4DFLA

Crystal structure of spleen tyrosine kinase complexed with a sulfonamidopyrazine piperidine inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
274
structure length
263
Chain Sequence
VYLDRKLLTLEDKELGSGTVKKGYYQMVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Pyrazine-based Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 263
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dflA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dflA01
4YBKA 3VULA 2VX1A 4PDOA 2QONA 4IC8A 4BCGA 3QF9A 4ACHA 4YC3A 4AGDA 4E5BA 5CQWA 4QMZA 5EYCA 1BX6A 3Q4ZA 3U9NA 3V5TA 3I5ZA 4I20A 2P33A 4WNPA 4E7WA 3RHXA 2VWXA 3FYKX 2E2BA 5HVJA 5FP5A 4AUAA 4G6NA 1OVEA 3FY0A 4FTQA 3VBWA 4DGLC 3S0OA 3SXRA 3CC6A 1Y6AA 4QTCA 3TWJA 5KZIA 4CG9A 4AT5A 3QD3A 4USFA 1KOBA 1VYZA 4M7IA 2RSVA 3OP5A 1WVYA 3QD0A 1UU3A 4MEDA 4YZMA 1BUHA 3FMDA 3I7BA 5IA4A 4UWBA 2C6OA 3L8PA 1R78A 3DKGA 4O21A 3NWWA 2R3MA 5E91A 4ZS4A 2WQBA 4QTDA 2C6EA 3OTUA 3M11A 2XM9A 3TACA 3GI3A 4DH7A 3ODZX 4GCJA 4YP8A 5CVGA 4FICA 4FG8A 5HVYA 2OFVA 4BKYA 1JSTA 1ZMWA 4L7SA 4BCQA 3MTLA 3H0YA 3SGCA 3W2SA 3WARA 5D7AA 1QCFA 4E6CA 5HLWA 5D1JA 2ZM1A 3M42A 4QTBA 1OUYA 3EHAA 4EZ7A 1YI4A 4WNOA 4DE4A 5JKGA 5JH6A 4EC8A 5KKRB 4ASEA 5JGDA 4DLIA 4O96A 1WVXA 3R8UA 4KABA 1P4OA 3CEKA 4FODA 5EG3A 3NDMA 5LWNA 4G9RA 4IMYA 1SYKA 3UBDA 3V01A 5AM6A 3P7BA 4UX9A 1OIYA 3TKUA 4P5QA 5KMMA 4BY9E 5DGZA 4KS7A 3E8DA 2IVSA 3A4PA 1OKWA 4ZTMA 5JFSA 2WB8A 2CGWA 4EH8A 3OS3A 2OXYA 2E9VA 4MX9A 1KUTA 4FTOA 5CU2A 2PY3A 2WKMA 5B2KA 3CD8A 3DBDA 3LAUA 1XHAA 2GS6A 4DFLA 2R9SA 3ACKA 4EOQA 5HOAA 2W1EA 2Z7SA 2YCSA 3SXSA 2QOKA 3BRBA 3KVXA 2YZLA 3DPKA 4QYGA 3U51A 3D5UA 4YJNA 3HV3A 5M44A 1H25A 3E8NA 2QLQA 3E5AA 4CFWA 5AUUA 3ENMA 3CY3A 4YJUA 5E8XA 5IA5A 4BHNA 4RJ5A 3F3ZA 3GVUA 2G01A 4E6QA 2PZYA 3AD6A 1GOLA 3O7LB 3LFBA 3AMAA 4MF1A 3AT3A 2GSFA 2C5OA 3FI2A 5I9ZA 4QP2A 3I5NA 4F99A 2X7OA 5K5XA 3AGMA 3OWKA 4Q5EA 3LE6A 4PV0A 5HG7A 3ENHA 4DHFA 5FBOA 4O7LA 1OGUA 4BGGA 2FH9A 4PQNA 4YTIA 3WILA 5K5NA 3LXLA 5ANGA 2RG6A 3HEGA 4D2VA 4EUUA 4E3CA 3W55A 4BDAA 2NP8A 2J0JA 4F1MA 3ZH8A 1Q8ZA 4BI2A 2W5HA 1J1CA 3DKFA 5IA1A 3U6HA 4M69A 3KK8A 2RKUA 2WIHA 2CJMA 5C03A 3T3VA 4TNDA 1XBBA 2UUEA 4L53A 3ZCLA 4DCEA 1XH5A 1P14A 2I0EA 4JQEA 4NU1A 3LJ2A 3EQGA 1PXKA 4IVCA 5CENA 5GIPE 2YERA 3CTQA 5HCYA 3EYHA 3UNKA 2FYSA 2HAKA 1JKLA 2W9FB 4ITHA 4YZDA 4R7BA 5CU0A 5DFPA 4BCNA 5ITAA 3GC9A 5CAUA 4AW2A 4MBJA 4IB0A 2UZTA 4FV1A 3TIZA 4DEHA 3NIEA 3VJNA 4H05A 1B39A 2QOFA 2J51A 3E64A 4H58A 3PG1A 5HG9A 4LV5A 