5EHLA

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
282
structure length
258
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANVGTVNYMPPEAIKDMSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle kinase 1 (MPS1) Using a Structure-Based Hydridization Approach
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 258
sequence length 282
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ehlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ehlA01
5E92A 1OBGA 3CY3A 3BLRA 4IBMA 3PXZA 4ZLOA 4MXCA 3W8LA 3EKNA 4FV5A 4IDVA 4JI9A 3PZEA 5AAFA 4H1MA 3QQFA 2VNYA 5HIEA 2E9NA 3HNGA 3HV4A 4NFNA 4U9AA 2P0CA 1RJBA 3QZHA 4MF1A 2UZNA 1J3HA 4WOVA 4BDIA 3AC1A 3KFAA 4FK3A 3TNIA 3RBWA 4JG6A 2E9OA 4MWHA 5HVKA 1CMKE 2HWOA 2XIKA 4RIWA 5JRQA 1TQMA 3PJ8A 4DTAA 5IQBA 1BYGA 1XKKA 1YOJA 4P5ZA 4U3ZA 4WBOA 5EFQA 3O2MA 4L3LA 4I21A 5E8XA 4BDEA 2H6DA 4PP7A 2ITOA 4Y95A 3BELA 3EZRA 3PXFA 5KZIA 3LOKA 3QTIA 4IZYA 3ZFYA 4O7LA 4N6ZA 1Q5KA 2B1PA 4A9RA 4ZTQA 3KGAA 4CKRA 1R3CA 3E63A 5ACBC 5AAEA 5EM7A 5HI2A 4KBAA 2Z8CA 4CXAA 4F08A 2GNLA 2OGVA 1SM2A 3UJGA 3VJNA 4C02A 3A4PA 1YQJA 3E8DA 3W33A 2XNMA 3G90X 2B55A 3C13A 2X7FA 2P55A 3TTIA 2JDSA 4MX9A 4ZK5A 3PWYA 4QP6A 5T3QA 5DR9A 5H8EA 1OL5A 1SZMA 4IWPA 4EK5A 2J0JA 4CFFA 2GPHA 5M06A 5L6PA 4K1BA 2F7ZE 4U0IA 4UN0C 4DN5A 2IO6A 3NW5A 4CGAA 3FZRA 2WMXA 3KL8A 4GK2A 4PMTA 3KY2A 5A4TA 2CKEA 2PVRA 3LJ0A 2OF4A 3FQHA 3QA8A 2PZRA 5CAOA 3OZ6A 3UZPA 3O51A 3TWJA 5FG8A 4F9BA 3WZDA 4IZ5A 2QCSA 3SLSA 2QHMA 3QYWA 4QYYA 4ERWA 4QMQA 5ICPA 3H0YA 1SVEA 4DLJA 3UOKA 2RL5A 3AT4A 3KK8A 4I4FA 1ZOGA 2X6EA 3IG7A 1YHSA 3R0TA 4OTPA 5HEZA 3BHYA 1MRVA 3LFQA 1K3AA 3CIKA 2YJRA 4USDA 4C38A 2X0GA 2I0VA 3AT2A 4XG6A 4HYUA 3AC5A 3DFAA 4LL5A 4C36A 5EKNA 1J7UA 4EH3A 4O7RA 4OLIA 3KRXA 4LRMA 4WSQA 4DINA 4EH7A 1PKDA 3OOMA 4O6EA 2XK4A 3BHUA 3GC9A 4JDIA 3Q04A 4FZ7A 3RHKA 3T9IA 4AZVA 5M09A 4M68A 4O0XA 3WIKA 3UE4A 5K4JA 3T3VA 1M2QA 3U6IA 2HENA 1JKLA 1JNKA 4L6QA 3SKCA 4WRSA 2G2IA 4X3FA 3OF0A 3QGYA 4ZOGA 3AGMA 3DGKA 3EB0A 4RQVA 5B2MA 4FEXA 5GZ9A 4BN1A 2UZEA 4QMNA 1XWSA 2XK3A 3D0EA 4D28A 3S1HA 4IAYA 2W4JA 4QQ5A 4FIHA 3Q53A 3FI2A 2BHHA 2J0LA 3PE2A 2BRGA 2HZIA 3KEXA 4BCNA 5FTQA 4YZNA 5GJDA 2W1CA 2J7TA 5FRIA 4CYJA 4D9UA 2ZM3A 5C1QB 2PTKA 2F49A 2OIDA 4BDDA 2GDOA 4HYSA 3DTCA 3RVGA 3AD4A 4M13A 3TKUA 5BX0A 4ANMA 4IM3A 5TOZA 4C59A 2BRHA 2XIYA 4GH2A 4RFYA 5EDRA 5KBRA 3FE3A 4RGJA 3GC8A 4B8LA 3HAVA 3TTJA 3A7HA 2JIIA 2FVDA 3CR0A 3LCDA 2W5AA 5A9UA 4WSYA 3GU7A 1DI8A 3DKOA 4FX3A 4FZ6A 4M7IA 3PG3A 4PX6A 2B7AA 2X4ZA 3IPHA 5CX9A 5CYIA 4BCMA 5CAUA 1R78A 4I0SA 3UO4A 3FAAA 3FI4A 3IS5A 3BGZA 3HL7A 3O50A 3Q9WA 3R2YA 4F1OA 5KMLA 2JAVA 4G3CA 4R3RA 1IG1A 5JRSA 3MVMA 5LOHA 3LPBA 2WGJA 4ITHA 1YOLA 5AX9A 1UKIA 5AA9A 2R3MA 5E8TA 4DAWA 1PMNA 4P5QA 4NT4A 3ANQA 4RC4A 4I0RA 1YW2A 2I6LA 4C4IA 2EUFB 4I6QA 4KIQA 5C8NA 2WHBA 4FKLA 3IKAA 1ZARA 3FDNA 1ZRZA 3AOXA 3AMBA 3TNHA 5EYDA 1OKWA 4N57A 1GY3A 2XUUA 3HV6A 4XUFA 4J71A 2BAKA 4XOYA 5D10A 3UG1A 2R3LA 2HW6A 2W9ZB 2WOUA 3PFQA 4BCGA 3UIBA 2BKZA 4HGSA 4E1ZA 2XJ2A 4O0SA 5H9BA 1ZYJA 4HGEA 3LW0A 2PMLX 5HNBA 3UQCA 4BWKA 3V5LA 3R8ZA 2ZDTA 4ONAA 4QMVA 3WF6A 3DLSA 3QQUA 4C34A 3FKLA 4IX6A 4M0ZA 4V0GB 4BL1A 2C69A 5HIBA 4BFMA 3EQPA 3IW4A 3DK7A 2IVVA 3QXOA 2V7AA 2ZM4A 3II5A 1QL6A 4GG7A 4HCUA 4W4WA 4EOMA 4X3JA 3VS7A 1U5RA 2DWBA 2QD9A 5H8GA 3KMUA 3LM5A 4PUZA 3W16A 5BVNA 3F7ZA 3ITZA 3QX2A 4KINA 4YZBA 3LIJA 4F7JA 2J90A 1L8TA 2Y7JA 4YNEA 4EK6A 3BYVA 3UP2A 3OBGA 3V6SA 3VNTA 4ACDA 3PVBA 4D55A 3NS9A 5JFWA 3MSSA 5EW3A 3VW6A 4TKSA 5EH0A 5CALA 5JKGA 5LJJA 3ATSA 4LGGA 4ZMFA 4LRKA 3UC3A 3OW3A 1YXXA 3ZCLA 4FF8A 2R64A 3GFWA 3EJ1A 5IDPA 3ROCA 1ZAOA 3GNIB 4QMSA 4TXCA 4BDKA 4G16A 4G6LA 4OTWA 4FTLA 5A14A 2BIKB 3OEZA 3OROA 3NUNA 5FXQA 4WA9A 3ALOA 4IB0A 4YTFA 5B7VA 2PVMA 5C4KA 4U7ZA 4E6DA 3A7FA 3ZFXA 1TQPA 4YJSA 2X2MA 2X7OA 3HMOA 2QO9A 2RGPA 4FKWA 4WT6A 3LJ1A 1PXNA 3KMWA 2IW9A 2BALA 2XYNA 3W2OA 3MWUA 3EQDA 4YO6A 5CANA 1XR1A 1JSTA 3L8SA 4DEHA 5IA2A 4ZIMA 2UW4A 3MY0A 4FKQA 4L3PA 2EXMA 4J96A 3RPOA 3FLSA 3W2PA 4ZY4A 5GZAA 3PVWA 4FE2A 2BPMA 4M66A 3AC8A 1R39A 2X2KA 4QPMA 5CASA 4BZOA 4LG4A 1QPDA 4Y85A 5AEPA 2PVKA 2W1DA 5ITAA 3QFVA 2YN8A 1JSVA 1FGIA 2ETMA 3FI3A 2QURA 4MD9E 4FNXA 4C4GA 3FY0A 4IJPA 4RVTA 4AP7A 4C62A 3G6HA 5BUJA 3T9TA 1UV5A 3TNWA 2A27A 3R7VA 3WE4A 3F5GA 3TNPC 4DEDA 4C33A 4ASDA 4P90A 1NY3A 2R3PA 2GSFA 3ENHA 3R21A 4EOJA 2O8YA 1VYWA 2WPAA 1LR4A 3D7TB 2PMNX 1BUHA 2E9UA 2C6KA 4F0IA 3MGYA 4RVKA 4WNOA 4FUXA 2PUIA 3C0IA 4K33A 3WZUA 4I94A 4XLIA 3R8VA 5J9YA 2GTMA 4IVCA 5FM2A 3EQBA 4R5YA 4J8MA 4I5HA 4KIOA 3TUBA 3SOAA 1GZ8A 3NUXA 5K4IA 5C01A 4D4YA 4GFOA 2Y6MA 4MBLA 2JDVA 2W9FB 2Z2WA 3SVVA 1H4LA 1Q4LA 2VTJA 4ACHA 2JC6A 4CLIA 3D5UA 2CGWA 4I5MA 4MEDA 3BYMA 4TYHB 5BPYA 1GJOA 3VS4A 2JAMA 4C3RA 4CTBA 4RJ7A 4A07A 3R30A 2XB7A 4EKKA 3BI6A 3WI6A 4HOKA 4BCFA 4FT3A 1CKPA 2OKRA 4MAOA 5CEPA 2V0DA 4OGRA 2R3NA 2YM8A 3FWQA 4O91A 4X6RA 4XP0A 3ZTXA 5HBJA 3ANRA 3LVPA 4C57A 3ORMA 5L2QA 5LVMA 4O84A 3EFJA 3MN3A 4FV2A 1H00A 4GMYA 5JSMA 4BDBA 4EHVA 3ZEWA 1YWRA 3VF8A 3PPJA 5ETFA 1JWHA 2G9XA 4CFNA 4FSMA 3F3WA 3TV7A 3ZYAA 