4DH1A

Low temperature x-ray structure of camp dependent protein kinase a catalytic subunit with low mg2+, atp and ip20
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Low- and room-temperature X-ray structures of protein kinase A ternary complexes shed new light on its activity.
pubmed doi rcsb
source organism Mus musculus
total genus 110
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dh1A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dh1A02
4Y5HA 4I3ZA 4BR3A 4DITA 5HD4A 2WTKB 3QQGA 4HJOA 4BDDA 3OT3A 3F61A 3CPCA 3PIYA 4XJ0A 1S9IA 4Z9LA 5GZ9A 4V05A 5AIRA 3SHEA 3ZXZA 2YDIA 4BCPA 5FDPA 4OAUC 3H0ZA 3LM0A 4DGGA 1R39A 2A0CX 2IZUA 2E2BA 2R3GA 3QAME 4U41A 3PPKA 3EFKA 2XF0A 2CNUA 3LLAA 3MYGA 4XG6A 5EI6A 3HKOA 2W9ZB 3ZC5A 3OUNB 5AUUA 4IIRA 3R2YA 2E9OA 2VTLA 4OTWA 3VF8A 4H39A 4EKKA 2R3LA 4QOXA 2R64A 3V6SA 4M84A 5J9ZA 4XYFA 1BL6A 4YZMA 5GJDA 4BWXA 2CGXA 2W0JA 1ERKA 3EHAA 3E7OA 1Q5KA 4FV6A 4AQCA 4J95A 2F2UA 1WBOA 3Q3BA 2XZSA 1EH4A 4RT7A 3OW3A 4BDIA 4ALWA 3WIKA 4JDJA 4WBOA 4QTEA 4TYEA 2OXYA 1H1QA 3WZEA 4AU8A 2GNJA 4I20A 1J3HA 2B52A 2NPQA 2R0IA 2B53A 4EONA 2ERKA 3RGFA 4ZTQA 4AN9A 4NL0A 3FI3A 3IDCA 3W8QA 2WTIA 4K77A 4IC8A 3L8PA 2VU3A 3RALA 4EOMA 3MGYA 2C6LA 4KIKB 4TTHB 3KN5A 1P5EA 2QOFA 3NPCA 4ASEA 3MY0A 4BI1A 3Q5ZA 4D4VA 1RJBA 4JBQA 4ZLZA 1YWVA 2CGWA 3HRFA 2FYSA 5DGZA 2O63A 3TNQB 4DG0E 4RJ8A 3MPAA 2HXQA 3UVPA 5HNIX 1KE7A 2Z2WA 4C57A 4DGLC 5AX3A 5A6NA 4S33A 3RWPA 5E8TA 2GS2A 2OIDA 4MD8E 2QQ7A 3F5GA 4Q5HA 4BRXA 3RJCA 5AIKA 4W9XA 5EOLA 3SC1A 2Q83A 3KFAA 5EDQA 3FMMA 4YNOA 3TV6A 1W8CA 4BHZA 3SA0A 4CTCA 5HESA 4RJ7A 5AR4A 2J0KA 4TPTA 3F69A 4NTTA 2NP8A 2UVYA 2X2MA 5EW3A 2R9SA 3H9FA 3BQCA 4IM2A 5LVLA 4ZTLA 1G8SA 1NVQA 2G2HA 2WHBA 1ZOGA 3S2PA 3ZYAA 2QCSA 3RPSA 3VNTA 3QLGA 3LMIA 4UMTA 3ZCLA 5BUEA 5DWRA 2ETKA 2O3PA 2PZ5A 5KNJA 1H0VA 3UNZA 2RG5A 1JAMA 1UNLA 3BPRA 3QWKA 3TNPC 5KMIA 2FSMX 5KE0A 4N6ZA 4RX9A 1UNHA 3WF8A 4G6OA 4GCJA 1SNUA 3VAPA 1KOAA 3E88A 3BU3A 3PJ2A 1OL1A 3QTWA 4G2FA 5IG1A 4HNIA 4KIOA 2EXCX 4RZVA 5EKOA 4BGGA 4BKJA 4AACA 2NO3A 2YCSA 2FH9A 1JKSA 3KEXA 4MQ1A 4MNEA 1PYXA 3QHWA 1XH8A 3KC3A 3IOPA 2YA9A 4AT5A 4KBKA 1BLXA 2Y9QA 4UZDA 4HPTE 1WBVA 3ID6C 5LWMA 1MQBA 4RIOA 4N0SA 5EW8A 4S30A 3NDMA 4BWPA 4X3FA 4EOIA 3GU5A 5AUZA 3H10A 4CLIA 3HMPA 4I0TA 2YM3A 2FUMA 4FZ7A 1GAGA 3CIKA 4QO9A 2WTWA 4QMOA 4I6FA 5FP5A 1I44A 5C9CA 3VHEA 1Q8WA 3HP5A 1U4DA 2FSOX 4CLJA 5JK3A 3DKFA 3HNGA 5DG5A 5EYDA 5C27A 3D2KA 5FWKK 4FKOA 4QT1A 4I6BA 4QYGA 3U6HA 4U42A 2DQ7X 2JKOA 2Q0BA 2JBPA 4GSBA 3V5JA 3H30A 4AOJA 1Q61A 3QGWA 3CGOA 4LGHA 5DT3A 4EH3A 4NWMA 1JSTA 3G33A 2R7BA 4XBRA 5DT0A 2W5HA 3G90X 5AM7A 4OR5A 2X8IA 1U54A 2BPMA 2OH4A 3QYWA 4OTQA 2W1DA 4KNBA 1YXSA 2OJGA 3CPBA 1QPEA 3BELA 5BNJA 1R1WA 4RC4A 5FEDA 3O8PA 1Q41A 4KB8A 1UU7A 2PMIA 2WNTA 4HPUE 3R73A 1WZYA 3UC3A 4DFLA 2UW3A 2PMLX 3P79A 2H6DA 4ZK5A 2C68A 4FOCA 4O7VA 4BCOA 4D5HA 5BVFA 4OLIA 3EIDA 5G6VA 4B8LA 3U87A 5E8XA 2IZTA 4EQCA 3SVVA 3QQHA 2VTAA 1I09A 2XKFA 3IPHA 1UWJA 4JXFA 4RIYA 3A4OX 3GGFA 2WMAA 2CN8A 4R1VA 4BGHA 5HNBA 1J7UA 1PXKA 4RVLA 3NCZA 4RJ6A 3FMNA 2IJMA 2J9MA 2I0EA 3RI1A 4AW2A 5E91A 3O71A 2JIVA 3C5UA 4GVAA 4YO4A 2GQGA 4AGWA 2GHLA 4FIFA 3BHHA 4E93A 2H8HA 1OUKA 1WBSA 3OP5A 2C5YA 1MQ4A 3BBWA 4KD1A 4X6RA 5DNRA 2JDVA 4XG4A 1LUFA 2QOOA 3K5VA 4LRMA 5AADA 4DT8A 4O2ZA 3NSZA 4Y46A 2YN8A 3F3ZA 1VYZA 4PDPA 2C6KA 3KCFA 3CY3A 4UXLA 5ANOA 4PQNA 3QCQA 1UVRA 4GKHA 5M07A 2XBJA 2PY3A 5LWNA 5D12A 3R28A 2HWOA 1JQHA 2ZB0A 3NR9A 4AA0A 4FKWA 4X21A 2YCQA 4XLIA 3NX8A 3IKAA 3QTIA 4O7WA 5E8WA 4ORKA 4B99A 2P2IA 3SV0A 3OW4A 4ZZOA 4EQUA 2XNMA 5D1JA 1QL6A 4IX5A 3E8NA 4PPBA 3RNYA 3PXKA 4BL1A 2J4ZA 3KULB 4JRNA 3COIA 3FZOA 3OCTA 4ITHA 4NEUA 3RZBA 3TV4A 1ZZLA 4FT3A 5EQPA 4JJRA 2E9UA 4MKCA 3MB6A 5AJQA 3HECA 4GKIA 5M4CA 2BAQA 4P5ZA 4AX8A 4GVJA 2V55A 5KMJA 5JZNA 3R8LA 4UWBA 4C0TA 4R7IA 1OPJA 4F99A 5A6OA 2QU5A 3M42A 2JKMA 4Y85A 4YJSA 3WF9A 2J90A 3UO6A 4MF1A 3R04A 3WF7A 3EYGA 4BDAA 4J53A 2EVAA 3L8XA 4XLVA 2YCRA 3OWKA 4XG8A 4ASDA 4CT1A 4DBNA 2OICA 3QGYA 5EYMA 3BQRA 4BTMA 3FLYA 5K5NA 3LXNA 4M14A 4EHVA 2PUNA 3OG7A 2IPXA 4MWHA 3EN6A 3P7CA 2QOQA 4FEXA 3FY2A 3UP2A 5GJGA 1M2PA 1PKDA 3NW5A 3P7AA 4LQMA 2GS7A 3ZH8A 5IH5A 5IUGA 4WO5A 2YWPA 5J1VA 2I1MA 1PXLA 3QRUA 2UZOA 4AW5A 4Q5EA 4FSMA 4CTBA 4KWPA 5IA0A 4A9TA 5DRDA 3BU5A 1OIUA 3QA8A 4FKRA 3UOJA 3I7BA 1TQMA 4RX5A 2ZV2A 5BVOA 3G0EA 1JSUA 3NVMB 3NUNA 1YHVA 5CSVA 4TYGA 5HLPA 2W1FA 3C9WA 3FHRA 2C69A 2F49A 4L43A 4MH7A 5CENA 3W2PA 3MW1A 2C5NA 4YPDA 4YSJA 4ZJVA 1LEZA 4IM3A 2E9NA 1WBPA 3LFNA 2X8EA 5J5TA 4CKIA 4X7QA 4E1ZA 3WBLA 2YIQA 4QMMA 5CNOA 5B0XA 4NTSA 5HOAA 3ZO3A 4EEVA 4O7ZA 1YI6A 4UBAA 4I93A 3A7IA 3MV5A 3Q53A 4ZOGA 1BKXA 1YOJA 1H0WA 4AF3A 4BKYA 3QTQA 3TM0A 4FOBA 3LMGA 3FMKA 3QZIA 1U5QA 5KMNA 5J8IA 4QMZA 3DU8A 4G16A 4MBJA 2ZDTA 1U46A 1H8FA 1YOMA 2VTNA 4RWIA 4ANBA 2YISA 3UTOA 3AC2A 2EUFB 3BEAA 5AP5A 3DJ7A 3ZLSA 3CGFA 3Q2JA 4PL3A 1AQ1A 4G6NA 4G5PA 4YGAA 5J95A 3ZM4A 4HCUA 3LCKA 5AP1A 3FXWA 3NUSA 4FZ6A 3TIZA 3OFMA 3MIYA 3GUBA 3V5LA 3DAJA 2QLQA 3IQ7A 3ULZA 3LCOA 3R6XA 1XO2B 5IU2A 3NAXA 3FY0A 