5EHLA

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
282
structure length
258
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANVGTVNYMPPEAIKDMSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle kinase 1 (MPS1) Using a Structure-Based Hydridization Approach
rcsb
source organism Homo sapiens
total genus 72
structure length 258
sequence length 282
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ehlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ehlA01
3HUCA 1J1CA 4KNBA 4WG4A 2QR8A 3A8XA 4YZCA 3MVJA 5EM7A 4P5QA 3S95A 2HY81 4KKGA 3RTPA 3W33A 4F7LA 4FODA 3PA5A 4FV7A 3NUYA 4GRBA 3RAKA 4TT7A 2AC5A 1LEWA 2QLQA 2CKEA 5GIPE 4PMMA 2YM3A 2UZNA 4DF3A 2BIYA 3FZOA 4FSQA 3QZFA 1ZOGA 3AC2A 4RIWA 3LCOA 4O22A 3W16A 2VGPA 3PUPA 5CEOA 3FPQA 3LQ3A 4GUEA 4U7ZA 3EOCA 3LHJA 3D83A 4X6RA 3KXGA 4YSMA 5EDRA 1CKJA 3THBA 3TL8A 3U55A 4ANMA 2CLQA 3VW8A 2R3PA 5DRDA 4ANLA 3WF7A 3NIZA 3MY5A 2HK5A 4P5ZA 2P2IA 3ZUVA 4AOTA 2X9EA 1OGUA 3W1FA 2XNEA 2ERZE 2BZIB 2VWBA 3DK3A 4FSRA 3PRIA 4EI4A 3TDWA 3F5UA 5GJDA 4FKQA 1XH9A 4J98A 3L8SA 3QF9A 5HCYA 4MQ2A 3NGAA 4F65A 5HO8A 3DBEA 3WE4A 3DBCA 2REIA 3VQHA 3LPBA 1GZNA 5EYMA 3W8LA 4R7BA 2A2AA 4YUQA 4IH8A 5B2LA 4IM3A 3EFLA 1F3MC 3Q96A 4U40A 3A7FA 4X21A 3PSBA 3QWKA 2UW4A 3RI1A 4ACHA 4O0RA 4DGNA 3MESA 3MVLA 3VUHA 4DEHA 3ATTA 4FVRA 2O65A 3EIDA 1E1XA 3FMMA 4IZ5A 4YHFA 3VO3A 4BBMA 4F99A 1PXIA 5CSHA 5JGDA 4BYJA 2PWLA 4NJ3A 3RZBA 2QVSE 3WOWA 3TNQB 1AD5A 1PXOA 4HYUA 4JOAA 2HZIA 5AA8A 2IG7A 4XS2A 2VWYA 2J5EA 3DBFA 3PXRA 4IZAA 1UNGA 3BHUA 4BI1A 4E6QA 4ERWA 5CF6A 4G3EA 5LJJA 4EORA 4L3LA 2XZSA 4KIKA 2XMYA 2PY3A 3O51A 4D0XA 4O7LA 5M4CA 5TE0A 2YFXA 3DB6A 3PVUA 5CWZA 5DYJA 3NUPA 3QZIA 3FL5A 2XVDA 4WNMA 4ACGA 4BWXA 1PMEA 2O63A 4EKLA 3LMIA 1KOAA 3BHVA 4I4EA 4QYYA 5DT4A 2VTQA 4O0XA 1K2PA 3P7CA 4QTBA 5H8EA 1ZOEA 3EQCA 5AM6A 2C3IB 5ANGA 3C4WA 5CSXA 1KE6A 3HGKA 4XG6A 4J99A 4ZAUA 5KE0A 2GU8A 3SXRA 4K9YA 3KL8A 5JN2A 4EJ7A 5F95A 2PVMA 3COKA 5M4IA 1REKA 5GZAA 3MTLA 4XV3A 5BNJA 4PTGA 3ITZA 2JIUA 2NRYA 2V5QA 4CZYB 5ANEA 2BDFA 4WA9A 1DM2A 3FXWA 4ZTMA 3UO4A 1XH4A 2O3PA 4GSBA 4AF3A 4E73A 4RVTA 4U3ZA 1ZY5A 1OECA 3TT0A 4F09A 3MGYA 4F7JA 2IZRA 3QKKA 1IRKA 3QRJA 2W0JA 3R1QA 3WE8A 3WZJA 3RAWA 5FTQA 3QHRA 4RX7A 3T8OA 1WAKA 3VHKA 5BVWA 1OKWA 2W1FA 4RIOA 4F0IA 3CCNA 5BQ0A 2WMTA 4IX4A 4YBKA 2W1HA 4O86A 3H30A 2JKOA 3G5DA 1P5EA 3G90X 5TT7A 4AAAA 5KMKA 3BIZA 5ACKA 5I3RA 3OWPA 4HNFA 4I92A 3WF6A 2GQSA 3CY3A 2X4ZA 2XH5A 4RGJA 5AR7A 2WQEA 2XNNA 3R1SA 4YZDA 4ARKA 3KULB 2XRUA 3QUEA 4FKOA 4MNFA 3NS9A 4ASZA 2CCHA 4PPAA 4U41A 3ZO1A 3F3TA 3SOAA 2CMWA 3EZVA 2BDWA 4DG3E 4RJ5A 3TJDA 3MH0A 4FYNA 4CFWA 2CNQA 4D2RA 4JDKA 3R8VA 2IW6A 3SRVA 1H25A 4K1BA 3RINA 2BAKA 3BRBA 4QTCA 2GS6A 4BHNA 1OL5A 2XK3A 4QNAA 4FNYA 3W2RA 2RFNA 4KRCA 5BYLA 4S32A 4HVSA 4ZSAA 3Q60A 5KX8A 1UV5A 3LFEA 5DIAA 3FLZA 4LOQA 1OPKA 3G0FA 3KRRA 5CQWA 5DN3A 3PZEA 3B2WA 4V04A 4JXFA 4FOBA 3ZRMA 2J9MA 4O6EA 4EOLA 4F7NA 4A07A 3R9DA 4O0YA 4YJVA 5JH6A 4IDVA 4C4HA 1H0WA 3Q4TA 2X2LA 2IVVA 2VTMA 3SD0A 3WZUA 4AGDA 5CVGA 5M4FA 3D4QA 4V0GA 4JIKA 3W2PA 4DH1A 2WEVA 1NXKA 4CXAA 1V0BA 4QPAA 4UY9A 5CU4A 2XJ2A 4DG2E 3KVXA 4D4RA 3VS5A 2J2IB 5FEEA 5FTOA 3UG1A 5IQIA 1LEZA 5K3YA 2R3HA 4EWQA 3V8TA 4EOQA 5K4JA 3EWHA 3CTJA 2JFLA 2YIQA 3DNDA 4H3BA 1PXMA 4HPTE 3T9TA 3GCUA 3LMHA 3NUAA 4WNPA 5FRIA 1OVEA 3NPCA 2OI4X 4IAKA 3UMXA 3N4VA 4IACA 4PY1A 3P4KA 1WBNA 4AQCA 4IWQA 2XNMA 3FMLA 3BQRA 4MQ1A 2XYNA 2W1EA 4MX9A 2HY0A 4RWLA 1V0OA 3V5LA 4YLJA 4O7VA 2QOCA 4FEWA 4AG8A 3FZPA 1YXTA 4RC3A 2NNWB 2V7AA 1H8FA 3DK6A 4FEQA 1Q99A 1QPCA 3QU0A 4YJQA 3U9CA 2BFYA 2QI8A 2JIVA 3KKVA 3V5JA 3QTQA 4N4SA 2WU7A 5D1JA 3KXHA 1U5QA 2R3IA 4KIQA 1YDSE 5E92A 3OP5A 3MFSA 2UW9A 3EKNA 3ULIA 1PF8A 3IW4A 3KU2A 4RJ8A 4YNEA 3W55A 4OW8A 2QONA 2VTLA 3TIZA 4G6OA 3GU5A 3Q53A 2CN5A 2ERKA 2B9JA 5CX9A 4TYEA 4EZ7A 3NW6A 4F9BA 4XG2A 3MYGA 5L3AA 2YWPA 5IH6A 5A54A 3E88A 3F3ZA 3R30A 2YLFA 4FTUA 3V5TA 3W32A 4AXAA 4DH3A 5FG8A 3U87A 4EK6A 5B2KA 1M7NA 3DNEA 3LXPA 4R8QA 4XH6A 5LXMA 3CS9A 3PTGA 5E8SA 5IH4A 4A7CA 1CM8A 4LOPA 2BFXA 2ITTA 4D1ZA 2G2IA 2QODA 2F7XE 5AEPA 2Z02A 2YABA 3FHRA 4MH7A 3MVHA 1XH5A 3TZ7A 4BDIA 4ENYA 4BHZA 3OUNB 4QP4A 2GMXA 3AT4A 3DAKA 4RJ4A 3R0TA 4EH7A 4XLIA 2R3NA 1R1WA 5LVNA 3LOKA 2UZLA 4IFGA 1ZMUA 2QO7A 5ETFA 2UVXA 3BEGA 4RIWB 1RJBA 4IHPA 5HNGA 2R7IA 3CGFA 1Y8YA 3TWJA 3UQFA 3CE3A 4LM5A 3EHAA 1X8BA 3PG1A 4J71A 1KE5A 1BX6A 2JBPA 2P4IA 2OSCA 2WQBA 4MXOA 3VUMA 5KO1A 4DA5A 2IVUA 3I1AA 3RCJA 2ZAZA 3BQCA 2WEIA 3R8ZA 4ZS4A 2CSNA 4FTNA 5HD4A 2XIKA 4AW1A 2BMCA 2IN6A 4QMNA 3QD2B 4G9CA 4OLIA 4WD5A 4BICA 2ITNA 3JR1A 3D0EA 1SMHA 4BCKA 4O2ZA 1O9UA 2PE0A 5CEMA 4EC9A 4WG5A 2VTIA 3ROYA 4D1XA 2QO2A 3PJ3A 5M08A 2EU9A 3O8TA 3OT3A 4JDHA 1M14A 2X6DA 4JQ7A 3MS9A 4CZUA 1CKPA 5GJGA 5BPYA 1XH6A 4AA0A 3B2TA 4LRMA 4BR3A 3A2CA 4X3JA 5EI6A 4R77A 3ZZEA 2OJGA 2BHHA 1ZZ2A 4FIEA 5DEYA 4FKJA 1KE8A 2XP2A 2R0UA 4MWHA 5DLSA 3HDMA 3W2QA 2VU3A 2OLCA 1H07A 3KXZA 5FQDC 1Q41A 2DUVA 2BVAA 4X7QA 4NCTA 3HP2A 3OWJA 4L68A 3CR0A 2GNJA 5CQUA 3EKKA 5H8BA 4ASDA 2J5FA 1J1BA 5E1EA 4FZAB 5HCXA 4I0RA 3JVRA 3H10A 3QYWA 