 3VUKA 1G8SA 2XJ1A 3HEGA 4MTAA 3R9OA 3HYHA 2Q0NA 4FIFA 1F5QA 3PP0A 4GFOA 2QHNA 4MXOA 2QR8A 4EUTA 4FKIA 4CYIA 4AGDA 2VWBA 3NRMA 3IW6A 2OU7A 4HCUA 4IWDA 5H3QA 4OAVB 2IEWA 2X2MA 1DI9A 2WNTA 2CLXA 3TV7A 3SDJA 3ZO2A 1K3AA 5DLSA 4TYHA 5IQFA 3AGLA 3CCNA 4GK3A 2HZNA 4QP8A 4ZJVA 4BDGA 2AQXA 1AQ1A 4U43A 2JAVA 3RZFA 4GKHA 4U42A 3TMOA 1G8JA 4J1RA 4TN6A 4TWNA 4TT7A 2C3JA 3D7ZA 3HRBA 3U55A 4R3CA 4KD1A 3D15A 2PZYA 3HECA 1YWNA 3R1YA 1Y57A 3NNWA 3NR9A 3PZHA 5BPYA 3QTIA 4OW8A 4RWKA 3DJ6A 5AUUA 4AW5A 4BJJB 3SRVA 3PDTA 4XG6A 4DC2A 4XEYA 1DAWA 2HK5A 2CKEA 4EHVA 3QLFA 4XMOA 1LUFA 4P5ZA 4AQCA 5B7VA 2E9VA 3EZVA 4XOYA 3AD5A 5AIRA 3CP9A 3E8DA 5ACBC 4I24A 3W33A 2CNUA 4HGEA 3SG9A 4FTTA 4O81A 4ZMEA 4RIXA 3QTRA 2C6EA 2EB2A 4M13A 5EQYA 2KTYA 4N70A 4JG8A 3DXPA 1Q99A 5CSWA 3OUNB 3HX4A 1BKXA 1FOTA 1H07A 2PHKA 3NDMA 4A4XA 5GZ9A 3FI4A 5E8UA 2X81A 3VNTA 4BDCA 1H0WA 2Y4PA 3OF0A 4FTCA 1O9UA 5DRDA 4MWIA 5IPJA 3PIYA 4OT6A 5M07A 5EM5A 5JT2A 4NUSA 1WBSA 2QHMA 2B9IA 4D5HA 4F7JA 3JXWA 3AMBA 4IX6A 4IJPA 1H25A 1SNXA 2ETRA 5GJGA 2W1DA 3V3VA 4JBVA 3C9WA 4E4NA 4F1TA 2XARA 4FKUA 2A27A 2OLCA 2R3PA 3VUDA 4WO5A 3TN8A 3GC7A 3R8LA 3BZ3A 4EOQA 5JEBA 3VS4A 4QTAA 2J9MA 1YXVA 4Q2AA 3QQGA 4IZ7A 4FKVA 3VF9A 1U54B 4PY1A 3F2AA 4PP7A 1CKIA 1JOWB 3RK5A 4EBWA 3U51A 2JGZA 3AG9A 5M06A 4R7IA 3AOXA 2C1BA 5HG7A 4BCJA 2JDOA 4IB5A 1BLXA 3UC3A 4AG8A 2R3KA 4ZXTA 4FZ7A 4GJ2A 4AW2A 4HNFA 4M68A 4D2TA 5HG8A 4UMTA 4UYNA 5AUTA 3Q4CA 1GZNA 1ZY5A 4OTIA 3KULA 4BHNA 4BWKA 4CLJA 5ANDA 3ATTA 4DFNA 2WMBA 2W1ZA 3NPCA 4IM3A 5J5SA 2R0IA 3C7QA 4AACA 5LVPA 3I4BA 4H3PA 5IA2A 1W82A 4TYJA 3ZCLA 2DWBA 4BZOA 4ACMA 3FLZA 2PZPA 3NZ0A 3NAXA 1PXLA 2NO3A 4FGRA 4Q5EA 1IR3A 1YDTE 4EOSA 5DYJA 5E8SA 1WBOA 