3HL7A

Crystal structure of human p38alpha complexed with sd-0006
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
347
structure length
336
Chain Sequence
PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Structural bioinformatics-based prediction of exceptional selectivity of p38 MAP kinase inhibitor PH-797804.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 336
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hl7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hl7A01
4HVHA 3MWUA 3S3IA 2GNFA 5GJFA 4CQEA 1ZAOA 1KV1A 4H39A 1UNGA 3BKBA 1OIYA 3E5AA 2FGIA 4YURA 2W1EA 5L4QA 3WILA 4FTNA 5F9EA 3TV7A 4QP6A 4I24A 4D0XA 5HU9A 1CMKE 2QOFA 3DK7A 4GFOA 4M8TA 2YIXA 4XG7A 4KS7A 1UV5A 2J0KA 1PXOA 4BCJA 3EQDA 3AC1A 3VO3A 3ENHA 3FL5A 2R9SA 4CV9A 4B6LA 4CT2A 4Z3VA 3R73A 2Y4PA 3FKLA 2GSFA 4YZ9A 3Q96A 3JXWA 3FQHA 3ZTXA 3AT2A 2WIHA 1R0EA 3LFNA 4FUYA 3AD4A 3QWJA 4FTQA 4ZZMA 1ZARA 4LL0A 1ZYCA 4GIIA 4PTGA 4R6VA 4D55A 2BROA 3FLZA 3Q6WA 2PULA 2CNUA 3GCPA 4IX5A 3DZQA 3UGCA 3UE4A 3W2CA 3Q52A 2C3KA 4GFGA 4F08A 2OG8A 4AG8A 5KMNA 1R1WA 4C58A 4DEGA 4YJNA 4DGNA 4F9BA 2C5VA 5HTCA 3LFSA 1P4FA 3WZJA 2Z7SA 5DI1A 3TNQB 3MY0A 4G6LA 3QF9A 4D4SA 5T68A 1W82A 2DUVA 2QLUA 4HZRA 2GQRA 4OTRA 4ACHA 5K4JA 4J95A 1W98A 5DR9A 3THBA 4TNDA 2PUUA 4YZCA 4HVDA 3C0IA 4W9XA 5DRBA 4FIIA 5DEYA 3R1QA 3E3BX 4JQ8A 2JGZA 4FMQA 2PZIA 5CZIA 3UG2A 4AZTA 4C8BA 3ZH8A 5HVKA 4TYHB 3ZRLA 3QD2B 2B52A 3C51A 1F3MC 3CE3A 4FT9A 2BTSA 4NU1A 2JDRA 3CJGA 2HYYA 2UUEA 2XJ2A 3FL4A 4ZY4A 5AP0A 4DEDA 4O1OA 3FZOA 1BUHA 2W1CA 4U6RA 5AIKA 4YHFA 5BVOA 3DK3A 1OPKA 4AW2A 2ETRA 3LXNA 4B99A 2Y4IC 4AQCA 3EOCA 3FKOA 4R1YA 3Q5IA 3IS5A 4XLVA 4CEGA 3TZMA 4CLIA 4YLJA 5FWKK 2NPQA 3MIYA 3OCSA 2EU9A 5E8SA 2C30A 4FZAB 1H08A 5L2SA 5M44A 2V7AA 5BUJA 1IG1A 4BTJA 4PP7A 4FT7A 4I22A 3AG9A 4RIXA 3VS2A 3WZDA 5KNJA 2HXLA 2QI8A 2I40A 2Q0BA 2WXVA 3DAJA 2ZOQA 2FSOX 3W8QA 4EH8A 2XK8A 1FGKA 3FUPA 4NCTC 4X3FC 1QPCA 3P79A 3ROYA 3WBLA 2IW9A 3GXLA 3QALE 1LEZA 1CSNA 2DQ7X 2O0UA 2CNQA 4F9CA 5FTGA 2W4KA 4FL2A 4EWQA 2B53A 5JN2A 4M68A 2IZRA 3FLYA 4PPAA 5IQEA 3EQIA 3UZTA 4C57A 4DEIA 2IVSA 4R3PA 3O71A 2F2UA 4O0VA 4DFZE 1G5SA 5E91A 1Z57A 5CWZA 2CNVA 4FI1A 4CFNA 3Q4CA 3V5LA 3LLTA 2ITOA 2P4IA 1APME 2X9EA 2H34A 2ITQA 4NT4A 4NFNA 3LXKA 3B2TA 3ZYAA 1U59A 3U9NA 4C38A 1PKDA 2CLXA 5CANA 3I5NA 4GVJA 5M08A 4GYIA 3UIBA 2XEZA 1YHVA 2QD9A 4UWBA 2OXDA 3TIZA 2CPKE 3LCTA 2ITTA 2BVAA 4EZ3A 4FKQA 3CXWA 4O7NA 1RDQE 2WAJA 3RNIA 5LMKC 3BYMA 3Q53A 4FV5A 4TRLA 2PMOX 5HO8A 2XM8A 2P3GX 4O7WA 2C3LA 4FNZA 1YI4A 3LMHA 3RZFA 1LEWA 4Z7HA 3C5UA 3Q04A 4KBKA 4C62A 4ANLA 3H3CA 4IB3A 3PWYA 4I41A 3UQGA 3ZSGA 2BRMA 4C3RA 1JWHA 4AOIA 4F7SA 5M06A 2R3LA 4EYMA 4E4XA 4L53A 3N4TA 3TUDA 3UMXA 5DT0A 4JAJA 5J95A 3D9VA 3LCOA 4IVBA 1F5QA 4EOSA 4C4IA 3JVSA 4A06A 4TYEA 5HD4A 5CI7A 5IH6A 2XCKA 4TZRA 3VBQA 3VF9A 1M2RA 3QFVA 4FKOA 5EM8A 4IZYA 2RG6A 3CQWA 5AM7A 4F70A 3FBVA 4XNEA 1ZLTA 3QCYA 4A9UA 3VNTA 4ALVA 1XBAA 3QTRA 5HLNA 4XRJA 2XKCA 4J7BA 4JIAA 1UU8A 2J51A 1XH9A 2UVYA 5F94A 2UZBA 3ULZA 2XNEA 4ASZA 3KF4A 4PWNA 4Y46A 1WAKA 2GS2A 4DTAA 3SXSA 3JY0A 3U6JA 4DG2E 4O22A 1M7NA 3IW7A 3BEAA 2Y4IB 4A9TA 4O0XA 5TF9A 4MNEA 4QT1A 4FIEA 2VUWA 3ZO1A 1IAHA 4ZP5A 3KRRA 3NYXA 1OGUA 4L44A 4NKAA 4RT7A 3TJDA 4EC9A 1O6LA 2V62A 1ZYLA 3H4JA 4OBPA 4MD8E 3UOLA 4BCNA 1XH6A 2OJIA 2R3OA 3C4WA 5EDPA 2JLDA 2YZAA 5EHLA 3QCQA 2RGPA 2BFYA 5CSXA 3DJ5A 5I9UA 4QQCA 2J90A 4AOJA 4FKLA 1F0QA 2KULA 5FTOA 5IA1A 1O6YA 5I9YA 2YDJA 2Z7LA 4MKCA 3TL8A 4X3FB 3PJ8A 3VN9A 4YJSA 2JKKA 5DHJA 5HTBA 1H24A 3IGOA 3BQCA 3VVHA 3QHRA 4FKPA 1OUYA 3GU5A 3U8WA 3ULIA 2W1DA 2Y9QA 3C13A 3GEQA 3NNWA 4K9YA 5HG5A 3QBNA 1P2AA 4O7SA 3SA0A 4YP8A 3KXNA 3P86A 1NVRA 3AC8A 3LMGA 3Q3BA 4J8MA 3NLBA 3IONA 2W7XA 4DA5A 1XR1A 1KE6A 2W1FA 2WU7A 3DBDA 4PDSA 4QMVA 5DA3A 3VBYA 3U55A 5C8NA 4RIWB 5DR2A 4KRDA 3BLRA 1YOLA 3W8LA 3DPKA 3AMYA 4EHVA 2B55A 4XV9A 3N9XA 4W4WA 4U97A 3DS6A 2Z7QA 4A9RA 5LVNA 4P5ZA 4U81A 4DEBA 4XV3A 1JKTA 1LPUA 3NVKI 5HCXA 5A14A 1PHKA 3EWHA 3OWKA 3I6WA 4IH8A 3HV5A 4EK3A 5EI2A 5FXRA 2G9XA 5JQ8A 2QQ7A 4AW1A 5LWNA 3ACKA 4AT4A 1OITA 4ZTLA 3W10A 4BDIA 1KWPA 2QODA 3MW1A 4FV2A 2BAQA 4AGCA 3BV3A 4WG5A 1OECA 4AS0A 3Q2JA 3MFUA 2HAKA 3NAXA 4FKIA 2J6MA 3E8DA 3KL8A 4RWJA 4UXQA 3ORTA 3VS4A 3EFLA 2ITUA 4LM5A 2OK1A 5I5ZA 2CDZA 2XBAA 2RFEA 5EK7A 4IC8A 3F3TA 4GT5A 4J1RA 3KK8A 4DC2A 3KMMA 3CP9A 3HV6A 5IA5A 4FKGA 4ZSJA 4LGHA 3NCZA 4D2RA 3W2PA 3WZKA 2YWPA 1Q8WA 3QKKA 5EW9A 3R04A 3ORNA 4CG9A 3FXWA 3MY5A 4FIFA 1J7IA 4BDKA 2QO9A 2XCHA 3FSFA 4ZLYA 3R9OA 5EM6A 3C7QA 4DGLC 3HMIA 4YJUA 5A6OA 3QQGA 4Q9ZA 3O8TA 1YXTA 2B9HA 5JRSA 3EQBA 4LI5A 2NP8A 5JQ5A 3UO5A 4IM2A 3Q4TA 2UZLA 4XHKB 2OU7A 5G6VA 3EN6A 4PDPA 5CAOA 1BMKA 1FQ1B 1KOBA 1ZY4A 2XF0A 2YM6A 4II5A 2X0GA 4J96A 4O27B 4CYIA 3D5VA 1MQ4A 4G6NA 4QPSA 4XG8A 4UV0A 3ZS5A 5CSHA 3R1SA 1VEBA 4CVAA 2J7TA 4IX4A 2JAVA 2W1IA 2YFXA 2O5KA 3OCTA 4IADA 4EOMA 4AXAA 3KCKA 1H27A 2XNGA 4QD6A 4FSTA 1OL6A 2J9MA 3PA5A 2CGXA 2R3JA 3EZVA 2WKMA 2O2UA 5DBXA 5ITAA 3LFDA 4BTMA 2GU8A 3H30A 4O0WA 3SHEA 3V8WA 5CF6A 4NM3A 2ZB1A 3CTJA 4WG4A 4RIYA 4MD9E 