5BMMA 5BVDA 3U51A 2JITA 3NEWA 5CAPA 3SX9A 4BDKA 1H1RA 4QMXA 1PYXA 4QRCA 4FTLA 3PWDA 4L3JA 2WAJA 2CNVA 3KRXA 2VWUA 4F9YA 3VS1A 5BYYA 2IZUA 3A60A 3LW0A 3RCDA 4FG8A 4XYFA 2ZV2A 3MY1A 1GOLA 1PKDA 5AX9A 3UMWA 5K5XA 3G0EA 5CU6A 4K8AA 4JG8A 5H2UA 3Q9XA 3RK7A 4CMOA 4R6VA 2PULA 4YC3A 5L2SA 3RP9A 3ALNA 1IA8A 4NZWB 2RKUA 4ZK5A 3WF5A 1HCKA 1ZZLA 4YJPA 5FGKA 4HVGA 3VS6A 1ZMVA 4MBIA 4APPA 4FV0A 3QA0A 3PE1A 4NH1A 2O5KA 5LWMA 4OGRA 3VWAA 4RJ6A 2FSOX 3D14A 3TIYA 3FMJA 4WUAA 4A9TA 2RG5A 3QRUA 3ZDIA 5ETCA 2E9UA 4C02A 1GIIA 2QQ7A 3H9OA 4NM3A 4BIDA 3SA0A 4FKIA 4B0GA 2ZV8A 4HCTA 4JDJA 4O0TA 1YHVA 4RC4A 5DMZA 5FBOA 3QX4A 4ZZNA 2OIDA 2BILB 1JSTA 2XK8A 5EW8A 3R9OA 2XYUA 5EHYA 1FMKA 1J7LA 4NW6A 4PMTA 2Z8CA 3R02A 4RX8A 4IC8A 1XJDA 2DWBA 2OW3A 3PJ2A 1WZYA 3OD6X 4RIYB 4QQTA 3ZEWA 5IQCA 2C68A 3ZXZA 4EH6A 4KS8A 4XX9A 2PZRA 4JBPA 5F1ZA 4FZ6A 2VO6A 1PJKA 2CGXA 5DOSA 5HX8A 2Y4IC 1VEBA 3CKXA 4G5JA 4HNIA 3UIUA 3C0HA 3WIKA 3PIXA 5DHJA 4PNIA 1NT2A 2X7GA 3MDYA 3NAYA 2GQGA 5AUUA 2B9FA 2VNWA 5K0KA 4ZLOA 4U5JA 4GG7A 4I4FA 1A48A 4JQ8A 5KMIA 4AN2A 1MQBA 4BCQA 1R3CA 3LFDA 4KIOA 3PXYA 3MY0A 3E64A 2R3FA 4ZJVA 3AMBA 4APCA 5L2IA 3GB2A 3W2OA 4R78A 3A7IA 4UMQA 3OG7A 4JDIA 3NNWA 4V0GB 3LM5A 5CNOA 3V6SA 4CKIA 5L2TA 2W5AA 3D15A 3DLSA 2ZOQA 3RPSA 2VTRA 3EB0A 4FT5A 5CZHA 3RM7A 5J87A 4ITIA 4CG8A 4AS0A 5J9LA 4KRDA 4QMMA 1YDTE 3VW6A 4CG9A 4TWCA 5CEQA 4Z7GA 4M8TA 4HGTA 2I40A 4UEUA 4C2VA 2CGUA 2VTPA 3FKOA 4R7HA 3VBXA 2HZ4A 4YJRA 4YZMA 2W9FB 4ACMA 3UJGA 2XJ1A 3E8EA 1Q97A 3A7GA 3DBQA 5HESA 5A4TA 4QP9A 3UO5A 2B52A 2JAMA 3AD5A 2W9ZB 4F0FA 3EL7A 4C57A 5CEPA 1WBSA 4FT9A 4EK5A 3C9WA 3LFCA 3IOKA 4M84A 5GZ9A 4U43A 4D4YA 2PVLA 4EOKA 2G2HA 4IEBA 2ITXA 4G17A 3ZRLA 5IG1A 2HWPA 4FIFA 3AC4A 4RJ3A 4ZZOA 5KCVA 3V8SA 3CBLA 5HEZA 1GIJA 1JSVA 3P5KA 3U9NA 4BIBA 1GZ8A 4ONAA 3LQ8A 4AFEA 5JGAA 4WIHA 4F9AA 3C4CA 5DBXA 5DR6A 2I7QA 4GKIA 2YCFA 3NLBA 4FSMA 3S1HA 2WTDA 4NK9A 3SDJA 4HGEA 5AP2A 4UMRA 4GFGA 1T46A 4FF8A 4EQUA 4JIAA 4NJDA 2OZAA 2R64A 2KTYA 5CI7A 5HORA 3I6WA 4WRGA 3PA3A 3AC1A 3F7ZA 4FV1A 5C8NA 2WMBA 2WQOA 2OU7A 4BCHA 3Q04A 2PK9A 4D2TA 1WBTA 3DBDA 4QMUA 4D2PA 2B0QA 2OWBA 5TOZA 3T3UA 3BE9A 3FYJX 3FBVA 5CU0A 3VF9A 2YLEA 3PE2A 1Q8UA 3QC4A 4DFBA 4FZFB 5DFPA 4I1ZA 4O0SA 3KK8A 3OBJA 2BR1A 2YDIA 3PVBA 4M0ZA 2JGZA 3WI6A 4ITHA 1Q5KA 1QL6A 2QC6A 4YBJA 5ETIA 4PDSA 5AADA 3ZS5A 1ZYJA 4YNOA 5HLPA 1M2RA 3HNGA 3R71A 2PSQA 4EYJA 5HTBA 4M14A 3OBGA 1U4DA 3VQUA 3GU4A 4OAUC 3HL7A 4I5MA 4QTAA 4ID7A 5CU3A 4BDJA 5L2WA 1Z9XA 3P08A 1IASA 1BLXA 3FAAA 3OFMA 4IB3A 4BCGA 3RALA 3CGOA 4CRSA 3ZSIA 3BBWA 3ZFYA 4TWNA 2VRXA 4BWPA 2FA2A 3GOPA 3M11A 3G9NA 3H4JA 5EI8A 2OK1A 1Q24A 1U54A 4GK3A 4QMSA 2UZTA 2YIYA 3CPBA 5CT7A 4I6HA 4CKJA 2V7OA 3P86A 2RL5A 2GTMA 2W17A 3N9XA 1YOJA 2V55A 2PU8A 1Q8WA 5D7AA 3OUKA 5E9EA 3C4ZA 3NNXA 4DGMA 1WBOA 5K5NA 3Q5ZA 4ACDA 3PJ8A 3O2MA 4ZTQA 2C1AA 3RAHA 4N6ZA 3QRTA 2R4BA 3POZA 3O71A 2G2FA 5EK7A 4O83A 2WTKC 3LXKA 3ET7A 4FIIA 4IX3A 4CFFA 4IAYA 3EQRA 1XQZA 4X6QC 3RMFA 2WIHA 3CIKA 1OMWA 5DRBA 5AM7A 3I79A 2O2UA 3CTHA 3DZQA 4FSNA 4G31A 4IAAA 4G16A 4QMPA 3IS5A 4IZ7A 5KZ0A 1UU9A 3MJ2A 5HLNA 3SXFA 3VBYA 4C4GA 4PDYA 2BAQA 4YTHA 4MNEA 3PPZA 4GFOA 4S31A 4BDDA 5J9ZA 3DXPA 4IM2A 3TXOA 3MPAA 1UU7A 1ZXEA 4JR7A 2Z7LA 3FL4A 4ZSJA 1H1SA 4DGLC 3D9VA 5KMMA 4EOMA 4WNOA 2VWWA 2PZIA 4IWDA 1NY3A 2QURA 2Z60A 3FI4A 4B8LA 5IF1A 4DFNA 2JKKA 4CD0A 5BVNA 4TYHB 3Q2JA 2Z2WA 2C1BA 3R9HA 3VUTA 1SVEA 3PG3A 2FSTX 5M09A 4C59A 5FDPA 4RFYA 5B7VA 4NM5A 4UXLA 2FH9A 3R8UA 4XP3A 4C8BA 3C0IA 4FX3A 1ATPE 4L67A 1STCE 5JK3A 2AYPA 2XBJA 1Y8GA 2W4OA 3GC0A 4DITA 5DA3A 2ZMCA 3ORIA 1H0VA 4I93A 4O38A 1M2PA 4EH4A 3FHIA 3ERKA 3R1NA 1S9IA 2PVFA 4AW2A 4CRLA 2CCIA 5EW3A 4X3FA 2JAVA 2F57A 1YDRE 4O1OA 4W8EA 2HZ0A 4MK0A 3OWLA 3SHEA 4OR5A 3SV0A 3MH1A 4JX7A 2R3GA 3HX4A 4FT0A 4OTPA 1HOWA 4H1JA 4Y95A 4ZS0A 4QPSA 4Q5EA 4D5KA 2Y8OA 3H3CA 4FG7A 2ZDTA 3K3IA 3PPJA 3GXLA 3ZLSA 2WMUA 2OF4A 3E62A 5GHVA 2ETRA 3V01A 2C6DA 3CQEA 4XG8A 4WNKA 3COIA 3WBLA 4IM0A 2B9IA 4II5A 3UIMA 1XKKA 4V01A 2J0KA 2RIOA 4ALVA 1M52A 3LJ1A 3DPKA 4FIJA 4KWPA 5HBHA 2O64A 3PFQA 3TUBA 2OIQA 2PPQA 4J96A 1M7QA 3Q6UA 3QD4A 2VWIA 5J1VA 3DLZA 3L8XA 4BGHA 5KBQA 5HE3A 4DTAA 3UGCA 3MWUA 5F94A 4DAWA 2XBAA 5K0XA 4U45A 4C61A 4RG0A 3WIGA 4B99A 1OIUA 5I5ZA 3NZ0A 5C4KA 1YVJA 5HG7A 2CKPA 3JVSA 4MYGA 4AGCA 2ITPA 1A9UA 1JAMA 2BUJA 3F6XA 3R63A 2LGCA 4U81A 4G3CA 4AE6A 2OH4A 4USFA 5CF8A 1LP4A 3FKNA 3HRFA 3VJNA 5IA1A 4W9WA 5E91A 1R0PA 2XIYA 3I5NA 4DBNA 2J0IA 3ORNA 4AA5A 1XH8A 3R04A 4EOSA 1YXUA 5E8XA 3S2PA 3K54A 4EJNA 4BDAA 2YITA 3DDQA 2FSMX 2PVYA 4YPDA 4E6AA 4ZMFA 4I20A 5AMNA 1GNGA 3I5ZA 4AT5A 3TKUA 3DKOA 3TV7A 1PRYA 2UZWE 3G33A 3EQHA 3VBVA 3ZSHA 5M55A 3DQXA 5IZFA 3OHTA 3COHA 1OKVA 4B7TA 4UZHA 4AUAA 3OCSA 3PWYA 3HYHA 3A61A 4FICA 5T6KA 4KUJA 5DVRA 3QTZA 5ICPA 4EZ5A 3AGMA 1W82A 4IFCA 5AUTA 3LCSA 3R2YA 3BPRA 4BVUA 4GIHA 2HW6A 3LXNA 4FK3A 3ORKA 2HAKA 4AN9A 4FTAA 5ANJA 5AJQA 4HYSA 3NYNA 4QP7A 4PQNA 2GS7A 4EK8A 4ALWA 3V6RA 3ENMA 5HZNA 3JYAA 5EHOA 1H00A 4QMVA 1UWJA 3VUIA 4H58A 1PMVA 2YM8A 4GW8A 5HE0A 3KQ7A 1PHKA 4PNKA 1H28A 3DS6A 3GCVA 3VVHA 3D7TA 