4EK6A 2QOFA 4F1MA 2B9JA 2C6TA 4GJ3A 3FSFA 4GIIA 4IVAA 4XOZA 4PL4A 4E6DA 4HVSA 5HTIA 3G9LX 4G1WA 1M17A 3GCPA 4LV5A 2NRYA 2QR7A 2ZDUA 4KAOA 4WT6A 3VWAA 5L2TA 3CTQA 4XG4A 4L01A 5CU0A 4ZIMA 1YW2A 3S95A 2XANA 5A9UA 3C51A 4FT7A 5HO7A 2WMUA 3ZO1A 5JGAA 2X8DA 2ITVA 2IZTA 3VW6A 3FY2A 4FEUA 1PRYA 5ANJA 3PTGA 3H10A 5CQWA 2BKKA 3NCZA 3V51A 2B7AA 4TWOA 1YVJA 2HIWA 2I0VA 4X2GA 3UG1A 2PMOX 3TNPC 1J1CA 4BGGA 1M7NA 4K0YA 5AP3A 2BAJA 3QUDA 4F65A 4R7HA 3ZHPC 3MN3A 3TJDA 1WAKA 2BRGA 4MHAA 4HCVA 3CXWA 2W1IA 5CASA 1REKA 4RX5A 1URCA 1WFCA 2RFEA 4FVQA 3F69A 4S32A 4ACGA 4CZTA 3IOPA 1VJYA 4R77A 1PKDA 1U46A 5FTQA 5GNKA 3ZBFA 1Q8UA 4JS8A 4WSYA 3TNQB 3LQ8A 4DFYA 4Y73A 4YZ9A 5FEEA 5M51A 3E92A 3WF9A 4O0RA 2X9FA 3BE2A 5HVKA 5IQIA 2B52A 4E26A 3L8PA 4IANA 2CGVA 2FH9A 3AD6A 4H58A 2GHLA 1OKYA 3UIUA 3TT0A 2YIYA 4FTMA 4MYGA 3R1SA 1SVHA 1FBNA 2BILB 4IM2A 4AXCA 5IF1A 5D10A 4LOQA 3FMDA 5J9ZA 3PXQA 1GZOA 5DI1A 2VO0A 2BFXA 4W9WA 3FLQA 2X2LA 3F3WA 5HE0A 3PUFC 4F78A 3P1AA 1UNLA 1IEPA 3KIOC 4UZDA 2IW9A 3UQCA 4V01A 4NTTA 3E7OA 4EH3A 4NEUA 2DQ7X 3ZMMA 3N4UA 4L3PA 3FQSA 3AMAA 4EOOA 4ARKA 5BVDA 3HL7A 5CYIA 3T3UA 2XM8A 4A9YA 3ANRA 3BU6A 1JLUE 4UY9A 4XP3A 1Y91A 4BBEA 2OZOA 3EQGA 1H01A 4DAWA 4X6QC 2FYSA 3R6XA 4L68A 4BI2A 3Q32A 3RPVA 4YC8A 4H1JA 4K11A 5ETFA 4DF3A 4TL0A 3UP2A 3G6HA 3F7WA 1Q5KA 3GU8A 2C3KA 2OGVA 3M1SA 2QU6A 1ND4A 3V8TA 5H8EA 3SXRA 3W8QA 4DDGA 5E7RA 5CAVA 4ITIA 2R3RA 2WB8A 5FRIA 1ZYJA 5DFPA 4BDKA 4L43A 1OPJA 2CCHA 4BWXA 2XKDA 2WXVA 4AN2A 3H9FA 4EK8A 1P2AA 2BHEA 4V0GB 5HE1A 5C8NA 3QQHA 2FB8A 2B53A 4O0TA 4KSQA 3ODYX 4G3EA 3I0QA 3IOKA 4M12A 4MNFA 4YZDA 2NRUA 2QI8A 5ETAA 2GNGA 3KKVA 3WZKA 4USDA 4CD0A 4QDEA 2B55A 4FF8A 5E92A 2HAKA 1QL6A 2BZKB 4BL1A 