3QUEA 4B0GA 2YA9A 4TXCA 4ZZNA 5GZ8A 5KHXA 5H8BA 5BQ0A 3QRKA 4KAOA 5LVMA 5DIAA 4IX3A 2GFSA 5HIDA 4OTIA 5CI6A 4D28A 4KBAA 4Q5HA 5IF1A 4JG8A 4RX9A 1OL2A 3GT8A 2KTYA 4IAZA 4YHTA 4BKZA 3U9CA 1W83A 3DBEA 4ASXA 4F6WA 3L8SA 4QMOA 4C61A 4IWQA 3LE6A 2FH9A 5CASA 1UWJA 4OTWA 3BU6A 1E1VA 1ERKA 2E2BA 5HE3A 3RK5A 4DEHA 2X81A 3HV4A 3EYGA 4W4XA 5DE2A 2VGOA 2DYLA 4FEWA 3Q4ZA 3ITZA 4ZAUA 3TG1A 3HA8A 1ZXEA 2J5EA 3FDNA 3OY1A 4FTKA 1EH4A 2J0MB 2UW4A 4I6HA 4XLIA 3V5WA 4ZK5A 3OUKA 2W05A 2WMQA 3QRIA 3GQIA 3ODYX 3EN7A 2XVDA 4PMTA 4CMUA 4DINA 5HX8A 5IDNA 1BL7A 4E93A 4J52A 3VBVA 4BI0A 4XP3A 5H8GA 4DCAA 2F7ZE 5HBEA 5DEWA 3LJ1A 3VS1A 2W5HA 5DT3A 2GNHA 2QCSA 3M11A 4GK3A 4FOCA 3P9JA 4MWHA 1CKIA 4UZDA 4MH7A 4X3JA 5KMLA 4AW0A 4F7NA 4F64A 3KULA 3HL7A 4DFUA 4F63A 4Y72A 2I6LA 4ACDA 5CLPA 2VTRA 3DDQA 5AUXA 4BBMA 4YO4A 4BDAA 4JBPA 4XP2A 2QOLA 4GSBA 3AOXA 4FEXA 4NEUA 2YISA 4ZS0A 3DCVA 5L2IA 4C4GA 5IPJA 2OF2A 2OH0E 3U6HA 1VYWA 3RK9A 2IZUA 1V0BA 1E9HA 4Y5HA 3WF8A 3C5IA 1PXJA 3E8CA 2XA4A 5M4UA 2C0IA 5A4QA 4FKSA 4YU2A 2WQOA 4EONA 2BMCA 3OCGA 4OT6A 5AM6A 4C34A 1GIJA 1PMNA 2OJ9A 2BKZA 4DH3A 4DT8A 3FAAA 4DAWA 3ZZWA 3EMGA 3LXLA 2X8EA 4HNFA 4QP1A 5IUGA 3R21A 3UOKA 3HP5A 3NNVA 4DLIA 3KRXA 4TPTA 5CF5A 5T6KA 4A9YA 4G9CA 1W8CA 2QNJA 3NR9A 4CYJA 3LKMA 2ESMA 2FYSA 2XIZA 3PSCA 4QPAA 4DFBA 3PLAE 2HIWA 2BUJA 3ORIA 5FTQA 3R83A 3TDVA 2FA2A 2VTHA 3L8PA 4AA5A 3QHWA 1ZOEA 4FG7A 4P90A 3W2RA 4CNHA 3MVJA 4BF2A 3DDPA 5LCJA 5ETAA 2OW3A 5L2TA 3PY1A 4UZHA 4JVGA 4RIXB 5CTPA 3HAMA 2Y6OA 3QTWA 3OW4A 3R22A 4MX9A 1XQZA 3COIA 4FNYA 2QOKA 2R2PA 2B9JA 4G3EA 4MF0A 1OPLA 2YAAA 4GEOA 4I6BA 3DOGA 4WNKA 2VWXA 5K0KA 2GNIA 3R7YA 3BX5A 5AV2A 3MBLA 2H96A 4NM0A 2GTMA 3G90X 2E9NA 4BZDA 3EYHA 3U4UA 5CXZA 4IZ7A 4AA0A 2CJMA 2I7QA 4WUNA 3I7BA 2A2AA 4FTAA 4KSQA 4WNOA 4OR5A 2RFNA 3BYUA 4BZNA 3A7GA 4CTCA 4TTHB 4V0GB 1AQ1A 3ELJA 3PZHA 4FK3A 2VD5A 4ANSA 2FSTX 4KSPA 5I3RA 2VAGA 2UZEA 2XK3A 4X2GA 5IQIA 4L01A 2GS6A 3HMPA 4FSYA 3RINA 4IXPA 3UQCA 1J7LA 3GQLA 3C4FA 4O38A 4NJDA 5EQYA 2VWIA 3D5UA 5HVYA 4FEVA 4CKJA 2RSVA 2R3FA 3QTZA 3RCJA 5A46A 4NM7A 2F57A 2RIOA 2W96B 1GOLA 3I60A 3R8ZA 3UIUA 5IQCA 4HGTA 3BEGA 4O21A 4CCBA 4J71A 2YACA 3KFAA 3U87A 2P2IA 4ID7A 4O91A 5CAPA 2R3KA 1PMUA 4LUEA 5CQUA 4RJ3A 5J8IA 5KMMA 1PXPA 3P08A 4DFNA 3CQEA 1RJBA 5EI8A 5AX9A 2W4JA 3FXZA 3CKXA 4FSNA 1FPUA 4RIOA 4LRKA 4IB0A 3IW8A 3R2BA 2QOIA 3VJOA 4ZEGA 4O0RA 3SX9A 4ALUA 3QRTA 2PYWA 4WKQA 4ZSEA 3P0MA 1UNHA 4R7HA 1OL7A 4FZ7A 4U3ZA 2VNWA 1YI6A 2VTTA 4NCTA 1ZYSA 1OKYA 5FXSA 5C9CA 1SVEA 3Q5ZA 3V5TA 1B38A 4LYNA 2JDSA 2WD1A 4BBEA 5FG8A 1S9JA 3A4OX 3MGYA 4RWKA 4GU9A 5HX6A 1SNXA 5JGDA 2REIA 4A4LA 4AE6A 5IQHA 4IMYA 5JRQA 4FNWA 5CX9A 4FL1A 3QU0A 4R77A 2X6EA 3PG1A 2F9GA 2XJ1A 1BI8A 5E1EA 4C33A 5J79A 5E4HA 2X2KA 3D83A 4O82A 3MPTA 2QU6A 5HG9A 4CFMA 5CY3A 4K6ZA 3PIYA 1K3AA 4S30A 3ZFMA 1DS5A 3A60A 3AC5A 4FV8A 2X7GA 3VW6A 4AZVA 3C9WA 4FKJA 3OY3A 4IWOA 5H8EA 4GKHA 3IDCA 1PMEA 3R71A 4U5JA 4QTBA 4QMQA 5BMSA 1XKKA 4MNEB 3ZLYA 5TOZA 3FKNA 5LVOA 3EHAA 3PA3A 3BU3A 2EB3A 3G6HA 2A27A 2O64A 2PE1A 1AD5A 2R3HA 5LARA 3DKOA 1ZMUA 3LVPA 3CQUA 1XH7A 4OTDA 3EQCA 5AR8A 3SLSA 5LMKA 3UNZA 3TUCA 3A2CA 4U0IA 4GYGA 4A4OA 4YTHA 2W9FB 4FF8A 2GPHA 3Q32A 2W5BA 2QOOA 4HOKA 4MF1A 5AR4A 2HY81 5EDQA 4BL1A 2HZNA 4CKRA 4FNXA 5D9HA 3K54A 4EZ5A 4IAYA 3PSBA 4IVCA 5LQFA 3AT3A 2E9UA 1OI9A 2BFXA 2I1MA 3P7AA 2C5XA 3ZM9A 1FVTA 4FV4A 4I21A 4DITA 4Y95A 3IQ7A 5CF8A 4NWMA 3MS9A 3FMEA 2CCHA 4AA4A 3F2AA 4A7CA 2IW6A 1NVQA 3LM5A 3WOWA 4AP7A 3QZIA 4I0RA 1J1CA 3GCSA 4QPMA 2YLFA 5IA2A 2XYNA 5LWMA 3GC0A 3HRCA 3BYOA 4MTAA 2VTLA 1P5EA 4G9RA 2OICA 4IFCA 2BDJA 2ITZA 2QVSE 4G34A 4XOZA 4CRSA 4E20A 4L00A 4PL5A 2BAJA 3O0GA 5CSVA 5AWMA 3VAPA 3ACJA 4CMOA 4CT1A 3R30A 4ITIA 3S00A 4M97A 2HZIA 2Z60A 4F9WA 3BE2A 3MA6A 4EQCA 2PU8A 1JSTA 5KE0A 5CEIA 2OF4A 4DH7A 4HYIA 3D0EA 3R01A 4MBIA 3VBTA 2ACXA 3PJ3A 4FVRA 4AT5A 3PJCA 4F0GA 3BLQA 2XIKA 4AN3A 2GDOA 3VUIA 3NX8A 1H1WA 3WIKA 4C35A 1J7UA 4DYMA 4O1PA 5J9LA 1PXIA 4E6AA 4DTBA 3I5ZA 5C8KA 1R3CA 5CEMA 4OGRA 2VTAA 5HG7A 2VX1A 2YDKA 3BHTA 4Q5EA 4WO5A 3T3VA 4KIOA 5AR3A 1Y8GA 4XJ0A 2ITXA 2IWIA 4KIKA 3ZBFA 2OO8X 3A7JA 4P7EA 2RKUA 4D4VA 4TL0A 5L3AA 2V7OA 3UOJA 2J0IA 3ORXA 1MRUA 5I4NA 3EQGA 2BKKA 3BHUA 3IDPA 3BV2A 2VWZA 3EB0A 5IUHA 3F69A 4L45A 4JS8A 4LGGA 2PVNA 2VTIA 4RJ8A 1XWSA 3C4EA 4TYJA 2I0VA 4WT6A 3ZSIA 2JDVA 4ZMFA 4L42A 3JY9A 2PVLA 2XRUA 3S1HA 2B9FA 2IZSA 4FKRA 1SNUA 2XS0A 3PSDA 3DTCA 4LRMA 4E8AA 3HP2A 1LR4A 5DG5A 5C26A 4G31A 2VV9A 2JFMA 2VTJA 3NDMA 4XS2A 3CEKA 2VTOA 1SVHA 2Z7RA 3Q9XA 4IFGA 4BIDA 3T8OA 3OOGA 4GMYA 4H3QA 4USEA 4EQUA 1YDSE 4OUCA 1YXVA 2ZV9A 3UNJA 3FMDA 4I5PA 3OOMA 1Q4LA 1VYZA 1H25A 4I1ZA 1XO2B 4ZLZA 3EFWA 3GFEA 3UZRA 4JQ7A 4FT5A 5ETCA 3DKCA 5CU0A 4BCIA 5IA4A 4MWIA 3DKFA 4DEAA 5LOHA 4D2TA 3PY0A 4H1JA 1JLUE 3ZO3A 4Y83A 3SOCA 3NAYA 2V22A 4QTAA 5C01A 3WF6A 2VU3A 4RIYB 1T46A 3CPCA 2WEIA 3LJ2A 4S34A 3EN9A 2J50A 3QYZA 1GY3A 3TNWA 3TNHA 4F1MA 4QP2A 4M69A 1PW2A 4E26A 4UMQA 3QA0A 5L6OA 2WMXA 4QTCA 5AP3A 2R3GA 1QL6A 3ZC5A 4F0FA 3TM0A 3DAEA 5IISA 4DE4A 2RFDA 2UZVA 1OIRA 4AE9A 4EJNA 3NYOA 