4FC0A 4KBKA 4P2KA 4F4PA 4RQKA 2UUEA 3FMEA 2YAAA 4J52A 3S3IA 1TKIA 3U6JA 5K4IA 2VZ6A 4E4NA 3C4FA 5ANKA 3GCPA 3UDBA 4LUEA 3CLYA 3FLNC 4EHEA 4DE4A 3QTUA 5AUXA 1R39A 3CD8A 3ACJA 4BB4A 4LMUA 2PVJA 2R9SA 2F7ZE 3BGZA 3FKLA 3MJ1A 4D2SA 5HD7A 1OZ1A 4QTEA 3L9LA 4FTRA 4EEVA 2X2MA 4CQEA 3OCTA 4MF1A 3BCEA 4I41A 4N57A 3UOKA 4EHVA 4IVCA 1SVHA 3FLSA 3QLGA 2IZSA 3T9IA 2ZB0A 4IVAA 5F4NA 1KUTA 4N70A 2HCKA 4BKJA 3O96A 4IW0A 3KCFA 4I94A 4CCBA 2KULA 3PY1A 1F0QA 1KOBA 2QD9A 1RE8A 4Q9SA 2XKEA 4DT8A 4FOCA 2E9OA 4XG4A 2LAVA 3AC5A 1PKGA 3KF7A 2QOHA 4IVDA 5FP6A 5IQFA 4R1YA 4CV8A 4LQMA 3KMWA 3QTWA 2YM4A 4CT1A 4AN3A 4NCTC 2OJJA 4TPTA 4FI1A 4CCUA 2C5YA 1XO2B 3DCVA 4FTQA 5J1WA 3P23A 3EN9A 4FKSA 4I5HA 3D2IA 4FIGA 2XEYA 4NM0A 4XHKB 4YJNA 2JD5A 4GYGA 2PYWA 4AOJA 2WMAA 1Z57A 1ERKA 3DFAA 3GQLA 3UP2A 3WYYA 5HTCA 5JMSA 1TQMA 3FMNA 3MA6A 4OTWA 3VAPA 2X6EA 3ZLWA 5IQDA 2CLXA 5F20A 3LQ5A 4BGQA 5KNJA 4EOIA 3MH2A 4X2FA 4M67A 4MBLA 2BKZA 2GFSA 3POOA 4KAOA 4U8ZA 1TVOA 3Q4UA 4HYIA 4GVJA 4ZTNA 1FBNA 2J0MB 3GEQA 2WXVA 2PUNA 3QGYA 3L8VA 5I9ZA 3EQFA 2P0CA 2VTJA 2RSVA 3BGQA 3EYHA 3IG7A 4IXPA 2F4JA 4C58A 1OKZA 2PVRA 2R7BA 4U79A 4FV2A 4U80A 4PL4A 2W1IA 5J5SA 4BZDA 3U4WA 2X0GA 1LPUA 3ORPA 5M06A 3DV3A 1XH7A 4M7IA 3VNTA 4QO9A 2JDRA 2C3JA 2XKFA 2XM9A 4DFYA 1MRYA 3FQEA 3Q4CA 1VYWA 4CFUA 4YO6A 4I6QA 1UKHA 1Q61A 4CYIA 1ZYDA 3I81A 4QQCA 4C4EA 5A9UA 3FZRA 1XHAA 2BKKA 3FMDA 2UZVA 4RSSA 4Z7HA 4PDPA 1WVXA 3ZBFA 5KHXA 2OICA 4IJ9A 4M69B 4XV2A 3ULZA 5IA0A 1FVVA 5DEWA 4GU6A 5IA4A 4L6QA 3G15A 3MTFA 2XF0A 4FZ7A 3HVCA 3LCKA 3O23A 2YCQA 3JPVA 4NWMA 5I0BA 3W2CA 3IW7A 4PL3A 5IISA 2YJSA 4JBQA 2ZDUA 3QFVA 4RFZA 2WPAA 1ZWSA 3FY2A 4IB1A 1FOTA 2WOTA 5BVFA 3SQQA 5JFVA 3PSDA 4WSQA 4HVDA 2XNPA 4TWPA 5BUJA 4ZTLA 2I0HA 3ANRA 5DGZA 5FBNC 3TNIA 3MIAA 2ZV9A 3F3UA 3QRKA 4W4YA 4XOZA 4YO4A 2F2UA 5HU9A 2B7AA 4JS8A 3ZONA 2C0OA 3C5UA 3F69A 4NSTA 4EHGA 2PE1A 5FEQA 2ITQA 4CFMA 1ZYSA 3OF0A 2BROA 1VJYA 3F2NA 1GZKA 3LAUA 4L3PA 5C26A 3PXZA 4EH2A 2W5HA 1GY3A 2XS0A 2Y4IB 2ITUA 1JQHA 2C30A 3FI2A 3MFUA 1YHSA 4TN6A 5CASA 2CHLA 3VC4A 2XK7A 4ZXTA 3CQWA 1QPDA 1OL7A 4S33A 3R9NA 4U6RA 5EYKA 1BI7A 1UVRA 4DC2A 3OCBA 3R6XA 4O7TA 3F3VA 3FZ1A 3DTCA 5HO7A 3TEIA 4XG7A 4DEEA 2YIXA 3QC9A 4RA5A 5CXZA 4QT1A 1Q8YA 4FSYA 3MPMA 2BRGA 1L3RE 2GNIA 3CD3A 3NW5A 2IPXA 3PXKA 1JNKA 4BDBA 1BL7A 3BHTA 3ROCA 3FQHA 4MVFA 1PYEA 2GQRA 2JDOA 4QNYA 2ONLA 4GJ2A 3WARA 3NWWA 2WNTA 1DS5A 5H9BA 4W4WA 3MW1A 4YGAA 1M2QA 1RW8A 1GAGA 4GFMA 2C3LA 4HGLA 1BUHA 3JS2A 4NT4A 3C1XA 4Y73A 3TNWA 2XM8A 4PP9A 4RVKA 5KMJA 3KREA 3SC1A 4RZVA 4MAOA 2Y0AA 1VR2A 3BI6A 3S4QA 3NCGA 3RBWA 2R0IA 3AD6A 2UW0A 3C50A 4ZMEA 5EQYA 2B4SB 3VBQA 5CEKA 2VO0A 1OIYA 4FTJA 1OI9A 4RX9A 1U59A 5EDPA 4BCMA 4U97A 1H01A 2YAKA 4UN0C 4O7SA 3E8DA 4QYFA 3ZOSA 4FGBA 4LV5A 4CLIA 1YXVA 3GUBA 1Q3WA 1ZARA 5CALA 4IMYA 4UB7A 3ZLYA 3ATSA 1BMKA 3TNHA 5LVPA 2P3GX 3QRIA 2YACA 4NUSA 3R83A 1KE7A 1MUOA 1ZAOA 2IO6A 3EZRA 3FI3A 2EXMA 5CY3A 4RBLA 4H36A 2YEXA 4GK2A 5CLPA 4UXQA 1MRUA 3ODYX 3VRZA 3DAEA 3PP1A 2AC3A 2OJ9A 4EK4A 3DT1A 1YKRA 3P0MA 2VX0A 4JI9A 3C7QA 4PRJA 3JY0A 3NNVA 4ZY4A 4J8MA 3KF4A 3LZBA 4LGGA 5L8LA 5CNNA 5AIKA 4XRJA 4QP1A 5EI2A 3QTSA 4M12A 1JVPP 1J7IA 5CF4A 2EXCX 2XIZA 2XK9A 3PA4A 4EH3A 3GFEA 2OXDA 2WKMA 1PMNA 4HZSA 3Q5IA 3BZ3A 3R8LA 4RVMA 3UNZA 3UNJA 3WF8A 4LRKA 5LMAA 2Y9QA 4XRLA 4BGGA 2H8HA 5AV0A 2ACXA 3KCKA 5C27A 2JBOA 3T3VA 3QTXA 5A14A 2VTSA 2C6TA 2WTCA 2XUUA 4IB5A 4ZP5A 4E3CA 5FTGA 1WVYA 2A19B 4ANNA 5DR2A 4FSTA 2FB8A 1W8CA 3GU8A 4LRJA 3C4EA 4OTRA 4E26A 3I60A 2W05A 2W1CA 3UODA 5L4QA 4B6LA 2X9FA 4KIKB 4HJOA 3GC9A 4TYJA 4DH5A 3MSSA 4H3QA 1NA7A 4I3ZA 1IR3A 3DJ7A 3ZO4A 2SRCA 3P78A 4RQVA 1PY5A 4R3RA 3R7OA 5M56A 3UOHA 4S30A 3QKLA 3ZZWA 5IEVA 2F2CB 5HOAA 3TNPC 4BFMA 4M3QA 2GNHA 3DA6A 3H9RA 4C34A 5AP0A 5KUPA 3IQ7A 3DOGA 3NAXA 4Y85A 4FR4A 2J6MA 2R5TA 3QQGA 1XWSA 4X2JA 3KN5A 5AX3A 5EYCA 1H24A 2O8YA 3IONA 5IUGA 4BI0A 3FYKX 1J3HA 2B54A 4YMJA 4ZY6A 5L2QA 3DKGA 3DK7A 2OH0E 4ANBA 1URCA 2UV2A 2WTKB 1G8SA 3EQIA 1YHWA 5E1SA 4FG9A 3RJCA 4D4SA 3NYOA 4EWHA 1KV1A 4FKUA 1LR4A 1UU8A 4F1MA 4K18A 5KHWA 2X7FA 4RLLA 4K77A 3NRMA 4AWIA 2XCHA 3ELJA 4QMLA 2WB8A 3LVPA 4XBUA 3CP9A 3OOMA 5AR8A 2GCDA 3RNIA 4DT9A 3RHXA 5I9YA 4X0MA 3KMMA 4A9YA 3QQLA 2G01A 3EMGA 4F08A 4H39A 5IDPA 2BIKB 4RIXA 4D9UA 2PMOX 1OUYA 2I0YA 5AR5A 5IPJA 2HWOA 5DT0A 4FL1A 3DTWA 4IX5A 4KINA 4XV9A 4FV8A 4L01A 5HIBA 3RKBA 2GS2A 1YOMA 2XJ0A 5EOLA 2IVSA 4O84A 5ANIA 1TQIA 4I21A 2XKCA 3Q9ZA 4QP8A 4E4LA 4YSJA 2JDTA 2WTJA 3SRVB 3VS2A 3V5QA 4A9SA 5AP1A 5DG5A 4X3FC 3TN8A 3U6HA 4DCEA 3K2LA 3QALE 3UVPA 4EL9A 1YXXA 3II5A 4EQMA 3N51A 4BCIA 2W1ZA 5IQAA 4C0TA 2G15A 3R8MA 2UZDA 3L9NA 5IUIA 4GCJA 1OIQA 4LUDA 2ZB1A 3NUXA 4KS7A 3V3VA 3KC3A 4Y46A 4WBOA 1W83A 2FVDA 3FLYA 1L8TA 4O7ZA 2J51A 2B53A 2UW5A 5HX6A 4ANQA 5KKRC 4CGAA 4B9DA 2X4FA 4P90A 1O6LA 3DFCB 4AZSA 3D2KA 2DYLA 1OL2A 4ANSA 4KBAA 3AC3A 5JGBA 4XV1A 4AW0A 2QHMA 4DCAA 2P2HA 1E9HA 1A06A 4EH8A 3AQVA 3RHKA 3GCQA 4AX8A 1IEPA 2HENA 2YIWA 3PSCA 2I6LA 1OPJA 2C0TA 3ZEPA 3VULA 5AUZA 2BRNA 3AT3A 3QQKA 3TACA 2QO9A 4AFJA 2JKQA 3BLRA 3PJ1A 3ZXTA 4IC7A 4GS6A 2QKRA 