3W32A 1FBNA 4EORA 1PXNA 4GT4A 4ZS0A 1E1VA 2ETMA 4RVTA 5CU4A 3I60A 1PXOA 3D2KA 3PIZA 4TYHA 2PUPA 4CFUA 4OTPA 4U6RA 3UJGA 2HWOA 3QTXA 1WBPA 3HUBA 2UZUE 3ZFXA 3CQWA 1UNHA 4BDKA 1JSVA 4DFZE 2Q83A 4AZEA 2RG5A 4ACMA 3AC4A 3OWLA 3MH2A 5HD7A 1SM2A 4C57A 3N51A 3P86A 4PUZA 4ASDA 4OTIA 3PVBA 1BL7A 4HW7A 3KY2A 4MXAA 5ETIA 3WZKA 5HI2A 3E3BX 4BDGA 3FC2A 3PUPA 1TKIA 5H2UA 1O6KA 5C1QB 2IN6A 2XP2A 2YLFA 1JVPP 4O91A 5EQYA 2XIKA 5J5SA 1RE8A 2G15A 2QD9A 3A7GA 3E63A 4L01A 5FXRA 3VUMA 5ANEA 2BFYA 2R3KA 4CMUA 3DNDA 3RM7A 5DYJA 3OWPA 4O7TA 5HBJA 4J7BA 2EXCX 5FRIA 3SAYA 3IG7A 4HGEA 4S2ZA 4J96A 4BCFA 4H1JA 3OXIA 1Q8TA 3L9PA 5I9UA 4RQVA 1YI3A 1YXTA 3EQPA 3RNIA 2OZOA 4FC0A 4QQ5A 2BTSA 4J8MA 4R7IA 4L45A 4MXXA 4XS2A 3FQSA 4PMSA 4AXAA 3GENA 4FNYA 1OPJA 2CSNA 4F6WA 2NRYA 5DLSA 2CGUA 5AR5A 2VTAA 3EZVA 5K9IA 3VWAA 4D9UA 3P7CA 2V5QA 5EM8A 4DH3A 2CMWA 3KEXA 4LFIA 2CN8A 1Q4LA 2R7IA 3NYVA 3QGWA 3O7LD 4ZSEA 3D2IA 3TUBA 2XIXA 4YNOA 2DS1A 3F6XA 2JKQA 4FL3A 3QX2A 5EYDA 3CSVA 3OC1A 3TCPA 4GEOA 5M06A 4ZY6A 1REKA 1TQMA 3TNHA 1H01A 3QQFA 1FVRA 4XOZA 5HHWA 3ULZA 3VQHA 2YM6A 4UZHA 4CMTA 5EHYA 3BI6A 4IH8A 5AJQA 3A8WA 4QOXA 3AC1A 2BZJA 4Y73A 4HVHA 3UVPA 3KXNA 4XBRA 3G0FA 3F7WA 3Q9WA 2H9VA 4OAUC 2J0LA 1Q8YA 2PU8A 3CGFA 4C62A 2VV9A 5FLFA 3ZEWA 3QTRA 4BIBA 3MYGA 4JS8A 4OTDA 2HZ4A 4C35A 4V0GB 3HECA 4J8NA 4PWNA 3NUSA 4C37A 1QL6A 4QQJA 2YIYA 4I6BA 4NFNA 1Q5KA 2PTKA 4FNZA 3KQ7A 4N6ZA 4NIFB 4DH1A 2XNGA 4CFVA 4MYGA 5CALA 4JR3A 1F5QA 2X1NA 3ZBFA 2JEDA 3RAWA 2WMVA 4UYAA 4RA4A 4EH4A 3BGZA 4NSTA 3DS6A 2IVTA 2UW4A 1OM1A 2UW3A 4FZ6A 3RZBA 4CQGA 4JBQA 4P90A 3H3CA 5BNJA 2WZJA 3TEIA 3P23A 2PULA 2W0JA 2FVDA 3MIAA 4LRJA 1GZ8A 2BRNA 3VHEA 4BRXA 1CM8A 3A99A 3LFEA 2BIYA 2ZDTA 2XKFA 4C4GA 1LPUA 2YCFA 4PPAA 1WZYA 2VGOA 3CJGA 4OTQA 2PVRA 5L6WL 4O0SA 3VS1A 4CFXA 4U44A 1UWJA 5EH0A 3FV8A 1KE7A 2Y6OA 3FDNA 3PXZA 4WRGA 3SHEA 2XNEA 5AA9A 2QOQA 3PPZA 3PXKA 1J91A 3ZM9A 4BZOA 3GUBA 4BDHA 5AUXA 5A46A 4DEEA 4LOOA 1AD5A 2A19B 2O0UA 3FZOA 3RTPA 2FSTX 4G9CA 3ZUVA 4EH3A 1XWSA 3A8XA 3EQBA 5JFWA 4IZ7A 3U8WA 4BN1A 4DGOA 4AP7A 2OK1A 3W2CA 4C4IA 1EH4A 5EDRA 4PNIA 2GFSA 4IQ6A 4BDJA 4F7SA 5A4TA 3UVQA 3Q9ZA 4L7FA 4FV5A 3FHIA 3QD2B 2XK6A 3Q5IA 5T68A 4CKRA 4RX8A 4CRLA 3CIKA 5IPJA 5BYLA 4ZTSA 5CEMA 2O8YA 2R7BA 3HNGA 3PTGA 5T3QA 1H4LA 4UY9A 2OF2A 4EWQA 1UVRA 3NX8A 4FT7A 3ZUUA 5GHVA 4EOMA 5JGAA 3ZDUA 1YDRE 3EN4A 2E9UA 4QNYA 3TV7A 3DV3A 4CZUA 3IW8A 1DS5A 2NNWB 3M1SA 4FA2A 4A07A 3BQCA 5LVMA 5ANKA 3V04A 2V62A 5CQUA 4Q9SA 3GP0A 5M4IA 2JAVA 2VX3A 