5JFXA 4TYHB 1FVVA 5LJJA 3ZTXA 4O2ZA 3VIDA 2QOCA 1SZMA 5IDNA 4EC9A 1OL6A 5DT4A 1TQPA 3AT2A 2Z60A 4D4SA 4QEBA 3VO3A 3DTCA 3CPCA 4O7VA 4JDJA 3UVPA 2W99B 1SNUA 4ZZOA 3QGYA 1QPCA 4G5JA 4IQ6A 1PXOA 2H8HA 4FTQA 2CGXA 3OW4A 4LOPA 5IA0A 3NNXA 3QTZA 4KIOA 4NT4A 3DLSA 1Q97A 3IK3A 3KK9A 4J52A 3RHKA 4EH8A 4F7NA 1AGWA 5AP6A 5EK7A 3PE2A 3I79A 3MH2A 3OP5A 3PJ3A 4CQEA 4Z3VA 3BQRA 2ETMA 2VTSA 5LQFA 4BDFA 4AF3A 4LV7A 4JI9A 5J1VA 1HOWA 4OTWA 5LMKC 2XS0A 3DJ7A 2PVLA 2WQMA 2IVSA 3AC2A 2LAVA 2ZM3A 5CEMA 3F2NA 5EHLA 3KXXA 5I3RA 2PUNA 4NFNA 3R1NA 3P86A 3W0QA 3UZPA 4U97A 3FV8A 4M8TA 3MH0A 3DKCA 4GK2A 2WMVA 2UZLA 2Y6MA 4YLKA 2QOLA 3MVHA 3BU5A 4R3PA 4AA5A 5IQBA 2XM9A 2GS6A 2A4LA 2ITWA 4WNPA 3G90X 2X7FA 5GJDA 3VONA 5M09A 3UOHA 4I5PA 3Q96A 3G51A 3LFQA 3W0SA 3AXWA 1XH9A 3QHWA 4XBRA 4FOCA 4N57A 5FEQA 4IWQA 5I3OA 3FL4A 4ZZNA 5JN2A 3CD8A 2Y8OA 3OROA 3CGFA 2ACXA 2XBJA 4I0RA 3ROCA 2BR1A 3P7CA 4FEWA 4JVGA 2XKCA 5IU2A 2UW0A 5EQEA 3BYUA 2WMRA 3QF9A 4H3BA 5CENA 4CFMA 5AWMA 5A4LA 5KMJA 1CMKE 3A99A 2QD9A 3KN5A 3NUXA 2UZDA 5C03A 5BVOA 4FEVA 4TWPA 2F57A 4HYSA 1JAMA 4GT5A 3SGCA 1FVRA 4AAAA 4K2RA 5IQHA 3FQHA 3F3UA 4JIAA 5FD2A 3V04A 4R7BA 2O8YA 2O3PA 4QOXA 3FLYA 4WHZA 1S9JA 5AJQA 3ZZWA 5IMXA 2I0YA 3CQEA 3PUPA 4DEIA 3DU8A 4EHGA 5L2SA 2HELA 2FVDA 2ZM4A 4BKZA 4PDOA 4RGJA 3D2IA 1UA2A 3FLNC 3PY3A 2ERZE 3OMVA 2EVAA 1V0OA 4GT3A 2YM4A 3PA5A 4JRVA 4XG2A 4GS6A 2JC6A 2WIPA 1H0VA 1ZYLA 1Z9XA 3KRWA 3QKMA 4GH2A 4ZLZA 3KRJA 4TKSA 4ANSA 5EDPA 3KVXA 2VNYA 3HVCA 5HNIX 3MBLA 5HX6A 4XLVA 4KBAA 4X0MA 2RL5A 3VN9A 3U9CA 3TV4A 2GNLA 3FSKA 4RLKA 3DTWA 1OKWA 1X8BA 3KF7A 4DYMA 2I1MA 1UV5A 4L7FA 4NTSA 1W7HA 2GQGA 3DBFA 1PHKA 2W4OA 3UVRA 1U4DA 1F3MC 4YP8A 2VWXA 4E20A 2Y4IB 