5DNRA 5DPVA 4PPBA 3BV3A 4XJ0A 3IO7A 5FXRA 3MFTA 3DU8A 3CTQA 2QOBA 4IZYA 3F2RA 4LOOA 5GJFA 4GIIA 3SW7A 4GMYA 3SW4A 3N4UA 4GT4A 4CTCA 1O6KA 3DAJA 1SZMA 2Z7SA 5CVHA 4DEIA 1W98A 5AUWA 3O17A 2R3OA 4C37A 2PUPA 5J8IA 3R7VA 1H08A 3EQBA 3D7ZA 4L53A 4OTHA 4TKSA 4C4IA 1B38A 4XG9A 4D9TA 3HA6A 3TI1A 4CQGA 2GTNA 2EWAA 2BALA 2PMIA 2Z7QA 2ITWA 2RFSA 4KSQA 3R21A 3KEXA 4RA4A 5M4UA 4IB0A 4L45A 2O0UA 4Y8DA 3F5PA 3OXZA 4K33A 2W1GA 4BCPA 4M13A 4BZOA 2OO8X 5IU2A 2IVTA 1WCCA 4O0VA 4XG3A 5A6NA 3HECA 4W4VA 1SNUA 3BU6A 2GHLA 2WMSA 3E93A 4PUZA 5G1XA 5GNKA 3BE2A 4PF4A 5L8JA 5FD2A 2YWVA 5JZNA 2PVHA 2GSFA 1BYGA 3IKAA 3OY1A 2FGIA 4GG5A 4XP2A 4D0WA 2JKMA 5C1QB 2QG7A 4E4MA 2I0EA 3K5UA 5A6OA 3RWPA 2XCKA 3IK3A 4H3PA 2W4KA 5CAOA 2EB2A 4P4CA 4YC8A 5B2MA 3A4OX 4UX9A 4RLKA 3GC7A 3U8WA 5J9YA 1H1WA 2EXEA 2WQNA 3ETAA 3NNUA 1ZYCA 3UE4A 4EUTA 4O7WA 4MXYA 4YZBA 3HV6A 2BZHB 5EFQA 2V22A 3UZPA 4BC6A 4BCFA 1OKYA 2W96B 4CMTA 3W18A 5HLWA 3FC1X 3HLLA 4Z3VA 4AT3A 3BYUA 4AZWA 3A99A 3KK9A 3IW6A 4JBOA 4OTDA 4S2ZA 5CAQA 3HAMA 4TY1A 4D1SA 3GI3A 4EOJA 4QP6A 5CAUA 2R3MA 3B8RA 4JRVA 3UYTA 2WTWA 4QP2A 3R22A 5LVOA 4IVBA 1QPEA 5H3QA 4FEVA 4HGSA 4KBCA 5HTIA 3C0GA 3A7HA 4EH5A 4PL5A 5IMXA 1W84A 4AW5A 3QZHA 3TJCA 5E7RA 3QXPA 5LQFA 5GZ8A 4F70A 1WBWA 2CN8A 2YA9A 2ZM4A 4FSWA 4O6LA 2WMRA 3I7BA 4QMTA 4IAZA 3E3PA 4OTGA 3EN7A 2G1TA 4FUYA 4BRXA 5TKDA 3RPRA 4TL0A 3QYZA 2QOFA 1PXJA 3KMUA 4I23A 4CVAA 4XEYA 3AC8A 3VF8A 1NVSA 4ZTRA 3ACKA 3KXMA 4DGGA 1VYZA 4JR3A 2VWVA 4FKRA 5LVMA 5BVKA 4FV5A 4IQ6A 3UVQA 5IEYA 3FI8A 4MXCA 4AGWA 3EQPA 2VTOA 3C4XA 3MIYA 4IAFA 4UV0A 5LOHA 5M53A 3UBDA 4E5BA 2FUMA 3R7EA 1E1VA 2ETMA 3FZTA 3KGAA 4EQCA 5A4EA 4PMPA 1OB3A 4GYIA 4KD1A 1NVRA 4FVQA 5G6VA 1SYKA 2IWIA 2ETKA 4MEDA 3SG9A 3TUDA 3R7GA 4NYEA 5HBEA 3KY2A 5HG9A 5FWKK 4IJPA 4CEGA 1JPAA 3CC6A 3CKWA 4O81A 4DFUA 3CQUA 2ESMA 3E92A 3EFJA 3EQGA 4QMOA 1H1QA 4ZIMA 3VRYA 1JKSA 4LL5A 3HDNA 4MWIA 4W4XA 3V8WA 3ZUTA 5ITAA 4I24A 1IG1A 4IBMA 4JBVA 2NRUA 3ZM9A 3QWJA 5TR6A 3LIJA 4UWBA 2UZBA 4RC2A 4Q9ZA 4I6BA 5IQGA 3HMMA 5AWMA 3HRBA 1JWHA 3N4TA 5EM5A 3FE3A 4OAVB 5ANDA 3O0GA 4BDEA 4C2WA 4BY9E 1CKIA 5E8TA 3FPMA 3M2WA 3D94A 5DT3A 4BCJA 2XNBA 2PZYA 4ASXA 2ZYBA 5EKNA 3WF9A 4AOIA 5IKWA 4DLIA 2PE2A 2CKOA 3KXXA 1M17A 4YPSA 4DG0E 2DQ7X 3QGWA 5D12A 3EL8A 1PMUA 4L46A 4ZSGA 3ZUUA 4DEAA 4BWKA 5HNBA 2BRMA 2F49A 1IAJA 3CPCA 4LYNA 4NIFA 5FUTA 2XNGA 4XP0A 2IJMA 1JKTA 3A8WA 4TW9A 2PL0A 3VN9A 3SXSA 4F0GA 4EHZA 1QMZA 2BTRA 3Q4ZA 3UOLA 4GJ3A 1H26A 4FVPA 2ITZA 4D28A 4F63A 3QZGA 4CKRA 3F2AA 2HELA 4M0YA 4ZY5A 4FKGA 3R7YA 4R5YA 1PXNA 2Q0NA 2WMVA 2VX3A 4FA2A 4Y5HA 5JKGA 4DBXA 3KFAA 5IMEA 3REPA 3F66A 3ORLA 3L9PA 4WG3A 2XEZA 1JKKA 3EFKA 4HYHA 3VUKA 3O50A 3FWQA 1B39A 2W7XA 3TV6A 4PX6A 3I6UA 4GH2A 3WYXA 3R7IA 3R01A 2X8EA 4MCVA 3OT8A 3OW3A 2BAJA 4K6ZA 4PV0A 4A4XA 2UZUE 2Y6OA 3Q6WA 4DTKA 3V5PA 3P7AA 5LMKA 4EOOA 3MPTA 4GT3A 3I7CA 2DS1A 4BKYA 2XIXA 5FM3A 2NP8A 4MKCA 3E8CA 4ENXA 1YQJA 2QG5A 3BEAA 3Q9WA 3F5GA 5JSMA 2WFYA 3HA8A 3PXFA 4IE9A 4YJTA 3BLQA 5I9UA 3FC2A 2YDKA 3VUGA 2XIRA 4HW7A 4RT7A 1ND4A 5IA2A 2V62A 4FV6A 2ITYA 3C51A 1R78A 3FMKA 3KRJA 3WZDA 4GKHA 2CPKE 3F61A 4RMZA 4ZOGA 1GJOA 4FTOA 4H1MA 3NVKI 3QQUA 4PTEA 1KE9A 3KB7A 2VTTA 4JAIA 4OBQA 4RWIA 4EBWA 3S00A 3MV5A 3D5WA 5ETAA 3UPZA 2C6LA 3V04A 4FT3A 1Q8TA 4G34A 4NTTA 2ONLC 4XBRA 4XOYA 4L00A 4O82A 5CSPA 2C6EA 1PXKA 3EH9A 2R2PA 4E6DA 1ZYLA 5I9XA 5CF5A 4RWKA 5E8ZA 5E8UA 4U42A 3ZSGA 5J7BA 5BMSA 5IQEA 4R5SA 3AD4A 3GP0A 5LCKA 4YHJA 2WQMA 3QD3A 4AGUA 2YHVA 1ZMWA 3TTIA 3ZU7A 3SVVA 5CENA 3ZO3A 3D5XA 4JG6A 3FZSA 5C03A 2QCSA 3BYVA 1FVRA 2VTHA 4Y5QA 4FZDB 4I22A 5HGIA 3QCSA 2EVAA 1K9AA 4XNEA 5E90A 5AP6A 4NKAA 1OBDA 4WHZA 5FM2A 4C38A 3KXNA 3VS0A 4NW5A 1ZLTA 4EZ3A 5A46A 4HZRA 1Z5MA 5HHWA 5FXSA 3MB7A 4IADA 3C13A 2F7EE 3F3WA 4GU9A 2C69A 2PZPA 4S34A 2YM5A 4XUFA 3ZMMA 3ZRKA 2W1DA 3A4PA 3QLFA 2WOUA 3MB6A 1Q3DA 1URWA 4Q5HA 5EG3A 4TXCA 5AP4A 2J4ZA 3FMHA 3JY9A 3QKMA 5AV1A 3UTOA 2PMLX 3O8UA 1P4FA 3VS7A 4DFXE 2PZ5A 4UALA 1PXPA 2OZAB 3WILA 4YJOA 4I5PA 4G1WA 5BUIA 3GVUA 2VAGA 4YLLA 5AR2A 2VTAA 4E6CA 4BDCA 2BZJA 3OTUA 3PIZA 1JOWB 3DXNA 1RDQE 3UPXA 3KA0A 1FQ1B 2C6IA 3Q9YA 3HMPA 3TM0A 2JFMA 4E7WA 2JEDA 5LARA 3M1SA 3ZBXA 3ZC5A 3W2SA 2C5NA 5AUYA 4RX5A 1FGKA 4EK3A 3HP5A 4BL1A 1G8AA 4RPVA 3H0YA 4O91A 3TCPA 2OFUA 4ZSEA 3VIDA 2H96A 2VWZA 3COMA 2EUFB 2R3RA 4D2WA 4O0UA 3IOPA 2WU6A 4FGRA 2WTIA 3LFBA 1REJA 3DKFA 5F9EA 4GVAA 4FL3A 3RAIA 2C6KA 5AAGA 3PVWA 1APME 2HZNA 4IAIA 4J53A 5CT0A 3QL8A 2E9PA 4L7FA 1S9JA 4O0WA 1LUFA 3QQJA 5KMLA 3OXTA 3F7WA 4CYJA 5E8WA 3DKCA 5I9WA 3UNKA 4NFMA 3Q3BA 4XMOA 4AU8A 2HXLA 2BCJA 3UO6A 2R3QA 4AE9A 1U54B 4BDFA 2BZKB 3NIEA 2I0VA 3HMNA 3DXQA 2YCRA 3RZFA 2QOKA 4E5WA 4FKVA 4MF0A 2Y4PA 2YIRA 4FIHA 1OBGA 4H05A 3QCYA 3GBZA 3NYXA 5LWNA 3CEKA 4CMUA 4FNWA 5LMBA 2B9HA 4GL9A 2C47A 3QHWA 3A7JA 4QYGA 4RZWA 4QQJA 2QHNA 4UWYA 2YDJA 5JQ5A 3JUHA 5HVYA 5A4LA 2X81A 5HE1A 1EH4A 4FKLA 2PUIA 3HMIA 1UA2A 3E87A 2YM7A 1WFCA 4QMWA 1HCLA 5CZIA 3LE6A 2BTSA 4MNEB 4ZTHA 3RPOA 4JVGA 2B1PA 4JX3A 1ZOHA 2C4GA 5FDXA 4WRSA 3RWQA 5IA3A 3LCTA 3HV5A 1MQ4A 4TYGA 5CYIA 4Y83A 4UMUA 4Z16A 