4H3PA 3NW7A 5AP1A 3VHKA 3NVKI 3D15A 4XG8A 2JAMA 5DT3A 4QMQA 5EI8A 4HYUA 3IGGA 3MY1A 4KWPA 4D0XA 5CAPA 2C4GA 3PE1A 5DIAA 1URWA 5ICPA 3GU6A 1IAJA 3H30A 4ANBA 4IJ9A 3I6WA 5GJGA 2QOCA 2JD5A 3KB7A 3MH0A 3ZYAA 3LJ0A 3ANRA 4CQEA 3IECA 4FIEA 4WOVA 3ZOSA 3EB0A 2C0TA 2R3HA 3CXWA 5I4NA 2XMYA 2NO3A 3WBLA 5IQGA 1REJA 2RGPA 5HIBA 3TZ8A 3LKMA 4EKLA 1XO2B 1IEPA 3EJ1A 2HELA 3OHTA 3WE8A 5KCVA 3BE2A 4RIOA 4UEUA 3OMVA 3RNYA 2VO3A 2I0HA 3EL7A 4ZAUA 2PUNA 4CTCA 1CKIA 2VWUA 2FA2A 3ZXTA 4NM3A 5FP6A 3BWJA 5HIDA 3ZLYA 4IX5A 2WMRA 4FTMA 5HU9A 3CKXA 3R63A 4RFYA 3Q2MA 4RJ3A 4EHEA 3RWPA 5EW8A 4R6VA 3WF6A 2OJFE 5HEZA 3DFCB 3QTWA 5B0XA 5HO8A 4HJOA 1IASA 4ZK5A 5H8EA 3K3JA 5A6OA 2B55A 2W1GA 4OLIA 3R9RA 3DA6A 2Y4IC 3ET7A 4OGRA 3G15A 4UXLA 4NK9A 2OXDA 4Y5QA 4BZNA 3BU3A 2PVJA 4FSUA 1OL6A 3D83A 3Q9YA 4NTTA 4YR8A 4O7WA 1XKKA 3PWYA 4QYHA 2RF9A 2C1BA 2ZV2A 4ZSLA 2CNVA 3DB8A 4F7LA 2ZAZA 2X2KA 1LEWA 4F6UA 3EZRA 4OT5A 2YJRA 1NVRA 4MNEA 4RT7A 4ERKA 4AG8A 2QOOA 2X0GA 2WMBA 5LWMA 4LL5A 5BUJA 4U3YA 1PMNA 4N4SA 5AM7A 2G2FA 2PL0A 2PZ5A 3DXQA 4N57A 5KHWA 3U54A 2WOUA 2BPMA 4BBMA 2XKDA 4B7TA 3N9XA 2YA9A 3R6XA 2GTNA 4IACA 4ZSGA 3NS9A 5IF1A 4CTBA 3OT3A 3EN9A 3R8MA 3HV4A 3LFSA 1NY3A 4WG5A 3VBQA 3W33A 3MWUA 4DFNA 4Z16A 2P0CA 3EMGA 4P5ZA 1PJKA 4YHJA 4BWKA 2VTOA 4Z7GA 3MY0A 4X3FA 1OKVA 3U4WA 1FQ1B 4EK4A 2VTMA 3WOWA 4LGGA 3E88A 1KSWA 3Q60A 4RIYB 5J79A 2Y6MA 3GBZA 4IANA 2UV2A 3RWQA 1PXJA 5M51A 4KRCA 3KK9A 4ZTLA 1H1PA 4TY1A 1GIHA 3HP2A 5LQFA 4BZDA 5HG8A 1VR2A 5FTOA 3R0TA 2JIVA 4LI5A 3Q4TA 1YOLA 5TE0A 3VUHA 1QMZA 4N0SA 5E8TA 3KXGA 5FDPA 4IWDA 4A9RA 4EZ5A 4O7VA 2EB3A 1UA2A 4WA9A 3ITZA 2GNHA 1KOAA 2B52A 3S00A 3SC1A 4UBAA 4LUEA 1YOJA 4FKIA 4UYNA 1PMVA 4R8QA 5LMAA 1APME 2R3IA 2WMUA 3FKLA 4DYMA 3CLYA 3PZHA 4ACGA 2VNWA 4CSVA 4O0UA 3UTOA 2QC6A 4A4LA 3EQCA 2BDFA 2JDSA 4FV3A 3QUEA 3TNIA 1TQIA 2OICA 4TRLA 3QCQA 1PHKA 3AGLA 3HMMA 2RFEA 5DNRA 4EH9A 4BI1A 2IW9A 2F4JA 3ZO1A 5BQ0A 3DK3A 4KINA 2C6MA 2G2IA 4FYOA 3BKBA 2XUUA 1DI9A 4IE9A 3SRVB 3UDBA 3P5KA 1CDKA 5IA0A 2QO9A 2ITZA 2R3QA 4QQCA 4QMVA 4L00A 3UZPA 4MWIA 2C6DA 4HCTA 2YFXA 2C30A 2ESMA 3NZ0A 4I92A 4B6LA 3Q3BA 4JDIA 3QYWA 4NUSA 2F57A 3RP9A 4Z55A 3DK6A 3DJ6A 5CYIA 1CKJA 4F09A 5J8IA 3N4UA 2F7XE 2ITWA 4C7TA 4YGAA 4X2JA 4DGMA 4EK6A 4ACDA 3R7GA 2Z02A 1XQZA 3NNUA 1V0BA 2QHNA 2UW9A 4AOJA 2H6DA 4RWJA 2OH0E 2BROA 4PTEA 3ZO4A 1GJOA 3V6RA 3ZLWA 5CEPA 3E7VA 3NLBA 4FZ7A 4QP7A 2RFDA 1L3RE 1KV1A 4WRSA 2ZVAA 3OOMA 4FV8A 4KIQA 5I3OA 4ITIA 4PRJA 3TI1A 4ZZNA 4DLJA 4J53A 4FTTA 4L8MA 5JT2A 