5LMBA 3TCPA 4AQKA 2FSOX 3LPBA 1Y8YA 2YDIA 3DXQA 1NXKA 3AKKA 1YOJA 4D0XA 3TIYA 4EK5A 2JDTA 4OBPA 2ITUA 4DHZA 1ZZLA 5KBQA 2BRBA 3GU7A 1W0XC 2GFSA 2IZSA 2RFDA 2VO7A 4GCJA 4QMOA 2WMAA 4K8AA 3PG3A 4WOVA 1J91A 4QMWA 2FO0A 4F4PA 5I9WA 4UWYA 2A2AA 3KCKA 3TNWA 4EZ5A 1STCE 2Z2WA 5HG5A 1URWA 3DV3A 5JH6A 4UMRA 5F1ZA 4FVRA 3IONA 4O0SA 2F2UA 3UQGA 1ZYDA 4QTBA 4QMNA 4XJ0A 3NFGB 4C4FA 4PMSA 2YM5A 4AWIA 4IJ9A 3EQIA 4JDKA 4YHFA 4BCHA 2CHLA 1H1QA 2XYNA 4BDJA 4QP6A 4BN1A 4KRDA 2HWOA 4RIYB 3BHVA 5L6WL 2VTHA 4OT5A 3GU5A 2BROA 3H9RA 3LFBA 5AA8A 3RWPA 3MJ2A 3ZS5A 5C4KA 3BHUA 4FV1A 2VX0A 2JBPA 1SVGA 4EKKA 2BRHA 2F7EE 2XA4A 5HORA 4IDTA 3FBVA 3LJ1A 4MXZA 2E9PA 1FQ1B 1XJDA 3M11A 3ZSHA 4K33A 3U6HA 3QTXA 1CTPE 5KMNA 4Q9ZA 3OW3A 4LFIA 4EHEA 1BI7A 3ALOA 4IXPA 5E8YA 3QALE 5I5ZA 4E93A 1UU3A 1KE9A 4YHTA 5C01A 2VN9A 3EFKA 3TL8A 4AZSA 3MTLA 4Y72A 4FTIA 1XWSA 4KBKA 4FTOA 3TV6A 3VHEA 2XK6A 1M2QA 1XH4A 3QZIA 1Y6BA 3MW1A 3R7EA 3FZTA 5J9LA 3PFQA 5FM3A 5AR4A 4FTRA 3PA4A 1PMEA 4LMUA 2CGWA 2W1GA 4IAIA 2DYLA 3AQVA 3QTSA 4TYEA 3UYTA 2WQEA 1DM2A 3VS0A 4D9UA 5B2MA 1UKHA 5J7HA 4JXFA 3UNJA 4B8LA 3V5LA 2GTMA 3LMIA 4G34A 4FIJA 4W4WA 1W2CA 3RCJA 3TXOA 3CQUA 2QO2A 4B4LA 4CQGA 3V5PA 3L8XA 1YKRA 2R9SA 3UMXA 1HCKA 3QWKA 2RG5A 3NNUA 5L6PA 2R64A 4RC4A 4DHIB 3GXLA 1FVTA 3OT8A 4QMSA 5TOZA 4MAOA 3Q52A 4FV2A 3NUYA 3EQHA 2YM6A 2UW7A 5CSPA 3FPQA 4DBXA 4O4BB 5AR8A 1YHWA 2UVZA 1W83A 4JQ7A 3TNIA 3FMJA 4D2SA 1YQJA 4LQMA 2RIOA 3PXKA 1GIJA 3FXWA 5CZHA 3R28A 2IG7A 2X8EA 2WMTA 2YN8A 1JPAA 2WTJA 4D4RA 3TJCA 3EIDA 3FZ1A 3RAHA 4DFBA 1GNGA 5E8VA 1IASA 2UUEA 1Q8WA 3C0HA 3DB6A 3W10A 5AAEA 3D94A 4QNAA 4YUQA 2GTNA 3OY1A 4FSTA 5CU4A 5FLFA 3TI1A 4CMOA 3FL5A 4L67A 4GSBA 3W0OA 4I92A 