3UVRA 4OUCA 4IWOA 2ZVAA 4C3FA 2OZOA 4RIYA 3ZFXA 2VUWA 5EOBA 3OXIA 3KN6A 4EH9A 3R7UA 2PVNA 4ZJIA 1O6YA 2ZJWA 3QCQA 4PTCA 4NU1A 3UC4A 4W8DA 4O7NA 1B6CB 2WHBA 3CSVA 4G5PA 4FUXA 5CTPA 3AMYA 3F9NA 5J95A 2X1NA 3O8PA 5EM6A 5LCJA 4ORKA 3W8QA 2UZEA 4EONA 3OWKA 4DEGA 3OOGA 4C62A 3CY2A 4GK4A 4X2KA 4IDTA 2GNFA 2C6MA 1V1KA 2OXXA 2ITVA 4WKQA 3QA8A 3QXOA 3AT2A 2H9VA 5DR9A 4DINA 5HKMA 1SNXA 4DEBA 1MRVA 3NYVA 5CSVA 3EN5A 4B8MA 4UMPA 4QPMA 1YWRA 4WBBB 1Y6BA 3UZRA 3OC1A 3P1AA 5EW9A 4WT6A 4D55A 5HQ0A 3EYGA 3ZHPC 3R1YA 5HBJA 4XCUA 4X3FB 5IEXA 3M42A 4JG7A 2A4LA 5GINE 5IDNA 2J7TA 2GDOA 2HXQA 3ODZX 4GEOA 5D7VA 2FO0A 4BTMA 4KSPA 5E4HA 4NIFB 1YI6A 4LGHA 4M97A 4FV4A 1P4OA 3HUBA 3LFSA 4R3CA 4BDHA 5J79A 2VNYA 3TKHA 5L6WL 3PDTA 2WGJA 3E7VA 4L52A 2QOIA 4BF2A 1U46A 3GOKA 5AP7A 5KKRB 4UWCA 5AR3A 3R8PA 4NKSA 2BRBA 1FMOE 3G9LX 2VN9A 3IDPA 4FL2A 5BVEA 4K0YA 3I4BA 2XRWA 3ID6C 4QMYA 1W7HA 2RFDA 1OL6A 3VS4A 4J97A 5IQHA 4V05A 2HIWA 2RF9A 3P7BA 4R3PA 5CS6A 4FKWA 4UBAA 4DFLA 3O7LD 2GHMA 4ERKA 5AAEA 1DI9A 4MD8E 5JT2A 2C5XA 3MBLA 2CJMA 4OT5A 4NL0A 1J91A 2R3KA 3PRFA 3ZC6A 5CAVA 2W99B 3HV4A 3ORTA 4L7SA 4HOKA 1DAYA 1W0XC 2Y6MA 4KA3A 5A4QA 4LG4A 4PP7A 4RWJA 4D2VA 3SKCA 4C4FA 4FK6A 3FXZA 1JBPE 4F64A 3EQDA 4DH7A 3DJ6A 3OTVA 3L1SA 3ZFMA 5HG5A 4BBFA 1WBPA 2XKDA 3F82A 3IDBA 3ORZA 3LFNA 4AZTA 3Q32A 5L8KA 1NW1A 4YLKA 2W4JA 4RFMA 3UYSA 1XBBA 1JLUE 4C35A 1BL6A 4LGDA 4FV3A 2FSLX 5D11A 3H9FA 1FGIA 1U5RA 4QTDA 2OJFE 2UVZA 4YJSA 5D41A 2OGVA 3ZCLA 2W06A 4G3DA 3WZKA 4XLVA 3PLAE 2I1MA 3IW5A 3MH3A 4OTFA 4O2PA 3AMAA 1P14A 2CGWA 1I44A 3NW7A 4I0SA 4QQ5A 3BYMA 3RGFA 5DE2A 3IDCA 3SLSA 4JL9A 2YN8A 1F5QA 1Y91A 2QU5A 1CDKA 2P55A 4AACA 3BYOA 3GU6A 4F9CA 3AGLA 3OW4A 5AFVA 5KBRA 3RK5A 3OROA 3HEGA 1XR1A 4KB8A 3C5IA 2PTKA 3D7TB 3HRCA 3BELA 4UZDA 2RG6A 2VV9A 4BYIA 5M51A 3LLAA 3OEFX 2B55A 4MD9E 5JQ8A 4QOXA 2A1AB 2JDSA 1Q62A 2C5OA 4F1OA 3CXWA 4W9XA 5HIDA 2UZOA 4U0IA 4YZNA 2G9XA 4I0TA 4J95A 4C7TA 5A4CA 4UYNA 4F6WA 5ACBC 3GGFA 5T3QA 2ZMDA 5DH3A 3KVWA 3QUDA 1OM1A 4TTHB 3BGPA 3U4UA 3F5XA 2GNLA 2YCSA 3OY3A 3LFAA 3DY7A 4JAJA 4E20A 3K5VA 3MA3A 5TF9A 3QTIA 4PPCA 1PXLA 5E8YA 3U54A 1H27A 4MD7E 3TTJA 2RFEA 2VO7A 4B4LA 3DJ5A 3NUUA 3ZM4A 2WMQA 4FBXA 4A9UA 5C8MA 4PDOA 3ZLXA 3S0OA 4BTKA 3HKOA 2QOQA 5EKOA 3R00A 3R2BA 3TG1A 4O1PA 4BIEA 3ZTXA 4R7IA 3ZYAA 4EYMA 3NUNA 4GV1A 4MHAA 5CVFA 3R73A 3GQIA 5EDQA 2GFCA 3RM6A 4BZNA 3A62A 3SAYA 3DDPA 1WBVA 2E2BA 2VTNA 1XBCA 3PIYA 4DGOA 1V0PA 5KMNA 3RNYA 3LKMA 2XNOA 2NO3A 4FYOA 4A9RA 3GU7A 3CJFA 4FV9A 3E3BX 4DFZE 4DN5A 1YOLA 4YC6A 5J7HA 2GNGA 4J1RA 5IH5A 3F88A 4NTSA 5GIOE 4TYHA 3TZ8A 4D58A 3FQSA 4M68A 2WZJA 3HZTA 5EYDA 3UQCA 3HAVA 1G3NA 3FDNA 3QQFA 2ZV7A 3GFWA 3H0ZA 4DLJA 5AV2A 3E8NA 4ZLYA 3Q2MA 3GT8A 2H6DA 5H8GA 1OIRA 3K3JA 4JRNA 4FKPA 3PZHA 4IX6A 4J7BA 5HG8A 5AAFA 4OBPA 4Q2AA 4K2RA 4Z55A 2CNUA 2X39A 3ORMA 5T68A 3IW8A 3LFQA 5CI6A 1DAWA 4KKEA 4YTFA 4IANA 1XBAA 1CSNA 4TWOA 1WVWA 1JSUA 2ZM1A 3ENHA 5FP5A 4EBVA 5BYZA 5C9CA 2BHEA 1BKXA 3LM0A 5JRSA 3WZEA 4I5CA 5CU2A 4BDGA 4YU2A 2WMWA 1VZOA 3G51A 4HPUE 1OITA 1OL1A 3BBTB 4ASEA 5HI2A 3P79A 3NR9A 2OFVA 3QX2A 5AV3A 2BPMA 3I0OA 4L8MA 4O7RA 4G2FA 4BCOA 3TDVA 1YI3A 4LV8A 2C5VA 1YRPA 1MP8A 3OS3A 3E7OA 3EJ1A 2WD1A 4MBJA 5AA9A 1H4LA 4ITJA 2YJRA 1QPJA 2YISA 3JXWA 2OBJA 2PMNX 4U3YA 3UC3A 2QLUA 3PY0A 4G6LA 1IA9A 2WIPA 4AZFA 1AQ1A 2Q83A 2WELA 3TUCA 3RK9A 1UU3A 4C3RA 4JJRA 4FEXA 3IECA 4ALUA 4EC8A 2VWXA 4TYIA 4BBEA 2P33A 2BRHA 2OJIA 1ZY4A 3AOXA 3QUPA 5HNIX 4C33A 4QYEA 4FMQA 2X2KA 4DTBA 2V0DA 2E9NA 2IW9A 5AV4A 3DGKA 4LI5A 5LMKC 1Q4LA 2A0CX 2ITOA 3BHHA 4TNDA 1R0EA 3PYYA 2OF2A 1FPUA 2NPQA 2QOLA 3PY3A 1K3AA 5HVJA 1Y57A 3BU5A 1OPLA 3PJCA 4FTKA 4YTIA 4KKHA 3SOCA 4DYMA 4C4JA 4MXAA 3LCDA 1WMKA 4A4LA 4F6UA 1Y6AA 3PXQA 2XA4A 4FTCA 4WSYA 4CFVA 4PWNA 3UG2A 3KRLA 1H1PA 2QKWB 4YJUA 4CFNA 2UVYA 3LMGA 5CSWA 4JT3A 4JLCA 4ACCA 5BX0A 4FNZA 4BCNA 5AP5A 3BWJA 4OTIA 5JFWA 3GC8A 3FEGA 3UQGA 5EQPA 4F7SA 5D10A 3ZH8A 3BKBA 4AA4A 2JDVA 1UKIA 4CT2A 3BX5A 3FXXA 3FV8A 4NM7A 3SG8A 4ANOA 2IW8A 2YZLA 4F1TA 4FT7A 4ZJJA 5D9HA 3UOJA 4TZRA 4USDA 5I3OA 4KIPA 3UP7A 3G6HA 3ZO2A 1G5SA 3DQWA 5K9IA 1T45A 3FUPA 3O7LB 4GT5A 3ORXA 4EKKA 4O7YA 3BLHA 4RVLA 3GNIB 4I6FA 4CV9A 4E5AX 2HOGA 3FJQE 1J7UA 4UMTA 5JRQA 5FXQA 4J8NA 3HV3A 4QYHA 2VD5A 4DH8A 4IIRA 4AT4A 5JFXA 4WUNA 5HVKA 5HIEA 2OKRA 1RQQA 3OMVA 4Y72A 3FSFA 5AR4A 4U44A 3NSZA 4TRLA 4L44A 2VO3A 3V5WA 3W10A 3QTRA 4FSUA 3VBTA 4E4XA 3EN4A 4HVHA 2Q0BA 3LJ0A 4YR8A 4FKTA 2JC6A 2CDZA 2IZTA 4M15A 2PHKA 3LJ2A 2AUHA 4ZZMA 3B8QA 1YI4A 4ZTSA 1KV2A 4A4OA 1CMKE 3QBNA 5HICA 4EUUA 4L42A 5C8KA 4BTFA 4N0SA 2A27A 2YERA 2XB7A 5FEDA 4BKZA 4C3PA 4QMQA 5IQBA 4FNXA 2R3JA 5ANOA 4CFXA 4OT6A 1OUKA 2PVKA 5DI1A 3G2FA 5CEIA 2QNJA 5M07A 3GENA 1Q8ZA 5JEBA 4L9IA 1SM2A 2XK4A 3VS3A 2Y7JA 4NEUA 2ZM3A 1FINA 5KZIA 3UIBA 3MVMA 3PPKA 4A06A 3NMUF 3EFWA 3RPYA 4FTMA 4JQEA 4N6YA 4WOVA 3NDMA 3R9RA 5C4LA 3BU3A 1SVGA 5DWRA 3QD0A 3PP0A 2JIIA 4Z9LA 1IAHA 4EOPA 1AGWA 4MXZA 5FLFA 2VGOA 3G6GA 1FVTA 1KWPA 1ZRZA 3E63A 2EB3A 3OEZA 3IGGA 5JZJA 5M57A 4OTQA 4HCUA 3D5UA 4MTAA 3TZMA 4X2NA 1GZOA 4QP3A 3ALOA 5C01A 1GIHA 1YWVA 