4G3FA 4QQTA 4U80A 1O6YA 3TV6A 3GOKA 4OW8A 4EBWA 5AAGA 5BMMA 3U51A 4CTCA 5EQPA 2ITTA 5CSHA 4I4EA 4L9IA 3W2CA 1YDRE 4BR3A 2PUUA 4D0WA 3TZMA 4IB1A 4KS8A 4BCHA 1KOBA 3OTVA 3GCVA 2IVTA 3ORTA 4JXFA 3CC6A 4O0TA 4PDPA 5LCKA 4USFA 5GZ8A 5FP5A 3VW8A 4IFCA 1REKA 4C58A 1OITA 4GUEA 4EK4A 3PLAE 3KXMA 5DGZA 4Z3VA 3UYTA 5IH5A 5J7HA 4DFXE 4I41A 3R9OA 2ITUA 3DFCB 5E4HA 3JUHA 4IB5A 1FOTA 2PE1A 2YDJA 3G6GA 4FIEA 4YTHA 3TIYA 4NM3A 4L00A 3U6HA 3AXWA 2VZ6A 3ALNA 5M4UA 4MHAA 4FVQA 2XA4A 1M2RA 4YU2A 4ASEA 2OSCA 2OZAB 3LQ8A 2ERKA 3ODYX 1KE6A 4JQ7A 1P5EA 4C4JA 2WTDA 3P78A 4BICA 4CKIA 3QTWA 4H3PA 4F99A 4WBBB 3OEFX 4DGLC 4FKGA 4ACMA 4V05A 4IVAA 1KV1A 4YJNA 4AT4A 3OXIA 3I1AA 2Z7QA 4FKPA 4RWIA 1Q99A 1XHAA 2C5XA 2IW6A 4LUEA 2YLEA 5KMKA 3A62A 4U42A 2ITQA 2C6MA 2XNOA 3OCSA 3MTLA 4ERKA 3PA5A 2CJMA 1OM1A 2J9MA 5EYCA 4DH8A 4QTAA 5BQ0A 3L8PA 4DHFA 3KF4A 2JFMA 2XCKA 3QRJA 4OT6A 2W1GA 5DE2A 2PVNA 4N6YA 4WHZA 3QGWA 4U44A 4UALA 4HNIA 4L42A 4CT2A 1J1BA 4IHPA 4F63A 4C37A 3MJ2A 4F0GA 3QD4A 4WG3A 3UO5A 1PJKA 1V1KA 2ZYBA 3M1SA 1J7LA 4KKEA 4QMOA 3CJGA 1ZMVA 2FSLX 4HVSA 1LUFA 1GAGA 2I40A 2GNGA 1Q61A 2O63A 4AT5A 1VYZA 2OFUA 3DCVA 3BEAA 3CKWA 3GU4A 1DAWA 3TJDA 1GZNA 1FBNA 4U3YA 4G3EA 4GKIA 4BDHA 2GS7A 2UVYA 4ZSLA 4F70A 3D5XA 3ZRLA 4QT1A 5A6OA 3LXKA 5LVPA 4CFUA 3QD0A 3NW7A 5AR4A 4AN9A 1UA2A 3R28A 3PPKA 5J9LA 4JDJA 3CEKA 1UWJA 3ZZWA 4PDSA 2CCIA 4FV1A 3FLYA 4PQNA 1U59A 4EH4A 5J5SA 2VTOA 3B2WA 3F6XA 3P9JA 2UW6A 3H0ZA 3R1SA 4BBEA 3MB7A 4MQ1A 4HVHA 2REIA 4GV1A 3EFWA 3ZRKA 5JH6A 2UVZA 4FV4A 4F9AA 1OMWA 5L8JA 5CT0A 3KCKA 4FTJA 4KAOA 3QCYA 2CSNA 5L2SA 4RWKA 3QC9A 2QOHA 3FHIA 3BBWA 5EDPA 1OVEA 5IA0A 4WUNA 4EJ7A 4JAJA 3CPBA 5C27A 3BPRA 1W98A 4EOOA 2J2IB 2YM4A 4P2KA 4ZJJA 4ZZMA 5AV0A 5HQ0A 3IW7A 3UO6A 4XS2A 3LAUA 4RWLA 4Z7HA 3TUDA 4S34A 5ETAA 3HMPA 5HLPA 2JLDA 4GRBA 1U46A 4N4SA 3QA0A 1PXPA 4LOQA 2CGXA 3Q32A 4M3QA 4NKSA 4YJVA 3I81A 5F1ZA 5CEMA 3FJQE 3UPXA 2RFSA 2ONLC 1RW8A 4W4YA 5AP2A 3U9CA 4CQEA 4FBXA 4BC6A 4AA5A 3V3VA 2JBOA 3LLTA 4ITIA 2GFCA 3RJCA 1Z9XA 4HZSA 3F3VA 5D9HA 1Q97A 2WELA 1UU3A 3S00A 3HMIA 5J1WA 2Z7RA 1Y91A 3GT8A 2Z7LA 2R3KA 4S30A 4RBLA 3BKBA 4RQKA 1ZYDA 4FOBA 4QP7A 1WBOA 3VRZA 3LXLA 4JBPA 2JFLA 2XM9A 5AP5A 1MUOA 1ZYLA 3QRIA 4AE9A 3GCPA 4NCTC 2ETRA 3EL7A 4B7TA 4O7WA 4FIIA 3MY1A 3C50A 4LQMA 5J1VA 3PZHA 5LMKA 3QXPA 4L45A 4XNEA 3UNKA 2WD1A 2CKPA 4MNEB 1LP4A 2BAJA 2BDFA 2QLQA 4LI5A 4O38A 3Q4CA 4I20A 4R77A 2UW8A 2WU6A 5CSPA 3RK5A 5IUGA 4HCTA 5IEVA 4FK6A 2P2HA 4O7SA 5CENA 2WMWA 4PV0A 5DPVA 4E5WA 5I9VA 2FGIA 3JR1A 4WG5A 3OY1A 5HNGA 4D0XA 3R6XA 2BFXA 2ZV9A 3EQIA 3RPVA 4BZDA 5JZJA 4RX9A 5KMIA 3P86A 3KXXA 4EQMA 5LWNA 2HCKA 4NSTA 2AUHA 3FL5A 2PUPA 3P0MA 2B9FA 3G0EA 5IA1A 3C0HA 4FV0A 4ZTHA 3QHRA 3COKA 5CZHA 4JJRA 4WO5A 2XYUA 3EL8A 4BI0A 2X8DA 4AF3A 3LMHA 3LHJA 4RRVA 1FVRA 1PXOA 2BCJA 2I0HA 4UX9A 2HK5A 1WCCA 2XK7A 4YJPA 3QTZA 4EOSA 5EYMA 4S31A 4S32A 3UOJA 4G31A 4RZWA 3ORPA 5CEOA 4X2KA 3BE9A 3Q60A 2VTLA 4WIHA 5LVOA 1XH7A 5HCZA 3E3PA 4A4OA 1WAKA 1UVRA 1OIYA 2GCDA 3RWQA 3S0OA 3QTRA 4Y72A 4IIRA 5T6KA 4WNPA 3UC4A 1OBDA 4QNAA 3ETAA 4JLCA 2PK9A 4IM2A 4NM7A 4QNYA 4Q2AA 5FXSA 4QMMA 3DXPA 4QMTA 5CXHA 3EN4A 4GJ3A 4J7BA 4H1JA 4EQCA 3SG8A 2ZV8A 4A9YA 3R04A 5HVYA 2PVLA 4AT3A 5CVFA 3PP1A 3TKHA 3H9FA 3Q2MA 5CLPA 4ENXA 4TZRA 1MP8A 3GVUA 4H39A 3A8XA 3DAEA 4N70A 1XO2B 2YAAA 4GS6A 3G0FA 5A3XA 1G5SA 2W5BA 4UWYA 5DLSA 3D7ZA 2OBJA 5FQDC 2VN9A 4TW9A 3R8PA 4Y83A 4EZ3A 4O0WA 2VWVA 4FSWA 2Z02A 4EKLA 2BIYA 3CLYA 3QALE 2R3QA 4KRCA 4V04A 3RPRA 4O0YA 4FR4A 4Y73A 4DITA 2XNPA 4PNKA 2YIQA 1PXMA 4ZSJA 3ACJA 3PSBA 5HLNA 3VBYA 4A9TA 4AW1A 5A54A 5L3AA 1H25A 4QD6A 1OUKA 1H1PA 4FNWA 3RAWA 4AOIA 4BKZA 4V0GA 4ACGA 5AP3A 4MXOA 2WTCA 3H4JA 4O22A 5H2UA 4PPCA 3GCQA 4F4PA 1NT2A 4K8AA 5DWRA 3QU0A 4FTQA 3MESA 1F3MC 1YI6A 2Y4IB 2W1FA 5IA5A 5EM8A 4OAUC 4O7VA 1W7HA 3I7CA 3DAKA 1ZYSA 4U45A 4XP2A 4CMTA 4E5AX 5IQCA 2YEXA 3SX9A 3PSDA 4YUQA 2QLUA 1H1RA 3L9PA 2OF2A 4W9XA 2P33A 5M4IA 2O64A 5IH6A 4F9CA 4M67A 3OCBA 4R7BA 2XEYA 4JRNA 2OH4A 2X9FA 2VTRA 4EHGA 3R7EA 4MXXA 3JVSA 4V01A 5AMNA 3MI9A 2A4LA 4Z9LA 5DIAA 3PP0A 4QMWA 4TYEA 4BIEA 4LOPA 1WVYA 2J0KA 4X6QC 1P2AA 4NWMA 2H9VA 3WOWA 4BIBA 3PVUA 5CY3A 4NM5A 2OJJA 3EN5A 3TJCA 4FIFA 3V6RA 1H01A 2F2UA 4JQ8A 5L2IA 2W96B 2P4IA 4D2WA 4ZTRA 4O7YA 4NIFB 3BE2A 1SNXA 4ZLYA 1CKIA 3KVXA 4CVAA 1WFCA 3R73A 3N9XA 3R9DA 4RLKA 5CAVA 3NNXA 4BTMA 4CT1A 3FEGA 3REPA 3P1AA 3E62A 4ZS0A 5L6OA 1AD5A 3FZ1A 4O2ZA 4E5BA 3FXXA 2IG7A 4XRJA 3KRLA 4DEIA 1KE9A 3FZTA 5TE0A 5HU3A 3QKMA 2PVJA 3ZSHA 3GEQA 4OUCA 2ETKA 4CSVA 2G2FA 1DAYA 2ITPA 3FMEA 3QWKA 5EQYA 4ALVA 4J53A 5JFXA 4YO4A 5JQ5A 4JX7A 1JBPE 4L7FA 4XBRA 5IUIA 4DGGA 2HXQA 2C5VA 4XBUA 2W4KA 5IQHA 3DY7A 4HVGA 1Q41A 2V5QA 3DAJA 4C2WA 3QZIA 5DEWA 2C47A 2PE2A 3Q6WA 2BZHB 4O96A 4UEUA 2HY81 4YC8A 3MTFA 2W06A 5FDXA 3NVMB 1PHKA 3PJ3A 4AZFA 4I0TA 2BRMA 2ZDUA 4XJ0A 4JBVA 5CF4A 4GFGA 5HBEA 3Q52A 4F0FA 2ITYA 2UV2A 2VO7A 2UVXA 4RFZA 4YJRA 4ZTMA 4BKYA 2BRNA 3F3ZA 4WUAA 3C4CA 2OJFE 2VX3A 2GTNA 5CF5A 4TYGA 3RINA 4IXPA 3I4BA 5AX3A 4R6VA 2W1ZA 4O1OA 2ZM1A 4HZRA 3RMFA 4BCQA 3C5UA 1V0BA 5DBXA 3GC7A 2XIXA 