3LJ2A 5A14A 4FSRA 2BUJA 3LFFA 3MTFA 3NYOA 3M42A 3H3CA 3JVSA 4JQ8A 1BI8A 5F95A 3R8VA 4AT3A 2HYYA 2YDKA 3F88A 4YHJA 5HG9A 1H4LA 4OBQA 3KEXA 2BIKB 3P4KA 1XBCA 2BZJA 4NJ3A 1XH8A 2ITNA 4O7RA 3QZGA 4C4IA 5KZ0A 3F5XA 3NW5A 3CS9A 5IUGA 1OI9A 2HZ0A 3QC4A 3DDQA 4NL0A 3B8RA 3A4PA 1CM8A 1TVOA 5M44A 2A1AB 2XNEA 2REIA 3E64A 4EOJA 2OJIA 2VRXA 4N6YA 5EFQA 1KV1A 3G15A 2YLFA 4HGTA 5FGKA 3UIXA 4BVUA 4G3DA 2IJMA 3PSDA 4E4MA 3FPMA 2H9VA 2C6LA 1JBPE 3ORXA 5AMNA 4DFLA 4E4LA 3QU0A 3ACJA 3BLHA 3F7ZA 2UZWE 3EFLA 3UE4A 4FGBA 5CSHA 2VTJA 3R8ZA 4HVIA 4NKAA 2PVNA 3K5VA 3ULZA 4FV5A 4UBAA 4WG4A 5K9IA 4ID7A 4J95A 2B9HA 3EN9A 3P08A 2J0IA 3RZBA 5AUVA 1LEWA 3ROYA 4QP1A 3LCDA 4R1VA 2XIZA 3QBNA 2J5EA 4O91A 4LM5A 5K5XA 3WZDA 4E3CA 5ETIA 2IVTA 1MQBA 5DRBA 5ANGA 4EOMA 1APME 2WGJA 1XQZA 2V62A 3HMNA 2C6OA 5EI6A 1E1VA 3F9NA 3ORTA 4QP3A 3D2KA 3UIBA 5KBRA 1MRYA 5DBXA 4AAYA 3EL8A 1ZXEA 5D12A 2VTLA 2C0IA 5G6VA 4C3FA 5JRQA 5HI2A 4D0WA 4YJRA 4CXAA 3FZPA 2J4ZA 3FEGA 2J2IB 5HLWA 2O64A 4D2RA 5FP6A 3FI3A 3KXNA 5JSMA 4R3RA 3RAIA 4IMYA 5K0KA 5GZ8A 4HPTE 4PPCA 4WKQA 4XRJA 4DLIA 4P4CA 5J87A 4BDHA 3VBVA 3HP2A 3W55A 2QOQA 2W7XA 3CGOA 3QRIA 4J98A 1H27A 3CKXA 4M69B 5HD4A 5M4UA 3QZFA 4YR8A 2VX3A 4W8DA 4O96A 2G2HA 4IEBA 3EWHA 3DAEA 3EQFA 2YWPA 3OY3A 2JD5A 2XB7A 5EM7A 3RVGA 5FUTA 5H8BA 1V1KA 2X2KA 2XJ0A 2CNVA 3W1FA 1R0EA 3HAVA 4ZTHA 3DS6A 4UMPA 5AAFA 1H00A 3CY2A 1Z5MA 3QRJA 3A61A 2OF2A 3BE9A 3W2SA 4FT9A 3VS2A 3UPZA 3LMHA 3CIKA 3ZUTA 1V0PA 3MA3A 4CFUA 4DCAA 3O2MA 1Q8ZA 3EFWA 3Q5ZA 3T8OA 4ZSLA 4D9TA 2VTIA 2I7QA 3BV2A 1MP8A 2YIQA 3C4CA 3QQLA 3QD3A 4PL3A 1R78A 2P2HA 2W05A 2EUFB 2YAAA 3FHIA 3OEFX 4RJ6A 4Y83A 4HYUA 3MFUA 4D4VA 3Q2JA 4FNXA 4UX9A 4Y85A 4GG7A 3QCQA 3QTQA 3PVUA 