2QNJA 2JC6A 4RMZA 4FGRA 1GAGA 4M97A 2ZM3A 3OBGA 3ORZA 2X2MA 2W7XA 3BIZA 2PVMA 3NYXA 3EKKA 3PY1A 5J5TA 3PY3A 4G34A 3LCKA 1P4FA 2GHLA 2XNOA 3QHWA 4II5A 3QL8A 4GSBA 4LGHA 4RC2A 4TWNA 5L2WA 3SVVA 3UO6A 1U5RA 4XUFA 1F3MC 1Y57A 2FSLX 4OBPA 3ZUTA 5DG5A 3R9NA 5CU3A 3KXMA 1G5SA 4CZYB 2YM7A 4YSJA 2ITXA 3EL8A 3NW6A 1ZLTA 1Z57A 1BL6A 3L8XA 3BX5A 1MRUA 5CVHA 2RIOA 3ALOA 2VTQA 3KXHA 3SXFA 2O3PA 4FVRA 4FSYA 2BAQA 5E8WA 1J3HA 2JDOA 2R3RA 5FQDC 1S9JA 3QX4A 3C13A 3KXZA 2H8HA 3FAAA 4W8DA 4JX3A 2GU8A 4YZCA 4A9TA 2R5TA 3T9IA 3LXPA 4C58A 5JGBA 5AP4A 5EOLA 2X7FA 3GCPA 2QURA 4FIJA 4IWPA 5ACBC 3KN5A 3VS5A 2ERZE 2WTWA 1MRYA 3MH1A 4YJRA 2QR7A 5CSPA 3A61A 1NVSA 3VF9A 5IUHA 1ZYLA 3V5LA 2IVVA 3ORTA 2ZV8A 3LXKA 5CSHA 2BFXA 5AUTA 2A1AB 4N70A 3MFTA 5F9EA 3QC9A 1ZMUA 2YLEA 4KSPA 2IO6A 5AUWA 4YTCA 3OF0A 4QYFA 5EW3A 4TL0A 4JR7A 1YWRA 3MFSA 4Y5HA 1ZY4A 4IW0A 4GJ3A 3LIJA 4RX9A 3R1YA 5BVNA 1U59A 4G31A 3KU2A 4QNAA 4EBVA 4RIXB 4D4SA 3F2NA 4TYGA 1KE6A 5J9ZA 3R7OA 5IDNA 3UPXA 2P2HA 3F5XA 1K2PA 3FUPA 4PTGA 5DVRA 3UVRA 4MXYA 4BC6A 5HO7A 1H0WA 4C2WA 4ZLZA 2YISA 2DQ7X 2W99B 4IADA 1WBSA 4E8AA 2GNLA 2JDTA 5CF6A 1G8SA 5ETCA 3FLSA 3VUGA 2OO8X 3DTCA 4X2NA 5AMNA 5BUEA 3LQ3A 2P2IA 3O0GA 2XNMA 3H9FA 3QGYA 1FOTA 3LCOA 1WAKA 2QOLA 4IFCA 3VO3A 1PXPA 3PYYA 3TV4A 5AWMA 4M69B 4ZTRA 1DAWA 2WAJA 4BR3A 4PMPA 4FVQA 4TTHB 4RFZA 2QKWB 3Q9XA 5BYZA 3KMMA 3UQFA 4JIAA 4EEVA 3A62A 4HNFA 3BLRA 3ZLSA 3GB2A 4IB3A 5JZJA 4HOKA 4AGWA 5JZNA 3GCUA 2C3IB 4MD9E 4EH5A 5HORA 4U8ZA 5L2IA 5AADA 4XEYA 4FKRA 2B1PA 1FINA 4CD0A 3FWQA 4UMQA 5D12A 1KWPA 4FSNA 2VWBA 2I0VA 4F1OA 1YW2A 5LMKC 5ETAA 4E4NA 3B2TA 3QC4A 4IDVA 4YLKA 2CNUA 2IG7A 4EOLA 5M4UA 5E4HA 1HCLA 3FL4A 4K11A 4BYIA 1OECA 3C4ZA 5BVWA 1H08A 3KL8A 3JY9A 5J1WA 3JR1A 5CASA 4O7YA 5DHJA 5I9YA 1PKGA 2XIZA 5G1XA 1OIUA 4OUCA 3CY2A 5K3YA 4XG9A 4R5SA 5GZ9A 3O2MA 4RLKA 3MVLA 3PSBA 3CQUA 4GT3A 3IK3A 3W18A 1M7NA 4WSQA 2VWVA 5IH6A 5FGKA 1PMEA 4W9XA 1S9IA 2CN5A 2GQRA 4FF8A 2R3GA 3I81A 2B7AA 2QHMA 4ANQA 3OFMA 2PMOX 4BDIA 5IQHA 3QZFA 4I6FA 3TG1A 5HQ0A 2YCRA 2J5FA 4JX7A 3ZBXA 5ANIA 4EUTA 3UPZA 1GZKA 3FLWA 3QHRA 4L68A 4LOPA 5HGIA 1MQBA 1OL7A 4YZ9A 5A3XA 4AF3A 3GCVA 2VN9A 3HA8A 3NUYA 4YJVA 3JUHA 1W82A 1OL5A 1UKIA 4K1BA 1G3NA 4XG4A 3WIGA 4GVJA 3R7YA 3VUKA 3QRJA 3P79A 4FV9A 2A2AA 1H28A 2CGXA 4L46A 1UKHA 4MKCA 5M53A 4ZLYA 3BYVA 5EOBA 2PE2A 1F0QA 3KRWA 3EH9A 3I1AA 3VS3A 2PE0A 1PRYA 3QBNA 5AV1A 3KXXA 4JRVA 3D7ZA 3RK5A 4DG0E 4L44A 2C6IA 4JG8A 3ZRMA 4J97A 1PYXA 4LYNA 2G2HA 4KBCA 2PMLX 2OLCA 4JQ7A 