4ZZOA 2J51A 2JGZA 4XMOA 3R01A 3FUPA 4RIYA 4GIHA 5AWMA 2QR8A 2BR1A 4TYHA 4DEAA 3C5IA 3JY9A 3BX5A 4AUAA 2R7BA 1Q24A 2ITNA 2ITVA 4XCUA 2QKRA 4BGGA 2PPQA 4ZAUA 3DB6A 2Y9QA 3PPZA 5EI8A 4DGOA 1O6KA 4OTDA 4U43A 3ORZA 5DVRA 3LCKA 5JEBA 2ESMA 2WOTA 4CKJA 3NNVA 1WVWA 3IDPA 5HE2A 3MBLA 2BTSA 2OO8X 3F5XA 4I5PA 4X2GA 5L6WL 4UWCA 5M56A 4EHZA 5M44A 3KXHA 4DTBA 3EYGA 4GK3A 1LEWA 4MTAA 3HZTA 4D2SA 5A4QA 3DXQA 4PWNA 5EHLA 4DE4A 3R9NA 3JVRA 3TN8A 3ZRMA 5EKOA 3O8PA 2C30A 4XOZA 3KB7A 3POZA 1M7NA 4CLJA 4D5HA 3LMIA 4WKQA 5E8YA 5HHWA 3S2PA 2WMTA 4BRXA 4EWHA 5E91A 5E8ZA 4WRGA 4ANSA 4DH1A 2B53A 2KULA 2RFNA 3VS0A 1CTPE 1IAHA 3D2IA 5M55A 4AZTA 5BYZA 4PTEA 3UVPA 2C6LA 1OECA 4FZDB 3QQJA 1VJYA 3WE8A 2DUVA 5J5TA 4R1YA 2PULA 4ZSEA 3IDBA 1QMZA 5E90A 2C5NA 3QTQA 4LYNA 3ET7A 4FV6A 4Q9ZA 4RT7A 4BWPA 4CD0A 5K0KA 3VBTA 3COMA 3OWPA 4U97A 1ATPE 1S9JA 1UNLA 3SOCA 4ANBA 3FZOA 1NVSA 3LCTA 2V55A 3FL4A 1F5QA 3MFTA 4K2RA 3NWWA 2JEDA 4X7QA 4FV7A 2FA2A 4FTIA 5DEYA 2R0UA 2YIXA 4GU6A 3FMHA 1KV2A 4YC3A 1TVOA 3SXRA 4ZS4A 2Q83A 2OZAA 4D2RA 4OBOA 3Q9XA 5M57A 2QU5A 1BL6A 2RG5A 3F61A 3POOA 3R2BA 4NUSA 4PDYA 3MDYA 3HP2A 1VZOA 3DU8A 4G5JA 3DK3A 3I60A 4O2PA 4RVMA 2VUWA 2BROA 3CXWA 4Y46A 4DFYA 2X81A 3GQLA 1UNGA 3ULZA 4I93A 2QR7A 2XVDA 1VEBA 3W18A 3RTPA 3PRIA 2WTVA 4K6ZA 5IU2A 4S33A 3GB2A 1Q8UA 5A4EA 3ZXZA 1M14A 3BWJA 4FNYA 4YHFA 4XG4A 5AUTA 4IAKA 2R3FA 3MH3A 5C8MA 3UIXA 4I23A 1JKSA 2C1AA 1GZOA 2HIWA 2QVSE 5AUZA 5F94A 3UZTA 3MY5A 2YM5A 4HYHA 4BYIA 3FSFA 3UG2A 1STCE 3DT1A 2OG8A 3HV5A 3RM7A 3COIA 1OPKA 2UZLA 3EMGA 3MPTA 4M0YA 2XNNA 4A06A 1PXIA 3PIZA 4G34A 3M2WA 4E4XA 5I4NA 3UGCA 1U4DA 2PYWA 5A6NA 2B9JA 4M97A 4XP3A 1FVTA 5CU4A 5D1JA 2BFYA 1BKXA 4A9UA 2GNIA 2F7EE 3RCJA 4GCJA 4LL0A 5HOAA 3LFFA 4L8MA 1SYKA 1G8AA 4NL0A 2AYPA 2WTKC 3S3IA 2BMCA 5CNNA 4I6FA 3MV5A 4FSZA 2FO0A 3ZC6A 4AW5A 3GGFA 2VWBA 1FGKA 1P4FA 2C4GA 4DA5A 1NA7A 2YM7A 4DH7A 4AACA 2GQGA 4UMUA 3DJ7A 5CU0A 3VULA 5KCVA 4LGHA 2VTMA 3DXNA 2BUJA 4G6OA 3BLQA 3CCNA 2O0UA 4CFVA 2OWBA 2PE0A 1DM2A 4X2JA 4FV9A 1H26A 2CMWA 2I0EA 3BU3A 4O27B 1A06A 4O6LA 3VWAA 3NVKI 3Q9ZA 4Z55A 2OU7A 2WFYA 1CM8A 4ASZA 5T68A 5B2KA 4CYIA 1ND4A 1WBPA 5DHJA 4BWXA 1YDSE 5KMMA 3HX4A 4XLVA 1E1XA 4ASXA 3F82A 1BLXA 3QRKA 3EN7A 4G9CA 3CD8A 1QPEA 3P7BA 3C9WA 4FTKA 4YZMA 5AIKA 3EQFA 4ALUA 1P4OA 3SDJA 2XKDA 2XNGA 3CQUA 4QP3A 2PU8A 2C6IA 4NJ3A 4DF3A 4FTMA 3D15A 2XBAA 4O0UA 4B0GA 1DI9A 4MBIA 5HD4A 4ZTSA 1M2PA 2V22A 1XBCA 3RM6A 3I79A 4IJ9A 5FXRA 4FTCA 2WTKB 3OWLA 4O7ZA 4GUBA 4AN3A 2XS0A 4QP8A 3D4QA 2VTQA 3ZUUA 2WMAA 1YRPA 4CCBA 3U4WA 4AE6A 4BCIA 3TM0A 2OLCA 3BEGA 4FZAB 4RIXB 4TYIA 4D1ZA 3NUSA 5BVFA 5L2WA 1ERKA 4M69B 5EW9A 4BDAA 2IVSA 1OPLA 1OIUA 3OMVA 3CSVA 2X8IA 5KHXA 3H30A 3CTHA 1IAJA 4HVDA 2UZUE 2OJ9A 3F7WA 1NW1A 3Q4UA 2YA9A 2DYLA 1YI4A 2OW3A 2CN5A 4MNFA 1PMUA 3TL8A 3QRTA 3OXZA 1PYEA 5J8IA 4MXYA 4BDGA 3S4QA 3EQGA 4KIKA 4IX5A 4IFGA 3LCSA 2FH9A 4R3CA 1R0EA 5DT4A 2YABA 2E9PA 4FODA 4QOXA 3TKIA 4RIWB 3V5WA 1M52A 2RG6A 2A1AB 4BTKA 2NRYA 3RCDA 3RAKA 2W4OA 2OXXA 5I5ZA 4MNEA 1R0PA 5EOLA 1TQIA 3NDMA 4FC0A 1PMEA 4ZZNA 4I6HA 4XYFA 4KSPA 2WMUA 3MPAA 4U79A 5I9YA 1JKKA 1YOMA 2UW7A 2Y8OA 4PDOA 1XH5A 3SGCA 2PMIA 2H8HA 2YM6A 3PJ1A 2FUMA 4GG5A 2WEIA 5HTIA 2R3GA 2QONA 4FSNA 3PTGA 3C0GA 2O65A 5CWZA 4FGBA 3I5NA 1RDQE 3UIMA 4EORA 4X0MA 2ZV7A 3VQUA 3G15A 3EZVA 3HEGA 3W2SA 4GT3A 4YZCA 3KC3A 4X3FC 4DG3E 1H07A 3ORIA 1H0VA 4B9DA 3FLZA 5JK3A 5K0XA 3DDPA 3VBWA 4QPSA 5CNOA 5KMNA 3DZQA 4FTUA 5D7VA 2XZSA 3SA0A 3ID6C 4E73A 3P7CA 4NCTA 3MIYA 1Z57A 1YXVA 5DMZA 3WYXA 3PRFA 3FKNA 1XBAA 3HGKA 5K5XA 3FYJX 4ZMEA 3L9MA 2YWPA 5DN3A 1H27A 4AQCA 5IMXA 2HAKA 3LM0A 2J0MB 4UMQA 3FMDA 3QD3A 3AG9A 4YNOA 3KKVA 3QZFA 5CU3A 1PYXA 4H3BA 4D4RA 4EJNA 1LPUA 1BX6A 3CS9A 3EQCA 3Q4ZA 4UMTA 5F95A 3V5PA 4AW2A 1A48A 2OIBA 3HMNA 2PVHA 1P14A 3I7BA 5EQEA 3VS3A 4XX9A 4U8ZA 5KO1A 2ITXA 4AN2A 3B2TA 4CG9A 2ITZA 3LMGA 4K0YA 3ZHPC 2J5EA 4GVAA 3QKLA 2OXYA 4NM0A 4LV5A 3ULIA 4IWOA 4M84A 3VUTA 3IW8A 1GIIA 3O71A 3DDQA 4FT9A 2B54A 4G2FA 2XKCA 3ODZX 3OY3A 3PY1A 3RHXA 3U4UA 3K5UA 4X2NA 3CD3A 4FKOA 4O0VA 4DTKA 5AFVA 4UB7A 3V5TA 3QL8A 4TWOA 4EH9A 1PMVA 2YJSA 3C4EA 3FMLA 4JIAA 4UV0A 3MA6A 4FTTA 3NEWA 4XG3A 2AC3A 4ANNA 3QCXA 4IAZA 1XH9A 1ZLTA 5HESA 4PL3A 3R02A 3VUKA 5L8KA 3F5UA 3OG7A 5TT7A 2BTRA 3PG1A 5JGAA 3HUBA 3IOPA 1PF8A 2XIZA 4FSRA 3R63A 5BUEA 2JD5A 2XP2A 4HJOA 2XCHA 4AOJA 3C1XA 3A2CA 2VAGA 3IONA 4EONA 1OB3A 3OS3A 2RIOA 4TPTA 2WMSA 3NW6A 2R2PA 3F3UA 5EI2A 3ZO2A 4BB4A 4KWPA 4FTAA 3G5DA 5K9IA 3DNDA 3WARA 5JT2A 4UXQA 4Y5QA 5IQIA 2HZ0A 3CKXA 2XJ0A 5IA4A 3MPMA 3U55A 1KE5A 3FHRA 4R5SA 4IACA 3UMWA 4RC2A 3M11A 4EC9A 3PXRA 4B8MA 2CKOA 4KUJA 3ZH8A 4OBPA 1WBSA 2QI8A 5HLWA 2CGVA 2JDRA 2XRWA 5TKDA 3BGQA 1WBTA 4FSYA 4KBKA 3NCZA 1KOAA 1MRYA 2G2HA 4QMZA 4F9WA 3VS1A 4NIFA 3R8MA 2PZYA 4QYHA 5DA3A 3OC1A 2VO6A 3UOLA 2QG5A 3RWPA 3IGOA 4IAIA 4AS0A 5DNRA 4U5JA 5KMOA 4PMSA 4AA4A 3WYYA 4IX4A 2KTYA 4JNWA 4LFIA 2B52A 4E3CA 3DK6A 1GNGA 4PPBA 4QP1A 1UU7A 3UBDA 3T8OA 1PXJA 2XKFA 4EWQA 2JITA 2CPKE 2WIHA 3FV8A 3O0GA 4QP2A 3R1YA 4R7IA 5GHVA 4XH6A 5IEYA 4DFUA 4O1PA 4KB8A 5AIRA 3VC4A 