5L6PA 3P9JA 4JNWA 3BYSA 3BV2A 2GPHA 5IUHA 3QAME 4USEA 3PLSA 3UZTA 3BHYA 4O21A 5L6OA 4ZEGA 3KULA 3NVMB 3R28A 4LFIA 4FTIA 4QMZA 2J50A 5JFSA 4YURA 4FSZA 4G9RA 2OXYA 4G6NA 2FYSA 5AP3A 3AXWA 2UW6A 5EHLA 2XK6A 5J5TA 2UW7A 2WO6A 4E1ZA 3SGCA 4C36A 1UNLA 5EH0A 4CLJA 4YHTA 3VHEA 4E8AA 4R1VA 3NCZA 1NVQA 2JLDA 3OCGA 2OG8A 5B0XA 4HVIA 3NX8A 5HO6A 3LFFA 3OZ6A 3FSKA 4NFNA 1QCFA 4YZ9A 4PMSA 3LLTA 3VJOA 4M69A 5HCZA 5EM8A 4P7EA 3TV4A 4CTBA 3TZ9A 4AZEA 2VX1A 3HMOA 1UWHA 4CSVA 4WO5A 2HYYA 1CTPE 2YM6A 2QU6A 3MI9A 1BI8A 2UW3A 4OBOA 3MFRA 4IWPA 5I9VA 5AIRA 1PW2A 3LXLA 4CZTA 3FLWA 5HU3A 2R3LA 3L9MA 4DEDA 1YW2A 3Q52A 4O96A 3AG9A 2X8IA 4O27B 4L43A 4BI2A 3IGOA 4YTCA 5KMOA 4RRVA 5M44A 1I09A 3FY0A 4G3FA 5I4NA 4TNBA 4YP8A 4BN1A 3IPHA 4X2GA 1YXSA 4RIXB 2WMXA 4KABA 1JKLA 4F9WA 5BVOA 2F9GA 2J0JA 4D4VA 4QD6A 3QQHA 3RPVA 4F6SA 5CANA 5CXHA 2PUUA 3EN6A 2W5BA 3RVGA 4HCVA 4ZSLA 2C3KA 4RJ7A 3MN3A 3VUDA 1UNHA 3KRWA 4LMNA 2WTVA 2X7OA 3TKIA 3GCSA 5TO8A 4ZLZA 4D5HA 1TQPA 2H34A 2RGPA 3CJGA 3HV7A 4CNHA 4AZVA 5EQEA 3ANQA 5IA5A 4DHFA 4FE2A 2C6OA 3FLQA 4BTJA 3DZOA 3UIXA 4K11A 2Z7RA 3ZDUA 4UYAA 4FTTA 3L8PA 3PVGA 2GHGA 2QR7A 3NUSA 2X8DA 3QCXA 4G3GA 3VBWA 4LL0A 3D5VA 2HW7A 4E93A 5BUEA 4FEUA 1DI8A 5A3XA 2E9VA 4U9AA 2UW8A 4GUBA 3U6IA 2QOOA 2OIBA 2J0LA 3DB8A 4M66A 5AUVA 5LVLA 1P2AA 2CKQA 2BDJA 1YWNA 5HE2A 2C0IA 4MXXA 1KSWA 2CGVA 5E8VA 3BWFA 3OVVA 4AP7A 3E5AA 3I0QA 2J90A 3V51A 2YZAA
chains in the Genus database with same CATH superfamily
3HUCA 1J1CA 4KNBA 4WG4A 2QR8A 4F78A 3A8XA 4YZCA 3MVJA 5EM7A 4P5QA 3S95A 2HY81 4KKGA 3RTPA 3W33A 4F7LA 4FODA 3PA5A 4FV7A 3NUYA 4GRBA 3RAKA 4TT7A 2AC5A 1LEWA 2QLQA 2CKEA 5GIPE 4PMMA 2YM3A 2UZNA 4DF3A 2BIYA 3FZOA 4FSQA 3QZFA 1ZOGA 3AC2A 4RIWA 3LCOA 4O22A 3W16A 2VGPA 3PUPA 5CEOA 3FPQA 1OGYA 4GUEA 4U7ZA 3LQ3A 2XAMA 3EOCA 3LHJA 3D83A 4X6RA 3KXGA 4YSMA 5EDRA 1CKJA 3THBA 3TL8A 3U55A 4ANMA 2CLQA 3VW8A 2R3PA 5DRDA 4ANLA 3WF7A 3NIZA 3MY5A 2HK5A 4P5ZA 2P2IA 3ZUVA 4AOTA 2X9EA 1OGUA 3W1FA 2XNEA 2ERZE 2BZIB 2VWBA 3DK3A 4FSRA 3PRIA 4EI4A 3TDWA 3F5UA 5GJDA 4FKQA 1XH9A 4J98A 3L8SA 3QF9A 5HCYA 4MQ2A 3NGAA 4F65A 5HO8A 3DBEA 3WE4A 3DBCA 2REIA 3VQHA 3LPBA 1GZNA 5EYMA 3W8LA 4R7BA 2A2AA 4YUQA 4IH8A 5B2LA 4IM3A 3EFLA 1F3MC 3Q96A 4U40A 3A7FA 4X21A 3PSBA 3QWKA 2UW4A 3RI1A 4ACHA 4O0RA 4DGNA 3MESA 3MVLA 3VUHA 4DEHA 3ATTA 4FVRA 2O65A 3EIDA 1E1XA 3FMMA 4IZ5A 4YHFA 3VO3A 4BBMA 4F99A 1PXIA 5CSHA 5JGDA 4BYJA 2PWLA 4NJ3A 3RZBA 2QVSE 3WOWA 3TNQB 1AD5A 1PXOA 4HYUA 4JOAA 2HZIA 5AA8A 2IG7A 4XS2A 2VWYA 2J5EA 3DBFA 3PXRA 4IZAA 1UNGA 3BHUA 4BI1A 4E6QA 4ERWA 5CF6A 4G3EA 3BL7A 5LJJA 3TYKA 4EORA 4L3LA 2XZSA 4KIKA 2XMYA 2PY3A 3O51A 4D0XA 4O7LA 5M4CA 5TE0A 2YFXA 3DB6A 3PVUA 5CWZA 5DYJA 3NUPA 3QZIA 3FL5A 2XVDA 4WNMA 4ACGA 4BWXA 1PMEA 2O63A 4EKLA 3LMIA 1KOAA 3BHVA 4I4EA 4QYYA 5DT4A 2VTQA 4O0XA 1K2PA 3P7CA 4QTBA 5H8EA 1ZOEA 3EQCA 5AM6A 2C3IB 5ANGA 3C4WA 5CSXA 1KE6A 3HGKA 4XG6A 4J99A 4ZAUA 5KE0A 2GU8A 3SXRA 4K9YA 3KL8A 5JN2A 4EJ7A 5F95A 2PVMA 3COKA 5M4IA 1REKA 2AQXA 5GZAA 3MTLA 4XV3A 5BNJA 4PTGA 3ITZA 2JIUA 2NRYA 2V5QA 4CZYB 5ANEA 2BDFA 4WA9A 1DM2A 3FXWA 4ZTMA 3UO4A 1XH4A 2O3PA 4GSBA 4AF3A 4E73A 4RVTA 4U3ZA 1ZY5A 1OECA 3TT0A 4F09A 3MGYA 4F7JA 2IZRA 3QKKA 1IRKA 3QRJA 2W0JA 3R1QA 3WE8A 3WZJA 3RAWA 5FTQA 3QHRA 4RX7A 3T8OA 1WAKA 3VHKA 5BVWA 1OKWA 2W1FA 4RIOA 4F0IA 3CCNA 5BQ0A 2WMTA 4IX4A 4YBKA 2W1HA 4O86A 3H30A 2JKOA 3G5DA 1P5EA 3G90X 5TT7A 4AAAA 5KMKA 3BIZA 5ACKA 5I3RA 3OWPA 4HNFA 4I92A 3WF6A 2GQSA 3CY3A 2X4ZA 2XH5A 4RGJA 3UDZA 5AR7A 2WQEA 2XNNA 3R1SA 4YZDA 4ARKA 3KULB 2XRUA 3QUEA 4FKOA 4MNFA 3NS9A 4ASZA 2CCHA 4PPAA 4U41A 3ZO1A 3F3TA 3SOAA 2CMWA 3EZVA 2BDWA 4DG3E 4RJ5A 3TJDA 3MH0A 4FYNA 4CFWA 2CNQA 4D2RA 4JDKA 3R8VA 2IW6A 3SRVA 1H25A 4K1BA 3RINA 2BAKA 3BRBA 4QTCA 3W0MA 2GS6A 4BHNA 1OL5A 2XK3A 4QNAA 4FNYA 3W2RA 2RFNA 4KRCA 5BYLA 4S32A 4HVSA 4ZSAA 3Q60A 5KX8A 1UV5A 3LFEA 5DIAA 3FLZA 4LOQA 1OPKA 3G0FA 3KRRA 5CQWA 5DN3A 3PZEA 3B2WA 4V04A 4JXFA 4FOBA 3ZRMA 2J9MA 4O6EA 4EOLA 4F7NA 4A07A 3R9DA 4O0YA 4YJVA 5JH6A 4IDVA 4C4HA 1H0WA 3Q4TA 2X2LA 2IVVA 2VTMA 3SD0A 3WZUA 4AGDA 5CVGA 5M4FA 3D4QA 4V0GA 4JIKA 3W2PA 4DH1A 2WEVA 1NXKA 4CXAA 1V0BA 4QPAA 4UY9A 5CU4A 2XJ2A 4DG2E 3KVXA 4D4RA 3VS5A 2J2IB 5FEEA 5FTOA 3UG1A 2IF8A 5IQIA 1LEZA 1TFFA 5K3YA 2R3HA 4EWQA 3V8TA 4EOQA 5K4JA 3EWHA 3CTJA 2JFLA 2YIQA 3DNDA 4H3BA 1PXMA 4HPTE 3T9TA 3GCUA 3LMHA 3NUAA 4WNPA 5FRIA 1OVEA 3NPCA 2OI4X 4IAKA 3UMXA 3N4VA 5BV3A 4IACA 4PY1A 3P4KA 1WBNA 4AQCA 4IWQA 2XNMA 3FMLA 3BQRA 4MQ1A 2XYNA 2W1EA 4MX9A 2HY0A 4RWLA 1V0OA 3V5LA 4YLJA 4O7VA 2QOCA 4FEWA 4AG8A 3FZPA 1YXTA 4RC3A 2NNWB 2V7AA 1H8FA 3DK6A 4FEQA 1Q99A 1QPCA 3QU0A 4YJQA 3U9CA 2BFYA 2QI8A 2JIVA 3KKVA 3V5JA 3QTQA 4N4SA 2WU7A 5D1JA 3KXHA 1U5QA 2R3IA 4KIQA 1YDSE 5E92A 3OP5A 3MFSA 2UW9A 3EKNA 3ULIA 1PF8A 3IW4A 3KU2A 4RJ8A 4YNEA 3W55A 4OW8A 2QONA 2VTLA 3TIZA 4G6OA 3GU5A 3Q53A 2CN5A 2ERKA 2B9JA 5CX9A 4TYEA 4EZ7A 3NW6A 4F9BA 4XG2A 3MYGA 5L3AA 2YWPA 5IH6A 5A54A 3E88A 3F3ZA 3R30A 2YLFA 4FTUA 3V5TA 3W32A 4AXAA 4DH3A 5FG8A 3U87A 4EK6A 5B2KA 1M7NA 3DNEA 3LXPA 4R8QA 4XH6A 5LXMA 3CS9A 3PTGA 5E8SA 5IH4A 