3K3JA 5I5ZA 4AAAA 3I60A 3VW6A 1XHAA 2C0TA 4BC6A 1PYEA 3FMLA 4O81A 1JPAA 2ITVA 2VGOA 4TW9A 5KUPA 4PWNA 4AZFA 2BKZA 4I0RA 3VC4A 3JUHA 3KKVA 3DTCA 3PDTA 3I81A 4R5YA 2LAVA 2F2CB 5K3YA 3Q32A 4HVDA 3ETAA 1KV1A 2CPKE 3C0GA 3HP2A 2UVZA 5ACKA 5JMSA 4N57A 2GSFA 2WD1A 3NUXA 5FTOA 5T68A 1J7IA 2YM4A 3KGAA 3O50A 2OIBA 4O0TA 1H1WA 3KRLA 4O0UA 2CGUA 4JAJA 1JSVA 1R0EA 2RIOA 3KRWA 5EI2A 4EWQA 4KINA 4D2SA 2JIIA 3JS2A 2CKQA 1KOBA 3P78A 5DEYA 5ICPA 3MESA 4FZAB 5CAQA 4D9TA 1BI7A 3I0OA 4IADA 4F0GA 2PZRA 5FRIA 5DR2A 4D0XA 4F9WA 1FOTA 3BLHA 3OTVA 4UALA 3EB0A 3G6GA 2WKMA 3BYSA 3DAEA 4BGQA 4BWKA 3LFBA 3ATTA 2Y4IB 1DM2A 5TE0A 4EC8A 1DAYA 2QONA 4XNEA 4GL9A 4ZS4A 2AYPA 4NM7A 2VV9A 5CI6A 2W1GA 3QQLA 4CVAA 4BF2A 4DEIA 2OXXA 1IAJA 2CNVA 2Q0NA 4FF8A 5ANDA 4DLJA 4IMYA 3BU6A 4FV4A 4FT5A 2A19B 3RHKA 2O64A 3ORPA 3DA6A 4QYYA 5CSXA 1DI8A 4O21A 3RHXA 3LVPA 2XNBA 4C33A 4IZ5A 4FK3A 1VEBA 2ZVAA 3EL7A 4H36A 4USDA 3PY0A 2BDJA 3W10A 4ASXA 2OI4X 2GCDA 1U5RA 4FNYA 2ZYBA 3TZMA 5HO7A 3HGKA 2H34A 2X1NA 3DS6A 4GMYA 5EHOA 3OBJA 2WMRA 3UMXA 3HV5A 4QQCA 4C8BA 4C38A 4ZSJA 2VWXA 5BX0A 2VRXA 4X2KA 3EQIA 2G2FA 3BYUA 3HUCA 3BKBA 3VULA 4TZRA 3L9PA 2B7AA 3PLSA 1CKIA 3E3BX 1BYGA 2Z60A 4X2FA 3HDMA 1W98A 4JBVA 4XG3A 5EM8A 2FB8A 4R8QA 3UOLA 4FSYA 4PUZA 4Y72A 3PPZA 5HIEA 3F2RA 4EH7A 4KIQA 4BCJA 3E8EA 5CU4A 1H08A 3F5XA 2UZWE 3Q9YA 3D83A 1XH7A 3OD6X 3CP9A 3A8WA 3NNXA 3PFQA 4V01A 3WZJA 2JD5A 4EYJA 3KK8A 2PE0A 3KB7A 3F7ZA 3MBLA 4EJNA 4KAOA 1OM1A 4I6HA 4RA4A 4U45A 1HCLA 5L8JA 4I92A 4CT2A 3DBFA 3RAKA 4DCAA 1JVPP 2X0GA 5C4LA 5TOZA 3EQBA 4EQMA 2XK4A 3ZLXA 3MVLA 5HCZA 5IISA 3PVBA 3KULA 5FXSA 2OG8A 1E1VA 5EQEA 4IX3A 5D41A 4ZSAA 5DT4A 1YWRA 4ID7A 4LRJA 3DAKA 3N4UA 4BVUA 4C34A 3OT8A 3RK7A 4CZYB 3N51A 4HCVA 2DWBA 2OIQA 4WNKA 3S4QA 3DXQA 2VTRA 4EL9A 3AC1A 2HK5A 4XP0A 2WTDA 3ZO4A 3MB7A 2C6DA 3GQIA 3SQQA 5GHVA 3C4ZA 2OO8X 2BDFA 2J0IA 1M14A 3DOGA 1PMVA 4RWLA 4EOPA 4C2VA 2CNQA 5DN3A 2WO6A 1FINA 3GI3A 3HEGA 4U80A 3FBVA 3R71A 4X2NA 2FVDA 3GBZA 4NW6A 5I3RA 5JEBA 2GHMA 4G9RA 4RJ5A 2XRWA 5HO8A 3OY3A 5A9UA 2VNWA 4PTEA 5KBRA 1PMNA 1QPCA 2QURA 1M7QA 2R3MA 3CD8A 2OZAB 5EG3A 4F64A 4O0WA 4EZ5A 2V7AA 4IAFA 3SXRA 2C4GA 5FLFA 2GNHA 4OBPA 3UP7A 3NCGA 4U0IA 3COHA 3TUBA 4L52A 2ITYA 3JYAA 4ONAA 4OTHA 2JDOA 4YHJA 4ENYA 3TZ7A 3VS4A 5L2QA 3U6IA 3DLSA 2OJFE 2Y4PA 4AGDA 4EH2A 1GZKA 4IB3A 1WCCA 2J50A 4TY1A 2B1PA 3UVQA 5J7BA 5I9UA 2XA4A 2J51A 2GNLA 1JNKA 2P4IA 3TTIA 3QHRA 3EOCA 3QD2B 5T6KA 3HMMA 4U3YA 3IW4A 4A06A 5B7VA 3HZTA 5AM6A 5AX9A 5L6WL 2Z8CA 4J97A 3HRBA 4B4LA 4RQVA 4CYJA 1H1SA 2UZTA 2ONLA 1REKA 4EI4A 2PMNX 4I5CA 3UDBA 4IAZA 3A7HA 4BDKA 1H26A 4O22A 3BHUA 2HELA 4OBQA 3OXTA 2XM9A 4QQJA 3FLNC 3BHTA 3CD3A 1UWHA 2ETRA 2OJ9A 5CSWA 4HCTA 2RFSA 1WMKA 3QCSA 1YXVA 3PJCA 4C3RA 4CQEA 3VRZA 1OIQA 4WD5A 4G3DA 4ZJJA 3ZUUA 2YDKA 4IEBA 5HVJA 4R7HA 4L67A 3TDVA 4NK9A 4M69B 4U97A 3N4TA 5EW9A 2C3IB 3IG7A 4GUEA 5L6OA 1FBNA 2ZM4A 3D5XA 3IW8A 5IDPA 3SG9A 4ZS0A 1A9UA 3O23A 4FIGA 4BIDA 4W9WA 2OU7A 2GQSA 4RFYA 4KSPA 3ENMA 3QRTA 3RTPA 4EK4A 4L3LA 5H2UA 3BYOA 4FTAA 5D10A 4YTFA 2G01A 3E62A 2YZAA 3CLYA 4K9YA 5DE2A 3UODA 4BCFA 5IH4A 3LQ5A 1QPJA 4AT3A 2PVLA 3WYYA 4X2JA 4XP3A 2WOTA 4NUSA 2OZOA 3N9XA 4MNFA 4YR8A 2OF4A 4IZYA 2X2KA 1NVSA 5BVDA 5CX9A 1GZ8A 3ZEPA 5FM2A 2ZM3A 1SVEA 3MSSA 2G2IA 3Q96A 4D4SA 2JGZA 2YAAA 4DA5A 2UW5A 2J6MA 1V0BA 4EH9A 3R7IA 2VWWA 1GNGA 3I79A 4YJPA 2B9HA 3GT8A 3LHJA 4BDBA 1VJYA 2C6TA 4DC2A 3UJGA 3K54A 2YIXA 4FTKA 2ITOA 4FKIA 4S34A 1JKTA 4CG8A 4IZAA 1PKGA 3MVHA 3PA4A 4K6ZA 1KV2A 2B55A 3KMMA 4N4SA 5EYKA 1F0QA 3E7VA 4APCA 3FE3A 3MJ1A 3DDPA 2UW8A 3BHVA 4UMRA 4GG5A 3F9NA 4I94A 5JZJA 2F7XE 3MIAA 4DINA 4YPSA 5FG8A 3EQRA 5KCVA 2XRUA 3FZPA 3ERKA 5L4QA 3LPBA 5E8SA 3QU0A 4U81A 3BYMA 3CJGA 4WRGA 4ZTMA 3GU7A 3PJ3A 3R9NA 4ANSA 4CV8A 3LCTA 2PUUA 3Q60A 4DE4A 3F88A 4HNFA 4C61A 5J1WA 1OL2A 1H24A 2YM8A 3UPXA 4OTPA 4PL4A 3NYVA 4E7WA 1SVHA 1GIHA 4FV9A 5EDPA 5LQFA 4O7YA 3AOXA 4IFCA 4RPVA 2J2IB 4YJVA 1CKJA 3EN9A 5JFWA 2CMWA 3NW7A 3CEKA 4RX7A 3V6RA 4OUCA 4BBMA 4ZMFA 3RAIA 3PJ1A 5AUVA 4EZ3A 5HTBA 3ATSA 3A4PA 2W05A 1KSWA 5CF6A 4FT9A 4RFZA 1FQ1B 1YI3A 2ITWA 5HQ0A 2V7OA 3QF9A 4DG2E 1UNGA 4XG2A 2PVJA 2R0UA 2Y6OA 3MTLA 4WBBB 3ZXTA 3LXLA 5BQ0A 3UQCA 2GDOA 3FLZA 5LVOA 2FSLX 2X7FA 4NKAA 3LKMA 2QOKA 3ZZWA 4I5PA 5M44A 3EH9A 5DI1A 4TYJA 3SW4A 4E6CA 3ZDIA 4AXAA 2YM7A 3TV7A 5HU9A 4YZDA 1BMKA 1IEPA 3FYKX 5DBXA 2R3PA 3E63A 3G51A 4FKGA 5IUIA 1CKPA 5IA3A 2C30A 2EXMA 3SAYA 5E1SA 1Y6AA 1PMUA 4JS8A 3PSCA 4EH5A 3UQGA 1OPLA 4B0GA 5AR2A 4QPMA 5HE1A 2GS6A 2XH5A 4DH1A 1W0XC 4D9UA 4K18A 3DJ6A 3E5AA 2VTHA 3FZRA 4TNBA 5AR7A 2ERZE 2HOGA 4YHTA 4APPA 4EOKA 2OK1A 2XP2A 3MA6A 3VBQA 4PY1A 2XVDA 4ACDA 2ACXA 3EWHA 3H9RA 1M2RA 4QMYA 4QMSA 3EYHA 4A9RA 4ALVA 5CU0A 1TQIA 2BR1A 5JQ8A 5CEQA 4RSSA 2J7TA 3PE2A 3EKNA 3KXMA 4FKTA 2QLUA 2UW0A 4WG3A 5HO6A 4CQGA 4DN5A 2ZV9A 4RWJA 4XEYA 1PW2A 1FMKA 3GU6A 1WAKA 1O9UA 5F4NA 3VW8A 5ETCA 4R3CA 3TJDA 4CSVA 1RQQA 4PTCA 3LIJA 4H58A 2AC5A 3OC1A 3HYHA 2BILB 4UN0C 1ZLTA 3HMOA 1OUYA 3R00A 4UMUA 3EZRA 4GS6A 4FV1A 5AR8A 3PIXA 5BVNA 5LVMA 4O96A 1RW8A 3BCEA 4E4XA 2XKCA 