2JIUA 4QMPA 4IW0A 5CVHA 5DG5A 4FIJA 4G1WA 3PSCA 3BRBA 1ZY5A 4RJ5A 2UW9A 3IW5A 4D1SA 3FYKX 5ANEA 3O7LD 3UVQA 4FOCA 3PXKA 2VO0A 3R7OA 3OD6X 3QTXA 3A60A 4E8AA 5IQFA 3ZUTA 2OJIA 2WZJA 1NVRA 2W17A 4U40A 2PY3A 3FLWA 3O7LB 1PKGA 4FT7A 2B9HA 4KBCA 3ZO4A 3E87A 2YCFA 2XH5A 4FSQA 3R71A 5IF1A 3Q9YA 5IDNA 5HG5A 5AUUA 4D4SA 3W32A 4AAAA 1YWNA 4JG8A 3FXZA 2QOBA 3OVVA 3DKGA 2YHVA 3KXZA 3C7QA 4JQEA 4X2FA 4HPTE 3CY2A 5ANIA 4L01A 4RIOA 3TNQB 4EUTA 5CEQA 3AC2A 1ZZLA 3ZLXA 3A61A 4R3PA 4PPAA 3RNIA 2QG7A 1UU8A 3OFMA 3TDVA 1KWPA 3HUCA 2ITWA 2GHLA 3P4KA 4YHTA 3EQHA 3ZLYA 2YLFA 1NVQA 2YCRA 2Q0BA 4BIDA 5ANDA 1E9HA 3U8WA 2C0OA 5GJFA 5AR3A 1H1WA 3CBLA 3QZGA 3TZ8A 5IPJA 3FZPA 5I9WA 2QC6A 3AMYA 3UIUA 3QF9A 1URCA 5D11A 4DT8A 2GS6A 1HOWA 5IZFA 2WB8A 3QHWA 1Y57A 4J99A 5HG8A 2CNQA 2JKQA 4QQJA 3RGFA 3F2RA 4A4LA 2XKEA 4FKTA 5AA8A 3ZS5A 2HZ4A 3BBTB 3ZDIA 4QYEA 3ZSIA 5HTBA 1REJA 3LCOA 3O8TA 4I92A 4IC7A 3KQ7A 4DH3A 3UDBA 4EI4A 4IANA 3K3JA 4XV9A 5M53A 2WMBA 5IKWA 4NK9A 2IN6A 3SW4A 3FMKA 1ZXEA 3V01A 1I09A 3KRJA 4E4LA 4AGDA 3MVLA 2ZVAA 5C03A 3RI1A 2O3PA 4FEUA 1YI3A 3GENA 4CZUA 1SMHA 4AZEA 4QMLA 3EWHA 3NNUA 4BI1A 1WMKA 4UBAA 2SRCA 1ZZ2A 4OTFA 4P4CA 5BVEA 4WNKA 3PE1A 4ZSGA 2QODA 3NR9A 5CS6A 3MVHA 5LARA 4UY9A 5JZNA 1SNUA 5HO7A 5BMSA 2VWWA 2LGCA 1M7QA 3LZBA 2YITA 4Q5HA 5KE0A 2QO7A 2VO3A 2CDZA 3ZC5A 5IA3A 1OL7A 3ERKA 4R8QA 2GS2A 5BNJA 4PMPA 4DBXA 4C2VA 4DG2E 4TWPA 4QP4A 2C68A 2BHEA 4R1VA 3EH9A 4TN6A 2QU6A 3PA3A 2UZDA 5DOSA 3OCGA 4H58A 4EOLA 4EYMA 5HCXA 4MH7A 4ZP5A 3KN5A 3ZU7A 3DQWA 5JGBA 3TCPA 3HRCA 3VBVA 2J5FA 3HKOA 3MJ1A 4YJTA 2IW8A 2G01A 3HRBA 1YXTA 4F1MA 4NYEA 4XEYA 4YPDA 4I24A 2YM3A 3COHA 4MWIA 4A9SA 4CMOA 3EKKA 3RP9A 2I1MA 4E7WA 5JN2A 3G2FA 3G33A 4QQCA 2C6OA 5AADA 4E6QA 2W1HA 3I0OA 3UQGA 3KXNA 3AT3A 2C0TA 5HZNA 4JR3A 4RA5A 1KE7A 3W55A 2WQMA 4U6RA 4WD5A 3JYAA 3DBFA 4YSJA 2XNEA 5J87A 4EH5A 2J4ZA 3GU8A 1ZOEA 3P08A 5FEQA 4GSBA 4KKHA 4F9YA 4HW7A 3AC3A 3IO7A 4HCVA 4GK4A 4FTNA 4B99A 4FL3A 4J98A 2R3JA 1WBNA 2Y4PA 4M15A 3ZBFA 2HYYA 3R9HA 3V8TA 4BCPA 4NEUA 1FINA 4D9TA 3CQEA 4HNFA 3Q5IA 1B39A 4EYJA 3W2QA 2X7GA 5CTPA 3DTWA 1B6CB 4GU9A 4L7SA 5ANOA 1GIHA 3MVJA 4BI2A 5DT0A 3R83A 4G3DA 4HGTA 1PW2A 4NW6A 2Y0AA 3WF8A 5J79A 4TYJA 4W8EA 3WF7A 2WMRA 4QTBA 2WU7A 3VUMA 3TACA 4NKAA 4E93A 4J8NA 4E4NA 5AR8A 1URWA 1V0PA 2R4BA 2X1NA 4BDCA 4YGAA 3F9NA 2QOLA 2WIPA 5TR6A 2IZUA 4XG9A 4S2ZA 3ZZEA 3GC0A 2WTWA 3ZEPA 3ZO1A 4CCUA 5JFSA 2YZLA 3PWDA 1H1QA 5AV1A 5HE3A 1XQZA 4NH1A 5CU6A 3VVHA 4EK3A 5DYJA 3W2RA 4DGMA 4BY9E 3QLFA 3VJOA 4UMPA 3OOGA 3UYSA 2C6EA 3LFAA 3PIXA 3VHEA 3GOPA 3KULB 3N51A 3NNWA 5FLFA 1I44A 3MYGA 4D2PA 2W99B 3PY3A 3ZLSA 5FM3A 3QRUA 3U6JA 2QOCA 2YACA 2HY0A 4RWJA 1PRYA 5GINE 3DB8A 4FG8A 3V04A 3R7YA 4MF0A 3EHAA 4L3JA 4H05A 5ACKA 4RIXA 1JLUE 3GCSA 3RAIA 4BVUA 4DFBA 4YR8A 2YERA 2F9GA 3JS2A 5AUYA 4QMXA 4M69A 4WG4A 3E8CA 3P5KA 5FWKK 5JQ8A 4JBOA 5J9ZA 3MH2A 3MFSA 5FEEA 5HVJA 3A7IA 4F7LA 3VO3A 4JDKA 3DBQA 3OWKA 5HNIX 3UOHA 1YVJA 1JKTA 5HKMA 1Q3DA 1H0WA 4ORKA 3SQQA 4UXLA 2NO3A 3B8QA 4FKVA 2VTNA 2X4FA 2XRUA 4FKJA 4GT4A 4IAAA 4AW0A 4GL9A 5D12A 3E5AA 3EIDA 3CQWA 3HDNA 1U54B 2UZBA 1YDTE 4YZ9A 2W0JA 5G6VA 2NNWB 2C3JA 4O86A 2UZWE 2WXVA 3CE3A 3Q96A 3D7TA 4ZJVA 4O82A 1SVGA 4H36A 2EU9A 2VTIA 3HLLA 3LFSA 2VWUA 2ZOQA 2WTIA 4BBFA 2CLXA 3UQFA 2BRBA 4ARKA 3GQIA 3NIZA 3BWFA 1BL7A 3JY0A 4ITJA 4LRJA 4AU8A 5BVDA 5FEDA 3BGPA 5C9CA 2OFVA 2W7XA 4IDTA 2OK1A 3SRVB 4AG8A 4BKJA 3DJ6A 3ZONA 4FA2A 4U41A 3A7JA 1W0XC 3BYOA 4APCA 4C4HA 1F0QA 4IVBA 4C0TA 4PY1A 4EC8A 4EHEA 5KNJA 4C3FA 2GFSA 3QUEA 2QOQA 4HVIA 5LMKC 2ZJWA 3ZOSA 2W1IA 3LXNA 3L8VA 4YTCA 5IUHA 4FVRA 4FT0A 4GFMA 3BCEA 3LXPA 3RPYA 3RK9A 4UZHA 4IH8A 5CSXA 3ZMMA 4BYJA 2BAQA 2JBPA 4IMYA 3G9NA 4FUYA 4ALWA 3EFKA 4QMYA 5FGKA 4F6SA 2FYSA 3C4WA 4K11A 3GU6A 3IW6A 2HELA 1Y8GA 3MFUA 4A4XA 2GHGA 4FKUA 3P23A 4MD7E 5FBOA 4FL2A 1UU9A 3AGLA 2YDIA 1KSWA 3NMUF 4NFMA 3TEIA 2CNVA 2QOOA 5HE1A 4TTHB 4MQ2A 3WILA 4MK0A 2Q0NA 2VTHA 4G17A 1BI8A 4OTGA 3ZO3A 1PY5A 2HZNA 4TY1A 2YDKA 4IEBA 3RZBA 4W8DA 4ANOA 3NX8A 4DBNA 3KREA 3F66A 2PVYA 2F57A 2IZTA 3ENMA 2CGUA 4QMUA 1XJDA 3KVWA 2R7IA 3VBXA 5BUIA 1GOLA 5M4CA 3FSKA 4GIIA 1QCFA 4B4LA 3LKMA 3MFRA 4BHNA 3QLGA 3S95A 4E6CA 5FUTA 1OL1A 2CCHA 1M17A 4DLIA 3E7OA 5IG1A 4YC6A 4CZYB 3WZKA 3R1QA 4O81A 4RJ4A 2GQRA 4XHKB 4YLKA 4BZNA 3HDMA 3QCQA 2VU3A 2VTPA 5I3RA 2HXLA 1NXKA 3L9LA 2EB3A 3OW4A 4EOQA 3M42A 5DR6A 2R0IA 1YHWA 4LMUA 5AUWA 2B4SB 3DA6A 5K3YA 5EW8A 2OIQA 4FICA 4MYGA 3KU2A 3CGOA 4D1XA 3TUCA 3BV3A 3L9NA 4TNDA 1GIJA 3CGFA 3VHKA 2FSTX 3Q3BA 3OHTA 3VIDA 2XK8A 4PTGA 4TNBA 4ZY6A 3WZEA 5KX8A 2IWIA 1OKVA 4F6UA 5DFPA 2IZRA 2UW3A 2FSMX 2BZJA 2WAJA 3FKOA 3FMNA 3QAME 1Q8YA 3QQKA 5DRDA 5EI6A 2C6TA 5KZ0A 4ZJIA 3O23A 2PZ5A 5I0BA 1K9AA 1VR2A 2A0CX 3DQXA 4PTCA 5B2LA 2PUNA 4DEBA 5AP0A 1JQHA 4NU1A 4AFJA 4ENYA 3IK3A 1WBWA 3K3IA 3PA4A 5EM6A 3VAPA 1PXLA 3OP5A 4AFEA 4DEGA 1G3NA 1W82A 4JR7A 3IDCA 5LCJA 5E7RA 2VNWA 1O6LA 3BYUA 4O21A 4YP8A 3TIZA 3TT0A 4RC3A 4FKIA 4XG7A 3WF9A 4KA3A 5CEIA 5HX8A 3O17A 3SD0A 3WBLA 4JG7A 2XJ1A 4BCJA 4QTEA 4XG2A 3A7GA 2IPXA 4XG8A 4FEVA 3H10A 4CMUA 4IZAA 3N4VA 