3LLAA 5HBJA 3SAYA 3TEIA 5LMBA 2C1BA 2OXXA 1JPAA 2W17A 4GJ2A 4EQMA 2WQBA 4U9AA 4L3LA 3OHTA 4W8DA 5B2KA 3RK7A 3MTLA 5JFWA 4FEUA 4WSQA 1NXKA 3O2MA 4IDVA 2IO6A 1K2PA 2X39A 2XIXA 3DB8A 4H36A 4MEDA 3RAKA 1OUKA 1JNKA 4EK8A 2HCKA 3A62A 3COMA 2NO3A 2JBPA 2X8IA 1ZRZA 2RF9A 2BZIB 3NYVA 1RQQA 3QRJA 3FYJX 5GJDA 4R8QA 2R64A 2ZJWA 2IJMA 5L6WL 3VBWA 3P7BA 4DGOA 4BY9E 3FI2A 3P23A 4IANA 3IW6A 4XEYA 4XOYA 4O86A 2R4BA 3NUYA 4BDHA 4ALWA 2CKEA 3Q9WA 1K9AA 1Q8UA 1JKKA 3EJ1A 3POOA 4FTTA 3ALNA 4XG2A 4D9UA 4QMYA 3FHRA 5CT0A 2NNWB 3JPVA 4X2JA 4W4VA 2PZPA 1PYXA 3KULB 2IVTA 3D94A 2XIRA 2OKRA 1L8TA 4BCQA 4C59A 3OTVA 3S4QA 3GCQA 4FYOA 3TWJA 2WU6A 3F9NA 3L9PA 3M42A 3G0EA 2WPAA 3KN5A 2IVVA 3FLWA 4EH4A 4FT3A 5HE0A 4F1OA 2QG5A 3FQSA 4YZMA 4ACCA 3TIYA 5D11A 4YZDA 2W0JA 3V5JA 4ZTMA 3DU8A 5JKGA 2R7BA 5HG8A 4D1XA 4DBXA 5B2LA 5J1VA 4E4NA 3F3WA 3I0OA 4WHZA 3SD0A 1WBSA 4RJ7A 3JS2A 4GK2A 4YJQA 3QUDA 5CVGA 3ZLWA 4UB7A 5CF4A 2PZ5A 2OJGA 1JVPP 3D2KA 4LOOA 1JOWB 4O0SA 4E5AX 5K5XA 3ZDIA 5HESA 5H3QA 5D41A 3SKCA 2WIPA 3R2YA 4TWOA 2ZVAA 3ANQA 3KQ7A 5BUIA 3ZZEA 4I6FA 1G8AA 5HGIA 4UWCA 2IW8A 3LOKA 1FVRA 4IAAA 2V5QA 5AFVA 5A6NA 2QR7A 2R5TA 1FINA 3F5UA 1ZOHA 3GB2A 2X4ZA 4JL9A 4K8AA 1FBNA 2AUHA 1FOTA 4BTKA 3OS3A 4DT9A 4FIJA 5GINE 4MXAA 4LQMA 3HLLA 4ZTQA 2F7XE 1YXUA 2ERKA 3F61A 1STCE 5DFPA 4ITHA 4E7WA 4QTEA 2C4GA 3O96A 4UMTA 3TNPC 2C68A 4FSZA 5ANJA 2UW9A 4M0ZA 3BPRA 1H28A 4DN5A 4RLKA 5E90A 4J53A 2PUNA 3I79A 3ORMA 3UMWA 1Y8YA 3GI3A 1UKHA 2PWLA 4CG8A 1WVWA 4I93A 2WMVA 4BWKA 2OH4A 2BZKB 3MV5A 3MY1A 2YM7A 5CENA 5JSMA 4KABA 1QCFA 4XG4A 5A9UA 3GCVA 3NUSA 3ATSA 2FSMX 5C4LA 4M13A 4XRLA 3MH3A 1ATPE 2Q83A 2PK9A 3G15A 4AACA 1JSUA 3KF7A 4BDDA 4RA5A 5CAQA 3OMVA 4IZ5A 5JGBA 4BB4A 4DFYA 3WF5A 4WUAA 2C1AA 1KSWA 1H1PA 4GU6A 3AC4A 3P1AA 5FXQA 5AA8A 2J2IB 3PA4A 4FKWA 1IA9A 3VHEA 1SMHA 3D14A 5M07A 5KUPA 3LXPA 4ZOGA 3DLSA 4G3CA 4GUBA 4XBRA 4BVUA 4XMOA 1LP4A 4FG9A 4H1MA 4PDOA 5CSWA 3UIXA 5HTIA 4L9IA 2PMIA 2UZTA 3A8WA 3EKKA 3DKGA 4I4FA 1UVRA 3OXZA 3OP5A 3W18A 4AZFA 5C03A 2VO6A 3S2PA 1H0VA 5CAVA 5L6PA 2QO7A 4OAVB 2YWVA 2Y7JA 1W84A 2GNLA 2RFSA 3L8VA 1PXMA 3QQKA 4GK4A 3PVBA 3ORLA 3HA6A 3RBWA 3UZPA 3ZLSA 4C7TA 4GKIA 4FL3A 2IVUA 5J5SA 3P5KA 2VTSA 4QP7A 3O8UA 4PPBA 2X7FA 4G1WA 3U4WA 3FC1X 4GG5A 3UG1A 3ZCLA 4R7BA 3G5DA 2C69A 1H26A 3HMMA 4RPVA 1UNLA 3E63A 4XG6A 3ALOA 2YAKA 3KXGA 4DLJA 5LXMA 2PUPA 5ANIA 2ITNA 5IUIA 3VJNA 4R3CA 4E6DA 5K9IA 4JJRA 5C27A 4FE2A 4GH2A 5H2UA 4OBQA 4BIBA 2W9ZB 5BVKA 3R02A 5J87A 2XYUA 3DK6A 4OTGA 1PXKA 4HW7A 3PIZA 5CEOA 1PY5A 3A61A 4RSSA 3VULA 3NEWA 4PNKA 3R7OA 4WD5A 5FEQA 5GIOE 4ZZOA 2BRNA 4W8EA 3CGFA 4DG0E 4U42A 5A54A 3FMHA 4X2FA 4X6QC 3OD6X 2ZB0A 4BICA 1IR3A 4F7LA 3R8LA 3LM0A 1GZOA 2HK5A 1KE5A 4ZY5A 3UYSA 5B2MA 3FYKX 4F9AA 3KREA 3NVMB 1R39A 1UA2A 3FLSA 1GZ8A 4J8NA 4X2NA 3DBFA 3VS6A 4AFJA 5ETFA 2XH5A 3PJ2A 1MP8A 2AYPA 4AGUA 2X8DA 5A4CA 5HO7A 4FGRA 3DA6A 2Z8CA 3IW4A 2C6EA 2J0JA 5DGZA 3KRWA 1U5RA 4IHPA 4HGLA 4FUXA 5IQFA 4AFEA 3NYNA 5AUUA 1H4LA 3VUTA 4CFWA 5F4NA 3KCFA 2GQGA 4FIHA 4QRCA 2CKPA 3KXMA 3F3ZA 5AP2A 1DI8A 4FIGA 4C4FA 4CQGA 1KE7A 3PDTA 1IEPA 4KKGA 4QNYA 5I9WA 3R28A 4QMNA 2GHGA 5CQWA 5I9ZA 4IM0A 5GJGA 4ANMA 2SRCA 3H0ZA 5M09A 4YBKA 3KK9A 3DV3A 3MN3A 4RMZA 4C3PA 3MYGA 3LPBA 3VUDA 4QMTA 1JKLA 4YC3A 1Q8YA 2ETMA 3FEGA 3GUBA 4JBQA 4NKSA 3NRMA 2VX3A 1CKPA 4Y5QA 3EN4A 3VQHA 1M2PA 2YM8A 4QP8A 3FWQA 3QGYA 2ZV2A 5FEDA 4HYHA 3UVRA 4W4YA 4R5YA 5HLPA 4O7ZA 4NH1A 3N4UA 2B0QA 2FSLX 4QOXA 4KUJA 5M4CA 4BIEA 1IRKA 1TVOA 5LCKA 4QP3A 5DT4A 2PTKA 2VWBA 3A99A 3BWJA 3CS9A 3C1XA 3GU7A 4HGSA 3W16A 2UZWE 5EQEA 3UDBA 3LQ3A 2HWOA 3R7GA 3M1SA 3KMUA 4TN6A 1WMKA 4LV5A 3F66A 4QO9A 4QMLA 3UTOA 4BDBA 3CKWA 2XNPA 4J98A 3FZ1A 3U51A 3R8VA 4PMPA 4DCEA 3ZO2A 3H0YA 5EOBA 2X4FA 4EHZA 4HPUE 5HHWA 1XBBA 2C3JA 2UZNA 3PRIA 5TKDA 3EKNA 4Y8DA 4FV6A 4O7YA 1KE8A 2JEDA 3VUKA 2JIUA 4R7IA 3NIZA 5AV0A 3CGOA 4KS8A 3BIZA 3QD4A 4U43A 4EOLA 4NIFA 4D4RA 4FSMA 3FI8A 5JZJA 2EUFB 2UW6A 4ZTNA 4FSUA 4Z55A 5HORA 3FPMA 4YLKA 3QC4A 4KIQA 3R8PA 4RQVA 4UWYA 2B54A 4RVLA 1H1SA 3QKLA 1M14A 3MPMA 1FGIA 1XH8A 3FZPA 5HBHA 3EL8A 4ANQA 3CTHA 1SM2A 5FQDC 5AP6A 2G2HA 3RWPA 4I6QA 2PVKA 4ZTSA 5EQPA 4FTIA 2OFUA 5KX8A 4FZDB 3PFQA 5ACBC 3F6XA 5AR5A 2GFCA 4RWIA 3R7VA 4P4CA 4GVAA 4ZXTA 2WTVA 4BN1A 2QG7A 4CGAA 1Z5MA 4ASDA 4IC7A 5LMAA 4CZYB 4EOOA 3HEGA 3PP1A 4LG4A 4TWPA 5AJQA 3ZXZA 4BDCA 4BYJA 4JRNA 5CZHA 3VRZA 1W0XC 4RZWA 4C4JA 5CSPA 2BAKA 4AWIA 2QKWB 4IE9A 3NCGA 3LFCA 1FVVA 4RJ4A 3W2OA 5HIEA 2GHLA 5E1SA 2J0LA 3QRUA 3UOHA 3SW7A 2GMXA 1A06A 4ORKA 4YNEA 2A1AB 1O9UA 2FVDA 2XM9A 3BYSA 3OTUA 3QTIA 3OW3A 3F3VA 4BCMA 1XBCA 3GNIB 4M69B 3FMMA 3NW5A 2XK4A 4HVIA 4XP0A 1SZMA 4BKYA 5HD7A 3BBTB 4EEVA 2G1TA 2W1ZA 5DNRA 4TNBA 3WZEA 3DNDA 4C02A 3ZRKA 2A19B 4KB8A 4FV0A 5AADA 1R0PA 4AZWA 4YTCA 2WTIA 3FPQA 3HV7A 3C4CA 3TTIA 4F7JA 4AN2A 3N51A 2P0CA 3HMNA 3Q60A 4AAAA 4G2FA 5IU2A 4I20A 3NUAA 4WBBB 1DM2A 3TKUA 4C2VA 2WHBA 5AUYA 3CY2A 1GNGA 2ONLA 4O7TA 2C6TA 4N6YA 1BL6A 4TT7A 3R7EA 1PJKA 4TW9A 5HQ0A 3A7HA 3MH2A 5J5TA 1YWVA 4DG3E 5GIPE 4F99A 4DF3A 3QAME 1UWHA 3NUUA 3QX4A 4ITJA 4C2WA 3PUPA 