4YNEA 4FG9A 5IF1A 2IVSA 1R0PA 3JVRA 3JY9A 1KE8A 4G3CA 4BBEA 3P1AA 5CU3A 4BDEA 5KZIA 5JH6A 4F1OA 3TZ9A 1YXTA 2P0CA 3C5IA 3F66A 2FA2A 1SVGA 4L3JA 4IACA 3FI4A 4EBWA 4LV5A 3C0IA 4YBJA 3CKXA 2XKEA 4BI0A 4FV8A 1H07A 1YXXA 3P9JA 5JT2A 4QP8A 4O84A 3L8VA 3NYNA 5DA3A 2YLFA 4ZLYA 4IJ9A 2OZAA 4KIPA 2OJIA 4ZY5A 5CU2A 1CDKA 3OCSA 2XYNA 3RK5A 4YC8A 3EN5A 5CEPA 1GZNA 4O91A 5EKNA 2A2AA 2EB2A 3OTUA 3DJ5A 1CTPE 3C4XA 4RG0A 5HICA 5CWZA 4FZFB 4CD0A 3FLSA 4FTIA 4E4MA 3FXZA 2DUVA 2JFMA 3OEZA 3KXNA 4O86A 3R9OA 5KBQA 4HVSA 1OL5A 2XM8A 4YZBA 3TUDA 4DG3E 3PXFA 1BX6A 2QU6A 4IWPA 5HE0A 3ORIA 3F3TA 3HLLA 3MY5A 3A7FA 4JAIA 4D2RA 1G8AA 5BMSA 2WEIA 3DFAA 4QMQA 4TWOA 5L6PA 4FTUA 2OJJA 4IC7A 3NNVA 4TWPA 5EHLA 3MVJA 3W2QA 3ZONA 5IQDA 1YVJA 5CT0A 4WA9A 4FIHA 4A4LA 4TL0A 4O38A 3VVHA 3B2WA 3CTQA 2Z7LA 4FG7A 4MK0A 1XH5A 2FO0A 3ITZA 4FTJA 2CLQA 4IB5A 4NT4A 4QYFA 4FTOA 4ZTHA 3TI1A 3VBTA 1GIJA 1Z5MA 2YIWA 4PDYA 5I9ZA 4KS8A 5JGDA 3NEWA 2X81A 3UIUA 2Y7JA 2YJRA 5HTCA 3PY3A 3R1SA 5CNNA 1DI9A 3QQUA 4KABA 4C62A 2R3KA 4BHNA 2UUEA 4BCIA 1FGKA 2H9VA 4G9CA 4QTAA 4M69A 4C59A 1K2PA 3UPZA 2HAKA 4R77A 2RFEA 1O6LA 5CAUA 5JRSA 2W17A 1K3AA 4YJUA 3TKIA 4WKQA 4F9BA 3QKKA 3DDQA 3VO3A 3ZTXA 5J7HA 5J5SA 4BDGA 4C3PA 2CDZA 3R1YA 1OVEA 3FV8A 1AGWA 4FTNA 3S3IA 2ZMDA 4QMXA 4ZSGA 3OXIA 3P08A 2W1CA 4QTBA 3S1HA 4B7TA 2YM5A 3F82A 4F70A 3PP0A 2X39A 4I4FA 4DGOA 3VN9A 5CAVA 1JOWB 5FD2A 1Q3WA 5A4CA 5J87A 2PMOX 3MVMA 4I5MA 4XRJA 2YZLA 3FMHA 3FQHA 3HA8A 5EYCA 2VN9A 4J71A 5CLPA 4FKJA 4WT6A 3FMEA 3VUIA 4FYNA 3MY1A 3ZO2A 2R3IA 5M09A 5BYZA 4DEAA 2UZBA 4U3ZA 3O96A 3RPOA 5IQAA 3LCSA 4NM0A 3TCPA 5IQIA 3PXQA 3Q9WA 3VS7A 1VYWA 4ZTSA 4F65A 5FBOA 3IDPA 5HVYA 3VS3A 4L7FA 3ULIA 3VHKA 1XH4A 2RKUA 1LP4A 4RZWA 2WPAA 2J5EA 3GC8A 4JDKA 5HVKA 3HV6A 3KVWA 4O7TA 4LL0A 3AC4A 3LW0A 2CKPA 3QTXA 4I41A 3NUAA 4R7BA 3DNDA 1PMEA 3NIZA 2AC3A 5F20A 1FVTA 4E4NA 1MRYA 4G6LA 5F1ZA 2PK9A 4IFGA 3WYXA 3MFUA 3V04A 3C4CA 4JI9A 3RAWA 4E5BA 3GVUA 2IW8A 2WQBA 4II5A 5BPYA 2VWYA 4FGRA 5B2MA 2VO7A 4ZSEA 5AUWA 3JR1A 1UU9A 3OF0A 2P2HA 4BBFA 4I23A 1T45A 2RF9A 3TXOA 2R4BA 3AXWA 4OT6A 3AD5A 4BI2A 2QD9A 3KXHA 1Y91A 3ZRKA 2UW9A 1WBNA 2VO0A 2YCFA 3COKA 4KSQA 4UV0A 4FT0A 5CQWA 4ANMA 5CF4A 1FPUA 1WBTA 4PV0A 4D1ZA 3FSKA 4RVKA 2YERA 4BDCA 3KQ7A 3MH2A 3FQEA 4PMTA 3TG1A 1BUHA 3QC9A 5IQHA 3AT3A 4J99A 3D4QA 5IEYA 4YJOA 3PYYA 2KTYA 4ZJIA 4D2WA 2BTSA 1GJOA 2RFDA 4FL3A 1PXMA 2WB8A 2X9EA 1G5SA 4X3JA 2BZIB 3KRRA 3QX4A 4L44A 2ONLC 4LMNA 3RM7A 3TL8A 3TNHA 4YZ9A 3TTJA 3WF6A 4CXAA 2QOCA 4BZNA 5JRQA 4ASZA 3P0MA 3L8SA 1U59A 3MI9A 4MBIA 5CEOA 5ITAA 1MUOA 1S9JA 2ZAZA 3DB8A 3ZLYA 4ACCA 2ZB1A 1V0PA 3R8UA 3F3UA 3RMFA 3R8ZA 5M4IA 3KF4A 4RIWB 4U40A 4IB1A 4QP1A 4FC0A 3C4EA 2WGJA 1P4OA 2O0UA 4NU1A 3G5DA 3EFLA 2B4SB 3BIZA 3FHIA 5IA5A 4K0YA 5CT7A 4MHAA 1OKWA 3SRVB 4OGRA 3U9CA 4UXQA 2VTJA 3QKMA 1W82A 2O5KA 4WNOA 5AP7A 4L53A 3QTSA 4UEUA 4AGUA 4IE9A 3EQGA 4EK6A 3POZA 2W5AA 2GMXA 1CSNA 1E1XA 4Q2AA 4Z55A 4FTLA 4F6WA 4W4YA 4TXCA 4BY9E 3A61A 2XS0A 4G31A 3R7OA 1B6CB 4L00A 4NW5A 1W84A 3TN8A 4KIKA 4W4XA 3U4WA 4IX6A 2CKOA 1SNXA 1R3CA 3WILA 2VTIA 4QMVA 4FEUA 4DTAA 3VQUA 5C1QB 5IQCA 3PWYA 3JVSA 3GCQA 3V3VA 2C5XA 4BCGA 4YJRA 5LMKC 4NKSA 3BE2A 1KWPA 4IQ6A 1CMKE 4M13A 4R6VA 3U9NA 2J5FA 3G0FA 4OBOA 2VO6A 3SXFA 3QD3A 4XOZA 4K11A 2W4JA 5L8LA 1FMOE 4OT5A 3E93A 4HOKA 2UZVA 4LG4A 4AG8A 4QMWA 2W4OA 4U44A 4EOJA 4QQTA 2BMCA 3BBTB 3VUMA 2B9IA 4JBPA 3VIDA 3MFTA 1RE8A 5A3XA 1JBPE 1NVRA 1Q99A 1XJDA 5AP0A 5GIPE 2BHEA 1YOLA 4GIHA 4AE6A 3BLRA 4RVMA 4O1OA 4V0GB 3ZSGA 1PJKA 2XJ2A 5DFPA 2YABA 4DH8A 4C4IA 4GFOA 2BRHA 2XNOA 3PTGA 1YXUA 4J1RA 3R9DA 5L2WA 4JX7A 4CFUA 1XBCA 5HG5A 1WFCA 2WQNA 3AT2A 3OOMA 5CVFA 4DGMA 4EOSA 4J52A 2VGPA 3VF9A 5M53A 4OAVB 4FL1A 2V5QA 4FODA 2Y4IC 3UBDA 4GYIA 4EJ7A 1ND4A 1PY5A 2ITXA 3ANRA 3CSVA 3PVWA 1CM8A 4HGEA 2XKDA 3NUYA 3VWAA 1OECA 3HX4A 3O8UA 3ZSHA 5CSPA 4RGJA 4FZDB 4GU9A 4FK6A 4HZRA 3RBWA 2NNWB 2PULA 3A7GA 3QRKA 2OBJA 4TKSA 4Y95A 1K9AA 3QCYA 1Y6BA 4DTBA 4W8EA 3QA0A 4KKEA 1YWNA 5CF8A 4LUEA 5G1XA 5GZAA 1JKLA 5LVPA 4QPSA 4Y5QA 2ZV7A 3V5TA 1UU3A 4I5HA 4IXPA 3F5UA 4ZAUA 3ZS5A 3ELJA 3F7WA 4QP7A 5M4UA 3SLSA 3V5PA 1M2QA 2Z02A 4CGAA 3IW5A 2HZNA 3DK7A 4RLLA 4MQ2A 4RC2A 2OSCA 3D2IA 2BALA 5DLSA 2BDWA 4CFVA 3AMYA 2BRNA 3D15A 3DK6A 4O2PA 3DB6A 4XV9A 2HYYA 4DAWA 4GJ2A 4QRCA 2G9XA 1T46A 4QP9A 1UU8A 2BFYA 5CEMA 4ACHA 4IW0A 3NVKI 3D9VA 2FGIA 2PVYA 1XQZA 1NXKA 2HZIA 4YLJA 3VS2A 2XNPA 4XG7A 3GP0A 4EK8A 4LRKA 2WQOA 4BCKA 4JRVA 5LARA 4GT5A 4H3PA 4JIAA 3FKNA 5CAOA 3ZC6A 2QODA 2X2LA 3CCNA 2UZDA 3OS3A 4IDVA 1Q8TA 4UY9A 5I9YA 4L46A 1O6KA 2GPHA 4M66A 2V22A 2QO7A 3SKCA 3FWQA 3QUDA 4K1BA 3SXSA 5M57A 4V04A 2ITTA 4FNWA 3P4KA 4CRLA 2OF2A 2PL0A 2VTTA 3GCVA 5DPVA 3R1NA 4DH5A 2QVSE 5A4TA 3QD4A 4RQKA 3DBEA 3AMBA 3ZSIA 4C2WA 4CYIA 2IN6A 2YLEA 5CALA 4FNXA 1Q24A 4AW0A 5IPJA 4Q9SA 4DH7A 5IQBA 3AD4A 2Z7QA 4D0WA 3C0HA 2EWAA 3FZ1A 3ROYA 3MJ2A 4ITJA 4BIEA 1ZY5A 4KRDA 5I9XA 3AC5A 4PDOA 2C6IA 4W4WA 3UG1A 2OLCA 3QQKA 4A4XA 4USEA 2PYWA 1QCFA 4UYAA 3KXZA 4E6QA 3EQDA 3UZTA 3PXRA 2GTMA 3HMIA 4BKZA 4QP2A 5K0KA 2VWVA 2ZOQA 1NA7A 2UW6A 