3JVSA 4KIKA 5LARA 3MVHA 3TUCA 3QCYA 4FSZA 2YDJA 3RPSA 2XJ1A 3OVVA 3DDQA 1BLXA 2O63A 3DK7A 3HV5A 3KRLA 5KHXA 4DEAA 5IDPA 2RFSA 2I7QA 3AMBA 3AT2A 1H00A 4JVGA 4CCBA 4W4XA 2VTJA 2EU9A 1ZOGA 2OH4A 1M52A 4HVGA 3MFRA 4FR4A 2VZ6A 2ZB1A 3DGKA 1OI9A 3MFUA 4FKUA 2FSOX 4JJRA 4O27B 4D5HA 3SA0A 3JXWA 3TL8A 1RDQE 2OJGA 4FTCA 2REIA 2BRBA 1R39A 4PL5A 4EHVA 2XEZA 4FKGA 3KF7A 2VO6A 3DJ7A 2BZIB 4RWKA 4CV8A 4BCHA 4FSTA 2AC5A 4PMMA 4I0TA 2HXLA 3QQGA 5J1VA 4QP1A 4YURA 3BYSA 4W4VA 3LOKA 4S34A 3EQFA 4IFGA 1UNGA 4D5KA 4G1WA 5L6PA 3MSSA 4V01A 1SVGA 5KO1A 5A4LA 3R1QA 4Y95A 3KA0A 3P9JA 3QLFA 5BVOA 1KE5A 1W0XC 3S2PA 4UALA 4TWPA 3RPRA 3TNPC 4JAIA 4CYJA 4CT1A 3F69A 1WFCA 2QU6A 1KE9A 5IMEA 1QPCA 2OJ9A 4DT9A 4TWOA 4KD1A 1XH6A 3QTZA 5J87A 4ORKA 3Q6UA 4XNEA 4RWLA 4AZWA 2WTDA 4NM5A 4BTJA 4EOJA 2ZB0A 3K5UA 3RAKA 2GMXA 4CMOA 3QKKA 4X6RA 4E5WA 3MESA 2CNQA 3VBVA 4MHAA 5LMKA 1JKSA 4K8AA 3PPKA 3LCDA 2HWPA 3MY5A 4O6EA 5IEVA 3TNWA 3BELA 2OZAA 4P4CA 4USEA 5M57A 1A48A 4YBJA 1OITA 4KBKA 3R8VA 1PKDA 3NCZA 5DBXA 3VS4A 4FEWA 5ACKA 2PVFA 2GDOA 2X6EA 4K9YA 4RZVA 4OW8A 3I79A 2CKOA 4AX8A 4BI0A 3ZRKA 3QRIA 3HP5A 4TYIA 5TOZA 3TIYA 5JQ8A 1YKRA 1L8TA 3JVRA 3LXNA 3B8QA 4U9AA 3FSKA 2XCKA 4U80A 3UGCA 3QZIA 4ITJA 4MD7E 4XOYA 3W8LA 4XLIA 4AE9A 4MXZA 1M2PA 1YHSA 5E8VA 4BB4A 5AV0A 3BQRA 3QD4A 5FTGA 2ITTA 3W10A 4F7JA 4YMJA 3R01A 2OJJA 5DWRA 3GNIB 4UWCA 5GZAA 5KUPA 2JBOA 4DAWA 3UIBA 5E7RA 3Q53A 3FXWA 3KCFA 4Y46A 4O7SA 3TT0A 3PP0A 3AD5A 2X4ZA 3GC7A 3ZFYA 5HX8A 2JITA 4QMYA 3NRMA 2J7TA 1JKKA 2V55A 4G6OA 2IWIA 4XP3A 3N4TA 1XH9A 2C68A 2C5NA 2VWIA 3VBYA 4FYNA 1XH7A 4DEBA 5BMSA 4W9WA 5D7VA 4E20A 4QMTA 5AUVA 2YACA 2H96A 4JDHA 4FL2A 4RX7A 5EDPA 3ZMMA 5B2MA 5F1ZA 3SX9A 4TZRA 5LCJA 3MTFA 4ZTQA 5M55A 3UIUA 2I40A 4QMPA 5L4QA 1U46A 3BHTA 3LHJA 4QT1A 4RPVA 4ZY5A 3KGAA 2J0KA 3N4VA 2X7GA 3UG2A 4F4PA 3BHVA 4CKIA 4IXPA 5HCZA 3LFCA 3LM5A 1Z9XA 4ZTNA 4FZDB 4F9WA 2Z8CA 4JBPA 5EK7A 2ACXA 5J95A 1CMKE 2EUFB 4EOPA 3PRFA 4FT3A 2BDJA 1H26A 4QO9A 5FEDA 3C1XA 3HL7A 2HENA 1Q24A 5KZ0A 5L2SA 2QO7A 3WF5A 4D58A 1A06A 5IUGA 5LOHA 4QP3A 4ZMEA 4P7EA 3VW6A 3C4CA 4FIFA 4GV1A 4PL4A 5AR3A 5AR8A 4TT7A 4QPSA 1FMOE 4EL9A 3HRFA 4TNBA 4LMUA 2JLDA 4I93A 2OG8A 4EOKA 1JLUE 4QMWA 2P4IA 2WEVA 3UNZA 4FSQA 2VWWA 5HIEA 4HCVA 2HY0A 1P5EA 2HW6A 4G3FA 5B7VA 4G3DA 4YPSA 5FEQA 4EJ7A 4FKOA 2O2UA 2R3PA 3NNXA 4YJSA 2UW5A 2ETRA 4YLJA 2YM5A 2QLUA 2ZYBA 4AW5A 2WTCA 2FGIA 4KKHA 1U4DA 4Y83A 4R78A 5EQPA 3HA6A 4FG9A 4CZTA 1ZYSA 2CLQA 5IQBA 2ETKA 2WTKC 2PVNA 4QMOA 5GZ8A 3V6SA 5J9LA 