3B8RA 4GW8A 5ETCA 5I3OA 4QO9A 3TZ9A 3NCGA 3EN6A 4TRLA 2R3HA 3VBQA 4DCEA 4E26A 3A4OX 4DFZE 1ZWSA 4U81A 4EQUA 2WNTA 3KF7A 3PXQA 3FC2A 4OTQA 3RZFA 1ZMWA 1TKIA 2PHKA 3ZSGA 5K5NA 4YJOA 4R78A 2BILB 3PXYA 1J7IA 4XV1A 2OICA 3QC4A 4GEOA 2Z60A 4IX3A 4AZSA 2F2CB 2BZKB 3EOCA 5LMBA 1UWHA 3QTUA 3QYZA 5EK7A 3U9NA 4J97A 1Z5MA 4FSTA 4E6AA 4BHZA 4AGUA 3O96A 4YLJA 3FMMA 4QP9A 2A2AA 2BDJA 5EHYA 3RNYA 1LEZA 1PXKA 1OL6A 3W1FA 3MA3A 4W4VA 5FD2A 2O5KA 1Q8TA 4KD1A 5CVGA 2O2UA 3A8WA 4CZTA 2BZIB 5EYKA 3C4ZA 3DV3A 4FIGA 5HG7A 4MVFA 3MH1A 4PL4A 2JDTA 3TDWA 2C3KA 1H1SA 4MKCA 4PRJA 2XF0A 3C51A 4ZEGA 4AGWA 4EH2A 5HD7A 4UYNA 1Q3WA 4BDFA 5BVOA 5IEXA 4E20A 3OXTA 4IADA 4YHJA 2X2LA 4PP9A 4FG9A 3QUDA 4QRCA 3G51A 3K5VA 4ANQA 3HECA 1OIQA 1W83A 3I5ZA 3ZDUA 3FXWA 5DT3A 5JMSA 1XH6A 4G3GA 2R9SA 4F64A 3TG1A 2R3OA 2CLQA 1YWVA 4C61A 4PMMA 1IA8A 4QPAA 4JVGA 3QTSA 1HCLA 2X39A 1FVVA 4EEVA 4G6NA 3EFLA 4IVDA 1JVPP 4OTIA 3I6WA 4F65A 3ELJA 4FYOA 3ACKA 4FEWA 5HBHA 1ZYCA 2PMOX 4EOKA 3NAXA 1X8BA 2ACXA 2WMVA 4I3ZA 5D41A 5KHWA 3BU5A 5LMAA 3KCFA 3RAHA 3FY2A 3THBA 3FQSA 4CFMA 4ZTLA 1V0OA 5KMJA 1APME 5GIPE 2DS1A 1OKYA 3DOGA 5FBNC 2VRXA 2J50A 5GIOE 1XH4A 1ZOHA 3FMJA 3AMAA 4FTOA 3EN9A 2J0IA 5CZIA 3OCTA 2VWYA 5DRBA 3DKFA 4JIKA 4M8TA 3KXGA 3ZUVA 2OXDA 4J1RA 3QQGA 4NTSA 3FBVA 3I0QA 1WZYA 2WQOA 4KABA 1Q62A 4LM5A 2ONLA 3AQVA 3C4FA 2GNJA 3DBCA 5CF8A 2C1BA 4O7NA 3KRRA 3TZ7A 2FSOX 2C6DA 4QYFA 3CP9A 4RJ3A 3LFDA 3ZM9A 3MIAA 2ZMDA 4HPUE 4PNIA 3D94A 3FQEA 2YWVA 3R7IA 3NYVA 2WO6A 3FLNC 3ZFMA 2YFXA 1JPAA 2ZAZA 5ANJA 5E1SA 3LQ5A 2RSVA 1R1WA 4FKSA 5FP6A 4RX7A 5JGDA 3MW1A 3KA0A 5AP4A 3IQ7A 4LUDA 4MD8E 5E8WA 3GP0A 5CI6A 3VRYA 5F9EA 3JXWA 4RX8A 5EHOA 4BF2A 2VWXA 4RIYB 4BGQA 1JOWB 2C5OA 3LFEA 4F1TA 3PDTA 2ZB0A 4D2VA 4RZVA 3H3CA 3ZM4A 3QBNA 5HO8A 5BYYA 5C26A 1S9IA 4NTTA 3AC4A 3GCUA 5ANKA 3DLZA 4YPSA 5HE0A 4C35A 2CHLA 2YISA 2YCSA 4QTCA 4JRVA 5HG9A 5HU9A 1K2PA 5C8KA 2CN8A 5AUXA 4N0SA 4DYMA 5EM5A 4I1ZA 5CF6A 1KE8A 2QOIA 3GBZA 4ANLA 4BDJA 2XIRA 5AR5A 5I9UA 1EH4A 4TWNA 5E8UA 4H3QA 3DPKA 4F09A 4ZLZA 3N4TA 4IM0A 2C0IA 4RA4A 1UNHA 5L4QA 2B9IA 4RX5A 4GKHA 3R9RA 4RVLA 4CV9A 2JKKA 4X3FB 5BVKA 4EUUA 3RKBA 3V51A 2YIYA 3UNZA 3GU5A 3V8SA 2H96A 2XMYA 2VTSA 3F2AA 4R7HA 3R8LA 2W05A 4GYIA 5AV3A 4BGHA 3QWJA 4M14A 4OBQA 4F7SA 4D58A 5DH3A 3F69A 4XRLA 3OUKA 2YZAA 4YURA 2VV9A 3F88A 2XEZA 4KSQA 4MXZA 2VGOA 4NW5A 4A7CA 4IQ6A 5AM6A 4C8BA 5TO8A 4LMNA 3NYOA 2GNHA 3KRWA 3DBDA 4CNHA 3TV4A 3VQHA 2GMXA 3PJCA 1W84A 3KMMA 5IH4A 4G5PA 4IE9A 4F6WA 4FEQA 4OAVB 4UWBA 4UMRA 1RE8A 4KRDA 4K18A 4OTHA 2I0YA 4GT5A 3QCSA 3QQHA 3L1SA 3OTUA 4L44A 3W8QA 4Z7GA 3HMMA 3F3TA 3ORLA 4FNZA 4GYGA 3SV0A 2R5TA 3D5WA 5AP1A 1KUTA 2J6MA 3D83A 3OUNB 5IISA 2E2BA 4K9YA 2VTTA 5HTCA 5GNKA 5KUPA 3HRFA 4DH5A 2GNFA 3LFNA 1OIRA 4IWDA 5AR2A 3UNJA 2FB8A 1OL2A 3E8NA 5LXMA 5ETIA 3R00A 3C4XA 5M08A 3Q4TA 1AQ1A 4GJ2A 3D5VA 4FVPA 3V5QA 3CPCA 1AGWA 3BQRA 3KULA 5BVWA 4EBVA 4FZFB 2W1EA 1Q8ZA 3BYSA 2P3GX 4FYNA 3NLBA 4RJ6A 4YBJA 3KN6A 2UZTA 3U54A 1JAMA 2HOGA 2ZMCA 2WQNA 4C4EA 2R3IA 1YHVA 3PVGA 2XM8A 4AA0A 4EOIA 3N4UA 5CSVA 4CQGA 3E88A 4JT3A 3NUAA 4GVJA 1WVXA 4F7NA 3QD2B 2QKWB 2VGPA 1J91A 4IZ7A 1FPUA 3QQLA 2B0QA 1J1CA 3PYYA 1O9UA 2VX1A 3HA6A 4AX8A 4FG7A 2NPQA 4I22A 3IECA 2VWZA 3LQ3A 2R3RA 3OT8A 2IVUA 5KKRC 4YZDA 3TXOA 4CFWA 2UW5A 2NP8A 3E64A 3EQRA 3NAYA 2VWIA 3FPMA 3BLHA 4X21A 4FSUA 4KNBA 3E8EA 3ORNA 3SW7A 3E7VA 4EH6A 4USEA 2XK9A 4C3PA 3PY0A 5BYLA 1U54A 5IQEA 3ZBXA 5J7BA 2F4JA 4AXAA 4TL0A 5HORA 3MB6A 4Q5EA 4DT9A 1YKRA 1SVHA 2BDWA 3NRMA 4II5A 3VS2A 1T46A 1Y6AA 2QOFA 3UZRA 2JDOA 3VS6A 2EB2A 3AD5A 3ORKA 1FMOE 4JX3A 4D5KA 2G1TA 2WTJA 4L68A 3ZLWA 5HICA 1IA9A 3SC1A 1OPJA 3RK7A 2F7XE 2EXEA 3JPVA 1CDKA 4OT5A 1FMKA 4DCAA 4JDHA 5A4LA 3BIZA 4KKGA 3HV3A 4Y8DA 4O7TA 1WBVA 4MXAA 4CRLA 1A9UA 3EYHA 4FV3A 4NJDA 4ZY5A 3BU6A 2HWPA 1OKZA 2UZOA 3Q6UA 5JFVA 1HCKA 3SAYA 3PLSA 4FKRA 3SRVA 3UTOA 2LAVA 3V8WA 2PWLA 2OZOA 3DKCA 5CSWA 2VX0A 5CXZA 3NGAA 3DS6A 3R1NA 5CI7A 4ZSAA 3K2LA 4RLLA 4OR5A 3VF9A 4AWIA 5CEKA 3NUUA 3Q2JA 3TI1A 4DEEA 3ORXA 4FMQA 1ZMUA 3O8UA 4RSSA 3P7AA 3D9VA 2EVAA 3OT3A 5KKRB 3T3UA 4I6BA 4FGRA 3R7UA 2Y6OA 4CV8A 3SG9A 2C5YA 3NYXA 4MBJA 2OH0E 5HGIA 4IWQA 1DS5A 1XH8A 1Y6BA 4DFNA 1IR3A 4ZXTA 2X8EA 2OI4X 3AD6A 2VD5A 4AGCA 4O83A 1RQQA 4PF4A 3H9RA 5D7AA 3QKKA 2ZB1A 5LVLA 3WF5A 1Q8WA 3G9LX 5A4CA 3DNEA 4L53A 4IC8A 1ZY4A 4I5CA 4RG0A 4CFXA 5GJGA 3BZ3A 2YIWA 3PIYA 4BTFA 4AZWA 4O0RA 4C4FA 5FDPA 2UZVA 1OI9A 4RFMA 1H24A 3VUDA 4OTRA 4JL9A 5ANGA 3HYHA 1IEPA 2BVAA 4P7EA 3HV7A 4WNMA 4KIKB 3D2KA 3FZSA 1BI7A 5AP7A 5EOBA 5CAPA 5IQAA 5TF9A 2BKKA 4CG8A 2QOKA 2GHMA 3NZ0A 3UP7A 2V62A 3UVRA 2PVFA 3U87A 2Z7SA 2WMQA 4FV8A 5L8LA 5C4LA 2PZPA 3E92A 4JS8A 1QPCA 3Q5ZA 2EWAA 5AR7A 3E93A 3ZXTA 3OWJA 3FPQA 5HCYA 3RPSA 3HAMA 5M07A 1H28A 2YCQA 3LFCA 2WQBA 4DFLA 2WKMA 1XBBA 1QPJA 3D14A 4CRSA 4ZTNA 4EOPA 4LGDA 2YIRA 4LV8A 1OZ1A 2ZV2A 2GQSA 4E4MA 1T45A 2C3LA 3OBJA 4JBQA 4RPVA 1IRKA 1GZKA 4YJQA 5AV4A 3MS9A 5LWMA 5IQDA 3BV2A 4ID7A 4L43A 3ROYA 3MH0A 2EXCX 4YJUA 4XV3A 5E9EA 4FTRA 3DZOA 5E8VA 4EL9A 3IGGA 5AP6A 5CQUA 4YBKA 5KBQA 4BCKA 1YXUA 2XNBA 4B6LA 