3LQ8A 4FICA 2V0DA 4M68A 5C8KA 1URCA 4F1TA 5DR6A 3ODZX 3QRJA 3PG3A 2X4FA 4XP2A 4AS0A 5JGBA 1NT2A 4YSMA 4YZCA 5TO8A 3WE8A 4FNZA 4P2KA 4B8MA 2IZRA 1IRKA 3EN4A 4FTRA 4TYIA 2GNFA 3IO7A 1P4FA 2HZ0A 2DYLA 4EHZA 4AA4A 4PX6A 3P23A 2ZM1A 3OMVA 4YURA 2W1EA 5CTPA 5EQYA 2XK6A 3I4BA 5FM3A 1QMZA 2HW6A 3G6HA 3HV7A 5HE3A 3DT1A 4FR4A 2XNEA 4F0IA 3PIZA 4UB7A 2R3OA 3Q2MA 2X7GA 3NLBA 3Q5IA 3P86A 4EOOA 2GNIA 5KHWA 4BYIA 2JAMA 2P3GX 4H05A 1PXOA 3FMDA 3IW6A 4HVGA 3HDNA 5CVHA 5I0BA 2F7EE 1KE6A 2C3LA 3R7GA 4PPCA 3WI6A 5AEPA 2YITA 3GENA 4L68A 1GIIA 2WQMA 4IVAA 3BX5A 4O0SA 4EH6A 5CZIA 2Z7SA 3E8CA 3I0QA 3V5QA 3QC4A 5ANEA 1URWA 2ZV8A 3Q6UA 4GH2A 4RIWA 2ZDUA 3L1SA 4O0VA 4R78A 2CLXA 5E8VA 5HLNA 5IA1A 4HGLA 3F2AA 3NNUA 3FPQA 5H8GA 2C6MA 2JITA 4RJ4A 5KKRB 3ANQA 1JLUE 4O6EA 4KBCA 1SM2A 3S0OA 3TNWA 1R78A 3SRVA 4M12A 5ETFA 5M55A 2C3JA 2XYUA 4IBMA 4CNHA 4JOAA 3ZHPC 3BWFA 5JGAA 5TF9A 3ORLA 2WTVA 3EL8A 5M4FA 2XK7A 4FSWA 1ZAOA 5K4JA 3MPTA 4AP7A 1HOWA 3T8OA 2YFXA 1G3NA 1ZY4A 4IAAA 2Z7RA 2CN5A 2Y8OA 3OY1A 3QKLA 4DFZE 3PA3A 4DT9A 3KREA 2OW3A 1IASA 4EORA 2OH0E 2JIUA 3QFVA 1ZYDA 3RPVA 3WF5A 1XH9A 3UMWA 3DBCA 5IQGA 2OWBA 5FEEA 3S95A 2BVAA 3R9RA 5AV4A 3KF7A 5L8KA 2W1ZA 2B9JA 3MS9A 4FSZA 4CV9A 4YHFA 3TKUA 5CXZA 3DY7A 4FTMA 5E7RA 4R1YA 3BHYA 3C4FA 2PTKA 5IDNA 3QZGA 1IG1A 2ESMA 3OWLA 4LM5A 5ANJA 2GFSA 3PWDA 4FI1A 3C13A 4D28A 5M56A 3EQFA 1PXIA 5GZ8A 5LOHA 1M7NA 3V01A 4F9AA 4C4JA 5EFQA 3GU4A 3R8PA 3K2LA 4GK4A 4XV3A 4U7ZA 3V8WA 5JFXA 4I1ZA 5AA8A 4QMUA 4BZOA 4MXYA 2XK3A 4MXXA 4V0GA 3HAVA 3FI8A 4YUQA 2F57A 3VUHA 3MH1A 2YJSA 3VUGA 5FGKA 2HENA 3POOA 4ARKA 2WZJA 2W1HA 3LFCA 2WTCA 2WMBA 1B38A 3HAMA 2PZYA 5AP3A 4IVDA 3E3PA 3O17A 4DGNA 2QO2A 3DPKA 3FKOA 4IAYA 3BE9A 2ZJWA 3LFEA 4E8AA 2IVVA 1XR1A 3LFQA 2I0YA 4FKQA 5CASA 1W7HA 3EMGA 3NWWA 3W33A 2O65A 4UWCA 3ZOSA 4LOPA 4PTGA 2QNJA 4RJ3A 2JDRA 4GFGA 5DEWA 4JG8A 1YHWA 3UIXA 1AD5A 4D5KA 2NRUA 2QOHA 5LMKA 4IAIA 1B39A 3IOKA 2WAJA 4F63A 2B0QA 2WMTA 5HTIA 3CQEA 3DQXA 5EHYA 4FSRA 1ZYLA 3D7ZA 3QQFA 1OPKA 3LFSA 5GNKA 3WIGA 2RGPA 4MXOA 5AWMA 4RWKA 4FV7A 3ZEWA 4FKLA 5FUTA 4XUFA 4RFMA 3UE4A 1TVOA 2EB3A 2QC6A 2R3FA 4PDSA 3R7YA 3SOCA 1H00A 1MP8A 3PXYA 4FV5A 5IUHA 2WMSA 3GB2A 2QOLA 4F7JA 3IGOA 4PNKA 3PZEA 5A54A 2IZSA 3PXZA 5DHJA 4EH8A 3H4JA 4WRSA 5HCXA 5L3AA 3CY2A 2JDTA 2R3RA 4RIYB 5FXRA 3NNWA 5K0XA 3ET7A 3ALNA 2VWUA 5ACBC 3HMNA 4YJNA 3MWUA 3OOGA 1Z57A 4HGSA 5ANIA 3O2MA 3VUDA 3IECA 2PWLA 3IDBA 1FGIA 3F5PA 4D2TA 1LPUA 3FJQE 3MFRA 4CEGA 4AW1A 3LFFA 4BICA 3COMA 4LUDA 3GCUA 3T9TA 4NZWB 3UOKA 4Y8DA 2X6EA 3AC3A 1TQPA 4MXCA 2PU8A 1QPDA 1ZYCA 4O82A 3F3WA 2B54A 4J8NA 4MTAA 1NY3A 3VUTA 4UX9A 2RG6A 4XX9A 4DYMA 5CU6A 4WIHA 3W55A 3ZMMA 4FEWA 4DBXA 4M3QA 3Q6WA 4DFXE 4F7LA 4LFIA 2QKWB 1LR4A 4C4FA 3QQJA 4AFEA 4RMZA 3RAHA 4CKJA 1J1CA 1OL6A 3O7LB 5CF5A 4OW8A 3IGGA 4O0XA 1MRUA 2J0LA 5BUIA 3SG8A 3QXPA 3GC9A 4CFXA 1IA9A 5CSHA 4N70A 4TWNA 3ORZA 2I0HA 4LV8A 2WU7A 4GUBA 5D9HA 3DXPA 4XG9A 2W96B 1M17A 1E9HA 4L7SA 3A99A 3M2WA 4FTQA 5HCYA 3ORTA 2CCIA 2XIXA 3ORNA 4QD6A 4WNMA 2GHGA 4FV3A 3SDJA 3TNIA 3VS6A 5GIOE 5D11A 1YDRE 4Z3VA 2WEVA 4W8DA 5IQEA 2X4ZA 3D5WA 5AV1A 4F09A 3GU8A 1XBAA 4L3PA 5IA4A 2G1TA 3UZRA 5L2IA 4NIFB 1RDQE 3FDNA 5TT7A 4Y73A 4GYGA 2WQEA 2QR8A 4YLLA 4L01A 1V0OA 2HZ4A 2QI8A 1PF8A 2OFUA 3PY1A 4FBXA 3V8TA 4YC6A 1MRVA 2IO6A 3PJ8A 4MAOA 2YIYA 3QL8A 4GJ3A 1Y8GA 3M11A 1YW2A 4IWQA 1Q97A 3OBGA 3D5VA 3CR0A 3LXPA 4EOLA 4DFUA 5HG7A 5EOBA 3U51A 3ZFXA 3GEQA 1KUTA 2GFCA 2C1AA 5DH3A 1OL7A 5IEXA 4DLIA 3CE3A 3GQLA 4FSTA 2IG7A 4C7TA 4J98A 2VUWA 4RIXB 4JVGA 5AP6A 5DIAA 2R7IA 1TKIA 3UIBA 4YU2A 5F9EA 4ANOA 3UIMA 3WZDA 1HCKA 5AV0A 3U55A 2DS1A 2GTNA 3QTRA 4ZY6A 4IZ7A 4D4YA 3H3CA 3QUEA 4DF3A 5GJFA 2VTSA 3I1AA 3VBVA 3FEGA 1FVVA 2W4KA 2XEZA 2JC6A 4TNDA 2A27A 4WUNA 3FMJA 5E8YA 3A8XA 4CCUA 4EYMA 4FA2A 3EFWA 4KA3A 4X2GA 5HBHA 5C01A 3PUPA 4NCTC 3S00A 1SZMA 1SMHA 3T9IA 4CZTA 4D1SA 3NAYA 1OGUA 3UO5A 3I6UA 3RCJA 1Q8UA 3O0GA 4FVRA 4PP9A 2VD5A 3KXXA 4G3GA 3TWJA 3DLZA 3JPVA 3BI6A 3FC1X 4FSNA 2VX3A 3G15A 3EQHA 3FYJX 5H9BA 3ZBFA 3R7UA 5BYLA 3FLQA 4LI5A 4ZMEA 3W1FA 3AT4A 1DAWA 1GY3A 2SRCA 4LGDA 3L9LA 3IW7A 4EHEA 4EK3A 4EOQA 3D0EA 3ZUTA 3RNIA 4UZHA 2B9FA 4M0ZA 4EBVA 3LAUA 4AE9A 1OI9A 5J9YA 2YDJA 3NUUA 4WOVA 4ACMA 5EH0A 3ZBXA 4L6QA 5C8NA 4ANLA 4CFNA 4QPAA 2BROA 3QXOA 4XOYA 3KK9A 4ITIA 3E64A 4BYJA 1OITA 4OTFA 3E87A 2QHNA 1ZWSA 3FZSA 3PVUA 3RZFA 4C35A 4WHZA 1WVYA 1Q8ZA 2HXLA 4WUAA 4X6QC 4ZLOA 5CI7A 3FLWA 4H1MA 4WSYA 4U79A 3Q4UA 1JWHA 2BKKA 1UV5A 3BV2A 1LEWA 1WVWA 1Q62A 4FKVA 4JDHA 3GNIB 4XCUA 3VJNA 4F7NA 2WU6A 3Q52A 2ITZA 4PRJA 3QZFA 3VBWA 4RRVA 2BHHA 4WNPA 1XH6A 3MN3A 4EC9A 5GINE 4QTDA 4GV1A 1ZOHA 3NIEA 1UA2A 3PRIA 5CQUA 2VWZA 4LOQA 1O6YA 4A9SA 3E8DA 2QKRA 2X7OA 4YJQA 4QQ5A 3CKWA 3K5UA 1A48A 3U54A 4IVCA 3JY0A 2WIPA 3KVXA 4JQ7A 4CMTA 5IEVA 3KL8A 3H0YA 2YIRA 5BVKA 4C37A 5JFVA 3CTHA 4NJ3A 1ZRZA 3DFCB 1OIRA 3FZTA 2W5BA 3C1XA 3HL7A 2X8DA 2XBAA 3AGMA 4OTGA 4EH4A 2C6OA 4AOTA 3R7VA 2VZ6A 4U5JA 1PRYA 4P90A 4RVTA 2YM6A 2JBOA 4CZUA 4JQEA 3ZZEA 4DTKA 4A9YA 2CGVA 3VJOA 2WMQA 3UC4A 3MTFA 3CTJA 3GCPA 3R22A 4BZDA 2C47A 