2XS0A 2ZMDA 3WE4A 3PE2A 2R64A 5DE2A 2HXQA 3QCXA 2H34A 3KMUA 3POZA 4MD8E 3SKCA 4X3JA 4JXFA 5IQCA 3H0ZA 5CNOA 3CKWA 5FM2A 4ZEGA 4XP2A 4KB8A 4L6QA 1IRKA 4KS8A 4JRNA 2XK8A 4FSMA 4M12A 5KNJA 3ROYA 3RM6A 2C3JA 4O84A 4KKEA 3C0HA 2A27A 2YN8A 3EFJA 5JSMA 4B99A 2VRXA 4FIHA 4APPA 2E9OA 3VUTA 4UWYA 5AFVA 4LUDA 2NPQA 5BVEA 2GS7A 3L8SA 3IS5A 4DG2E 3LFFA 4NTSA 4C2VA 1R0PA 5A54A 4PPBA 3W1FA 2ZV9A 2C5XA 2ITVA 5M07A 3HMIA 4AU8A 5KE0A 3U55A 5BVKA 5CVFA 2XEYA 2Z7RA 4O81A 1OB3A 4BDCA 3NIZA 4X3FC 4A7CA 5B2LA 4HVIA 4L3JA 2PWLA 3S1HA 3FZSA 4MBLA 4HGLA 5HLNA 3FQEA 1MRVA 3RI1A 1UNLA 2WMXA 4A9YA 4C8BA 2AC3A 1GIIA 2UVYA 3C50A 4GUBA 3ETAA 4ANMA 2J2IB 4IC7A 1R3CA 4RJ4A 4XG6A 4I5CA 4AS0A 3P08A 3FXZA 2W17A 3ZSGA 1HOWA 4ZTHA 1MP8A 2HW7A 2BR1A 3NUXA 2P3GX 4ZY4A 4C36A 4HGTA 4EH7A 3C5UA 3LVPA 3OW4A 4IJPA 4RQKA 3TTIA 3CS9A 4M8TA 4PF4A 4W8EA 5HKMA 4EZ3A 2XRUA 4BICA 4WUAA 2WMTA 3D5VA 1WBWA 4C38A 4CRSA 2CCIA 1KE8A 5M08A 1JNKA 4KIPA 3G51A 1LEZA 4KBAA 3V8SA 1JKTA 4PPCA 5FXSA 3VUDA 3ZZWA 3NGAA 3ROCA 4CV9A 4I6QA 3T3UA 3ATTA 4FV4A 4G3GA 2WXVA 2B9HA 4AA4A 4U0IA 4PDYA 2CKEA 3GU5A 5CU6A 5IU2A 4NYEA 5FTQA 2UZEA 4QMSA 2F7ZE 5CY3A 5IUIA 4ASZA 1H07A 1YVJA 3NYNA 2KTYA 4G17A 2Z2WA 2X6DA 4IDTA 4JOAA 4F9YA 5CAVA 5KMIA 4M3QA 2PSQA 1WBVA 4MVFA 4F6SA 4NL0A 5IKWA 2R3NA 2XCHA 4IVBA 3HKOA 4XP0A 3QUDA 2G1TA 4U42A 4OTFA 3FQHA 3QA8A 2C6LA 2W1ZA 4U81A 2ZV7A 3RK7A 3NPCA 4NCTA 4FKTA 4X21A 4AA0A 5BVFA 5JN2A 3GC0A 3A7HA 5E90A 2VTTA 2XKEA 3GOPA 4RJ6A 4UZDA 4ZSJA 3LMIA 2R0IA 2C0IA 5LVLA 4DGNA 4RZWA 2Y4IB 4BKJA 4DFXE 3D94A 5CT7A 3FPQA 2ONLC 5HU3A 3EQHA 5DR9A 1ZAOA 2JDRA 4FBXA 3MA3A 3QQJA 4G5JA 4F70A 1PXMA 2EWAA 5H9BA 2X8IA 1YQJA 3OTVA 4MQ1A 1XBCA 4U7ZA 3VIDA 3IGOA 2OIBA 3EQRA 4FKJA 4YC8A 4BCKA 1Q62A 4D2PA 4C3RA 5EYMA 4DFYA 4K33A 3UC4A 3FMKA 3Q4UA 4XLVA 1BYGA 2BRGA 2VWZA 2Q0BA 5HO6A 1PXLA 4FT9A 2YIRA 2XH5A 3VRYA 4YJQA 3TKHA 4BHZA 4KA3A 4FX3A 4HVDA 1ZYCA 1Y6BA 3RGFA 3DU8A 3C4EA 5ANDA 3R9OA 3TJDA 3ZEPA 2W9ZB 4BDBA 3DAEA 1GY3A 3IQ7A 3C7QA 3L9LA 4FKVA 3EFWA 4GS6A 5TR6A 4IB1A 2GNJA 4D2RA 5IMXA 4FT0A 2WELA 3TXOA 1ERKA 1ZMVA 3R22A 4FKQA 4FKPA 3COIA 4D0WA 3F9NA 3UYTA 4AT4A 1LR4A 4YTHA 2F2UA 4MK0A 5CI6A 4ERWA 5I9XA 4G6LA 4QRCA 3HAMA 3D14A 2X8DA 4J52A 3ID6C 3UO4A 2KULA 1RQQA 3F88A 4JAJA 3ORMA 3PVGA 4WSYA 3GEQA 4HGSA 1PMUA 4ZZOA 4OR5A 3T9TA 3R8ZA 4CG8A 4RBLA 4FV0A 4APCA 3ZU7A 1CTPE 3FY2A 5M4CA 4XG7A 1U54A 2UVZA 5IISA 3AQVA 2J90A 5DR6A 3LPBA 2PMNX 2YDKA 4HYHA 5F94A 3V8TA 4ALUA 1OL2A 1FGKA 1ATPE 4FTJA 2BZHB 4IAAA 3G6HA 4TXCA 