2YAKA 4BCOA 2PSQA 3VUGA 4APPA 3I6UA 4RJ8A 4Y5HA 4AOTA 4TWCA 5AM7A 1MRUA 2RFDA 2ERZE 3F5PA 3QX4A 3BQCA 2W5HA 3WZJA 3PJ2A 3UPZA 4Q9SA 4YLLA 3SXSA 4EH8A 2G15A 2JKOA 2DQ7X 2CKQA 3GFEA 4UZDA 1BMKA 5LVNA 1CKJA 3BHHA 3GXLA 2A19B 3GI3A 4D4VA 3F2NA 4BBMA 2QNJA 5F20A 2JKMA 4MCVA 4EZ7A 4TT7A 5H3QA 3VUHA 2UW0A 5B0XA 3CTQA 2WEVA 3L8XA 2Y4IC 2WQEA 4W9WA 4BTJA 1E1VA 2RFEA 2X9EA 4YMJA 3LJ2A 5I9XA 1W8CA 1H8FA 3KK9A 2C3IB 4EZ5A 3NYNA 4FL1A 4CEGA 3A99A 4FI1A 4IB3A 5E8SA 3W10A 2I7QA 3E3BX 3VS5A 5H8BA 4EK8A 3QUPA 5CT7A 4YTIA 3H9OA 3K54A 3V5JA 5I9ZA 5LQFA 2NRUA 4HYIA 5CU2A 5AUVA 1U5QA 1FQ1B 4IAFA 4K77A 1MQBA 5IQGA 3BHTA 4D2TA 3FC1X 1MQ4A 1G8SA 1OGUA 3NPCA 5FTOA 5AJQA 2E9VA 5F4NA 3CJFA 3NIEA 3VUIA 5EDQA 1H08A 1IASA 2IZSA 2QO2A 1UKHA 2GU8A 3UMXA 5DI1A 2HW7A 2V7OA 4DC2A 2AC5A 3NUPA 5J95A 3HA8A 4M12A 4C7TA 4LOOA 3NUYA 4L52A 5HIDA 3PUPA 2P2IA 3NSZA 3DJ5A 4XV2A 4KIPA 5FTGA 5AV2A 3FI8A 5M4FA 5DR2A 2CNUA 5L2TA 3LFBA 3LLAA 3WIGA 2IJMA 2QHNA 2X6DA 4DG0E 4Z16A 5E1EA 5CQWA 3UODA 3LE6A 1JSUA 4JOAA 2H34A 3R7GA 2RKUA 3SXFA 5HX6A 5IMEA 2QQ7A 4FT5A 3FLQA 3RALA 4QYGA 3HVCA 4J95A 3DBEA 4UYAA 4ACCA 2VTAA 3HP5A 2UUEA 1YXSA 3IOKA 4L46A 4PL5A 1Y8YA 4J52A 4W4XA 5G1XA 5CAQA 4RMZA 5M51A 1B38A 3P79A 5A46A 2PL0A 1CSNA 2RF9A 1L3RE 3CTJA 4HGLA 3R22A 2OJGA 3GUBA 4YSMA 4DGNA 4KS7A 4L67A 3VN9A 4JAIA 2PZIA 3SHEA 2XK6A 5HO6A 1OUYA 2JIVA 4NZWB 3ATTA 4QTDA 3R8UA 4G9RA 3BHVA 2XBJA 5EG3A
chains in the Genus database with same CATH superfamily
5E92A 1OBGA 3CY3A 3BLRA 4IBMA 3PXZA 4ZLOA 4MXCA 3W8LA 3EKNA 4FV5A 4IDVA 4JI9A 3PZEA 5AAFA 4H1MA 3QQFA 2VNYA 5HIEA 2E9NA 3HNGA 3HV4A 4NFNA 4U9AA 2P0CA 1RJBA 3QZHA 4MF1A 2UZNA 1J3HA 4WOVA 4BDIA 3AC1A 3KFAA 4FK3A 3TNIA 3RBWA 4JG6A 2E9OA 4MWHA 5HVKA 1CMKE 2HWOA 2XIKA 4RIWA 5JRQA 1TQMA 3PJ8A 4DTAA 5IQBA 1BYGA 1XKKA 1YOJA 4P5ZA 4U3ZA 4WBOA 5EFQA 3O2MA 4L3LA 4I21A 4DHJA 5E8XA 4BDEA 2H6DA 4PP7A 2ITOA 4Y95A 3BELA 3EZRA 3PXFA 5KZIA 3LOKA 3QTIA 4IZYA 3ZFYA 4O7LA 4N6ZA 1Q5KA 2B1PA 4A9RA 4ZTQA 3KGAA 4CKRA 1R3CA 3E63A 5ACBC 5AAEA 4LV7A 5EM7A 5HI2A 4KBAA 2Z8CA 4CXAA 4F08A 2GNLA 2OGVA 1SM2A 3UJGA 3VJNA 4C02A 3A4PA 1YQJA 3E8DA 3W33A 2XNMA 3G90X 2B55A 3C13A 2X7FA 2P55A 3TTIA 2JDSA 4MX9A 4ZK5A 3PWYA 4QP6A 5T3QA 5DR9A 5H8EA 1OL5A 1SZMA 4IWPA 4EK5A 2J0JA 4CFFA 2GPHA 5M06A 5L6PA 4K1BA 2F7ZE 4U0IA 4UN0C 4DN5A 2IO6A 2AEGA 3NW5A 4CGAA 3FZRA 2WMXA 3KL8A 4GK2A 4PMTA 3KY2A 5A4TA 2CKEA 2PVRA 3LJ0A 2OF4A 3FQHA 3QA8A 2PZRA 5CAOA 3OZ6A 3UZPA 3O51A 3TWJA 5FG8A 4F9BA 3WZDA 4IZ5A 2QCSA 3SLSA 2QHMA 3QYWA 4QYYA 4ERWA 4QMQA 5ICPA 3H0YA 1SVEA 4DLJA 3UOKA 2RL5A 3AT4A 3KK8A 4I4FA 1ZOGA 2X6EA 3IG7A 1YHSA 3R0TA 4OTPA 5HEZA 3BHYA 1MRVA 3LFQA 1K3AA 3CIKA 2YJRA 4USDA 4C38A 2X0GA 2I0VA 3AT2A 4XG6A 4HYUA 3AC5A 3DFAA 4LL5A 4C36A 5EKNA 1J7UA 4EH3A 4O7RA 4OLIA 3KRXA 4LRMA 4WSQA 4DINA 4EH7A 1PKDA 3OOMA 4O6EA 2XK4A 3BHUA 3GC9A 4JDIA 3Q04A 4FZ7A 3RHKA 3T9IA 4AZVA 5M09A 4M68A 4O0XA 3WIKA 3UE4A 5K4JA 3T3VA 1M2QA 3U6IA 2HENA 1JKLA 1JNKA 4L6QA 3SKCA 4WRSA 2G2IA 4X3FA 3OF0A 3QGYA 4ZOGA 3AGMA 3DGKA 3EB0A 4RQVA 5B2MA 4FEXA 5GZ9A 4BN1A 2UZEA 4QMNA 1XWSA 2XK3A 3D0EA 4D28A 3S1HA 4IAYA 2W4JA 4QQ5A 4FIHA 3Q53A 3FI2A 2BHHA 2J0LA 3PE2A 2BRGA 2HZIA 3KEXA 4BCNA 5FTQA 4YZNA 5GJDA 2W1CA 2J7TA 5FRIA 4CYJA 4D9UA 2ZM3A 5C1QB 2PTKA 2F49A 2OIDA 4BDDA 2GDOA 4HYSA 3DTCA 3RVGA 3AD4A 4M13A 3TKUA 5BX0A 4ANMA 4IM3A 5TOZA 4C59A 2BRHA 2XIYA 4GH2A 4RFYA 5EDRA 5KBRA 3FE3A 4RGJA 3GC8A 4B8LA 3HAVA 3TTJA 3A7HA 2JIIA 2FVDA 3CR0A 3LCDA 2W5AA 5A9UA 4WSYA 3GU7A 1DI8A 3DKOA 4FX3A 4FZ6A 4M7IA 3PG3A 4PX6A 2B7AA 2X4ZA 3IPHA 5CX9A 5CYIA 4BCMA 5CAUA 1R78A 4I0SA 3UO4A 3FAAA 3FI4A 3IS5A 3BGZA 3HL7A 3O50A 3Q9WA 3R2YA 4F1OA 5KMLA 2JAVA 4G3CA 4R3RA 1IG1A 5JRSA 3MVMA 5LOHA 3LPBA 2WGJA 4ITHA 1YOLA 5AX9A 3NFGB 1UKIA 5AA9A 2R3MA 5E8TA 4DAWA 1PMNA 4P5QA 4NT4A 3ANQA 4RC4A 4I0RA 1YW2A 2I6LA 4C4IA 2EUFB 4I6QA 4KIQA 5C8NA 2WHBA 4FKLA 3IKAA 1ZARA 3FDNA 1ZRZA 3AOXA 3AMBA 3TNHA 5EYDA 1OKWA 4N57A 1GY3A 2XUUA 3HV6A 4XUFA 4J71A 2BAKA 4XOYA 5D10A 3UG1A 2R3LA 2HW6A 2W9ZB 2WOUA 3PFQA 4BCGA 3UIBA 2BKZA 4HGSA 4E1ZA 2XJ2A 4O0SA 5H9BA 1ZYJA 4HGEA 3LW0A 2PMLX 5HNBA 3UQCA 4BWKA 3V5LA 3R8ZA 2ZDTA 4ONAA 4QMVA 3WF6A 3DLSA 3QQUA 4C34A 3FKLA 4IX6A 4M0ZA 4V0GB 4BL1A 2C69A 5HIBA 4BFMA 3EQPA 3IW4A 3DK7A 2IVVA 3QXOA 2V7AA 2ZM4A 3II5A 1QL6A 2IF8A 4GG7A 4HCUA 4W4WA 4X3JA 3VS7A 1U5RA 4EOMA 2DWBA 2QD9A 5H8GA 3KMUA 3LM5A 4PUZA 3W16A 5BVNA 3F7ZA 3ITZA 3QX2A 4KINA 4YZBA 3LIJA 4F7JA 2J90A 1L8TA 2Y7JA 4YNEA 4EK6A 3BYVA 3UP2A 3OBGA 3V6SA 3VNTA 4ACDA 3PVBA 3UDZA 4D55A 3NS9A 5JFWA 3MSSA 5EW3A 3VW6A 4TKSA 5EH0A 5CALA 5JKGA 5LJJA 3ATSA 4LGGA 4ZMFA 4LRKA 3UC3A 3OW3A 1YXXA 3ZCLA 4FF8A 2R64A 3GFWA 3EJ1A 5IDPA 3ROCA 3BL9A 1ZAOA 3GNIB 4QMSA 4TXCA 4BDKA 4G16A 4G6LA 4OTWA 4FTLA 5A14A 2BIKB 3OEZA 3OROA 3NUNA 5FXQA 4WA9A 3ALOA 4IB0A 4YTFA 5B7VA 2PVMA 5C4KA 4U7ZA 4E6DA 3A7FA 3ZFXA 3TYKA 1TQPA 4YJSA 2X2MA 2X7OA 3HMOA 2QO9A 2RGPA 4FKWA 4WT6A 3LJ1A 1PXNA 3KMWA 2X0PA 2IW9A 2BALA 2XYNA 3W2OA 3MWUA 3EQDA 4YO6A 5CANA 1XR1A 1JSTA 3L8SA 4DEHA 5IA2A 4ZIMA 2UW4A 3MY0A 4FKQA 4L3PA 2EXMA 4J96A 3RPOA 3FLSA 3W2PA 4ZY4A 5GZAA 