2PZPA 3QWJA 5AUYA 4F6SA 3JXWA 3TEIA 4PMPA 2R3HA 1Z9XA 2JEDA 4DEDA 5CXHA 3A60A 3BYVA 3FSFA 4IJPA 3UOHA 2XK9A 2XJ1A 2IW6A 2W1IA 3P5KA 2VX1A 5E92A 5AMNA 3G9LX 3HRCA 3CQUA 4I6QA 4O7NA 4C4GA 4QP4A 1PHKA 1M52A 3GC0A 4MD7E 5LVNA 3CXWA 3R30A 4JQ8A 4ZIMA 5CYIA 3WE4A 3NMUF 4K8AA 3ZLWA 4OTRA 4DFBA 1OB3A 2CKEA 4BIBA 3VBYA 1YKRA 3MPMA 4BCQA 3GC7A 4MCVA 2UZUE 2GU8A 4FV2A 5C8MA 3W2OA 3N4VA 1OKVA 3QX2A 3P7BA 4FIEA 4FT7A 3ORKA 2C0IA 4GU6A 4DEGA 5K4IA 4DHFA 5ETAA 2AUHA 5DVRA 1ZMWA 5FTGA 3QALE 4AZEA 5E1EA 4PMMA 2ITPA 4P4CA 3DCVA 2QR7A 3TZ8A 2XIRA 4TYHB 3PE1A 4WSQA 3VUKA 5CANA 3R8MA 4IWDA 4G1WA 2BTRA 2PVNA 3LZBA 5L2TA 4DEEA 5E8UA 2R3QA 3LJ0A 2X9FA 3D94A 4O0RA 3V51A 4O7SA 3FAAA 3IS5A 3D7TB 2NRYA 1OBDA 1VZOA 2PVRA 3GFWA 2YACA 5E8ZA 2REIA 3EFJA 3I6WA 4XBUA 3Q4CA 5F95A 3U8WA 3KCKA 4HYIA 4JL9A 1A06A 4R3PA 2XIKA 5IKWA 5TR6A 3MA3A 4FTCA 4N6YA 4Q9ZA 1ZYSA 4FYOA 3W2SA 3NS9A 5AV3A 4CKRA 3BGPA 4RLKA 3QBNA 2CHLA 5CEIA 5CAPA 3UZPA 2VTPA 2C6EA 5AAGA 1IAHA 3W32A 2A4LA 2OFVA 4H3BA 3RWQA 3M1SA 4F08A 4YTIA 1STCE 2H96A 4XV1A 4I4EA 4CMUA 4EZ7A 5I9VA 3R63A 2JKKA 2YEXA 3UNKA 5B2KA 5DR9A 4ALUA 4XHKB 4FKSA 4KRCA 3MH3A 3DKGA 4JNWA 3NUPA 5FTQA 1WBWA 4GK3A 3UO4A 4I0SA 3R7EA 4DFNA 2YAKA 1REJA 2HY81 3HUBA 3LLTA 3OCBA 4ZSLA 5JQ5A 5A4EA 4O83A 4Y83A 4CFFA 4W4VA 2VTQA 4NIFA 2ITUA 4NSTA 2XJ0A 3REPA 4AOIA 2BFXA 4JT3A 3BV3A 1L3RE 3R8VA 4AT4A 2PSQA 3DQWA 3II5A 4EK5A 3LOKA 5BVEA 3I7CA 2PVHA 3U4UA 2QG5A 3OWJA 4R3RA 4YP8A 4DH3A 5IA2A 4YMJA 4EKLA 3I5NA 4MD9E 5HIDA 4C36A 3HV3A 1ZYJA 5AA9A 2XUUA 3ZDUA 4MWIA 5J79A 5H8EA 4D2PA 2F9GA 3DZQA 4M0YA 3EKKA 3MFSA 4DFYA 3QD0A 4IB0A 4ZXTA 2QOBA 4AN3A 3KRJA 4G17A 1XBBA 1XKKA 3Q4TA 1PXNA 2HWPA 2BAJA 4RIXA 2IWIA 2QHMA 4FL2A 2A1AB 4CG9A 3ODYX 4B6LA 5M06A 1UKIA 4TWCA 3OHTA 4DCEA 4MXAA 2C1BA 3IK3A 4BDHA 3UG2A 4F6UA 3OVVA 4FSQA 5BUJA 1F5QA 2P33A 3KY2A 5HU3A 4D55A 4XV2A 3TT0A 4XH6A 3OZ6A 2HY0A 2CSNA 4IH8A 4Z16A 1BL7A 3C7QA 4JLCA 1ATPE 3VRYA 5LCKA 5AAEA 1FVRA 4FEQA 3GFEA 2VNYA 4NFNA 4QMPA 4FKPA 2ITQA 2BRBA 2BIYA 5JKGA 4IWOA 1H25A 4JG7A 2ITNA 5K5XA 4QMLA 4RA5A 5HKMA 3DV3A 3C51A 3ORXA 1Y57A 4M15A 3A62A 4RBLA 5EM7A 4C02A 3O7LD 3OCGA 4ZTNA 3DXNA 4H1JA 3A7JA 3BWJA 3ENHA 4HYHA 4K33A 4QTCA 3FL5A 1W83A 3VQHA 3ZRLA 4A9UA 5BVWA 3G2FA 4E20A 4CFMA 1YDTE 2QO9A 3L9MA 3RCDA 2WIHA 4PMSA 5BMMA 4NYEA 3QRIA 2UW4A 3K3IA 3VS1A 4AZWA 4P5QA 5AR5A 5HZNA 4TT7A 3CC6A 3F2NA 2GQRA 4DEBA 3OWPA 3OXZA 4ACGA 4AZSA 5HG9A 4WG5A 3AC8A 4U43A 4E5AX 4O7RA 5A4LA 5A46A 2CJMA 2PZIA 2UV2A 3WARA 5I4NA 4QYEA 5IH6A 5HLWA 5HD7A 4C4HA 2PE2A 3UNJA 4I22A 3R83A 1VR2A 3AD6A 2WMUA 3HVCA 4FUYA 4LOOA 3FKLA 4ANQA 4HGTA 5DOSA 4B9DA 4BB4A 2IVTA 3KMUA 3ZO1A 3LJ2A 2Y6MA 4F7SA 5KHXA 5AP4A 3W2RA 1OIYA 3UGCA 4NCTA 1H27A 2JFLA 3GCSA 3LQ3A 1ZZ2A 3DNEA 5M51A 5HHWA 3O8TA 2E9VA 4OTDA 4F9YA 5BYYA 5DRBA 3B8QA 3ACJA 4MXZA 2XB7A 5F94A 4BTJA 3QTZA 5KMKA 2F4JA 4AA5A 5HBEA 1J91A 4MF0A 1JKKA 5HEZA 3RPYA 4M8TA 2WTJA 3RK9A 5AR3A 4MVFA 3BZ3A 3CJFA 3WOWA 5AP2A 4R5SA 2C5VA 4YLKA 3VS5A 5LMAA 4AZTA 3TKHA 4BCHA 1H4LA 4A4OA 4FV0A 1SYKA 2UVXA 1ZARA 4HZSA 3OROA 1YHSA 4LL5A 4YJTA 5JSMA 5AFVA 5ANGA 2XCKA 3ZM9A 2OKRA 3AGLA 5FDXA 3TUCA 3DZOA 4O27B 2RSVA 3PVGA 4FIIA 4QP6A 5IQFA 3WZUA 4QMTA 4G5JA 4U9AA 3TIYA 3FXXA 5ANKA 5LJJA 3FI2A 3UQFA 4G3EA 5HNGA 4G34A 4F4PA 5HIBA 2OXDA 4CFWA 4ZY4A 4USFA 4GT3A 4KS7A 3QLFA 3EN7A 3V8SA 1BI8A 4LYNA 4QP3A 2IVUA 4AGCA 4L45A 3NW6A 4PL5A 5FP6A 2JAVA 4J96A 5HORA 5CS6A 5C03A 3PG1A 3EQPA 2VTMA 3IONA 4ANNA 5TKDA 3DKCA 4GFMA 1YI4A 3KRXA 2KULA 3QUPA 2R2PA 4S31A 3CQWA 4FVQA 4GEOA 5E4HA 4F9CA 1OBGA 2QOIA 1V1KA 5IMEA 2PVFA 3QZHA 2UZLA 3R1QA 5CY3A 1YDSE 4C4EA 4E4LA 5KO1A 1YRPA 2EU9A 2R3NA 3NRMA 4RX8A 2BZJA 4O1PA 4QNAA 3RPRA 4OTIA 5HE2A 4BCNA 3FL4A 1GOLA 5KKRC 3KMWA 4ZEGA 3LJ1A 3T3UA 4D4RA 2C0OA 4F1MA 3ROCA 3PLAE 4TYHA 4L8MA 5LMBA 3UVRA 3OEFX 3W2CA 2UZNA 3OUKA 4YO6A 1J1BA 4E6AA 4XMOA 4BTFA 2YWVA 5C26A 4PNIA 3F6XA 2WXVA 5KMMA 4J8MA 3Q9ZA 1YQJA 4FG8A 3D7TA 4O6LA 4FE2A 3GOPA 1ZOEA 3GOKA 2RFNA 5H8BA 2R5TA 1F3MC 3LFAA 2I40A 2WOUA 4U6RA 2J0MB 4JR7A 4ERWA 5A14A 5AUXA 4C58A 4HYUA 3VS0A 3MDYA 4MX9A 4IDTA 2RL5A 4HVIA 4CCBA 2V62A 4NM3A 3Q4ZA 2Y0AA 4ENXA 1Q4LA 2HIWA 4IX4A 5D7VA 3W18A 5JN2A 3AG9A 2CCHA 4ZZNA 4TRLA 2JDSA 5IMXA 2E9PA 1P2AA 2W06A 2GNGA 5KZ0A 2XMYA 4D58A 3LFDA 3ALOA 1APME 2EXEA 2WFYA 3D5UA 3HA6A 2I7QA 1KE9A 3LM5A 3DKOA 4NJDA 2JKQA 4PF4A 4XS2A 5AAFA 5FBNC 3H9OA 3LXKA 4NH1A 3QYZA 5ETIA 3Q9XA 3SX9A 4JR3A 2ZMCA 3UYTA 2BUJA 3ZFMA 3TACA 4A07A 3LCDA 2XNNA 5EK7A 3PPJA 4S32A 4IHPA 3G9NA 4GK2A 4ZZMA 5AUTA 5HX8A 2X6DA 4GIIA 4UYNA 3RINA 3ZUVA 3QTUA 4J7BA 2HW7A 2HCKA 3UYSA 4X3FC 4M67A 5CEKA 2VX0A 4NFMA 4JG6A 4E73A 1Q8YA 3DGKA 5KMLA 4JX3A 2XIYA 3PSBA 3WZKA 4KKGA 4FMQA 3I5ZA 3R01A 2VO3A 4FUXA 4H3QA 4IM0A 4UMQA 1IA8A 1KE5A 4FKUA 5EI8A 4BTKA 4YTCA 1ZMVA 4ZP5A 3BGZA 5D7AA 5HI2A 1ZMUA 4DEHA 4YZNA 3KN6A 4LMUA 2PHKA 3C4WA 3NGAA 3MH0A 1ZXEA 3ZFYA 4M7IA 3PA5A 4MEDA 2ETMA 4MYGA 1XWSA 3RP9A 3FPMA 4GRBA 3SGCA 4E5WA 2C3KA 3L9NA 3R9HA 2XK8A 3D14A 4Z7HA 3GXLA 4HVHA 4FGBA 4JDIA 3NYOA 3R0TA 1UKHA 3DK3A 2BZKB 2I6LA 3NYXA 4M97A 4C3FA 1P14A 5KMOA 4O0YA 