1YOLA 1ZYSA 2J5FA 4RA4A 2OKRA 3NSZA 4ONAA 3SAYA 4YTCA 1YOMA 3DNDA 3C5IA 1PXJA 3LFAA 5HO8A 1TQMA 4YJNA 2C6DA 4C0TA 1OITA 3OWJA 3C0GA 3K2LA 5EYKA 3WE4A 1WBVA 2YFXA 4FICA 3N4VA 3P9JA 1YHVA 4EC8A 4DHJA 2XVDA 3TZ9A 4D4YA 4BJJA 4YJPA 3MIYA 4DG0E 2UW9A 1O6LA 4O82A 4IVDA 4PWNA 3HV3A 2GNFA 3FC2A 1RDQE 3QRTA 1XKKA 3OOMA 4JBQA 4Q5HA 5EHOA 4YSJA 2PU8A 4ZS0A 3QKLA 1XH6A 3KCFA 1OMWA 4FNZA 3P79A 4FSNA 3GCUA 4FTAA 2PPQA 4YSMA 3WZUA 4OR5A 4ZTSA 5AP2A 2GHGA 2DUVA 2OXXA 4TYGA 1JKKA 2PVYA 2X6DA 3A2CA 3CC6A 4FK6A 4X2NA 5DPVA 5TE0A 4X3FB 3RINA 3UODA 5C8MA 4WNMA 4ZSGA 3VBXA 3FJQE 4JJRA 4FKJA 2Z8CA 5FBNC 4ACCA 1E1XA 4RG0A 4C34A 4DEAA 1J7LA 2XAMA 3S1HA 2C4GA 3R8PA 2ZB0A 4EJNA 3O7LB 4AE6A 4BIBA 3KA0A 3DT1A 3OBJA 3F61A 4FTJA 1R0PA 5CEOA 3RPSA 5M08A 2BKZA 1ERKA 2O65A 3ERKA 3QZHA 2B1PA 4FEQA 3PJ8A 5M57A 1QCFA 3GENA 2JDRA 5GZAA 3EH9A 2C5YA 4O1OA 4DEDA 3Q4ZA 4QYEA 3QD2B 5IUIA 2WQNA 4IADA 4F09A 2B9FA 4FG7A 5BYYA 5IA1A 3IGGA 1Q4LA 3CKWA 3RJCA 1OIRA 4EOIA 4KIPA 4P2KA 2PMNX 3V6SA 4B9DA 3FDNA 3TKIA 3OTUA 3VULA 2GQSA 4L3LA 2B4SB 4LL0A 4A9SA 2YISA 2WFYA 3UDBA 4EOLA 4F70A 5M4FA 4EOKA 5I9YA 4IZYA 3KREA 1CSNA 1JSUA 2G1TA 2C5OA 3UMWA 2UW4A 2PMLX 4LDTA 1PYXA 4KUJA 2P55A 2YM3A 5FXSA 3TKHA 4UB7A 1GOLA 5EM8A 3V6RA 2BTRA 3KRLA 3L9NA 3UZTA 5JQ8A 2QONA 4JR7A 3L8SA 3MSSA 4LGGA 2BCJA 4GU9A 4I21A 4EKLA 2YDJA 5B2KA 3HRCA 3P23A 4RQKA 3NUPA 3QGWA 1G5SA 4CKJA 3S4QA 5KHXA 1H8FA 3IW8A 3OWLA 1EH4A 3EN4A 2ZJWA 4RC2A 5E91A 3E8NA 4EQMA 4UALA 5F4NA 1KE5A 1OIUA 2QC6A 2R3JA 1VLRA 2FGIA 4WBBB 4C61A 3AC1A 3KGAA 4Y46A 2PYWA 4ZS4A 4BI0A 2IVVA 2YAKA 5CT7A 4ALVA 4MQ2A 4EHZA 1GY3A 4Z55A 2R4BA 5JFSA 2F4JA 3IW5A 4JMQA 2VTMA 4JDIA 2X0PA 3DZOA 4FUXA 3QTUA 4F08A 3NUAA 4CEGA 