4A7CA 1CM8A 4LOPA 2BFXA 2ITTA 4D1ZA 2G2IA 2QODA 2F7XE 5AEPA 2Z02A 2YABA 3FHRA 4MH7A 3MVHA 1XH5A 3TZ7A 4BDIA 4ENYA 4BHZA 3OUNB 4QP4A 2GMXA 3AT4A 3DAKA 4RJ4A 3R0TA 4EH7A 4XLIA 2R3NA 1R1WA 5LVNA 3LOKA 2UZLA 4IFGA 1ZMUA 2QO7A 5ETFA 2UVXA 3BEGA 4RIWB 1RJBA 4IHPA 5HNGA 2XANA 2R7IA 3CGFA 1Y8YA 3TWJA 3UQFA 3CE3A 4LM5A 3EHAA 1X8BA 3PG1A 4J71A 1KE5A 1BX6A 2JBPA 2P4IA 2OSCA 2WQBA 4MXOA 3VUMA 5KO1A 4DA5A 2IVUA 3I1AA 3RCJA 2ZAZA 3BQCA 2WEIA 3R8ZA 4ZS4A 2CSNA 4FTNA 5HD4A 2XIKA 4AW1A 2BMCA 2IN6A 4QMNA 3QD2B 4G9CA 4OLIA 4WD5A 4BICA 2ITNA 3JR1A 3D0EA 1SMHA 4BCKA 4O2ZA 1O9UA 2PE0A 5CEMA 4EC9A 4WG5A 2VTIA 3ROYA 4D1XA 2QO2A 3PJ3A 2XALA 5M08A 2EU9A 3O8TA 3OT3A 4JDHA 1M14A 2X6DA 4JQ7A 3MS9A 4CZUA 1CKPA 5GJGA 5BPYA 1XH6A 4AA0A 3B2TA 4LRMA 4BR3A 3A2CA 4X3JA 5EI6A 3KIOC 4QDVA 3ZZEA 4R77A 2OJGA 2BHHA 1ZZ2A 4FIEA 5DEYA 4FKJA 1KE8A 2XP2A 2R0UA 4MWHA 5DLSA 3HDMA 3W2QA 2VU3A 2OLCA 1H07A 3KXZA 5FQDC 1Q41A 2DUVA 2BVAA 4X7QA 4NCTA 3HP2A 3OWJA 2X0OA 4L68A 3CR0A 2GNJA 5CQUA 3EKKA 5H8BA 4ASDA 3UDSA 2J5FA 1J1BA 5E1EA 4FZAB 2AEGA 5HCXA 4I0RA 3JVRA 3H10A 3QYWA 5BMMA 5BVDA 3U51A 2JITA 3NEWA 5CAPA 3SX9A 4BDKA 1H1RA 4QMXA 1PYXA 4QRCA 4FTLA 3PWDA 4L3JA 2WAJA 2CNVA 3KRXA 2VWUA 4F9YA 3VS1A 5BYYA 2IZUA 3A60A 3LW0A 3RCDA 4FG8A 4XYFA 2ZV2A 3MY1A 1GOLA 1PKDA 5AX9A 3UMWA 5K5XA 3G0EA 5CU6A 4K8AA 4JG8A 5H2UA 3Q9XA 3RK7A 4CMOA 4R6VA 2PULA 4YC3A 5L2SA 3RP9A 3ALNA 1IA8A 4NZWB 2RKUA 4ZK5A 3WF5A 1HCKA 1ZZLA 4YJPA 5FGKA 4HVGA 4AQKA 3VS6A 1ZMVA 4MBIA 4APPA 4FV0A 3QA0A 3PE1A 4NH1A 2O5KA 5LWMA 4OGRA 3VWAA 4RJ6A 2FSOX 3D14A 3TIYA 3FMJA 4WUAA 4A9TA 2RG5A 3QRUA 3ZDIA 5ETCA 2E9UA 4C02A 1GIIA 2QQ7A 3H9OA 4NM3A 4BIDA 3SA0A 4FKIA 4B0GA 2ZV8A 4HCTA 4JDJA 4O0TA 1YHVA 4RC4A 5DMZA 5FBOA 3QX4A 4ZZNA 2OIDA 2BILB 1JSTA 2XK8A 5EW8A 3R9OA 2XYUA 5EHYA 1FMKA 1J7LA 4NW6A 4PMTA 2Z8CA 3R02A 4RX8A 4IC8A 1XJDA 2DWBA 2OW3A 3PJ2A 1WZYA 3OD6X 4RIYB 4QQTA 3ZEWA 5IQCA 2C68A 3ZXZA 4EH6A 4KS8A 4XX9A 2PZRA 4JBPA 5F1ZA 4FZ6A 2VO6A 1PJKA 2CGXA 5DOSA 5HX8A 2Y4IC 1VEBA 3CKXA 4G5JA 4HNIA 3UIUA 3C0HA 3WIKA 3PIXA 5DHJA 4PNIA 1NT2A 2X7GA 3W0NA 3MDYA 3NAYA 2GQGA 5AUUA 2B9FA 2VNWA 5K0KA 4ZLOA 4U5JA 4GG7A 4I4FA 1A48A 4JQ8A 5KMIA 3W0SA 4AN2A 1MQBA 4BCQA 1R3CA 3LFDA 4KIOA 3PXYA 3MY0A 3E64A 2R3FA 4ZJVA 3AMBA 4APCA 5L2IA 3GB2A 3W2OA 4R78A 3A7IA 4UMQA 3OG7A 4JDIA 3NNWA 4V0GB 3LM5A 5CNOA 3V6SA 4CKIA 5L2TA 2W5AA 3D15A 3DLSA 2ZOQA 3RPSA 2VTRA 3EB0A 4FT5A 5CZHA 3RM7A 5J87A 4ITIA 4CG8A 4AS0A 5J9LA 4KRDA 4QMMA 1YDTE 3VW6A 4CG9A 4TWCA 5CEQA 4Z7GA 4M8TA 4HGTA 2I40A 4UEUA 4C2VA 2CGUA 2VTPA 3FKOA 4R7HA 3VBXA 2HZ4A 4YJRA 4YZMA 2W9FB 4ACMA 3UJGA 2XJ1A 3E8EA 1Q97A 3A7GA 3DBQA 5HESA 5A4TA 4QP9A 3UO5A 2B52A 2JAMA 3AD5A 2W9ZB 4F0FA 3EL7A 4C57A 5CEPA 1WBSA 4FT9A 4EK5A 3C9WA 3LFCA 4I6LA 3IOKA 4M84A 5GZ9A 4U43A 4D4YA 2PVLA 4EOKA 2G2HA 4IEBA 2ITXA 4G17A 3ZRLA 5IG1A 2HWPA 4FIFA 3AC4A 4RJ3A 4ZZOA 5KCVA 3V8SA 3CBLA 5HEZA 1GIJA 1JSVA 3P5KA 3U9NA 4BIBA 1GZ8A 4ONAA 3LQ8A 4AFEA 5JGAA 4WIHA 4F9AA 3C4CA 2ZFYA 5DBXA 5DR6A 2I7QA 4GKIA 2YCFA 3NLBA 4FSMA 3S1HA 2WTDA 4NK9A 3SDJA 4HGEA 5AP2A 4UMRA 4GFGA 1T46A 4FF8A 4EQUA 4JIAA 4NJDA 2OZAA 2R64A 2KTYA 5CI7A 5HORA 3I6WA 4WRGA 3PA3A 3AC1A 3F7ZA 4FV1A 5C8NA 2WMBA 2WQOA 2OU7A 4BCHA 3Q04A 2PK9A 4D2TA 1WBTA 3DBDA 4QMUA 4D2PA 2B0QA 2OWBA 5TOZA 3T3UA 3BE9A 3FYJX 3FBVA 5CU0A 3VF9A 2YLEA 3PE2A 1Q8UA 3QC4A 4DFBA 4FZFB 5DFPA 4I1ZA 4O0SA 3KK8A 3OBJA 2BR1A 2YDIA 3PVBA 4M0ZA 2JGZA 3WI6A 4ITHA 1Q5KA 1QL6A 2QC6A 4YBJA 5ETIA 4PDSA 5AADA 3ZS5A 1ZYJA 4YNOA 5HLPA 1M2RA 3HNGA 3R71A 2PSQA 4EYJA 5HTBA 4M14A 3OBGA 1U4DA 1XMMA 3VQUA 3GU4A 4OAUC 3HL7A 4I5MA 4QTAA 4ID7A 5CU3A 4BDJA 5L2WA 1Z9XA 3W0PA 3P08A 1IASA 1BLXA 3FAAA 3OFMA 4IB3A 4BCGA 3RALA 3CGOA 4CRSA 3ZSIA 3BBWA 3ZFYA 4TWNA 2VRXA 4BWPA 2FA2A 3GOPA 3M11A 3G9NA 3H4JA 5EI8A 2OK1A 1Q24A 1U54A 4GK3A 4QMSA 2UZTA 2YIYA 3CPBA 5CT7A 4I6HA 4CKJA 2V7OA 3P86A 2RL5A 2GTMA 2W17A 3N9XA 1YOJA 2V55A 2PU8A 1Q8WA 5D7AA 3OUKA 5E9EA 3C4ZA 3NNXA 4DGMA 1WBOA 5K5NA 3Q5ZA 4ACDA 3PJ8A 3O2MA 4ZTQA 2C1AA 3RAHA 4N6ZA 3QRTA 2R4BA 3POZA 3O71A 2G2FA 5EK7A 4O83A 2WTKC 3LXKA 3ET7A 4FIIA 4IX3A 4CFFA 4IAYA 3EQRA 1XQZA 4X6QC 3RMFA 2WIHA 4LV7A 3CIKA 1OMWA 5DRBA 5AM7A 3I79A 2O2UA 3CTHA 3DZQA 4FSNA 4G31A 4IAAA 4G16A 4QMPA 3IS5A 4IZ7A 5KZ0A 1VLRA 1UU9A 3MJ2A 5HLNA 3SXFA 3VBYA 4C4GA 4PDYA 2BAQA 4YTHA 4MNEA 3PPZA 4GFOA 4S31A 4BDDA 5J9ZA 3DXPA 4IM2A 3TXOA 3MPAA 3AKKA 1UU7A 1ZXEA 4JR7A 2Z7LA 3FL4A 4ZSJA 1H1SA 4DGLC 3D9VA 5KMMA 4EOMA 4WNOA 2VWWA 2PZIA 4IWDA 1NY3A 2QURA 2Z60A 3FI4A 4B8LA 5IF1A 3W0OA 4DFNA 2JKKA 4CD0A 5BVNA 4TYHB 3Q2JA 2Z2WA 2C1BA 3R9HA 3VUTA 1SVEA 3PG3A 2FSTX 5M09A 4C59A 5FDPA 4RFYA 5B7VA 2X0PA 4NM5A 4UXLA 2FH9A 3R8UA 4XP3A 4C8BA 3C0IA 4FX3A 1ATPE 4L67A 1STCE 5JK3A 2AYPA 2XBJA 1Y8GA 2W4OA 3GC0A 4DITA 5DA3A 2ZMCA 3ORIA 1H0VA 4I93A 4O38A 1M2PA 4EH4A 3FHIA 3ERKA 3R1NA 1S9IA 2PVFA 4AW2A 4CRLA 2CCIA 5EW3A 4X3FA 2JAVA 2F57A 1YDRE 4O1OA 4W8EA 2HZ0A 4MK0A 3OWLA 3SHEA 4OR5A 3SV0A 3MH1A 4JX7A 2R3GA 3HX4A 4FT0A 4OTPA 1HOWA 4H1JA 4Y95A 4ZS0A 4QPSA 4Q5EA 4D5KA 2Y8OA 3H3CA 4FG7A 2ZDTA 3K3IA 3PPJA 3GXLA 3ZLSA 2WMUA 2OF4A 3E62A 5GHVA 2ETRA 