5HO6A 5M56A 3R00A 4E4LA 3SOAA 5KHWA 3C50A 4GIHA 4IAKA 5I9XA 4KA3A 1KV2A 3DAKA 4D9TA 1VZOA 3KMWA 3EL7A 4HPTE 3BGQA 4KINA 5HEZA 4UMPA 1W7HA 3CY3A 2ITYA 3LMIA 3SVVA 5JFXA 2PSQA 3VW8A 3L9MA 4ZSGA 4B8MA 2XNBA 3HZTA 3D7TA 4U41A 3V8SA 3CC6A 2OIBA 3RP9A 5K4IA 4N4SA 2G2IA 2YIWA 4QYYA 2QOHA 1YXXA 3IOKA 3T9IA 3SG8A 3RJCA 3LZBA 2YM5A 5BVWA 4ZJVA 3TUBA 3EQRA 1ZYDA 5JK3A 4EJ7A 1OVEA 4HCTA 4DBNA 3DT1A 4EOQA 5JT2A 2VO3A 4FYNA 5HIBA 4G6OA 1YKRA 2QKRA 2WMSA 3OZ6A 3PVWA 4ANOA 3POZA 3ROCA 4PL4A 4D4YA 4IZAA 4IM3A 2O63A 4JDIA 5L2WA 4CFXA 4FV1A 3TV6A 2VO7A 3GC7A 4HYSA 1H1QA 5I0BA 2XUUA 5AMNA 5KMOA 4OTPA 4XG9A 5CS6A 4IVDA 3OG7A 5E92A 3V6SA 4APCA 3V5PA 4JI9A 2WQNA 4DH8A 4Z9LA 4O6LA 4ACMA 3QTXA 4NTSA 2FUMA 2VWYA 3PG3A 5DR6A 2F2CB 3DQXA 3VC4A 2E9PA 2QO2A 4RJ5A 3FMJA 3O50A 4YJPA 2EXMA 4BWPA 3S0OA 3LCSA 1YI3A 5CNOA 2ZM3A 3BBWA 2BHEA 3O23A 3PE1A 4FTOA 4CCUA 4G17A 4RX8A 1YDRE 3D4QA 4M66A 2J4ZA 5DRDA 2YCSA 5GZAA 1NW1A 2WMTA 4MBLA 4RWLA 4G16A 4F09A 5JGAA 3AD5A 1ZMVA 1OKZA 4TY1A 2EB2A 4ZTRA 4DEEA 2WMRA 2W06A 5ANEA 1YOJA 3PXYA 4GFMA 4L3PA 3G6GA 1OKWA 3EQFA 4JNWA 1FMKA 3IKAA 2XKEA 4GW8A 4KIPA 4XG3A 2X7OA 3QZGA 5AV1A 3SW4A 4AN9A 2HWPA 3KGAA 5IZFA 4HCUA 4EC8A 3KXXA 3W1FA 5J7BA 2CKOA 3SRVA 4YJTA 3DXPA 4WIHA 4ZLOA 2C6MA 3FE3A 3HX4A 2C0TA 4QMWA 1Q99A 1YRPA 4CFVA 2C6LA 1S9IA 4O0YA 3NW6A 3ZC6A 2B9IA 3DXNA 4GL9A 4XBUA 5DN3A 2R0UA 5H9BA 2VTMA 5AUVA 4HJOA 4ZS4A 5L8JA 4IW0A 1UU7A 2YJRA 3RAIA 4IB1A 2C3IB 2XMYA 3TZ8A 3UVPA 3TDWA 3LW0A 4I94A 3CIKA 4MAOA 1KOAA 4AGDA 4EKKA 5CVFA 3FQEA 5K0XA 3QGWA 5FP6A 3V51A 1MRVA 3ZFYA 3L8XA 3QQUA 2QU5A 3G0FA 3QTUA 4JDKA 2C5YA 4JBVA 4E5BA 4B4LA 2XIYA 3IGGA 3REPA 4PX6A 5C8MA 4M14A 4PF4A 1M2QA 4IJPA 4M84A 4YSJA 4ZTHA 3QZFA 3TCPA 3TZ9A 2JKQA 5CNNA 4IX6A 4EK6A 3R8UA 2IN6A 5E8XA 2BR1A 5KKRC 3MB6A 2RL5A 3MH1A 5FGKA 3RKBA 4LV8A 4WRGA 3HDMA 3SC1A 3TZ7A 3RMFA 3PTGA 4F1TA 3UNKA 2QHMA 2R3RA 2W1GA 2CMWA 4L46A 4JOAA 4F4PA 4ENYA 1PRYA 4RC2A 1RW8A 4CXAA 1Q3DA 3BELA 3NWWA 3DFCB 5JZNA 5AP4A 1CTPE 2VX0A 3WF7A 4FVQA 4XUFA 4QP4A 3ZBXA 5BYLA 4O2PA 4O2ZA 4GG7A 5B0XA 2BRHA 3PVUA 2Y6MA 5AR7A 4IB5A 2OIDA 4D2WA 4DGGA 3QA8A 3GU4A 2UV2A 3TNIA 2YHVA 3JVRA 2GCDA 2OZAA 2GTNA 3C0GA 2I0EA 3FZRA 4EHEA 3NIEA 4D2VA 4FZ6A 1OIQA 3GU8A 2R0IA 3LFAA 4EH5A 2R3PA 4R78A 5DPVA 3NGAA 4WNMA 3VUMA 4B8LA 2I0HA 3L9LA 4BCKA 3V3VA 5K3YA 4FX3A 3QCXA 4PUZA 3R1NA 4K2RA 2GQSA 4F6SA 3R8MA 3FHIA 3F2NA 4RA4A 1JBPE 5EHYA 3UC3A 5DVRA 5BNJA 2HZ0A 5HKMA 4Q2AA 3GCUA 5A4TA 3NMUF 4HVSA 3SV0A 3R9RA 4PV0A 2UW8A 1ZZ2A 3L1SA 4QYHA 5A4LA 4C3FA 4NYEA 4FV9A 4V01A 3AC3A 3WYXA 2BPMA 3K3IA 4FSRA 1ZY5A 3RI1A 2UVXA 4FTUA 2HELA 5AAGA 1YQJA 4YLLA 5BVDA 3KC3A 2IPXA 2Z02A 5A4EA 2GHMA 4WA9A 3NZ0A 3NUNA 4U45A 2EWAA 4AF3A 3OVVA 5HU3A 2PE2A 4EH7A 3FMNA 4FTJA 2BZHB 4WNPA 4AU8A 3I81A 4BDEA 1B6CB 4YUQA 5KBRA 3ZHPC 1G8SA 3COHA 2WTWA 2YERA 3G9LX 4YPDA 5F20A 3CSVA 3BLHA 2YDIA 3MPAA 3U6IA 3DB6A 4MQ2A 4FKVA 2ZV7A 3GFWA 3EN5A 1QMZA 4JDHA 5FBOA 3O7LB 2ZYBA 2H6DA 2PZYA 4YJOA 5BVEA 2F7EE 1TQIA 3KVXA 2AC5A 2PVJA 4U79A 5CAUA 5E8ZA 4AZEA 5CALA 2VN9A 2WTDA 1OPJA 4GT3A 3G2FA 3VIDA 1UKIA 3CCNA 1JSVA 4ZIMA 4B7TA 4UMUA 2CN8A 2ONLC 1OB3A 4N6ZA 5IEYA 4LMUA 4X6RA 3TT0A 4BDJA 4EUUA 5IMEA 2HOGA 1H1RA 1G3NA 3DTWA 3I0QA 2DWBA 3F7ZA 4ZMEA 2ITVA 1O6KA 2HW6A 4UN0C 3E62A 2NRUA 2PVFA 4BC6A 5F1ZA 4C36A 1ZYJA 2BILB 5EYDA 3E88A 3K5VA 2CKQA 3OUNB 3H9RA 2BTRA 1U4DA 4LOPA 1VJYA 4MVFA 4CRLA 3F5XA 3CD8A 1DAWA 5EFQA 4LGDA 5GHVA 3W33A 2WTJA 5CEKA 2XKDA 4QQTA 2PMNX 4D1ZA 3KB7A 2QR8A 4IWPA 4JX7A 2XKFA 4TKSA 3NNUA 4OTQA 4AX8A 3GC9A 5DLSA 3ID6C 1UU9A 4JG7A 4KWPA 4NIFB 2YEXA 3QQHA 4BCOA 4NSTA 5AUTA 5HICA 5J1WA 2X6DA 3OCBA 1FMOE 3MFTA 2UW5A 3HVCA 4PDYA 3G51A 5HOAA 5GNKA 4OW8A 3SXRA 4RLLA 4MHAA 3W55A 1QPEA 3ZDUA 2C6IA 4J99A 2PY3A 5BVFA 2WMUA 3MJ2A 4MXZA 4S31A 3LFFA 4XYFA 4B9DA 1XJDA 3E87A 4CV8A 4NM5A 4CKIA 4QQ5A 3GOPA 5HE2A 2XP2A 4P2KA 4YBJA 4OLIA 4X0MA 3TV4A 4BRXA 3E3PA 1M7QA 3SQQA 1BYGA 1JQHA 2G15A 3PXRA 1H0WA 4RX5A 1E1XA 3E8NA 5DH3A 3CBLA 2W99B 2VTNA 3OF0A 1M52A 1Q62A 1QPJA 2VRXA 4EWHA 5BUEA 4E73A 2BIKB 4EHGA 5AAFA 3HKOA 3ORPA 2YITA 4K0YA 4U7ZA 2ZDUA 4GJ3A 4FTCA 1I44A 2AC3A 2NRYA 3A7FA 3I1AA 4LFIA 5EOLA 3RM6A 1WVXA 3R7IA 3VS7A 1PXNA 3SGCA 2YN8A 5KMIA 1L3RE 1WBOA 1WVYA 2PL0A 4GCJA 4IDTA 4U8ZA 5E8VA 1T45A 1XH5A 3LAUA 1Y6AA 4D58A 3AGMA 3PXKA 1H01A 4AOTA 1Q41A 1BLXA 4Z7GA 2P33A 3BHVA 3ZEWA 3RAHA 3BE9A 3D5WA 4CTBA 1KUTA 1ZWSA 3VS3A 3P7CA 1Q24A 4E3CA 1XHAA 4IIRA 3V6RA 3F2RA 3UYTA 4K77A 3ZUTA 2CCIA 4M12A 3KXZA 4U80A 2P55A 3RGFA 4LOQA 2JFLA 4BKJA 4FEQA 3VHKA 1M17A 3DGKA 4NJ3A 5D10A 4GS6A 2ITWA 3C4ZA 5M53A 1YOMA 4OT5A 4K1BA 3LHJA 1REJA 4BCHA 4WSYA 3WYYA 2BIYA 2BHHA 4O96A 5E8YA 4IEBA 5FM3A 1WBWA 2YLEA 4JR3A 1OL5A 3ZLXA 2W5AA 4NK9A 4WBOA 3RPOA 4R5SA 4BGHA 2IZTA 1WBPA 4UXLA 5AV3A 4EK4A 5EM7A 3BRBA 3OWPA 5HI2A 2WGJA 4EBWA 5AAEA 5CEQA 2R3NA 3SDJA 4TWNA 4UEUA 3ODZX 4TYIA 5TO8A 2WTCA 4EH2A 4QP9A 1NA7A 1YDTE 3C4XA 3D7TB 4N57A 3E7OA 3P4KA 4V0GA 3PYYA 3ORZA 4JDJA 3ENMA 3R63A 1CM8A 4RJ6A 5HE1A 3RZBA 4C37A 4BDGA 3E7VA 4FICA 4X21A 4BI1A 4RVTA 3ZONA 4XV1A 2E9OA 3OT8A 4HCVA 2XZSA 4CLJA 