2PVRA 4FX3A 3LQ3A 3EQPA 3Q60A 2AYPA 4GRBA 2PUIA 1PXPA 2V55A 4RPVA 4BTJA 2XNBA 5BVEA 2JBOA 3U87A 3II5A 3BGQA 2RG6A 4O0UA 3UDZA 5IZFA 3MFSA 3KB7A 4Y95A 4AE9A 4NM5A 4I41A 3Q5IA 4NYEA 2VU3A 3EQCA 4BYIA 5GJFA 3U4UA 3BX5A 1W2FA 5IQAA 1OPLA 1L3RE 4YURA 2ITXA 2BZHB 2VWVA 4EH7A 3SLSA 2YIRA 3L9PA 2PVHA 2NYAA 1KE8A 2WPAA 2XNOA 3R7GA 3OOGA 2P0CA 4FZ6A 4IH8A 2PVMA 4CSVA 5AP0A 2EU9A 2WTWA 1PXNA 3C1XA 3CJFA 4LG4A 3LFEA 3V5JA 5F94A 3LLAA 3L9LA 4BCNA 4IFGA 2PUUA 4U80A 1G3NA 3BHTA 4I6HA 4YBJA 4E5AX 4O7ZA 4XV1A 4F1OA 4LRKA 2JITA 1JWHA 2CSNA 2FSTX 3C4EA 3FXXA 4UZHA 4FJVA 2IW6A 4GMYA 3RI1A 5E1EA 4EWQA 4IDVA 5HEZA 4QRCA 1R39A 1WBWA 4CZUA 5BMMA 1BMKA 4JNWA 3ZFMA 4I6QA 3RPYA 5M4CA 2JDSA 2HENA 4QMXA 4CRSA 3NIEA 3ENHA 4DG2E 3MVLA 2O0UA 4EWHA 3Q9YA 4RWJA 2ESMA 3TM0A 5BV3A 4PPAA 5L4QA 3ORLA 2XNGA 5EI8A 5HE2A 3CY3A 3QQJA 4EQCA 2QKRA 5L3AA 4DH5A 4RFYA 3WARA 3ZLYA 1SM2A 3O8TA 2KULA 4JX7A 4E6AA 1WVXA 3SX9A 3EZRA 4MD7E 4CMTA 3QD4A 5HE3A 4IX5A 4HZSA 4XV3A 3EN7A 5DH3A 2V0DA 4F7SA 2JKOA 4HYHA 5JK3A 4I3ZA 5CEPA 2ZV9A 5HICA 3PA3A 1AD5A 4YJUA 5JGBA 5E1SA 4W9XA 4XHKB 5AP4A 4DT9A 2OJ9A 5IA3A 2XCKA 5C9CA 4CT1A 4HGSA 4DGMA 3PXYA 5ETCA 4O7YA 5GIPE 4L7SA 1ATPE 4M66A 5AM7A 3UTOA 4BDDA 4O38A 5EYDA 4TZRA 2CLQA 3MPMA 4E4XA 5HU9A 4CZYB 1T46A 3NFFB 3ITZA 5J1WA 3QD0A 5L2IA 2GCDA 2OH0E 4EORA 2WMQA 3K3JA 2EXMA 3EOCA 3LVPA 3LXNA 4ZTMA 4BF2A 3DCVA 4MD8E 1OM1A 1KE6A 4RVLA 4YJTA 4YPSA 5KMIA 5JRSA 4IAYA 3PJ2A 2JAMA 5D1JA 2A0CX 4FKRA 4DG3E 3LIJA 5CF5A 5KMKA 2VNWA 5CI6A 3BBTB 4HZRA 4KKGA 3DXNA 3QCSA 3CQWA 4DT8A 2BAKA 2C68A 3DKOA 3LZBA 4YBKA 3FYKX 1H1WA 2CMWA 2NPQA 3G5DA 4YJQA 3QQUA 3CTHA 4YZBA 3EQRA 3ZUVA 4YZMA 5D11A 4KNBA 3AC5A 5E8XA 1CDKA 2VWYA 2XIRA 2G2IA 3GEQA 