3V01A 2C6DA 3CQEA 4XG8A 4WNKA 3COIA 3WBLA 4IM0A 2B9IA 4II5A 3UIMA 1XKKA 4V01A 2J0KA 2RIOA 4ALVA 1M52A 3LJ1A 3DPKA 4FIJA 4KWPA 5HBHA 2O64A 3PFQA 3TUBA 2OIQA 2PPQA 4J96A 1M7QA 3Q6UA 3QD4A 2VWIA 5J1VA 3DLZA 3L8XA 4BGHA 5KBQA 5HE3A 4DTAA 3UGCA 3MWUA 5F94A 4DAWA 2XBAA 5K0XA 4U45A 4C61A 4RG0A 3WIGA 4B99A 1OIUA 5I5ZA 3NZ0A 5C4KA 1YVJA 5HG7A 2CKPA 3JVSA 4MYGA 4AGCA 2ITPA 1A9UA 1JAMA 2BUJA 3F6XA 3R63A 2LGCA 4U81A 4G3CA 4AE6A 2OH4A 4USFA 5CF8A 1LP4A 3FKNA 3HRFA 3VJNA 5IA1A 4W9WA 5E91A 1R0PA 2XIYA 3I5NA 4DBNA 2J0IA 3ORNA 1W2FA 4AA5A 1XH8A 3R04A 4EOSA 1YXUA 5E8XA 3S2PA 3K54A 4EJNA 4BDAA 2YITA 3DDQA 2FSMX 2PVYA 4YPDA 4E6AA 4ZMFA 4I20A 5AMNA 1GNGA 3I5ZA 4AT5A 3TKUA 3DKOA 3TV7A 1PRYA 2UZWE 3G33A 3EQHA 3VBVA 3ZSHA 5M55A 3DQXA 5IZFA 3OHTA 3COHA 1OKVA 4B7TA 3PUFC 4UZHA 4AUAA 3OCSA 3PWYA 3HYHA 3A61A 4FICA 5T6KA 4KUJA 5DVRA 3QTZA 5ICPA 4EZ5A 3AGMA 1W82A 4IFCA 5AUTA 3LCSA 3R2YA 3BPRA 4BVUA 4GIHA 2HW6A 3LXNA 4FK3A 3ORKA 2HAKA 4AN9A 4FTAA 5ANJA 5AJQA 4HYSA 3NYNA 4QP7A 4PQNA 2GS7A 4EK8A 4ALWA 3V6RA 3ENMA 5HZNA 3JYAA 5EHOA 1H00A 4QMVA 1UWJA 3VUIA 4H58A 1PMVA 2YM8A 4GW8A 5HE0A 3KQ7A 1PHKA 4PNKA 1H28A 3DS6A 3GCVA 3VVHA 3D7TA 4FC0A 4KBKA 4P2KA 4F4PA 4RQKA 2UUEA 3FMEA 2YAAA 4J52A 3S3IA 1TKIA 3U6JA 5K4IA 2VZ6A 4E4NA 3C4FA 5ANKA 3GCPA 3UDBA 4LUEA 3CLYA 3FLNC 4EHEA 4DE4A 3QTUA 5AUXA 1R39A 3CD8A 3ACJA 4BB4A 4LMUA 2PVJA 2R9SA 2F7ZE 3BGZA 3FKLA 3MJ1A 4D2SA 5HD7A 1OZ1A 4QTEA 3L9LA 4FTRA 4EEVA 2X2MA 1G8JA 4CQEA 3OCTA 4MF1A 3BCEA 4I41A 4N57A 3UOKA 4EHVA 4IVCA 1SVHA 3FLSA 3QLGA 2IZSA 3T9IA 2ZB0A 4IVAA 5F4NA 1KUTA 4N70A 2HCKA 4BKJA 3O96A 4IW0A 3KCFA 4I94A 4CCBA 2KULA 3PY1A 1F0QA 1KOBA 2QD9A 1RE8A 4Q9SA 2XKEA 4DT8A 4FOCA 2E9OA 4XG4A 2LAVA 3AC5A 1PKGA 3KF7A 2QOHA 4IVDA 5FP6A 5IQFA 4R1YA 4CV8A 4LQMA 3KMWA 3QTWA 2YM4A 4CT1A 4AN3A 4NCTC 2OJJA 4TPTA 4FI1A 4CCUA 2C5YA 1XO2B 3DCVA 4FTQA 5J1WA 3P23A 3EN9A 4FKSA 4I5HA 3D2IA 4FIGA 2XEYA 4NM0A 4XHKB 4YJNA 2JD5A 4GYGA 2PYWA 4AOJA 2WMAA 1Z57A 1ERKA 3DFAA 3GQLA 3UP2A 3WYYA 5HTCA 5JMSA 1TQMA 3FMNA 3MA6A 4OTWA 3VAPA 2X6EA 3ZLWA 5IQDA 2CLXA 5F20A 3LQ5A 4BGQA 5KNJA 4EOIA 3MH2A 4X2FA 4M67A 4MBLA 2BKZA 2GFSA 3POOA 4KAOA 4U8ZA 1TVOA 3Q4UA 4HYIA 4GVJA 4ZTNA 1FBNA 2J0MB 3GEQA 2WXVA 2PUNA 3QGYA 3L8VA 5I9ZA 3EQFA 2P0CA 2VTJA 2RSVA 3BGQA 3EYHA 3IG7A 4IXPA 2F4JA 4C58A 1OKZA 2PVRA 2R7BA 4U79A 4FV2A 4U80A 4PL4A 2W1IA 5J5SA 4BZDA 3U4WA 2X0GA 1LPUA 3ORPA 5M06A 3DV3A 1XH7A 4M7IA 3VNTA 4LDTA 4QO9A 2JDRA 2C3JA 2XKFA 2XM9A 4DFYA 1MRYA 3FQEA 3Q4CA 1VYWA 4CFUA 4YO6A 4I6QA 1UKHA 1Q61A 4CYIA 1ZYDA 3I81A 4QQCA 4C4EA 5A9UA 3FZRA 1XHAA 2BKKA 3FMDA 2UZVA 4RSSA 4Z7HA 2XAOA 4PDPA 3TMOA 1WVXA 3ZBFA 5KHXA 2OICA 4IJ9A 3AKJA 4M69B 4XV2A 3ULZA 5IA0A 1FVVA 5DEWA 4GU6A 5IA4A 4L6QA 3G15A 3MTFA 2XF0A 4FZ7A 4DDGA 3HVCA 2A98A 3LCKA 3O23A 2YCQA 3JPVA 4NWMA 5I0BA 3W2CA 3IW7A 4PL3A 5IISA 2YJSA 4JBQA 2ZDUA 3QFVA 4RFZA 2WPAA 1ZWSA 3FY2A 4IB1A 1FOTA 2WOTA 5BVFA 3SQQA 5JFVA 3PSDA 4WSQA 4HVDA 2XNPA 4TWPA 5BUJA 4ZTLA 2I0HA 3ANRA 5DGZA 5FBNC 3TNIA 3MIAA 2ZV9A 3F3UA 3QRKA 4W4YA 4XOZA 4YO4A 2F2UA 5HU9A 2B7AA 4JS8A 3ZONA 2C0OA 3C5UA 3F69A 4NSTA 4EHGA 2PE1A 5FEQA 2ITQA 4CFMA 1ZYSA 2XARA 3OF0A 2BROA 1VJYA 3F2NA 1GZKA 3LAUA 4L3PA 5C26A 3PXZA 4EH2A 2W5HA 1GY3A 2XS0A 2Y4IB 2ITUA 1JQHA 2C30A 3FI2A 3MFUA 1YHSA 4TN6A 5CASA 2CHLA 3VC4A 2XK7A 4ZXTA 3CQWA 1QPDA 1OL7A 4S33A 3R9NA 4U6RA 5EYKA 1BI7A 1UVRA 4DC2A 3OCBA 3R6XA 4O7TA 3F3VA 3FZ1A 3DTCA 5HO7A 3TEIA 4XG7A 4DEEA 3BL9A 2YIXA 3QC9A 4RA5A 5CXZA 4QT1A 1Q8YA 4FSYA 3MPMA 2BRGA 1L3RE 2GNIA 3CD3A 3NW5A 2IPXA 3PXKA 1JNKA 4BDBA 1BL7A 3BHTA 3ROCA 3FQHA 4MVFA 1PYEA 2GQRA 2JDOA 4QNYA 2ONLA 4GJ2A 3WARA 3NWWA 2WNTA 1DS5A 5H9BA 4W4WA 3MW1A 4YGAA 1M2QA 1RW8A 1GAGA 4GFMA 2C3LA 4HGLA 1BUHA 3JS2A 4NT4A 3C1XA 4Y73A 3TNWA 2XM8A 4PP9A 4RVKA 5KMJA 3KREA 3SC1A 4RZVA 4MAOA 2Y0AA 1VR2A 3BI6A 3S4QA 3NCGA 3RBWA 2R0IA 3AD6A 2UW0A 3C50A 4ZMEA 5EQYA 2B4SB 3VBQA 5CEKA 2VO0A 1OIYA 4FTJA 1OI9A 4RX9A 1U59A 5EDPA 4BCMA 4U97A 1H01A 2YAKA 4UN0C 4O7SA 3E8DA 4QYFA 3ZOSA 4FGBA 4LV5A 4CLIA 1YXVA 3GUBA 1Q3WA 1ZARA 5CALA 4IMYA 4UB7A 3ZLYA 3ATSA 1BMKA 3TNHA 5LVPA 2P3GX 3QRIA 2YACA 4NUSA 3R83A 1KE7A 1MUOA 1ZAOA 2IO6A 3EZRA 3FI3A 2EXMA 5CY3A 4RBLA 4H36A 2YEXA 4GK2A 5CLPA 3W0QA 4UXQA 1MRUA 3ODYX 3VRZA 3DAEA 3PP1A 2AC3A 2OJ9A 4EK4A 3DT1A 1YKRA 3P0MA 2VX0A 4JI9A 3C7QA 4PRJA 3JY0A 3NNVA 4ZY4A 4J8MA 3KF4A 3LZBA 4LGGA 5L8LA 5CNNA 5AIKA 4XRJA 4QP1A 5EI2A 3QTSA 4M12A 1JVPP 1J7IA 5CF4A 2EXCX 2XIZA 2XK9A 3PA4A 2IEWA 3GFEA 2OXDA 2WKMA 4EH3A 1PMNA 4HZSA 3Q5IA 3BZ3A 3R8LA 4RVMA 3UNZA 3UNJA 3WF8A 4LRKA 5LMAA 2Y9QA 4XRLA 4BGGA 2H8HA 5AV0A 2ACXA 3KCKA 5C27A 2JBOA 3T3VA 3QTXA 5A14A 2VTSA 2C6TA 2WTCA 2XUUA 4IB5A 4ZP5A 4E3CA 5FTGA 1WVYA 2A19B 4ANNA 5DR2A 4FSTA 2FB8A 1W8CA 3GU8A 4LRJA 3C4EA 4OTRA 4E26A 3I60A 2W05A 4DHZA 2W1CA 3UODA 5L4QA 4B6LA 2X9FA 4KIKB 4HJOA 3GC9A 4TYJA 4DH5A 3MSSA 4H3QA 1NA7A 4I3ZA 1IR3A 3DJ7A 3ZO4A 2SRCA 3P78A 4RQVA 1PY5A 4R3RA 3R7OA 5M56A 3UOHA 4S30A 3QKLA 3ZZWA 5IEVA 2F2CB 5HOAA 3TNPC 4BFMA 4M3QA 2GNHA 3DA6A 3H9RA 4C34A 5AP0A 5KUPA 3IQ7A 3DOGA 3NAXA 4Y85A 4FR4A 2J6MA 2R5TA 3QQGA 1XWSA