3PVWA 4FE2A 2BPMA 4M66A 3AC8A 1R39A 2X2KA 4QPMA 5CASA 4BZOA 4LG4A 1QPDA 4Y85A 5AEPA 2PVKA 2W1DA 5ITAA 3QFVA 2YN8A 1JSVA 1FGIA 2ETMA 3FI3A 2QURA 4MD9E 4FNXA 4C4GA 3FY0A 4IJPA 4RVTA 4AP7A 4C62A 4LDTA 3G6HA 5BUJA 3T9TA 1UV5A 3TNWA 2A27A 3R7VA 3WE4A 3F5GA 3TNPC 4DEDA 4C33A 4ASDA 4P90A 1NY3A 2R3PA 2GSFA 3ENHA 3R21A 4EOJA 2O8YA 1VYWA 2WPAA 1LR4A 3D7TB 2PMNX 1BUHA 2E9UA 2C6KA 4F0IA 3MGYA 4RVKA 4WNOA 2X0OA 4FUXA 2PUIA 3C0IA 4K33A 3WZUA 4I94A 4XLIA 3R8VA 5J9YA 2GTMA 4IVCA 5FM2A 3EQBA 4R5YA 4J8MA 4I5HA 4KIOA 3TUBA 3SOAA 1GZ8A 3NUXA 5K4IA 5C01A 4D4YA 4GFOA 2Y6MA 4MBLA 2JDVA 2W9FB 2Z2WA 3SVVA 1H4LA 1Q4LA 2VTJA 4ACHA 2JC6A 4CLIA 3D5UA 2CGWA 4I5MA 4MEDA 3BYMA 4TYHB 5BPYA 1GJOA 3VS4A 2JAMA 4C3RA 4CTBA 4RJ7A 4A07A 3R30A 2XB7A 4EKKA 3BI6A 3WI6A 4HOKA 4BCFA 4FT3A 1CKPA 2OKRA 4MAOA 5CEPA 2V0DA 4OGRA 2R3NA 2YM8A 3FWQA 4O91A 4X6RA 4XP0A 3ZTXA 5HBJA 3ANRA 3LVPA 4C57A 3ORMA 5L2QA 5LVMA 4F78A 4O84A 3EFJA 3MN3A 4FV2A 1H00A 4GMYA 5JSMA 4BDBA 4EHVA 3ZEWA 1YWRA 3VF8A 3PPJA 5ETFA 1JWHA 2G9XA 4CFNA 4FSMA 2NYAA 3F3WA 3TV7A 3ZYAA 4G3FA 4QQTA 4U80A 1O6YA 3TV6A 3GOKA 4OW8A 4EBWA 5AAGA 5BMMA 3U51A 4CTCA 5EQPA 2ITTA 5CSHA 4I4EA 4L9IA 3W2CA 1YDRE 4BR3A 2PUUA 4D0WA 3TZMA 4IB1A 4KS8A 4BCHA 1KOBA 3OTVA 3GCVA 2IVTA 3ORTA 4JXFA 3CC6A 4O0TA 4PDPA 5LCKA 4USFA 5GZ8A 5FP5A 3VW8A 4IFCA 1REKA 4C58A 1OITA 4GUEA 4EK4A 3PLAE 3KXMA 5DGZA 4Z3VA 3UYTA 5IH5A 5J7HA 4DFXE 4I41A 3R9OA 2ITUA 3DFCB 5E4HA 3JUHA 4IB5A 1FOTA 2PE1A 2YDJA 3G6GA 4FIEA 4YTHA 3TIYA 4NM3A 4L00A 3U6HA 3AXWA 2VZ6A 3ALNA 5M4UA 4MHAA 4FVQA 2XA4A 1M2RA 4YU2A 4ASEA 2OSCA 2OZAB 3LQ8A 2ERKA 3ODYX 1KE6A 4JQ7A 1P5EA 4C4JA 2WTDA 3P78A 4FRFA 4BICA 3QTWA 4H3PA 4CKIA 4WBBB 4F99A 3OEFX 4DGLC 4FKGA 4ACMA 4V05A 4IVAA 1KV1A 4YJNA 4AT4A 3OXIA 3I1AA 2Z7QA 4FKPA 4RWIA 1Q99A 1XHAA 2C5XA 2IW6A 4LUEA 2YLEA 5KMKA 3A62A 4U42A 2ITQA 2C6MA 2XNOA 3OCSA 3MTLA 4ERKA 3PA5A 2CJMA 1OM1A 2J9MA 1XMLA 5EYCA 4DH8A 4QTAA 5BQ0A 3L8PA 4DHFA 3KF4A 2JFMA 2XCKA 3QRJA 4OT6A 2W1GA 5DE2A 2PVNA 4N6YA 4WHZA 4QEBA 3QGWA 4U44A 4UALA 4HNIA 4L42A 4CT2A 1J1BA 4IHPA 3W0QA 4F63A 4C37A 3MJ2A 4F0GA 3QD4A 4WG3A 3UO5A 1PJKA 1V1KA 2ZYBA 3M1SA 1J7LA 4KKEA 4QMOA 3CJGA 1ZMVA 2AQXA 2FSLX 4HVSA 1LUFA 1GAGA 2I40A 2GNGA 1Q61A 2O63A 4AT5A 1VYZA 2OFUA 3DCVA 3BEAA 3CKWA 3GU4A 1DAWA 3TJDA 1GZNA 1FBNA 4U3YA 4G3EA 4GKIA 4BDHA 2GS7A 2UVYA 4ZSLA 4F70A 3D5XA 3ZRLA 4QT1A 5A6OA 3LXKA 5LVPA 4CFUA 3QD0A 3NW7A 5AR4A 4AN9A 1UA2A 3R28A 3PPKA 5J9LA 4JDJA 3CEKA 1UWJA 3ZZWA 4PDSA 2CCIA 4FV1A 3FLYA 4PQNA 1U59A 4EH4A 5J5SA 2VTOA 3B2WA 3F6XA 3P9JA 2UW6A 3H0ZA 3R1SA 4BBEA 3MB7A 4MQ1A 4HVHA 2REIA 4GV1A 3EFWA 3ZRKA 5JH6A 2UVZA 4FV4A 4F9AA 1OMWA 5L8JA 5CT0A 3KCKA 4FTJA 4KAOA 3QCYA 2CSNA 5L2SA 4RWKA 3QC9A 2QOHA 3FHIA 3BBWA 5EDPA 1OVEA 5IA0A 4WUNA 4EJ7A 4JAJA 3CPBA 5C27A 3BPRA 1W98A 4EOOA 2J2IB 2YM4A 4P2KA 4ZJJA 4ZZMA 5AV0A 5HQ0A 3IW7A 4AQKA 3UO6A 4XS2A 3LAUA 4RWLA 4Z7HA 3TUDA 4S34A 5ETAA 3HMPA 5HLPA 2XARA 2JLDA 4GRBA 1U46A 4N4SA 3QA0A 1PXPA 4LOQA 2CGXA 3Q32A 4M3QA 4NKSA 4YJVA 3I81A 5F1ZA 5CEMA 3FJQE 3UPXA 2RFSA 2ONLC 1RW8A 4W4YA 5AP2A 3U9CA 4CQEA 4FBXA 4BC6A 4AA5A 3V3VA 2JBOA 3LLTA 4ITIA 2GFCA 3RJCA 3AKKA 1Z9XA 4HZSA 3F3VA 5D9HA 1Q97A 2WELA 1UU3A 3S00A 3HMIA 5J1WA 2Z7RA 1Y91A 3GT8A 2Z7LA 2R3KA 4S30A 4RBLA 3BKBA 4RQKA 1ZYDA 4FOBA 4QP7A 1WBOA 3VRZA 3LXLA 4JBPA 3LMHA 2JFLA 2XM9A 5AP5A 1MUOA 1ZYLA 3QRIA 4AE9A 3GCPA 4NCTC 2ETRA 3EL7A 4B7TA 4O7WA 4FIIA 3MY1A 3C50A 4LQMA 5J1VA 3PZHA 5LMKA 3QXPA 4L45A 4XNEA 3UNKA 2WD1A 2CKPA 4MNEB 1LP4A 2BAJA 2BDFA 2QLQA 4LI5A 4O38A 3Q4CA 4I20A 4R77A 2UW8A 2WU6A 5CSPA 3RK5A 5IUGA 4HCTA 5IEVA 4FK6A 2P2HA 4O7SA 5CENA 2WMWA 4PV0A 5DPVA 4E5WA 5I9VA 2FGIA 3BLAA 4WG5A 3JR1A 3OY1A 5HNGA 4D0XA 3R6XA 2BFXA 2ZV9A 3EQIA 3RPVA 4BZDA 5JZJA 4RX9A 5KMIA 3P86A 3KXXA 4EQMA 5LWNA 2HCKA 4NSTA 2AUHA 3FL5A 2PUPA 3P0MA 2B9FA 3G0EA 5IA1A 3C0HA 4FV0A 4ZTHA 3QHRA 3COKA 5CZHA 4JJRA 4WO5A 2XYUA 3EL8A 4BI0A 1W2DA 2X8DA 4AF3A 3LHJA 4RRVA 1FVRA 1PXOA 2BCJA 2I0HA 4UX9A 2HK5A 1WCCA 2XK7A 4YJPA 3QTZA 4EOSA 5EYMA 4S31A 4S32A 3UOJA 4G31A 4RZWA 3ORPA 5CEOA 4X2KA 3BE9A 3Q60A 2VTLA 4WIHA 5LVOA 1XH7A 5HCZA 3E3PA 4A4OA 1WAKA 1UVRA 1OIYA 2GCDA 3RWQA 3S0OA 3QTRA 4Y72A 4IIRA 5T6KA 4WNPA 3UC4A 1OBDA 4QNAA 3ETAA 4JLCA 2PK9A 4IM2A 4NM7A 4QNYA 4Q2AA 5FXSA 4QMMA 3DXPA 4QMTA 5CXHA 3EN4A 4GJ3A 4J7BA 4H1JA 4EQCA 3SG8A 2ZV8A 4A9YA 3R04A 5HVYA 2PVLA 4AT3A 3BL7A 5CVFA 3PP1A 3TKHA 3H9FA 3Q2MA 5CLPA 4AXCA 4ENXA 4TZRA 1MP8A 3GVUA 4H39A 3A8XA 3DAEA 4N70A 1XO2B 2YAAA 4GS6A 3G0FA 5A3XA 1G5SA 2W5BA 4UWYA 1ST4A 5DLSA 3D7ZA 2OBJA 5FQDC 2VN9A 4TW9A 3R8PA 4Y83A 4EZ3A 4O0WA 2VWVA 4FSWA 2Z02A 4EKLA 2BIYA 3CLYA 3QALE 2R3QA 4KRCA 4V04A 3RPRA 4O0YA 4FR4A 4Y73A 4DITA 2XNPA 4PNKA 2YIQA 1PXMA 4ZSJA 3ACJA 3PSBA 5HLNA 3VBYA 4A9TA 4AW1A 5A54A 5L3AA 1H25A 4QD6A 1OUKA 1H1PA 4FNWA 3RAWA 4AOIA 4BKZA 4V0GA 4ACGA 5AP3A 4MXOA 2WTCA 3H4JA 4O22A 5H2UA 4PPCA 3GCQA 4F4PA 1NT2A 4K8AA 5DWRA 3QU0A 4FTQA 3MESA 1F3MC 1YI6A 2Y4IB 2W1FA 5IA5A 5EM8A 4OAUC 4O7VA 1W7HA 3I7CA 3DAKA 1ZYSA 4U45A 4XP2A 4CMTA 4E5AX 5IQCA 2YEXA 3SX9A 3PSDA 4YUQA 2QLUA 1H1RA 3L9PA 2OF2A 4W9XA 2P33A 