3UQGA 1TVOA 1XJDA 1M14A 2F9GA 3BBWA 4RG0A 3WI6A 3DCVA 4JLCA 4FEUA 2XK9A 2VTHA 4QP6A 1JPAA 1XBAA 1Y8YA 3EQIA 3FMNA 2DUVA 1K9AA 2UW6A 5EDQA 3UIMA 1V0OA 3CTHA 4OBQA 3JS2A 3PJ1A 4D28A 4IAYA 3F5GA 4IEBA 2IZTA 4RJ8A 5EHLA 5H8BA 3F3TA 4Z9LA 2WFYA 1I44A 3LLAA 5FBNC 3UZTA 2BVAA 4XCUA 3GXLA 5JK3A 4RIWB 4PTCA 3ZO2A 3I6UA 5HX6A 2W4JA 4AN3A 2UZOA 4Z3VA 3FL5A 2X9FA 3A7IA 1NA7A 3IKAA 3FPMA 1CSNA 4KUJA 2W5AA 4AWIA 2OXXA 4WHZA 4LQMA 1ZXEA 4NH1A 4USDA 5KMKA 4R3RA 4I41A 3JPVA 2BRHA 2YABA 3O51A 4X6QC 2QOBA 3WIKA 1H1WA 4FTNA 4U79A 3G90X 5GJFA 3ATSA 3PDTA 1R0EA 2QODA 4FTRA 4MTAA 5AAEA 3OEZA 3OT8A 3EN7A 5HCXA 4ZXTA 3PFQA 4EJNA 4CFFA 1SMHA 1ZZLA 4L67A 4I4EA 4EK3A 4M0YA 4EOSA 5H8GA 4C4FA 3TUDA 5L6OA 3E93A 3QQUA 3SLSA 3VBTA 2I1MA 4UMTA 3FLNC 2BAJA 5F95A 1I09A 5AUYA 3CPBA 4AOIA 3BEGA 4FIGA 3AC8A 2C1AA 4BWXA 3OCSA 3MVJA 4O0RA 4QTAA 5CTPA 5HE2A 2ONLA 4YNEA 5HNGA 3NSZA 2PK9A 3VQUA 4H1MA 2PZIA 4I5HA 4BCIA 3PLAE 3QRKA 2XIRA 4S31A 3FLZA 3KREA 3KVWA 3ZFMA 4EKKA 5DOSA 2VTLA 4LL0A 3F5UA 3F3VA 2IZSA 4MXCA 3S3IA 4O0YA 3ZRLA 1GIJA 3RPOA 2R3LA 3PWDA 1Y8GA 3BBTB 3KRJA 1Q97A 2Y0AA 1IAHA 3QRTA 2WU6A 3E8CA 5IQFA 3BYUA 1BI7A 3QXPA 2W4OA 5A4CA 3PSDA 2CGVA 3UC3A 4EHGA 2WEIA 4GL9A 1JOWB 3FHRA 1UU9A 4UMPA 3Q2JA 4X2KA 3O8PA 5HTBA 2XJ0A 3W2OA 4V05A 4B4LA 5CF8A 5BUIA 3FZPA 3W2RA 2BDWA 3Q4CA 4F0GA 4ARKA 4I21A 2EXMA 1YOMA 3NCGA 5AV3A 3QU0A 3E8EA 5C27A 4EWHA 4LGDA 2VTPA 4I94A 2XB7A 4YSMA 2ITNA 3PXYA 1OIRA 3BV3A 4U41A 1OZ1A 1ZARA 4X2FA 4KIKB 5IZFA 3EKNA 4LV8A 3JYAA 4O38A 4BBFA 2VO7A 4DTAA 4M68A 1Y91A 2ITUA 3CPCA 1H1RA 3CP9A 3P1AA 1OMWA 3LW0A 5JRSA 5FM3A 2GQGA 4GG5A 1M7QA 2C6KA 2QOIA 4XMOA 4FKWA 2R0UA 2J0MB 4D1ZA 4PDSA 3MN3A 3H9RA 3B2WA 3MPMA 5HLPA 3VS6A 4M13A 5CSVA 2WU7A 1DM2A 3HZTA 1YWVA 3QRUA 4GK3A 4BCOA 2QG7A 4FV2A 1J7IA 1QPDA 2CLXA 3HUCA 3W8QA 1PXIA 3ZLXA 4K2RA 2PUIA 3F3WA 4TPTA 4O7NA 4OAVB 5CAQA 3QAME 5IQDA 4HZRA 2BUJA 4RLLA 3BYMA 2O5KA 5D11A 2UVXA 3DAKA 2UZNA 4EQCA 5CEOA 4DH8A 3CE3A 4RA5A 5CXHA 4E4LA 2EVAA 2YZAA 4I6HA 3D5XA 4F9BA 3NNVA 5AP2A 4C33A 4RVLA 3PIXA 5L2QA 5EM6A 2OU7A 3MH3A 3C4WA 4MXOA 4XV3A 4B8LA 3BLQA 4EC9A 3LQ5A 2WMAA 4RFMA 4J95A 4D1XA 5BVDA 5AR7A 1RW8A 4O83A 2JDVA 3NW5A 4MBIA 2AUHA 5LCKA 3QWJA 2B9FA 2X8EA 3PA4A 5KMOA 3HLLA 4HYIA 4M0ZA 2WO6A 4L3LA 4AQCA 5HTIA 3PZEA 2Y8OA 2OSCA 4IB5A 3ZM4A 3MVMA 3F7ZA 3UYSA 2UZWE 1H27A 3TZ7A 4D9TA 1YXSA 3FC1X 5CSXA 1H8FA 3PPJA 3II5A 4AA5A 3U9CA 4RGJA 3Q96A 4QD6A 3QXOA 5C4LA 1M17A 3NAYA 5HBHA 5HTCA 1O6LA 4DA5A 3PVWA 4BGQA 4O82A 2F2CB 3U6JA 2B53A 3SW7A 