4S33A 3R7UA 3E93A 4QNAA 1R78A 2EXCX 4OTFA 3D2IA 2W4OA 4PRJA 4V05A 3ANRA 3RVGA 2UZUE 4EI4A 1Q8TA 4DH5A 2XB7A 3ZXTA 2BRBA 4PQNA 3DBQA 4ANBA 1YHWA 2QOQA 3AC2A 4QMMA 2CGVA 2YIRA 3B8QA 1Q97A 3IPHA 5GZ9A 5J9YA 4L6QA 4QMXA 1P4OA 4JIKA 4ENXA 3LCKA 5AUZA 5HVJA 2XNOA 5AP5A 3F5GA 3BI6A 3WI6A 4MBJA 2EXEA 4YNOA 2QLQA 3V5QA 4PY1A 4RG0A 4FK6A 4G3DA 4QMPA 3QC9A 5FD2A 5EKNA 1HCLA 2WEVA 4QYEA 5FP5A 2O65A 3DJ6A 5EM5A 5EYCA 3GOKA 4JXFA 5B7VA 3OROA 5IA0A 2F4JA 5HLWA 3EZRA 3HAVA 5BYZA 3DJ7A 4EOPA 1UU3A 3LIJA 3MSSA 4Q9SA 2W1HA 3LQ8A 4PTCA 1AGWA 1YHSA 4NFMA 5FLFA 3PLSA 4AW5A 3AXWA 4PMMA 4DFLA 3Q9ZA 3FLQA 5G1XA 2UW7A 4M15A 3IG7A 4L52A 1NY3A 4O6EA 5CU4A 3LCDA 3WF9A 3ETAA 3HNGA 5ANGA 3SRVB 1U54A 5KO1A 4JAIA 3I7CA 3BCEA 4M7IA 2VWWA 3AMBA 4F65A 4YSMA 3F88A 4YJVA 3UPZA 4YO6A 3MB7A 4ASEA 3BU5A 1MQBA 2DS1A 5EI6A 5HNBA 4YHJA 4JX3A 1TQMA 2O3PA 4ZJJA 3NUPA 3OEFX 3EFJA 2H9VA 4KKHA 3G9NA 2A4LA 4EZ7A 3F7WA 5IH4A 2R3MA 4USDA 4CMTA 1J1BA 1URCA 2OIQA 3RNYA 4BI2A 3TXOA 2HXQA 5CU2A 3O7LD 4EOKA 4BWXA 5IH5A 1NVSA 4HVGA 3ZMMA 2XRWA 3QD3A 3GU6A 2XBJA 5FDXA 2Y8OA 3MA3A 2OFVA 5C1QB 5EYKA 1XH4A 2BALA 4UALA 3O17A 4FKUA 4KD1A 2XNNA 3QYWA 4NW5A 2RG5A 2YCQA 5M55A 4JBOA 5JMSA 1OZ1A 4O0UA 3W2SA 5IKWA 4ZSAA 3IOPA 3O8PA 5CT7A 3IK3A 5IA3A 4RZVA 4HNIA 5I9VA 5BVNA 5M4IA 3NSZA 4JLCA 3UC4A 3MDYA 3EH9A 5CVHA 5FRIA 3BQRA 5ANOA 5ICPA 3VRYA 1Y6BA 4BBFA 4FC0A 3HUBA 1SYKA 1U5QA 4WOVA 4QTDA 5HNIX 2PVYA 3OWJA 1IA8A 2JDOA 3Q9YA 3ZUUA 5M51A 2GNJA 4MXCA 3E8EA 4EUTA 2ZV8A 3EQPA 2OJJA 4D1SA 5E7RA 1SVGA 3FSKA 2OZAB 3E92A 3TJCA 2WOTA 3FJQE 3PPKA 4RVMA 3UO4A 4OTHA 3P78A 4EORA 1CDKA 3I4BA 3GC8A 4BFMA 4J97A 2UW3A 3QTQA 4MXYA 3FZTA 3BZ3A 2OXYA 4BZOA 1Y57A 4OBOA 3JR1A 1ND4A 4XV2A 4S2ZA 3PJ1A 4JR7A 4EYJA 5TT7A 3IO7A 5DOSA 2J5FA 5A3XA 3LJ0A 4QMSA 4PTEA 2WZJA 5KBQA 3NNXA 4EOIA 3MVMA 3K5UA 3HRFA 1J3HA 3MH0A 1PF8A 1KE9A 4USFA 4K33A 3ATTA 3LQ5A 4R1VA 4C4HA 2ZM1A 3DFAA 5FM2A 3BHYA 5AP7A 3OXTA 4X7QA 2UZDA 1V0OA 2CGUA 3NUXA 1WBVA 3QKMA 3RHXA 4YTFA 4D2PA 2JAMA 2I0YA 3COKA 4PL3A 4FA2A 4DGMA 2VZ6A 3M2WA 3T9TA 3R0TA 3ZUVA 2FB8A 2JD5A 2UZOA 4FZFB 1B39A 3VS5A 5ETIA 4YZBA 3UVQA 4APPA 5C4KA 1WFCA 1BI7A 4H58A 3PRFA 1Z9XA 4U3YA 5EYMA 2HENA 4RFMA 3KKVA 3O51A 4YMJA 1YXSA 3GP0A 3IW5A 4KIKB 3D15A 5HCYA 3KN6A 1HOWA 1V0PA 4WRSA 3DBCA 2BDFA 4YTIA 3F5PA 4YZNA 4I3ZA 4JQEA 4NUSA 4O7LA 4MCVA 4A9SA 2QOCA 3WE4A 3RAWA 4UYAA 2CN5A 2CGWA 2XK7A 3FV8A 3RWQA 4RGJA 4P5QA 2X2MA 4DTKA 3TKIA 3ZM4A 3HV3A 4H3BA 5KMJA 5IEVA 4CZUA 3DNEA 5AA9A 3UP7A 3FMKA 5IQAA 5L8LA 4Y85A 4BR3A 4IAIA 5IQDA 1P14A 2CSNA 2OI4X 3BYVA 4FG8A 4RRVA 1WBNA 4XCUA 5CU6A 5HCZA 4IACA 4L8MA 4EBVA 2ITPA 4ERKA 3QD0A 2YIQA 5KZ0A 4MNFA 1OMWA 4EKLA 4IJ9A 1LUFA 4S32A 3F3UA 4O83A 2G01A 2YCRA 1Q3WA 3TTJA 5BPYA 5DWRA 3KA0A 1QPDA 3V01A 2G2FA 3OC1A 3HECA 4D0WA 3V04A 4G5PA 3RALA 2JDTA 2VNYA 3IDBA 3UO6A 4LUDA 2QOBA 4IQ6A 1Y91A 2C6KA 2XK6A 2QHNA 2C5NA 5CEPA 2LAVA 5FDPA 4F6UA 1DAYA 2YM3A 5AUWA 5L2QA 4TYHA 5HZNA 4O84A 3OT3A 2PVRA 2WMBA 2JIIA 4NW6A 4NL0A 4UBAA 4NTTA 5D7AA 4LL5A 2WQEA 3PVGA 4I92A 4I4EA 4FV7A 4I5CA 5AR2A 4L67A 5JH6A 1GIHA 2YZLA 3RHKA 3QX2A 4WG3A 1OM1A 4G3GA 4L3JA 5EDRA 2C47A 3IECA 4KRCA 5KZIA 4QQJA 4N70A 3CTQA 4Z16A 3GENA 4LMNA 4RQKA 4ZY6A 4ANNA 3QQLA 5CXHA 4UYNA 2F49A 2WMWA 5EHOA 4A4XA 4HYUA 2VTQA 3B8RA 4E4MA 3ORKA 2O8YA 2VO0A 3UJGA 4MD7E 4TYGA 3RPRA 2GS7A 3N4VA 2WTKC 2C5OA 2BZJA 2V0DA 2YIYA 1GAGA 2PMLX 3KXHA 4ZJIA 3QLFA 3VBXA 5L8KA 2UVZA 2C0OA 2EVAA 5E9EA 5M4FA 2XJ0A 4X2KA 3VUGA 4I0SA 1I09A 3C0HA 3Q6UA 2VWVA 2B1PA 4XH6A 3PY3A 3S95A 3VF8A 1IASA 2R3QA 3QXOA 4RFZA 3RTPA 4BHZA 3AT4A 3WIGA 4EH3A 4BHNA 3GBZA 1WCCA 2YCFA 4L68A 5FBNC 3QL8A 3ZOSA 4OAUC 4MQ1A 5FUTA 4BYIA 5D1JA 2XEYA 3QUPA 4IWDA 1V1KA 5AP1A 5K5NA 1BX6A 3CPBA 3LFEA 5EW8A 4CD0A 4CZTA 5AEPA 1NT2A 2PUIA 4H05A 3Q2MA 4QYGA 4AZSA 3MJ1A 2E9VA 5IQGA 3FLNC 4K18A 4ERWA 3OBGA 2OSCA 2XNMA 3KEXA 4FODA 1IAJA 3KRLA 5EKOA 4V04A 4GT4A 4YGAA 3QLGA 3KVWA 4FTRA 4O0TA 4R3RA 1MUOA 1PYEA 3OFMA 3PIXA 3F82A 5J9ZA 3A7IA 3FXXA 4G5JA 2WOUA 4A07A 3ZEPA 4QMZA 3R9DA 4PMSA 4IVAA 2GNGA 3DLZA 1Q61A 3Q4UA 4I23A 3RCDA 3CD3A 4RVKA 3D5XA 4FKTA 5M57A 4QYFA 1YWNA 4L7SA 3RPYA 3FZSA 3MESA 3VS0A 2PHKA 1Q5KA 4KKEA 2OJFE 3G33A 1ZMWA 3T3UA 3V8TA 2WMAA 1YWRA 3R1YA 3LFQA 1WZYA 4IAFA 4IBMA 5FEEA 3UP2A 4O7VA 5IQBA 2WELA 3H9FA 3TACA 4BCPA 4YC8A 1J91A 2B4SB 3FI3A 3HUCA 4GV1A 3MTFA 4YR8A 2ZDTA 3PXQA 5IEXA 2JIVA 5HNGA 3UIMA 4E6CA 1OIUA 2A0CX 3H10A 3K2LA 3UPXA 4I0TA 5TR6A 1CKJA 4U40A 4UMRA 3DQWA 4CFFA 4EOJA 2X2LA 4JG6A 3QQFA 1MRYA 3QQJA 3WZUA 2H8HA 2V55A 2YM4A 2BDWA 3FY2A 2XK9A 4CSVA 4F9YA 4RC4A 4EK5A 2VGPA 4GRBA 5J7HA 3ZRMA 3UQFA 4ONAA 4Y73A 5E8WA 2ERZE 5E8TA 3NW7A 1GZKA 2ETKA 3A4PA 3I6UA 1A9UA 3R6XA 1BKXA 3EQHA 3NS9A 3PZEA 4FBXA 3KY2A 4M0YA 3ERKA 3EIDA 3FC2A 5IMXA 1YW2A 3HDNA 3OXIA 2Y0AA 3E64A 4JT3A 4BDFA 3HMOA 1U46A 4D2SA 2WTKB 5T3QA 3MFSA 5ANDA 4FOBA 2OBJA 3L9NA 2QC6A 3CR0A 3BWFA 2P2HA 2Q0NA 2WQMA 3JYAA 1YVJA 4X3FA 5EG3A 3D7ZA 5F95A 1OBDA 3HYHA 4N0SA 4PPCA 4MYGA 4C0TA 4L7FA 4LRJA 2PPQA 3WE8A 3EFKA 3QCSA 4D5HA 2WNTA 1Q8ZA 2YJSA 3OWLA 2OWBA 4I5HA 2JBOA 2OLCA 3ET7A 3II5A 4FSQA 