5M4IA 2O64A 5IH6A 4F9CA 4M67A 3OCBA 4R7BA 2XEYA 4JRNA 2OH4A 2X9FA 2VTRA 4EHGA 3W0MA 3R7EA 4MXXA 3JVSA 4V01A 5AMNA 3MI9A 2A4LA 4Z9LA 5DIAA 3PP0A 4QMWA 4TYEA 4BIEA 4LOPA 1WVYA 2J0KA 4X6QC 1P2AA 4NWMA 2H9VA 3WOWA 4BIBA 3PVUA 5CY3A 4NM5A 2OJJA 3EN5A 3TJCA 4FIFA 3V6RA 1H01A 2F2UA 4JQ8A 5L2IA 2W96B 2P4IA 4D2WA 4ZTRA 4O7YA 4NIFB 3BE2A 1SNXA 4ZLYA 1CKIA 3KVXA 4CVAA 3KIOC 1WFCA 3R73A 3N9XA 3R9DA 4RLKA 5CAVA 3NNXA 4BTMA 4CT1A 3FEGA 3W0OA 3REPA 3P1AA 3E62A 4ZS0A 5L6OA 1AD5A 3FZ1A 4O2ZA 4E5BA 3FXXA 2IG7A 4XRJA 3KRLA 4DEIA 1KE9A 3FZTA 5TE0A 5HU3A 3QKMA 2PVJA 3ZSHA 3GEQA 4OUCA 2XANA 2ETKA 4CSVA 2G2FA 1DAYA 2ITPA 3FMEA 3QWKA 5EQYA 4ALVA 4J53A 5JFXA 4YO4A 5JQ5A 4JX7A 1JBPE 4L7FA 4XBRA 5IUIA 4DGGA 2HXQA 2C5VA 4XBUA 2W4KA 5IQHA 3DY7A 4HVGA 4QDVA 1Q41A 2V5QA 3DAJA 4C2WA 3QZIA 5DEWA 2C47A 2PE2A 3Q6WA 2BZHB 4O96A 4UEUA 2HY81 4YC8A 3MTFA 2W06A 5FDXA 3NVMB 1PHKA 3PJ3A 4AZFA 4I0TA 2BRMA 2ZDUA 4XJ0A 4JBVA 5CF4A 4GFGA 5HBEA 3Q52A 4F0FA 2ITYA 2UV2A 2VO7A 2UVXA 4RFZA 4YJRA 4ZTMA 4BKYA 2BRNA 3F3ZA 4WUAA 3C4CA 2OJFE 2VX3A 2GTNA 5CF5A 4TYGA 3RINA 4IXPA 3I4BA 5AX3A 4R6VA 2W1ZA 4O1OA 2ZM1A 4HZRA 3RMFA 4BCQA 4DDGA 3C5UA 1V0BA 5DBXA 3GC7A 2XIXA 4ZZOA 2J51A 2JGZA 4XMOA 3R01A 3FUPA 4RIYA 4GIHA 5AWMA 2QR8A 2BR1A 4O4DA 4TYHA 4DEAA 3C5IA 3JY9A 3BX5A 4AUAA 2R7BA 1Q24A 2ITNA 2ITVA 4XCUA 2QKRA 4BGGA 2PPQA 4ZAUA 3DB6A 2Y9QA 3PPZA 5EI8A 4DGOA 1O6KA 4OTDA 4DHIB 4U43A 3ORZA 5DVRA 3LCKA 5JEBA 2ESMA 2WOTA 4CKJA 3NNVA 1WVWA 3IDPA 5HE2A 3MBLA 2BTSA 2OO8X 3F5XA 4I5PA 4X2GA 5L6WL 4UWCA 5M56A 4EHZA 5M44A 3KXHA 4DTBA 3EYGA 4GK3A 1LEWA 4MTAA 3HZTA 4D2SA 5A4QA 3DXQA 4PWNA 5EHLA 4DE4A 3R9NA 3JVRA 3TN8A 3ZRMA 5EKOA 3O8PA 2C30A 4XOZA 3KB7A 3POZA 1M7NA 4CLJA 4D5HA 3LMIA 4WKQA 5E8YA 5HHWA 3S2PA 2WMTA 4BRXA 4EWHA 5E91A 5E8ZA 4WRGA 4ANSA 4DH1A 2B53A 2KULA 2RFNA 3VS0A 1CTPE 1IAHA 3D2IA 5M55A 4AZTA 5BYZA 4PTEA 3UVPA 2C6LA 1OECA 4FZDB 3QQJA 1VJYA 3WE8A 2DUVA 5J5TA 4R1YA 2PULA 4ZSEA 3IDBA 1QMZA 5E90A 2C5NA 3QTQA 4LYNA 3ET7A 4FV6A 4Q9ZA 4RT7A 4BWPA 4CD0A 5K0KA 3VBTA 3COMA 3OWPA 4U97A 1ATPE 1S9JA 1UNLA 3SOCA 4ANBA 3FZOA 1NVSA 3LCTA 2V55A 3FL4A 1F5QA 3MFTA 4K2RA 3NWWA 2JEDA 4X7QA 4FV7A 2FA2A 4FTIA 5DEYA 2R0UA 2YIXA 4GU6A 3FMHA 1KV2A 4YC3A 1TVOA 3SXRA 4ZS4A 2Q83A 2OZAA 4D2RA 4OBOA 3Q9XA 5M57A 2QU5A 1BL6A 2RG5A 3F61A 3POOA 3R2BA 4NUSA 4PDYA 3MDYA 3HP2A 1VZOA 3DU8A 4G5JA 3DK3A 3I60A 4O2PA 4RVMA 2VUWA 2BROA 3CXWA 4Y46A 4DFYA 2X81A 3GQLA 1UNGA 3ULZA 4I93A 2QR7A 2XVDA 1VEBA 3W18A 3RTPA 3PRIA 2WTVA 4K6ZA 5IU2A 4S33A 3GB2A 1Q8UA 5A4EA 3ZXZA 1M14A 3BWJA 4FNYA 4YHFA 4XG4A 5AUTA 4IAKA 2R3FA 3MH3A 5C8MA 3UIXA 4I23A 1JKSA 2C1AA 1GZOA 2HIWA 2QVSE 5AUZA 5F94A 3UZTA 1G8KA 3MY5A 2YM5A 4HYHA 4BYIA 3FSFA 3UG2A 1STCE 3DT1A 2OG8A 3HV5A 3RM7A 3COIA 1OPKA 2UZLA 3EMGA 3MPTA 4M0YA 2XNNA 4A06A 3AKJA 1PXIA 3PIZA 4G34A 3M2WA 4E4XA 5I4NA 3UGCA 1U4DA 2PYWA 5A6NA 2B9JA 4M97A 4XP3A 1FVTA 5CU4A 5D1JA 2BFYA 1BKXA 4A9UA 3PFYA 2GNIA 2F7EE 3RCJA 4GCJA 4LL0A 5HOAA 3LFFA 4L8MA 1SYKA 1G8AA 4NL0A 2AYPA 2WTKC 3S3IA 2BMCA 5CNNA 4I6FA 3MV5A 4FSZA 2FO0A 3ZC6A 4AW5A 3GGFA 2VWBA 1FGKA 1P4FA 2C4GA 4DA5A 1NA7A 2YM7A 4DH7A 4AACA 2GQGA 4UMUA 3DJ7A 5CU0A 3VULA 5KCVA 4LGHA 2VTMA 3DXNA 2BUJA 4G6OA 3BLQA 3CCNA 2O0UA 4CFVA 2OWBA 2PE0A 1DM2A 4X2JA 4FV9A 1H26A 2CMWA 2I0EA 3BU3A 4O27B 1A06A 4O6LA 3VWAA 3NVKI 3Q9ZA 4Z55A 2OU7A 2WFYA 1CM8A 4ASZA 5T68A 5B2KA 4CYIA 1ND4A 1WBPA 5DHJA 4BWXA 1YDSE 5KMMA 3HX4A 4XLVA 1E1XA 4ASXA 3F82A 1BLXA 3QRKA 3EN7A 4G9CA 3CD8A 1QPEA 3P7BA 3C9WA 4FTKA 4YZMA 5AIKA 3EQFA 4ALUA 1P4OA 3SDJA 2XKDA 2XNGA 3CQUA 4QP3A 2PU8A 2C6IA 4NJ3A 4DF3A 4FTMA 3D15A 2XBAA 4O0UA 4B0GA 1DI9A 4MBIA 5HD4A 4ZTSA 1M2PA 2V22A 2A98A 1XBCA 3RM6A 3I79A 4IJ9A 5FXRA 4FTCA 2WTKB 3OWLA 4O7ZA 4GUBA 4AN3A 2XS0A 4QP8A 3D4QA 2VTQA 3ZUUA 2WMAA 1YRPA 4CCBA 3U4WA 4AE6A 4BCIA 3TM0A 2OLCA 3BEGA 4FZAB 4RIXB 4TYIA 4D1ZA 3NUSA 5BVFA 5L2WA 1ERKA 4M69B 5EW9A 4BDAA 2IVSA 1OPLA 1OIUA 3OMVA 3CSVA 2X8IA 5KHXA 3H30A 3CTHA 1IAJA 4HVDA 2UZUE 2OJ9A 3F7WA 1NW1A 3Q4UA 2YA9A 2DYLA 1YI4A 2OW3A 2CN5A 1W2FA 1PMUA 4MNFA 3TL8A 3QRTA 3OXZA 1PYEA 5J8IA 4MXYA 4BDGA 3S4QA 3EQGA 4KIKA 4IX5A 4IFGA 3LCSA 2FH9A 4R3CA 1R0EA 5DT4A 2YABA 2E9PA 4FODA 4QOXA 3TKIA 4RIWB 3V5WA 1M52A 2RG6A 2A1AB 4BTKA 2NRYA 3RCDA 3RAKA 2W4OA 2OXXA 5I5ZA 4MNEA 1R0PA 5EOLA 1TQIA 3NDMA 4FC0A 1PMEA 4ZZNA 4I6HA 4XYFA 4KSPA 4AXEA 2WMUA 3MPAA 4U79A 5I9YA 1JKKA 1YOMA 2UW7A 2Y8OA 4PDOA 1XH5A 3SGCA 2PMIA 2H8HA 2YM6A 3PJ1A 2FUMA 4GG5A 2WEIA 5HTIA 2R3GA 2QONA 4FSNA 3PTGA 3C0GA 2O65A 5CWZA 4FGBA 3I5NA 1RDQE 3UIMA 4EORA 4X0MA 2ZV7A 3VQUA 3G15A 3EZVA 3HEGA 3W2SA 4GT3A 4YZCA 3KC3A 4X3FC 4DG3E 1H07A 3ORIA 1H0VA 4B9DA 3FLZA 5JK3A 5K0XA 3DDPA 3VBWA 4QPSA 5CNOA 5KMNA 3DZQA 4FTUA 5D7VA 2XZSA 3SA0A 3ID6C 4E73A 3P7CA 4NCTA 3MIYA 1Z57A 1YXVA 5DMZA 3WYXA 3PRFA 2X0QA 1XBAA 3FKNA 3HGKA 5K5XA 3FYJX 4ZMEA 3L9MA 2YWPA 5DN3A 1H27A 4AQCA 5IMXA 2HAKA 3LM0A 2J0MB 4UMQA 3FMDA 3QD3A 3AG9A 4YNOA 3KKVA 3QZFA 5CU3A 1PYXA 4H3BA 4D4RA 4EJNA 1LPUA 1BX6A 3CS9A 3EQCA 3Q4ZA 4UMTA 5F95A 3V5PA 4AW2A 1A48A 2OIBA 3HMNA 2PVHA 1P14A 3I7BA 5EQEA 3VS3A 4XX9A 4U8ZA 5KO1A 2ITXA