4EUTA 2FSTX 4EWHA 4JIKA 4E26A 4JBOA 4MNEB 1OKZA 4KKHA 4YTHA 4KBAA 5JFSA 5LCJA 3FQSA 3FUPA 5EM5A 3EZVA 4UMPA 5DMZA 4S2ZA 5DYJA 1Y8YA 4P7EA 5FEQA 1X8BA 3BEGA 5E90A 4AWIA 4XRLA 2G15A 3Q04A 3ZRMA 3W16A 1H28A 4Z7GA 4X3FB 3C50A 4FVPA 4CMOA 2W9FB 3QCXA 2XCHA 3KXGA 1DS5A 3AMAA 5K9IA 2PVKA 1NW1A 1H1PA 5CVGA 3R21A 2W99B 4HYSA 3BGQA 3KA0A 3PP1A 1Q3DA 4ZTRA 5I9WA 4F0FA 3E92A 2F7ZE 4BDFA 3SD0A 3W8LA 3F3VA 5H3QA 3AQVA 2UZEA 3SW7A 1OMWA 4PPAA 3U6JA 4FEVA 4E3CA 2I0VA 3RVGA 1H01A 4D2VA 5KX8A 1U54B 3B8RA 5I3OA 3HV4A 4K2RA 4WG4A 2VWIA 3O51A 5EDRA 2VWBA 3R02A 4IVBA 5L2SA 4ERKA 3DBQA 4YC3A 4O7LA 4QNYA 5HBJA 4I24A 3TDWA 2XNGA 3CS9A 4E6DA 2WMWA 3A2CA 4FX3A 4AZVA 4X0MA 3FC2A 3KU2A 4BCMA 3ZU7A 5A4QA 3B2TA 3PZHA 4NM5A 1PXJA 1OKYA 4GG7A 2YHVA 4YBKA 4UWYA 2R3JA 3SOAA 2WELA 2O2UA 4L42A 2VTOA 2BZHB 2XIZA 4FIJA 4FTTA 4QYHA 3LMHA 5CZHA 3PRFA 2WTKC 3EQCA 3ACKA 2UW7A 2IW9A 3BLQA 4FSUA 4EHGA 5B2LA 5J9LA 5M08A 2VAGA 2BAKA 5C4KA 4L9IA 5FXQA 4BDJA 2OGVA 2LGCA 4KUJA 3V5WA 4IAKA 2PE1A 5HG8A 3TJCA 4AN2A 3RM6A 2PUIA 3THBA 4QMNA 1GZOA 2C5OA 1IR3A 2O8YA 3RKBA 5IZFA 2PUPA 4AFJA 4AUAA 1OZ1A 5HGIA 4BFMA 3R2BA 2WMXA 2XEYA 3BRBA 4IANA 2PPQA 4RC3A 3ORMA 3CBLA 4LGGA 3NZ0A 1J7LA 2BIKB 2BRMA 2PVMA 4GT4A 4GW8A 5FQDC 4CRSA 5EM6A 5AV2A 3LE6A 4G3FA 5E9EA 1L8TA 2W7XA 2WMVA 1PXPA 2BCJA 1H1RA 3VBXA 4A7CA 2JLDA 2P55A 2BRGA 4U8ZA 5LXMA 2J0JA 3PSDA 4TN6A 3EJ1A 3DTWA 4BN1A 4HW7A 3T3VA 4PP7A 1WVXA 5HX6A 3DBDA 5T3QA 4EUUA 4I21A 2QG7A 4MBLA 4D1XA
chains in the Genus database with same CATH superfamily
4Y5HA 4I3ZA 4BR3A 4DITA 5HD4A 2WTKB 3QQGA 4HJOA 4BDDA 3OT3A 3F61A 3CPCA 3PIYA 4XJ0A 1S9IA 4Z9LA 5GZ9A 4V05A 5AIRA 3SHEA 3ZXZA 2YDIA 4BCPA 5FDPA 4OAUC 3H0ZA 3LM0A 4DGGA 1R39A 2A0CX 2IZUA 2E2BA 2R3GA 3QAME 4U41A 3PPKA 3EFKA 2XF0A 2CNUA 3LLAA 3MYGA 4XG6A 5EI6A 3HKOA 3W0MA 2W9ZB 3ZC5A 3OUNB 5AUUA 4IIRA 3R2YA 2E9OA 2VTLA 4OTWA 3VF8A 4H39A 4EKKA 2R3LA 4QOXA 2R64A 3V6SA 4M84A 5J9ZA 4XYFA 1BL6A 4YZMA 5GJDA 4BWXA 2CGXA 2W0JA 1ERKA 3EHAA 3E7OA 1Q5KA 4FV6A 4AQCA 4J95A 2F2UA 1WBOA 3Q3BA 2XZSA 1EH4A 4RT7A 3OW3A 4BDIA 4ALWA 3WIKA 4JDJA 4WBOA 4QTEA 4TYEA 2OXYA 1H1QA 3WZEA 4AU8A 2GNJA 4I20A 1J3HA 2B52A 2NPQA 2R0IA 2B53A 4EONA 2ERKA 3RGFA 4ZTQA 4AN9A 4NL0A 3FI3A 3IDCA 3W8QA 2WTIA 4K77A 4IC8A 3L8PA 2VU3A 3RALA 4EOMA 3MGYA 2C6LA 4KIKB 4TTHB 3KN5A 1P5EA 2QOFA 3NPCA 4ASEA 3MY0A 4BI1A 3Q5ZA 4D4VA 1RJBA 4JBQA 4ZLZA 1YWVA 2CGWA 3HRFA 2FYSA 5DGZA 3P5JC 2O63A 3TNQB 4DG0E 4RJ8A 3MPAA 2HXQA 3UVPA 5HNIX 1KE7A 2Z2WA 4C57A 4DGLC 5AX3A 2IF8A 5A6NA 4S33A 3RWPA 5E8TA 2GS2A 2OIDA 4MD8E 2QQ7A 3F5GA 4Q5HA 4BRXA 3RJCA 5AIKA 4W9XA 5EOLA 3SC1A 2Q83A 3KFAA 5EDQA 3FMMA 4YNOA 3TV6A 1W8CA 4BHZA 3SA0A 4CTCA 5HESA 4RJ7A 5AR4A 2J0KA 4TPTA 3F69A 4NTTA 2NP8A 2UVYA 2X2MA 5EW3A 2R9SA 3H9FA 3BQCA 4IM2A 5LVLA 4ZTLA 1G8SA 4O4BB 1NVQA 2G2HA 2WHBA 1ZOGA 3S2PA 3ZYAA 2QCSA 3RPSA 3VNTA 3QLGA 3LMIA 4UMTA 3ZCLA 5BUEA 5BV3A 5DWRA 2ETKA 2O3PA 2PZ5A 5KNJA 1H0VA 3UNZA 2RG5A 1JAMA 1UNLA 3BPRA 3QWKA 3TNPC 5KMIA 2FSMX 5KE0A 4N6ZA 4RX9A 1UNHA 3WF8A 4G6OA 4GCJA 1SNUA 3VAPA 1KOAA 3E88A 3BU3A 3PJ2A 1OL1A 3QTWA 4G2FA 5IG1A 4HNIA 4KIOA 2EXCX 4RZVA 5EKOA 4BGGA 4BKJA 1VLRA 4AACA 2NO3A 2YCSA 2FH9A 1JKSA 2IEWA 3KEXA 4MQ1A 4MNEA 1PYXA 3QHWA 1XH8A 3KC3A 3IOPA 2YA9A 4AT5A 4KBKA 1BLXA 2Y9QA 4UZDA 4HPTE 1WBVA 3ID6C 5LWMA 1MQBA 4RIOA 4N0SA 5EW8A 4S30A 3NDMA 4BWPA 4X3FA 4EOIA 3GU5A 5AUZA 3H10A 4CLIA 3HMPA 4I0TA 2YM3A 2FUMA 4FZ7A 1GAGA 3CIKA 4QO9A 2WTWA 4QMOA 4I6FA 5FP5A 1I44A 5C9CA 3VHEA 2XAOA 1Q8WA 3HP5A 1U4DA 2FSOX 4CLJA 5JK3A 3DKFA 3HNGA 5DG5A 5EYDA 5C27A 3D2KA 5FWKK 4FKOA 4QT1A 4I6BA 4QYGA 3U6HA 4U42A 2DQ7X 2JKOA 2Q0BA 2JBPA 4GSBA 3V5JA 3H30A 2XANA 4AOJA 1Q61A 3QGWA 3CGOA 4LGHA 5DT3A 4EH3A 4NWMA 1JSTA 3G33A 2R7BA 4XBRA 5DT0A 2W5HA 3G90X 5AM7A 4OR5A 2X8IA 1U54A 2BPMA 2OH4A 3QYWA 4OTQA 2W1DA 4KNBA 1YXSA 2OJGA 3CPBA 1QPEA 3BELA 5BNJA 1R1WA 4RC4A 5FEDA 3W0QA 3O8PA 1Q41A 4KB8A 1UU7A 2PMIA 2WNTA 4HPUE 3R73A 1WZYA 3UC3A 4DFLA 2UW3A 2PMLX 3P79A 2H6DA 4ZK5A 2C68A 4FOCA 4O7VA 4BCOA 4D5HA 5BVFA 3VONA 4OLIA 3EIDA 5G6VA 4B8LA 3U87A 5E8XA 2IZTA 4DDGA 4EQCA 3SVVA 3QQHA 2VTAA 1I09A 2XKFA 3IPHA 1UWJA 4JXFA 4RIYA 3A4OX 3GGFA 2WMAA 2CN8A 4R1VA 4BGHA 5HNBA 1J7UA 1PXKA 4RVLA 3NCZA 4RJ6A 3FMNA 2IJMA 2J9MA 2I0EA 3RI1A 4AW2A 5E91A 3O71A 2JIVA 3C5UA 4GVAA 4YO4A 2GQGA 4AGWA 2GHLA 4FIFA 3BHHA 4E93A 2H8HA 1OUKA 1WBSA 3OP5A 2C5YA 1MQ4A 3BBWA 4KD1A 4X6RA 5DNRA 2JDVA 4XG4A 1LUFA 2QOOA 3K5VA 4LRMA 5AADA 4DT8A 4O2ZA 3NSZA 4Y46A 2YN8A 3F3ZA 1VYZA 4PDPA 2C6KA 3KCFA 3CY3A 4UXLA 5ANOA 4PQNA 3QCQA 1UVRA 4GKHA 5M07A 2XBJA 2PY3A 5LWNA 5D12A 3R28A 2HWOA 1JQHA 2ZB0A 3NR9A 4AA0A 4FKWA 4X21A 2YCQA 4XLIA 3NX8A 3IKAA 3QTIA 4O7WA 5E8WA 4ORKA 4B99A 2P2IA 3SV0A 3OW4A 4ZZOA 4EQUA 2XNMA 5D1JA 1QL6A 4IX5A 3E8NA 4PPBA 3RNYA 3PXKA 4BL1A 2J4ZA 3KULB 4JRNA 3COIA 3FZOA 3OCTA 4ITHA 4NEUA 3RZBA 3TV4A 1ZZLA 4FT3A 5EQPA 4JJRA 2E9UA 4MKCA 3MB6A 5AJQA 3HECA 4GKIA 5M4CA 2BAQA 4P5ZA 4AX8A 4GVJA 2V55A 5KMJA 5JZNA 3R8LA 4UWBA 4C0TA 4R7IA 1OPJA 4F99A 5A6OA 2QU5A 3M42A 2JKMA 4Y85A 4YJSA 3WF9A 2J90A 3UO6A 4MF1A 3R04A 3WF7A 3EYGA 