3MVHA 1RE8A 2R7IA 1H00A 2JC6A 3ZO4A 4AT3A 3QWKA 5AX3A 3CLYA 3A8XA 4RIWA 1GZNA 3AMAA 5LJJA 4G3FA 1U54B 2FO0A 4FVPA 5BX0A 2R3IA 2X1NA 4C4EA 4DH1A 4ZSLA 3SG9A 3R9NA 5TE0A 3CJFA 4HGEA 3AD6A 4O81A 2UW0A 5IG1A 1OKVA 5E8UA 3OBJA 4YPSA 3VWAA 1PXLA 1PMVA 2CLQA 4RBLA 4YJRA 3PPJA 3VUHA 4PP9A 2JITA 3RM7A 1OL1A 1ZZLA 4RC3A 2ZMDA 4QMUA 4FSWA 5EH0A 1GJOA 4W9WA 3WARA 5D7VA 3OEZA 3QXPA 5D12A 2CHLA 2YABA 2ZMCA 3MIAA 4TWCA 3W32A 5KMKA 2BCJA 4FTMA 4MK0A 3RPVA 4M3QA 5LVPA 4BCFA 2PZRA 3ZU7A 1WBTA 1JKSA 5AIRA 4UY9A 4BGGA 3DXQA 3MFRA 4BTFA 4L43A 4ACGA 2HY0A 4EL9A 3BHHA 3PXFA 2QURA 3GVUA 3MVLA 5JFSA 4FT0A 4DHFA 2HZ4A 3DZOA 4E5WA 2IG7A 2ZAZA 1REKA 1OBGA 5ACKA 2VTPA 3HGKA 3NPCA 4JRVA 4MXOA 4D5KA 5JEBA 3AQVA 4RX7A 3R9HA 4O7RA 2JKMA 1TKIA 4F0IA 4GUEA 3UODA 2PVHA 3LFBA 2OZOA 2QONA 1A48A 2LGCA 3SXFA 3BGZA 3MI9A 3TI1A 5CU3A 2JKOA 3ZSHA 3TN8A 4KNBA 5DYJA 3QZHA 4KBCA 3UBDA 3U54A 2PE0A 3B2WA 5IDPA 5EW3A 4BCGA 4MXXA 5AV4A 5ANKA 4H3PA 2OGVA 2X9FA 3PP0A 5LVLA 3BGPA 4XX9A 4E6QA 3PPZA 4FGBA 4NZWB 4PNIA 1TQPA 4M67A 4RFYA 3K3JA 4YC6A 4FV3A 3FY0A 5KCVA 1PKGA 5BYYA 5I3OA 3H9OA 4UX9A 4FTLA 4BGQA 3PWDA 3FI4A 1H07A 2B7AA 2VWUA 3AGLA 4FR4A 5CYIA 3JUHA 3KRJA 3RPSA 1VR2A 5DMZA 1GIIA 3GGFA 1DI9A 3PXZA 2Z2WA 4HZSA 3HRBA 3VQUA 3W2QA 4ARKA 5BMMA 4EH6A 2WFYA 4E1ZA 1HCKA 3PE2A 3QTSA 2PVMA 2WO6A 4I5MA 4CFUA 1URWA 5JFVA 2WB8A 4DFXE 4EH9A 1ZOGA 3FMLA 4AGWA 2HW7A 1JAMA 4K11A 2C6DA 4U44A 3TKHA 3ZFXA 3KU2A 2C6OA 1X8BA 2ZM4A 4AUAA 3DY7A 2BRGA 5KKRB 1H8FA
chains in the Genus database with same CATH superfamily
4HVHA 3MWUA 3S3IA 2GNFA 5GJFA 4CQEA 1ZAOA 1KV1A 4H39A 1UNGA 3BKBA 1OIYA 3E5AA 2FGIA 4YURA 2W1EA 5L4QA 3WILA 4FTNA 5F9EA 2AEGA 3TV7A 1TFFA 4QP6A 4I24A 4D0XA 5HU9A 1CMKE 2QOFA 3DK7A 4GFOA 4M8TA 2YIXA 4XG7A 4KS7A 1UV5A 2J0KA 1PXOA 4BCJA 3EQDA 3AC1A 3VO3A 3ENHA 3FL5A 2R9SA 4CV9A 4B6LA 4CT2A 4Z3VA 3R73A 2Y4PA 3FKLA 2GSFA 4YZ9A 3Q96A 3JXWA 3FQHA 3ZTXA 3AT2A 3PFYA 2WIHA 1R0EA 3LFNA 4FUYA 3AD4A 3QWJA 4FTQA 4ZZMA 1ZARA 4LL0A 1ZYCA 4GIIA 4PTGA 4R6VA 4D55A 2BROA 3FLZA 3Q6WA 2PULA 2CNUA 3GCPA 4IX5A 3DZQA 3UGCA 3UE4A 3W2CA 3Q52A 2C3KA 4GFGA 4F08A 2OG8A 4AG8A 5KMNA 1R1WA 4C58A 4DEGA 4YJNA 4DGNA 4F9BA 2C5VA 5HTCA 3LFSA 1P4FA 3WZJA 2Z7SA 4FRFA 5DI1A 3TNQB 3MY0A 4G6LA 3QF9A 4D4SA 5T68A 1W82A 2DUVA 2QLUA 4HZRA 2GQRA 4OTRA 4ACHA 5K4JA 4J95A 1W98A 5DR9A 3THBA 4TNDA 2PUUA 4YZCA 4HVDA 3C0IA 4W9XA 5DRBA 4FIIA 5DEYA 3R1QA 3E3BX 4JQ8A 2JGZA 4FMQA 2PZIA 5CZIA 3UG2A 4AZTA 4C8BA 3ZH8A 5HVKA 4TYHB 3ZRLA 3QD2B 2B52A 3C51A 1F3MC 3CE3A 4FT9A 2BTSA 4NU1A 2JDRA 3CJGA 2HYYA 2UUEA 2XJ2A 3FL4A 4ZY4A 5AP0A 4DEDA 4O1OA 3FZOA 1BUHA 2W1CA 4U6RA 5AIKA 4YHFA 5BVOA 3DK3A 2XALA 1OPKA 4AW2A 2ETRA 3LXNA 2IF8A 4B99A 2Y4IC 4AQCA 3EOCA 3FKOA 4R1YA 1OGYA 3Q5IA 3IS5A 4XLVA 4CEGA 3TZMA 4CLIA 4YLJA 5FWKK 2NPQA 3MIYA 3OCSA 2EU9A 5E8SA 2C30A 4FZAB 1H08A 5L2SA 5M44A 2V7AA 5BUJA 1IG1A 4BTJA 4PP7A 4FT7A 4I22A 3AG9A 4RIXA 3VS2A 3WZDA 5KNJA 2HXLA 2QI8A 2I40A 2Q0BA 2WXVA 3DAJA 2ZOQA 1W2CA 2FSOX 3W8QA 4EH8A 2XK8A 1FGKA 3FUPA 4NCTC 4X3FC 1QPCA 3P79A 3ROYA 3WBLA 2IW9A 3GXLA 3QALE 1LEZA 1CSNA 2DQ7X 2O0UA 2CNQA 4F9CA 5FTGA 2W4KA 4FL2A 4EWQA 2B53A 5JN2A 4M68A 2IZRA 3FLYA 4PPAA 5IQEA 3EQIA 3UZTA 4C57A 4DEIA 2IVSA 4R3PA 3O71A 2F2UA 4O0VA 4DFZE 1G5SA 5E91A 1Z57A 5CWZA 2CNVA 4FI1A 4CFNA 3Q4CA 3V5LA 3LLTA 2ITOA 2P4IA 1APME 2X9EA 2H34A 2ITQA 4NT4A 4NFNA 3LXKA 3B2TA 3ZYAA 1U59A 3U9NA 4C38A 1PKDA 2CLXA 5CANA 3I5NA 4GVJA 5M08A 4GYIA 3UIBA 2XEZA 1YHVA 2QD9A 4UWBA 2OXDA 3TIZA 2CPKE 3LCTA 2ITTA 2BVAA 4EZ3A 4FKQA 3CXWA 4O7NA 1RDQE 2WAJA 3RNIA 5LMKC 3BYMA 3Q53A 4FV5A 4TRLA 2PMOX 5HO8A 2XM8A 2P3GX 4O7WA 2C3LA 4FNZA 1YI4A 3LMHA 3RZFA 1LEWA 4Z7HA 1XMLA 3C5UA 3Q04A 4KBKA 4C62A 4ANLA 3H3CA 4IB3A 3PWYA 4I41A 3UQGA 3ZSGA 2BRMA 4C3RA 1JWHA 4AOIA 4F7SA 5M06A 2R3LA 4EYMA 4E4XA 4L53A 3N4TA 3TUDA 3UMXA 5DT0A 4JAJA 5J95A 3D9VA 3LCOA 4IVBA 1F5QA 4EOSA 4C4IA 3JVSA 4A06A 4TYEA 5HD4A 5CI7A 5IH6A 2XCKA 4TZRA 3VBQA 3VF9A 1M2RA 3QFVA 4FKOA 5EM8A 4IZYA 2RG6A 3CQWA 5AM7A 4F70A 3FBVA 4XNEA 1ZLTA 3QCYA 4A9UA 3VNTA 4ALVA 1XBAA 3QTRA 5HLNA 4AAYA 4XRJA 2XKCA 4J7BA 4JIAA 1UU8A 2J51A 1XH9A 2UVYA 5F94A 2UZBA 3ULZA 2XNEA 4ASZA 3KF4A 4PWNA 4Y46A 1WAKA 2GS2A 4DTAA 3SXSA 3JY0A 3U6JA 4DG2E 4O22A 1M7NA 3IW7A 3BEAA 2Y4IB 3NFFB 4A9TA 4O0XA 5TF9A 4MNEA 4QT1A 4FIEA 2VUWA 3ZO1A 1IAHA 4ZP5A 3KRRA 4DDGA 3NYXA 1OGUA 4L44A 4NKAA 4RT7A 3TJDA 4EC9A 1O6LA 2V62A 1ZYLA 3H4JA 4OBPA 4MD8E 3UOLA 4BCNA 1XH6A 2OJIA 2R3OA 3C4WA 5EDPA 2JLDA 2YZAA 5EHLA 3QCQA 2RGPA 2BFYA 5CSXA 3DJ5A 5I9UA 4QQCA 2J90A 4AOJA 4FKLA 1F0QA 2KULA 5FTOA 5IA1A 1O6YA 5I9YA 2YDJA 2Z7LA 4MKCA 3TL8A 4X3FB 4BJJA 3PJ8A 3VN9A 4YJSA 2JKKA 5DHJA 5HTBA 1H24A 3IGOA 3BQCA 3VVHA 3QHRA 4FKPA 1OUYA 3GU5A 3U8WA 3ULIA 2W1DA 2Y9QA 3C13A 3GEQA 3NNWA 4K9YA 5HG5A 3QBNA 1P2AA 4O7SA 3SA0A 4YP8A 3KXNA 3P86A 1NVRA 3AC8A 3LMGA 3Q3BA 4J8MA 3NLBA 3IONA 2W7XA 4DA5A 1XR1A 1KE6A 2W1FA 2WU7A 3DBDA 4PDSA 4QMVA 5DA3A 3VBYA 3U55A 5C8NA 4RIWB 5DR2A 4KRDA 3BLRA 1YOLA 3W8LA 3DPKA 3AMYA 4EHVA 2B55A 4XV9A 3N9XA 4W4WA 4U97A 3DS6A 2Z7QA 4A9RA 5LVNA 4P5ZA 4U81A 4DEBA 4XV3A 1JKTA 