3KFAA 4GFMA 4D2PA 4BFMA 2ITZA 3IS5A 3ZXTA 4ZTLA 5KX8A 3KF4A 1J7IA 2PE2A 1E9HA 1ZY4A 2R3GA 1MRUA 4I6FA 4IVBA 3LJ0A 4IX3A 2VWUA 2W1FA 1W84A 3HKOA 3PPKA 4UWBA 5DNRA 2C30A 4AT5A 3R8MA 4EL9A 4U8ZA 2YCQA 3VBWA 2ZMCA 4NIFB 3RGFA 1ZRZA 2VV9A 3LCTA 4O1PA 3T3VA 2X0OA 3OFMA 4C7TA 1ZMVA 2HCKA 3A62A 5HHWA 5A4EA 5CAQA 2VTAA 4QP2A 2PZRA 4F7LA 4I0TA 4AGUA 3ORPA 2OZAA 5HIBA 3HUCA 1IAHA 5IQCA 2IWIA 3ULIA 2YWVA 3D9VA 1PW2A 2XF0A 4AOIA 3C4ZA 4BB4A 2JIUA 5HNBA 4BHZA 5BVFA 4HYIA 3E8EA 3RMFA 2GNIA 1M2PA 3B2TA 3EYHA 4IVCA 3RCDA 5EDRA 4BC6A 4IAZA 3GQLA 3O51A 3VS5A 4PNKA 4ASZA 3C4FA 3NYXA 1BX6A 2NP8A 2E9NA 1VYWA 4F0FA 1OBDA 3ET7A 2XKEA 3E63A 5A4QA 3LM0A 4ZK5A 3QA8A 4CNHA 2BDFA 3F82A 1OL1A 4WA9A 5C27A 4JOAA 2WTIA 4M84A 4WNKA 1S9IA 3DDPA 1FMKA 1VZOA 3C13A 4U9AA 4YNOA 5FP5A 4XH6A 1YXSA 4V05A 3R9DA 1BL6A 3ZU7A 4BWPA 4DHFA 4DEEA 3VRZA 3WBLA 1H1PA 4QMQA 3A7IA 2PVKA 4L52A 1B39A 4L45A 1M2RA 4AOTA 4DE4A 2OO8X 2ZAZA 3UBDA 5JMSA 3OEZA 3D5VA 4I5MA 3E87A 2UV2A 4RQVA 4BGHA 3SW4A 3RNYA 1J1BA 1LP4A 5IH6A 4CLIA 4OAUC 3V8SA 2XEYA 2XH5A 3MVMA 2UW3A 2AEGA 1XHAA 2EB3A 4J8NA 4YC6A 3TWJA 2UW6A 3PPJA 3BELA 1QPJA 1ZOGA 4G9CA 3PRIA 4NKSA 4G6NA 1V0BA 5GHVA 4DLJA 1VR2A 2IPXA 4OUCA 4QQJA 4HJOA 4A7CA 1Q8TA 2XK8A 4ITHA 1P5EA 3JYAA 1I09A 5JFWA 5KNJA 4O0YA 4FTNA 4OTGA 3ZSGA 2Y0AA 2WMXA 3I0OA 3JPVA 4RJ4A 4DH1A 1OBGA 3DK3A 3I7CA 4LV8A 4C38A 5HCZA 2PK9A 4RMZA 5KE0A 3R63A 1OKZA 2OF4A 1DS5A 2JLDA 5A4TA 2J0JA 3QUEA 5AP1A 4NK9A 3UP7A 3WZEA 1XBAA 5TKDA 3Q6UA 1UU8A 2VGOA 4J7BA 4ERWA 4CVAA 1Y6AA 4FIEA 4DEHA 3PE1A 2OFVA 3ORMA 3PXRA 4FOBA 4R1YA 4RJ5A 5HCYA 4YTIA 4X6RA 3FMLA 3MFRA 3A7JA 2A19B 3ATSA 3LMGA 1NVQA 4DTBA 2J7TA 4MF0A 3ZFXA 5BX0A 5H9BA 2W9FB 3ZM9A 4WUNA 4BDEA <