1TZDA 4BDAA 4J53A 2EVAA 3L8XA 4XLVA 4O4EA 2YCRA 3OWKA 4XG8A 4ASDA 4CT1A 4DBNA 2OICA 3QGYA 5EYMA 3BQRA 4BTMA 3FLYA 5K5NA 3LXNA 4M14A 4EHVA 2PUNA 3OG7A 2IPXA 4MWHA 3EN6A 3P7CA 2QOQA 4FEXA 3FY2A 3UP2A 5GJGA 1M2PA 1PKDA 3NW5A 3P7AA 4LQMA 2GS7A 3ZH8A 5IH5A 5IUGA 4WO5A 2YWPA 5J1VA 2I1MA 1PXLA 3QRUA 2UZOA 4AW5A 4Q5EA 4FSMA 4CTBA 4KWPA 5IA0A 4A9TA 5DRDA 3BU5A 1OIUA 3QA8A 4FKRA 3UOJA 4I6LA 3I7BA 1TQMA 4RX5A 2ZV2A 5BVOA 3G0EA 1JSUA 3NVMB 3NUNA 1YHVA 5CSVA 4TYGA 5HLPA 2W1FA 3C9WA 3FHRA 2C69A 2F49A 4L43A 4MH7A 5CENA 3W2PA 2AEGA 3MW1A 2C5NA 4YPDA 4YSJA 4ZJVA 1LEZA 4IM3A 2E9NA 1WBPA 3LFNA 2X8EA 5J5TA 4CKIA 4X7QA 4E1ZA 3WBLA 2YIQA 4QMMA 5CNOA 5B0XA 4NTSA 5HOAA 3ZO3A 4EEVA 4O7ZA 1YI6A 4UBAA 4I93A 3A7IA 3MV5A 3Q53A 4ZOGA 1BKXA 1YOJA 1H0WA 4AF3A 4BKYA 3QTQA 3TM0A 4FOBA 3LMGA 3FMKA 3QZIA 1U5QA 5KMNA 5J8IA 4QMZA 3DU8A 4G16A 4MBJA 2ZDTA 1U46A 1H8FA 1YOMA 2VTNA 4RWIA 4ANBA 2YISA 3UTOA 3AC2A 2EUFB 3BEAA 5AP5A 3DJ7A 3ZLSA 3CGFA 3Q2JA 4PL3A 1AQ1A 4G6NA 4G5PA 4YGAA 5J95A 3ZM4A 4HCUA 3LCKA 5AP1A 3FXWA 3NUSA 4FZ6A 3NFGB 3TIZA 3OFMA 3MIYA 3GUBA 3V5LA 3DAJA 2QLQA 3IQ7A 3ULZA 3LCOA 3R6XA 1XO2B 5IU2A 3NAXA 3FY0A 3K3JA 5I5ZA 4AAAA 3I60A 3VW6A 1ST4A 1XHAA 2C0TA 4BC6A 1PYEA 3FMLA 4O81A 1JPAA 2ITVA 2VGOA 4TW9A 5KUPA 4PWNA 4AZFA 2BKZA 4I0RA 3VC4A 3JUHA 3KKVA 3DTCA 3PDTA 3I81A 4R5YA 2LAVA 2F2CB 5K3YA 3Q32A 4HVDA 3ETAA 1KV1A 2CPKE 3C0GA 3HP2A 2UVZA 5ACKA 5JMSA 4N57A 2GSFA 2WD1A 3NUXA 5FTOA 5T68A 1J7IA 2YM4A 3KGAA 3O50A 2OIBA 4O0TA 1H1WA 3KRLA 4O0UA 2CGUA 4JAJA 2XAMA 1JSVA 4DHIB 1R0EA 1W2DA 2RIOA 3KRWA 5EI2A 4EWQA 4KINA 4D2SA 2JIIA 3JS2A 2CKQA 1KOBA 3P78A 5DEYA 5ICPA 3MESA 4FZAB 5CAQA 4D9TA 1BI7A 3I0OA 4IADA 4F0GA 2PZRA 5FRIA 1W2FA 5DR2A 4D0XA 4F9WA 1FOTA 3BLHA 3OTVA 4UALA 3EB0A 3G6GA 2WKMA 3BYSA 3DAEA 4BGQA 4BWKA 3LFBA 3ATTA 2Y4IB 1DM2A 5TE0A 4EC8A 1DAYA 2QONA 4XNEA 4GL9A 4ZS4A 2AYPA 4NM7A 2VV9A 5CI6A 2W1GA 3QQLA 4CVAA 4BF2A 4DEIA 2OXXA 1IAJA 2CNVA 2Q0NA 4FF8A 5ANDA 4DLJA 4IMYA 3BU6A 4FV4A 4FT5A 2A19B 3RHKA 2O64A 3ORPA 3DA6A 4QYYA 5CSXA 1DI8A 4O21A 3RHXA 3LVPA 2XNBA 4C33A 4IZ5A 4FK3A 1VEBA 2ZVAA 3EL7A 4H36A 4USDA 3PY0A 2BDJA 3W10A 4ASXA 2OI4X 2GCDA 1U5RA 4FNYA 2ZYBA 3TZMA 5HO7A 3HGKA 2H34A 2X1NA 3DS6A 4GMYA 5EHOA 3OBJA 2WMRA 3UMXA 3HV5A 4QQCA 4C8BA 4C38A 4ZSJA 2VWXA 5BX0A 2VRXA 4X2KA 3EQIA 2G2FA 3BYUA 3HUCA 3BKBA 3VULA 4TZRA 3L9PA 2B7AA 3PLSA 1CKIA 3E3BX 1BYGA 2Z60A 4X2FA 3AKLA 3HDMA 1W98A 4JBVA 4XG3A 5EM8A 2FB8A 4R8QA 3UOLA 4FSYA 4PUZA 4Y72A 3PPZA 5HIEA 3F2RA 4EH7A 4KIQA 4LDTA 4BCJA 4DHZA 3E8EA 5CU4A 1H08A 3F5XA 2UZWE 3Q9YA 3D83A 1XH7A 3OD6X 3CP9A 3A8WA 3NNXA 3PFQA 4V01A 3WZJA 2JD5A 4EYJA 3KK8A 2PE0A 3KB7A 3F7ZA 3MBLA 4EJNA 4KAOA 1OM1A 4I6HA 4RA4A 4U45A 1HCLA 5L8JA 4I92A 4CT2A 3DBFA 3RAKA 4DCAA 1JVPP 2X0GA 5C4LA 5TOZA 3EQBA 4EQMA 4AXEA 2XK4A 3ZLXA 3MVLA 5HCZA 5IISA 3PVBA 3KULA 5FXSA 2OG8A 1E1VA 5EQEA 4IX3A 5D41A 4ZSAA 5DT4A 1YWRA 4ID7A 4LRJA 3DAKA 3N4UA 4BVUA 4C34A 3OT8A 3RK7A 4CZYB 3N51A 4HCVA 2DWBA 2OIQA 4WNKA 3S4QA 3DXQA 2VTRA 4EL9A 3AC1A 2HK5A 4XP0A 2WTDA 3ZO4A 3MB7A 2C6DA 3GQIA 3SQQA 5GHVA 3C4ZA 2OO8X 2BDFA 2J0IA 1M14A 3DOGA 1PMVA 4RWLA 4EOPA 4C2VA 2CNQA 5DN3A 2WO6A 1FINA 3GI3A 3HEGA 4U80A 3FBVA 3R71A 4X2NA 2FVDA 3GBZA 4NW6A 5I3RA 5JEBA 2GHMA 4G9RA 4RJ5A 2XRWA 5HO8A 3OY3A 5A9UA 2VNWA 4PTEA 5KBRA 1PMNA 1QPCA 2QURA 1M7QA 2R3MA 3CD8A 2OZAB 5EG3A 4F64A 4O0WA 4EZ5A 2V7AA 4IAFA 3SXRA 3TMOA 2C4GA 5FLFA 2GNHA 4OBPA 3UP7A 3NCGA 4U0IA 3COHA 3TUBA 4L52A 2ITYA 3JYAA 4ONAA 4OTHA 2JDOA 4YHJA 4ENYA 3TZ7A 3VS4A 5L2QA 3U6IA 3DLSA 2OJFE 2Y4PA 4AGDA 4EH2A 1GZKA 4IB3A 1WCCA 2J50A 4TY1A 2B1PA 3UVQA 5J7BA 4AXFA 5I9UA 2XA4A 2J51A 2GNLA 1JNKA 2P4IA 3TTIA 3QHRA 3EOCA 3QD2B 5T6KA 3HMMA 4U3YA 3IW4A 4A06A 5B7VA 3HZTA 5AM6A 5AX9A 5L6WL 2Z8CA 4J97A 3HRBA 4B4LA 4RQVA 4CYJA 1H1SA 2UZTA 2ONLA 1REKA 4EI4A 2PMNX 4I5CA 3UDBA 4IAZA 3A7HA 4BDKA 1H26A 4O22A 3BHUA 2HELA 4OBQA 3OXTA 2XM9A 4QQJA 3FLNC 3BHTA 3CD3A 1UWHA 2ETRA 2OJ9A 5CSWA 4HCTA 2RFSA 1WMKA 4O4FA 3QCSA 1YXVA 3PJCA 4C3RA 4CQEA 3VRZA 1OIQA 4WD5A 4G3DA 4ZJJA 3ZUUA 2YDKA 4IEBA 2XARA 5HVJA 4R7HA 4L67A 3TDVA 4NK9A 4M69B 4U97A 3N4TA 5EW9A 2C3IB 3IG7A 4GUEA 5L6OA 1FBNA 2ZM4A 3D5XA 3IW8A 5IDPA 3SG9A 4ZS0A 1A9UA 3O23A 4FIGA 4BIDA 4W9WA 2OU7A 2GQSA 4RFYA 4KSPA 3ENMA 3QRTA 3RTPA 4EK4A 4L3LA 5H2UA 3BYOA 4FTAA 5D10A 4YTFA 2G01A 3E62A 2YZAA 3CLYA 4K9YA 5DE2A 3UODA 4BCFA 5IH4A 3LQ5A 1QPJA 4AT3A 2PVLA 3WYYA 4X2JA 4XP3A 2WOTA 4NUSA 2OZOA 3N9XA 4MNFA 4YR8A 2OF4A 4IZYA 2X2KA 1NVSA 5BVDA 5CX9A 1GZ8A 3ZEPA 5FM2A 2ZM3A 1SVEA 3MSSA 2G2IA 3Q96A 4D4SA 2JGZA 2YAAA 4DA5A 2UW5A 2J6MA 1V0BA 4EH9A 3R7IA 2VWWA 1GNGA 3I79A 4YJPA 2B9HA 3GT8A 3LHJA 4BDBA 1VJYA 2C6TA 4DC2A 3UJGA 3K54A 2YIXA 4FTKA 2ITOA 4FKIA 4S34A 1JKTA 4CG8A 4IZAA 1PKGA 3MVHA 3PA4A 4K6ZA 1KV2A 2B55A 3KMMA 4N4SA 5EYKA 1F0QA 3E7VA 4APCA 3FE3A 3MJ1A 3DDPA 2UW8A 3BHVA 4UMRA 4GG5A 3F9NA 4I94A 5JZJA 2F7XE 3MIAA 4DINA 4YPSA 5FG8A 3EQRA 5KCVA 2XRUA 3FZPA 3ERKA 5L4QA 3LPBA 5E8SA 3QU0A 4U81A 3BYMA 3CJGA 4WRGA 4ZTMA 3GU7A 3PJ3A 3R9NA 4ANSA 4CV8A 3LCTA 2PUUA 3Q60A 4DE4A 3F88A 4HNFA 4C61A 5J1WA 1OL2A 1H24A 