1LPUA 3NVKI 5HCXA 5A14A 1PHKA 3EWHA 3OWKA 3I6WA 4IH8A 3HV5A 4EK3A 4DHJA 5EI2A 5FXRA 2G9XA 5JQ8A 2QQ7A 4AW1A 5LWNA 3ACKA 4AT4A 1OITA 4ZTLA 3W10A 4BDIA 1KWPA 2QODA 3MW1A 4FV2A 2BAQA 4AGCA 3BV3A 4WG5A 1OECA 4AS0A 3Q2JA 3MFUA 2HAKA 3NAXA 4FKIA 2J6MA 3E8DA 3KL8A 4RWJA 4UXQA 3ORTA 3VS4A 3EFLA 2ITUA 4LM5A 2OK1A 5I5ZA 2CDZA 2XBAA 2RFEA 5EK7A 4IC8A 3F3TA 4GT5A 4J1RA 3KK8A 4DC2A 3KMMA 3CP9A 3HV6A 5IA5A 4FKGA 4ZSJA 1W2FA 4LGHA 3NCZA 4D2RA 3W2PA 3P5JC 3WZKA 2YWPA 1Q8WA 3QKKA 5EW9A 3R04A 3ORNA 4CG9A 3FXWA 3MY5A 4FIFA 1J7IA 4BDKA 2QO9A 2XCHA 3FSFA 4ZLYA 3R9OA 5EM6A 3C7QA 4DGLC 3HMIA 4YJUA 5A6OA 3QQGA 4Q9ZA 3O8TA 1YXTA 2B9HA 5JRSA 3EQBA 4LI5A 2NP8A 5JQ5A 3UO5A 4IM2A 3Q4TA 2UZLA 4XHKB 2OU7A 5G6VA 3EN6A 4PDPA 5CAOA 1BMKA 1FQ1B 1KOBA 1ZY4A 2XF0A 2YM6A 4II5A 2X0GA 4J96A 4O27B 4CYIA 3D5VA 1MQ4A 4G6NA 4QPSA 4XG8A 4UV0A 3ZS5A 5CSHA 3R1SA 1VEBA 4CVAA 2J7TA 4IX4A 2JAVA 2W1IA 2YFXA 2O5KA 3OCTA 4IADA 4EOMA 4AXAA 3KCKA 1H27A 2XNGA 4QD6A 4FSTA 1OL6A 2J9MA 3PA5A 2CGXA 2R3JA 3EZVA 2WKMA 2O2UA 5DBXA 5ITAA 3LFDA 4BTMA 2GU8A 3H30A 4O0WA 3SHEA 3V8WA 5CF6A 4NM3A 2ZB1A 3CTJA 4WG4A 4RIYA 4MD9E 3QUEA 4B0GA 3NFGB 2YA9A 4TXCA 4ZZNA 5GZ8A 5KHXA 5H8BA 5BQ0A 3QRKA 4KAOA 5LVMA 5DIAA 4IX3A 2GFSA 5HIDA 4OTIA 5CI6A 4D28A 4KBAA 4Q5HA 5IF1A 4JG8A 4RX9A 1OL2A 3GT8A 2KTYA 4IAZA 4YHTA 4BKZA 3U9CA 1W83A 3DBEA 4ASXA 4F6WA 3L8SA 4QMOA 4C61A 4IWQA 3LE6A 2FH9A 5CASA 1UWJA 4OTWA 3BU6A 1E1VA 1ERKA 2E2BA 5HE3A 3RK5A 4DEHA 2X81A 3HV4A 3EYGA 4W4XA 5DE2A 2VGOA 2DYLA 4FEWA 3Q4ZA 3ITZA 4ZAUA 3TG1A 3HA8A 1ZXEA 2J5EA 3FDNA 3OY1A 4FTKA 1EH4A 2J0MB 2UW4A 4I6HA 4XLIA 3V5WA 4ZK5A 3OUKA 2W05A 2WMQA 3QRIA 3GQIA 3ODYX 3EN7A 2XVDA 4PMTA 4CMUA 4DINA 5HX8A 5IDNA 1BL7A 4E93A 4J52A 3VBVA 4BI0A 4XP3A 5H8GA 4DCAA 2F7ZE 5HBEA 5DEWA 3LJ1A 3VS1A 2W5HA 5DT3A 2GNHA 2QCSA 3M11A 4GK3A 4FOCA 3P9JA 4MWHA 1CKIA 4UZDA 4MH7A 4X3JA 5KMLA 4AW0A 4F7NA 4F64A 3KULA 3HL7A 4DFUA 4F63A 4Y72A 2I6LA 4ACDA 5CLPA 2VTRA 3DDQA 5AUXA 4BBMA 4YO4A 4BDAA 4JBPA 4XP2A 2QOLA 4GSBA 3AOXA 4FEXA 4NEUA 2YISA 4ZS0A 3DCVA 5L2IA 4C4GA 5IPJA 2OF2A 2OH0E 3U6HA 1VYWA 3RK9A 2IZUA 1V0BA 1E9HA 4Y5HA 3WF8A 3C5IA 1PXJA 3E8CA 2XA4A 5M4UA 2C0IA 5A4QA 4FKSA 4YU2A 2WQOA 4EONA 2BMCA 3OCGA 4OT6A 5AM6A 4C34A 1GIJA 1PMNA 2OJ9A 2BKZA 4DH3A 4DT8A 3FAAA 4DAWA 3ZZWA 3EMGA 3LXLA 2X8EA 4HNFA 4QP1A 5IUGA 3R21A 3UOKA 3HP5A 3NNVA 4LDTA 4DLIA 3KRXA 4TPTA 5CF5A 5T6KA 4A9YA 4G9CA 1W8CA 2QNJA 3NR9A 4CYJA 3LKMA 2ESMA 2FYSA 2XIZA 3PSCA 4QPAA 4DFBA 3PLAE 2HIWA 2BUJA 3ORIA 5FTQA 3R83A 3TDVA 2FA2A 2VTHA 3L8PA 4AA5A 3QHWA 1ZOEA 4FG7A 4P90A 3W2RA 4CNHA 3MVJA 4BF2A 3DDPA 5LCJA 5ETAA 2OW3A 5L2TA 3PY1A 4UZHA 4JVGA 4RIXB 5CTPA 3HAMA 2Y6OA 3QTWA 3OW4A 3R22A 4MX9A 1XQZA 3COIA 4FNYA 2QOKA 2R2PA 2B9JA 4G3EA 4MF0A 1OPLA 2YAAA 4GEOA 4I6BA 3DOGA 4WNKA 2VWXA 5K0KA 2GNIA 3R7YA 3BX5A 5AV2A 3MBLA 2H96A 4NM0A 2GTMA 3G90X 2E9NA 4BZDA 1XMMA 3EYHA 3U4UA 5CXZA 4IZ7A 4AA0A 2CJMA 2I7QA 4WUNA 3I7BA 2A2AA 4FTAA 4KSQA 4WNOA 4OR5A 2RFNA 3BYUA 4BZNA 3A7GA 4CTCA 4TTHB 4V0GB 1AQ1A 3ELJA 4QDEA 3PZHA 4FK3A 2VD5A 4ANSA 2FSTX 4KSPA 5I3RA 2VAGA 2UZEA 2XK3A 4X2GA 5IQIA 4L01A 2GS6A 3HMPA 4FSYA 3RINA 4IXPA 3UQCA 1J7LA 3GQLA 3C4FA 4O38A 4NJDA 5EQYA 2VWIA 3D5UA 5HVYA 4FEVA 4CKJA 2RSVA 2R3FA 3QTZA 3RCJA 5A46A 4NM7A 2F57A 2RIOA 2W96B 1GOLA 3I60A 3R8ZA 3UIUA 5IQCA 4HGTA 3BEGA 4O21A 4CCBA 4J71A 2YACA 3KFAA 3U87A 2P2IA 4ID7A 4O91A 5CAPA 2R3KA 1PMUA 4LUEA 5CQUA 4RJ3A 5J8IA 5KMMA 1PXPA 3P08A 4DFNA 3CQEA 1RJBA 5EI8A 5AX9A 2W4JA 3FXZA 3CKXA 4FSNA 1FPUA 4RIOA 4LRKA 4IB0A 3IW8A 3R2BA 5BV3A 2QOIA 3VJOA 4ZEGA 4O0RA 3SX9A 4ALUA 3QRTA 2PYWA 4WKQA 3UDZA 4ZSEA 3P0MA 1UNHA 4R7HA 1OL7A 4FZ7A 4U3ZA 2VNWA 1YI6A 2VTTA 4NCTA 1ZYSA 1OKYA 5FXSA 5C9CA 1SVEA 4LV7A 3Q5ZA 3V5TA 1B38A 4LYNA 2JDSA 2WD1A 4BBEA 5FG8A 1S9JA 3A4OX 3MGYA 4RWKA 4GU9A 5HX6A 1SNXA 5JGDA 2REIA 4A4LA 4AE6A 5IQHA 4IMYA 5JRQA 4FNWA 5CX9A 4FL1A 3QU0A 4R77A 2X6EA 3PG1A 2F9GA 2XJ1A 1BI8A 5E1EA 4C33A 5J79A 5E4HA 2X2KA 3D83A 4O82A 3MPTA 2QU6A 5HG9A 4CFMA 5CY3A 4K6ZA 3PIYA 1K3AA 4S30A 3ZFMA 1DS5A 3A60A 3AC5A 4FV8A 2X7GA 3VW6A 4AZVA 3C9WA 4FKJA 3OY3A 4IWOA 5H8EA 4FJVA 4GKHA 3IDCA 1PMEA 3R71A 4U5JA 4QTBA 4QMQA 5BMSA 1XKKA 4MNEB 3ZLYA 5TOZA 3FKNA 5LVOA 3EHAA 3PA3A 3BU3A 2EB3A 3G6HA 2A27A 2O64A 2PE1A 2IEWA 3AKJA 3W0MA 1AD5A 2R3HA 5LARA 3DKOA 1ZMUA 3LVPA 3CQUA 1XH7A 4OTDA 3EQCA 5AR8A 3SLSA 5LMKA 3UNZA 3TUCA 3A2CA 4U0IA 4GYGA 4A4OA 4YTHA 2W9FB 4FF8A 2GPHA 4AXCA 3Q32A 2W5BA 2QOOA 4HOKA 4MF1A 5AR4A 2HY81 5EDQA 1TZDA 2HZNA 4BL1A 4CKRA 4FNXA 5D9HA 3K54A 4EZ5A 4IAYA 3PSBA 4IVCA 5LQFA 4BJJB 3AT3A 2E9UA 1OI9A 1G8JA 2BFXA 2I1MA 3P7AA 2C5XA 3ZM9A 1FVTA 4O4BB 4FV4A 4I21A 4DITA 4Y95A 1W2DA 3IQ7A 5CF8A 4NWMA 3MS9A 3FMEA 2CCHA 4AA4A 3F2AA 4A7CA 2IW6A 1NVQA 3LM5A 3WOWA 4AP7A 3QZIA 4I0RA 1J1CA 3GCSA 4QPMA 2YLFA 5IA2A 2XYNA 5LWMA 3GC0A 3HRCA 3BYOA 4MTAA 2VTLA 1P5EA 4G9RA 2OICA 4IFCA 2BDJA 2ITZA 2QVSE 4G34A 4XOZA 4CRSA 4E20A 4L00A 4PL5A 2BAJA 3O0GA 5CSVA 5AWMA 3VAPA 3ACJA 4CMOA 4CT1A 3R30A 4ITIA 3S00A 4M97A 2HZIA 2Z60A 4F9WA 3BE2A 3MA6A 4EQCA 2PU8A 1JSTA 5KE0A 5CEIA 2OF4A 4DH7A 4HYIA 3D0EA 3R01A 4MBIA 3VBTA 2ACXA 3PJ3A 4FVRA 4AT5A 3PJCA 4F0GA 3BLQA 2XIKA 4AN3A 2GDOA 3VUIA 3NX8A 1H1WA 3WIKA 4C35A 1J7UA 4DYMA 4O1PA 5J9LA 1PXIA 4E6AA 4DTBA 3I5ZA 5C8KA 1R3CA 5CEMA 4OGRA 2VTAA 5HG7A 2VX1A 2YDKA 3BHTA 4Q5EA 4WO5A 3T3VA 4KIOA 5AR3A 1Y8GA 4XJ0A 2ITXA 2IWIA 4KIKA 3ZBFA 2OO8X 3A7JA 4P7EA 2RKUA 4D4VA 4TL0A 5L3AA 2V7OA 3UOJA 2J0IA 3ORXA 1MRUA 5I4NA 3EQGA 2BKKA 3BHUA 3IDPA 3UDSA 3BV2A 2VWZA 3EB0A 5IUHA 3F69A 4L45A 4JS8A 4LGGA 2PVNA 2VTIA 4RJ8A 1XWSA 3C4EA 4TYJA 2I0VA 4WT6A 3ZSIA 2JDVA 4ZMFA 4L42A 3JY9A 2PVLA 2XRUA 3S1HA 2B9FA 2IZSA 4FKRA 1SNUA 2XS0A 3PSDA 3DTCA 4LRMA 4E8AA 3HP2A 1LR4A 5DG5A 2XAOA 5C26A 4G31A 2VV9A 2JFMA 2VTJA 3NDMA 4XS2A 3CEKA 2VTOA 1SVHA 2Z7RA 3Q9XA 4IFGA 4BIDA 3T8OA 3W0OA 3OOGA 4GMYA 4H3QA 4USEA 4EQUA 1YDSE 4OUCA 3BLAA 1YXVA 2ZV9A 3UNJA 3FMDA 4I5PA 3OOMA 1Q4LA 1VYZA 1H25A 4I1ZA 1XO2B 4ZLZA 3EFWA 3GFEA 3TMOA 3UZRA 4JQ7A 4FT5A 5ETCA 3DKCA 5CU0A 4BCIA 5IA4A 3W0QA 4MWIA 3DKFA 4DEAA 5LOHA 4D2TA 3PY0A 4H1JA 1JLUE 3ZO3A 4Y83A 3SOCA 3NAYA 2V22A 4QTAA 5C01A 3WF6A 2VU3A 4RIYB 1T46A 3CPCA 2WEIA 3LJ2A 4S34A 3EN9A 2J50A 3QYZA 1GY3A 3TNWA 3TNHA 4F1MA 4QP2A 4M69A 1PW2A 4E26A 4UMQA 3QA0A 5L6OA 2WMXA 4QTCA 5AP3A 2R3GA 1QL6A 3ZC5A 4F0FA 3TM0A 3DAEA 5IISA 4DE4A 2RFDA 2UZVA 1OIRA 4AE9A 4EJNA 3NYOA 3LLAA 5HBJA 3SAYA 3TEIA 5LMBA 2C1BA 2OXXA 1JPAA 2W17A 4GJ2A 4EQMA 2WQBA 4U9AA 4L3LA 3OHTA 4W8DA 5B2KA 3RK7A 3MTLA 5JFWA 4FEUA 4WSQA 1NXKA 3O2MA 4IDVA 2IO6A 1K2PA 2X39A 2XIXA 3DB8A 4H36A 4MEDA 3RAKA 1OUKA 1JNKA 4EK8A 2HCKA 3A62A 3COMA 2NO3A 2JBPA 2X8IA 4DHZA 1ZRZA 2RF9A 2BZIB 3NYVA 1RQQA 3QRJA 3FYJX 5GJDA 4R8QA 2R64A 2ZJWA 2IJMA 5L6WL 3VBWA 3P7BA 4DGOA 4BY9E 2A98A 3FI2A 3P23A 4IANA 3IW6A 4XEYA 4XOYA 4O86A 2R4BA 3NUYA 4BDHA 4ALWA 2CKEA 3Q9WA 1K9AA 1Q8UA 1JKKA 3EJ1A 3POOA 4FTTA 3ALNA 4XG2A 4D9UA 4QMYA 3FHRA 5CT0A 2NNWB 3JPVA 4X2JA 4W4VA 2PZPA 1PYXA 3KULB 2IVTA 3D94A 2XIRA 2OKRA 1L8TA 4BCQA 3AKLA 4C59A 3OTVA 3S4QA 3GCQA 4FYOA 3W0RA 3TWJA 2WU6A 3F9NA 3L9PA 3M42A 3G0EA 2WPAA 3KN5A 2IVVA 3FLWA 4EH4A 4FT3A 5HE0A 4F1OA 2QG5A 3FQSA 4YZMA 4ACCA 3TIYA 5D11A 4YZDA 2W0JA 3V5JA 4ZTMA 3DU8A 5JKGA 2R7BA 5HG8A 4D1XA 4DBXA 5B2LA 5J1VA 4E4NA 3F3WA 3I0OA 4WHZA 3SD0A 1WBSA 4RJ7A 3JS2A 4GK2A 4YJQA 3QUDA 5CVGA 3ZLWA 4UB7A 5CF4A 2PZ5A 2OJGA 1JVPP 3D2KA 4LOOA 1JOWB 4O0SA 4E5AX 5K5XA 3ZDIA 5HESA 5H3QA 5D41A 3SKCA 2WIPA 3R2YA 4TWOA 2ZVAA 3ANQA 3KQ7A 5BUIA 3ZZEA 4I6FA 1G8AA 5HGIA 4UWCA 2IW8A 3LOKA 1FVRA 4IAAA 2V5QA 5AFVA 5A6NA 2QR7A 2R5TA 1FINA 3F5UA 1ZOHA 3GB2A 2X4ZA 4JL9A 4K8AA 1FBNA 2AUHA 1VLRA 1FOTA 4BTKA 3OS3A 4DT9A 4FIJA 5GINE 4MXAA 4LQMA 3HLLA 4ZTQA 2F7XE 1YXUA 2ERKA 3F61A 1STCE 5DFPA 4ITHA 4E7WA 4QTEA 2C4GA 3O96A 4UMTA 3TNPC 2C68A 4FSZA 5ANJA 2UW9A 4M0ZA 3BPRA 1H28A 4DN5A 4RLKA 5E90A 4J53A 2PUNA 4MUQA 3I79A 3ORMA 3UMWA 1Y8YA 3GI3A 1UKHA 2PWLA 4CG8A 1WVWA 4I93A 2WMVA 4BWKA 2OH4A 2BZKB 3MV5A 3MY1A 2YM7A 5CENA 5JSMA 4KABA 1QCFA 4XG4A 5A9UA 3GCVA 3NUSA 3ATSA 2FSMX 5C4LA 4M13A 4XRLA 3MH3A 1ATPE 2Q83A 2PK9A 3G15A 4AACA 1JSUA 3KF7A 4BDDA 4RA5A 5CAQA 3OMVA 4IZ5A 5JGBA 4BB4A 4DFYA 3WF5A 4WUAA 2C1AA 1KSWA 1H1PA 4GU6A 3AC4A 3P1AA 5FXQA 5AA8A 2J2IB 3PA4A 4FKWA 1IA9A 3VHEA 1SMHA 3D14A 5M07A 5KUPA 3LXPA 4ZOGA 3DLSA 4G3CA 4GUBA 4XBRA 4BVUA 4XMOA 1LP4A 4FG9A 4H1MA 4PDOA 5CSWA 3UIXA 5HTIA 4L9IA 2PMIA 2UZTA 3A8WA 3EKKA 3DKGA 4I4FA 1UVRA 3OXZA 3OP5A 3W18A 4AZFA 5C03A 2VO6A 3S2PA 1H0VA 5CAVA 5L6PA 2QO7A 4OAVB 2YWVA 2Y7JA 1W84A 2GNLA 2RFSA 3L8VA 1PXMA 3QQKA 4GK4A 3PVBA 3ORLA 3HA6A 3RBWA 3UZPA 3ZLSA 4C7TA 4GKIA 4FL3A 2IVUA 5J5SA 3P5KA 2XANA 2VTSA 4QP7A 3O8UA 4PPBA 2X7FA 4G1WA 3U4WA 3FC1X 4GG5A 3UG1A 3ZCLA 4R7BA 3G5DA 2C69A 1H26A 3HMMA 4RPVA 1UNLA 3E63A 4XG6A 3ALOA 2YAKA 3KXGA 4DLJA 5LXMA 2PUPA 5ANIA 4O4EA 2ITNA 5IUIA 3VJNA 4R3CA 4E6DA 5K9IA 4JJRA 5C27A 4FE2A 4GH2A 5H2UA 4OBQA 4BIBA 2W9ZB 5BVKA 3R02A 5J87A 2XYUA 3DK6A 4OTGA 1PXKA 4HW7A 3PIZA 5CEOA 1PY5A 3A61A 4RSSA 3VULA 3NEWA 4PNKA 3R7OA 4WD5A 5FEQA 5GIOE 4ZZOA 2BRNA 4W8EA 3CGFA 4DG0E 2XAMA 4U42A 5A54A 3FMHA 4X2FA 4X6QC 3OD6X 2ZB0A 4BICA 1IR3A 4F7LA 3R8LA 3LM0A 1GZOA 2HK5A 1KE5A 4ZY5A 3UYSA 5B2MA 3FYKX 4F9AA 3KREA 3NVMB 1R39A 1UA2A 3FLSA 1GZ8A 4J8NA 4X2NA 3DBFA 3VS6A 4AFJA 5ETFA 2XH5A 3PJ2A 1MP8A 2AYPA 4AGUA 2X8DA 5A4CA 5HO7A 4FGRA 3DA6A 2Z8CA 3IW4A 2C6EA 2J0JA 5DGZA 3KRWA 1U5RA 4IHPA 4HGLA 4FUXA 5IQFA 4AFEA 3NYNA 5AUUA 1H4LA 3VUTA 4CFWA 5F4NA 3KCFA 2GQGA 4FIHA 4QRCA 2CKPA 3KXMA 3F3ZA 5AP2A 1DI8A 4FIGA 4C4FA 4CQGA 1KE7A 3PDTA 1IEPA 4KKGA 4QNYA 5I9WA 3R28A 4QMNA 2GHGA 5CQWA 5I9ZA 4IM0A 5GJGA 4ANMA 2SRCA 3H0ZA 5M09A 4YBKA 3KK9A 3DV3A 3MN3A 4RMZA 4C3PA 3MYGA 3LPBA 3VUDA 4QMTA 1JKLA 2X0QA 1Q8YA 4YC3A 2ETMA 3FEGA 3GUBA 4JBQA 4NKSA 3NRMA 2VX3A 1CKPA 4Y5QA 3EN4A 3VQHA 1M2PA 2YM8A 4QP8A 3FWQA 3QGYA 2ZV2A 5FEDA 4HYHA 3UVRA 4W4YA 4R5YA 5HLPA 4O7ZA 4NH1A 3N4UA 2B0QA 2FSLX 4QOXA 4KUJA 5M4CA 4BIEA 1IRKA 1TVOA 5LCKA 4QP3A 5DT4A 2PTKA 2VWBA 3A99A 3BWJA 3CS9A 3C1XA 3GU7A 4HGSA 3W16A 3AKKA 2UZWE 5EQEA 3UDBA 3LQ3A 2HWOA 3R7GA 3M1SA 3KMUA 4TN6A 1WMKA 4LV5A 3F66A 4QO9A 4QMLA 3UTOA 4BDBA 3CKWA 2XNPA 4J98A 3FZ1A 3U51A 3R8VA 4PMPA 4DCEA 3ZO2A 3H0YA