2YM8A 3UPXA 4OTPA 4PL4A 3NYVA 4E7WA 1SVHA 1GIHA 4FV9A 5EDPA 5LQFA 4O7YA 3AOXA 4IFCA 4RPVA 2J2IB 4YJVA 1CKJA 3EN9A 5JFWA 2CMWA 3NW7A 3CEKA 4FRFA 4RX7A 4OUCA 3V6RA 4BBMA 4ZMFA 3RAIA 3PJ1A 5AUVA 4EZ3A 5HTBA 3ATSA 3A4PA 2W05A 1KSWA 5CF6A 4FT9A 4RFZA 1FQ1B 1YI3A 2ITWA 5HQ0A 2V7OA 3QF9A 4DG2E 1UNGA 4XG2A 2PVJA 2R0UA 2Y6OA 3MTLA 4WBBB 3ZXTA 3LXLA 5BQ0A 3UQCA 2GDOA 3FLZA 5LVOA 2FSLX 2X7FA 4NKAA 3LKMA 2QOKA 3ZZWA 4I5PA 5M44A 3EH9A 5DI1A 4TYJA 3SW4A 4E6CA 3ZDIA 4AXAA 2YM7A 3TV7A 5HU9A 4YZDA 1BMKA 1IEPA 3FYKX 5DBXA 2R3PA 3E63A 3G51A 4FKGA 5IUIA 1CKPA 5IA3A 2C30A 2EXMA 3SAYA 5E1SA 1Y6AA 1PMUA 4JS8A 3PSCA 4EH5A 3UQGA 1OPLA 4B0GA 5AR2A 4QPMA 5HE1A 2GS6A 2XH5A 4DH1A 1W0XC 4D9UA 4K18A 3DJ6A 3E5AA 2VTHA 3FZRA 4TNBA 5AR7A 2ERZE 2HOGA 4YHTA 4APPA 4EOKA 2OK1A 2XP2A 3MA6A 3VBQA 4PY1A 2XVDA 4ACDA 2ACXA 3EWHA 3H9RA 1M2RA 4QMYA 4QMSA 3EYHA 4A9RA 4ALVA 5CU0A 1TQIA 2BR1A 5JQ8A 5CEQA 4RSSA 2J7TA 3PE2A 3EKNA 3KXMA 4FKTA 2QLUA 2UW0A 4WG3A 5HO6A 4CQGA 4DN5A 2ZV9A 4RWJA 4XEYA 1PW2A 1FMKA 3GU6A 1WAKA 1O9UA 5F4NA 3VW8A 5ETCA 4R3CA 3TJDA 4CSVA 1RQQA 4PTCA 3LIJA 4H58A 2AC5A 3OC1A 3HYHA 2BILB 4UN0C 1ZLTA 3HMOA 1OUYA 3R00A 4UMUA 3EZRA 4GS6A 4FV1A 5AR8A 3PIXA 5BVNA 5LVMA 4O96A 1RW8A 3BCEA 4E4XA 2XKCA 4YNEA 4FG9A 5IF1A 2IVSA 1R0PA 3JVRA 3JY9A 1KE8A 4G3CA 4BBEA 3P1AA 5CU3A 4BDEA 5KZIA 5JH6A 4F1OA 3TZ9A 1YXTA 2P0CA 3C5IA 3F66A 2FA2A 1SVGA 4L3JA 4IACA 3FI4A 4EBWA 4LV5A 3C0IA 4YBJA 3CKXA 2XKEA 4BI0A 4FV8A 1H07A 1YXXA 3P9JA 5JT2A 4QP8A 4O84A 3L8VA 3NYNA 5DA3A 2YLFA 4ZLYA 4IJ9A 2OZAA 4KIPA 2OJIA 4ZY5A 5CU2A 1CDKA 3OCSA 2XYNA 3RK5A 4YC8A 3EN5A 5CEPA 1GZNA 4O91A 5EKNA 2A2AA 2EB2A 3OTUA 3DJ5A 1CTPE 3C4XA 4RG0A 5HICA 5CWZA 4FZFB 4CD0A 3FLSA 4FTIA 4E4MA 3FXZA 2DUVA 2JFMA 3OEZA 3KXNA 4O86A 3R9OA 5KBQA 4HVSA 1OL5A 2XM8A 4YZBA 3TUDA 4DG3E 3PXFA 1BX6A 2QU6A 4IWPA 5HE0A 3ORIA 3F3TA 3HLLA 3MY5A 3A7FA 4JAIA 4D2RA 1G8AA 5BMSA 2WEIA 3DFAA 4QMQA 4DDIA 4TWOA 5L6PA 4FTUA 2OJJA 4IC7A 3NNVA 4TWPA 5EHLA 3MVJA 3W2QA 3ZONA 5IQDA 1YVJA 5CT0A 4WA9A 4FIHA 4A4LA 4TL0A 4O38A 3VVHA 3B2WA 3CTQA 2Z7LA 4FG7A 4MK0A 1XH5A 2FO0A 3ITZA 4FTJA 2CLQA 4IB5A 4NT4A 4QYFA 4FTOA 4ZTHA 3TI1A 3VBTA 1GIJA 1Z5MA 2YIWA 2X0PA 4PDYA 5I9ZA 4KS8A 5JGDA 3NEWA 2X81A 3UIUA 2Y7JA 2YJRA 5HTCA 3W0PA 3PY3A 3R1SA 5CNNA 1DI9A 3QQUA 4KABA 4C62A 2R3KA 4BHNA 2UUEA 4BCIA 1FGKA 2H9VA 4G9CA 4QTAA 4M69A 4C59A 1K2PA 3UPZA 2HAKA 4R77A 2RFEA 1O6LA 5CAUA 5JRSA 2W17A 1K3AA 4YJUA 3TKIA 4WKQA 4F9BA 3QKKA 3DDQA 3VO3A 3ZTXA 5J7HA 5J5SA 4BDGA 4C3PA 2CDZA 3R1YA 1OVEA 3FV8A 1AGWA 4FTNA 3S3IA 2ZMDA 4QMXA 4ZSGA 3OXIA 3P08A 2W1CA 4QTBA 3S1HA 4B7TA 2YM5A 3F82A 4F70A 3PP0A 2X39A 4I4FA 4DGOA 3VN9A 5CAVA 1JOWB 5FD2A 1Q3WA 5A4CA 5J87A 4AQKA 2PMOX 3MVMA 4I5MA 4XRJA 2YZLA 3FMHA 3FQHA 3HA8A 5EYCA 2VN9A 4J71A 5CLPA 4FKJA 4WT6A 3FMEA 3VUIA 4FYNA 3MY1A 3ZO2A 2R3IA 5M09A 5BYZA 4DEAA 2UZBA 4U3ZA 3O96A 3RPOA 5IQAA 3LCSA 4NM0A 3TCPA 5IQIA 3PXQA 3Q9WA 3VS7A 1VYWA 4ZTSA 4F65A 5FBOA 3IDPA 5HVYA 3VS3A 4L7FA 3ULIA 3VHKA 1XH4A 2RKUA 1LP4A 4RZWA 2WPAA 2J5EA 3GC8A 4JDKA 5HVKA 3HV6A 3KVWA 4O7TA 4LL0A 3AC4A 3LW0A 2CKPA 3QTXA 4I41A 3NUAA 4R7BA 3DNDA 1PMEA 3NIZA 2AC3A 5F20A 1FVTA 4E4NA 1MRYA 4G6LA 5F1ZA 2PK9A 4IFGA 3WYXA 3MFUA 3V04A 3C4CA 4JI9A 3TYKA 3RAWA 4E5BA 3GVUA 2IW8A 2WQBA 4II5A 5BPYA 2VWYA 4FGRA 5B2MA 2VO7A 4ZSEA 4BJJB 5AUWA 3JR1A 1UU9A 3OF0A 2P2HA 4BBFA 4I23A 1T45A 2RF9A 3TXOA 2R4BA 3AXWA 4OT6A 3AD5A 4BI2A 2QD9A 3KXHA 1Y91A 3ZRKA 2UW9A 1WBNA 2VO0A 2YCFA 3COKA 4KSQA 4UV0A 4FT0A 5CQWA 4ANMA 5CF4A 1FPUA 1WBTA 4PV0A 4D1ZA 3FSKA 4RVKA 2YERA 4BDCA 3KQ7A 3MH2A 3FQEA 4PMTA 3TG1A 1BUHA 3QC9A 5IQHA 3AT3A 4J99A 3D4QA 5IEYA 4YJOA 3PYYA 2KTYA 4ZJIA 4D2WA 2BTSA 1GJOA 2RFDA 4FL3A 1PXMA 2WB8A 2X9EA 1G5SA 4X3JA 2BZIB 3KRRA 3QX4A 4L44A 2ONLC 4LMNA 3RM7A 3TL8A 3TNHA 4YZ9A 3TTJA 3WF6A 4CXAA 2QOCA 4BZNA 5JRQA 4ASZA 3P0MA 3L8SA 1U59A 3MI9A 4MBIA 5CEOA 5ITAA 1MUOA 1S9JA 2ZAZA 4O4DA 3DB8A 3ZLYA 4ACCA 2ZB1A 1V0PA 3R8UA 3F3UA 3RMFA 2X0OA 3R8ZA 5M4IA 3KF4A 4RIWB 4U40A 4IB1A 4QP1A 4FC0A 3C4EA 2WGJA 1P4OA 2O0UA 4NU1A 3G5DA 3EFLA 2B4SB 3BIZA 3FHIA 5IA5A 2AQXA 4K0YA 5CT7A 4MHAA 4O4CA 1OKWA 3SRVB 4OGRA 3U9CA 4UXQA 2VTJA 3QKMA 1W82A 2O5KA 4WNOA 5AP7A 4L53A 3QTSA 4UEUA 4AGUA 4IE9A 3EQGA 4EK6A 3POZA 2W5AA 2GMXA 1CSNA 1E1XA 4Q2AA 4Z55A 4FTLA 4F6WA 4W4YA 4TXCA 4BY9E 3A61A 2XS0A 4G31A 3R7OA 1B6CB 4L00A 4NW5A 1W84A 3TN8A 4KIKA 4W4XA 4FJVA 3U4WA 4IX6A 2CKOA 4QEBA 1SNXA 1R3CA 3WILA 2VTIA 4QMVA 4FEUA 4DTAA 3VQUA 5C1QB 5IQCA 3PWYA 3JVSA 3GCQA 3V3VA 2C5XA 4BCGA 4YJRA 5LMKC 4NKSA 3BE2A 1KWPA 4IQ6A 1CMKE 4M13A 4R6VA 3U9NA 2J5FA 3G0FA 4OBOA 2VO6A 3SXFA 3QD3A 4XOZA 4K11A 2W4JA 5L8LA 1FMOE 4OT5A 3E93A 4HOKA 2UZVA 4LG4A 4AG8A 4QMWA 2W4OA 4U44A 4EOJA 4QQTA 2BMCA 3BBTB 3VUMA 2B9IA 4JBPA 3VIDA 3MFTA 1RE8A 5A3XA 1JBPE 1NVRA 1Q99A 1XJDA 5AP0A 5GIPE 2BHEA 1YOLA 4GIHA 4AE6A 3BLRA 4RVMA 4O1OA 4V0GB 3ZSGA 1PJKA 2XJ2A 5DFPA 2YABA 4DH8A 4C4IA 4GFOA 2BRHA 2XNOA 3PTGA 1YXUA 4J1RA 3R9DA 5L2WA 4JX7A 4CFUA 1XBCA 5HG5A 1WFCA 2WQNA 3AT2A 3OOMA 5CVFA 4DGMA 4EOSA 4J52A 2VGPA 3VF9A 5M53A 4OAVB 4FL1A 2V5QA 4FODA 2Y4IC 3UBDA 4GYIA