1SZMA 4FT5A 3UIXA 3UQCA 4K18A 4D4RA 3BU5A 4JBOA 4NJDA 2UZLA 3QZGA 5IEYA 3KFAA 2YHVA 3VC4A 3F5PA 2B9JA 5TF9A 1JQHA 4F0FA 2W05A 2W1DA 4NJ3A 2R2PA 5M4FA 3KCKA 3BCEA 3HX4A 5L8LA 3FMEA 5I0BA 3C0IA 4HVSA 4DBXA 1Q8WA 2BCJA 2OW3A 4YPDA 3UMWA 5C4KA 3V8WA 1HCKA 3ODYX 3OWJA 3OY3A 5AUZA 5KMNA 2C0OA 4IZ5A 4B0GA 4PNKA 4FTIA 4O0XA 1GNGA 4RJ7A 3VUIA 3DOGA 4FSWA 3U6IA 3DTWA 3IONA 3UOLA 1FPUA 2GHMA 3HV6A 4FKLA 4MNFA 5JQ5A 3Q6WA 3OG7A 4TYHB 2GPHA 4FEQA 4ZP5A 3IW4A 5FWKK 3PXFA 3WF8A 1ZZ2A 2WMQA 3O50A 4IHPA 4I3ZA 1STCE 4J1RA 5DPVA 4O2PA 4DT8A 3OOGA 4S32A 3O23A 4U43A 2ERKA 4AN2A 3PA5A 3R73A 5GJDA 4C3FA 1OBDA 3V5WA 4BGHA 4DEDA 3FMMA 3UNJA 4F63A 4BCMA 5HE3A 3EFLA 3Q52A 3QTQA 4Q9ZA 2C3LA 2O64A 5IG1A 2OWBA 5D41A 3UOHA 4DTKA 4K77A 4FK3A 4FV6A 4U3ZA 5LMBA 3BPRA 2UZVA 1GZNA 2YDIA 2XJ2A 3DBEA 4JIKA 3D7TA 1XH4A 3OUNB 4QPAA 5DT0A 3WF9A 4GRBA 3VN9A 4JI9A 4FZFB 4LM5A 3WF7A 4C4HA 4EONA 4LMNA 4EYMA 4BYJA 4GFOA 4YZNA 2JIIA 2Y4PA 1W83A 5C9CA 3IDBA 3IW5A 5AIRA 2ITPA 4JDKA 1WMKA 5I5ZA 2FO0A 3NMUF 4BIEA 2GFCA 4JL9A 3QUPA 5DR2A 3FEGA 4EK8A 5I9WA 4FTAA 2JKKA 5FG8A 4A4XA 5J7HA 5EM5A 4GYIA 3OXTA 4GH2A 3ELJA 3ZTXA 3REPA 4IM0A 2XK3A 4I23A 4X7QA 5K4IA 3DXPA 3HMOA 3DT1A 3DBFA 4X0MA 2QU5A 1IR3A 1H1SA 3K54A 3P0MA 2XZSA 3CCNA 2QCSA 3ORNA 4AZTA 3F66A 3R83A 1MUOA 4J71A 3D4QA 4UMRA 4O6LA 1PY5A 1QPJA 2EB2A 3PJ2A 4O0VA 4EYJA 5LVPA 2XA4A 5J7BA 3RCDA 3CD3A 3MJ1A 3SV0A 1E9HA 1W7HA 3QZHA 4QPMA 4WO5A 1VZOA 4MWHA 2OIQA 2ZMCA 3WZJA 3D5WA 4TKSA 5HG5A 3COMA 2J9MA 4C59A 4E6DA 2C69A 3I4BA 3K2LA 4KIOA 3SG8A 4L3PA 3Q32A 1WBNA 1YDTE 5IH5A 3TDWA 4AACA 2W4KA 4R7HA 4FVPA 3OCGA 4CLIA 5E8UA 4YJOA 5KBRA 4CKJA 5F20A 2VTSA 3EOCA 1O9UA 4V04A 4ALVA 2XF0A 5T6KA 4IM2A 3EN6A 2QR8A 4G5PA 5FDXA 2V7AA 3BZ3A 4J98A 4O0TA 3HMPA 4GJ2A 2SRCA 4D2WA 4P2KA 4QQTA 4CXAA 5HD4A 5KKRC 3O17A 3OROA 1UU8A 2XNNA 3BGPA 3R2BA 4DINA 1YXVA 5EYKA 2WTVA 2YIWA 5HBEA 4FTKA 4DGGA 3TNQB 2OIDA 3G33A 4FUXA 3EWHA 2VAGA 3G5DA 4RIXA 3V5PA 5KX8A 3SW4A 3TV6A 3HGKA 5CI7A 4LG4A 1WVWA 3BLHA 4ANSA 4EI4A 4UV0A 1W98A 5HVKA 2VX0A 3RAIA 4AGCA 2ITYA 2GCDA 2XM8A 2FB8A 4D4VA 5CF4A 3HDNA 3KULA 3IW7A 4YO4A 2W5BA 3THBA 4E73A 3KRXA 4Q2AA 1LP4A 1PF8A 1R1WA 1SNXA 3E3PA 3SOAA 4AFEA 3R7EA 4M66A 5KMLA 5J9YA 4NEUA 3K5VA 1JSUA 4TYJA 5CT0A 4TW9A 1M2QA 4XRLA 4E6AA 5KBQA 4M84A 5AX3A 3ZXZA 4IX3A 4MH7A 4ZIMA 3V51A 2PMIA 3GC8A 2IZUA 3NEWA 4S30A 3QTSA 2PVLA 4AFJA 4F64A 4ACCA 3GU7A 3KRRA 3R2YA 4IIRA 2WMSA 2YM4A 4MAOA 3DBQA 3LJ1A 3HRCA 3MPTA 4WT6A 5AAFA 1J1BA 2B54A 3POOA 3RPVA 4F9CA 2VWYA 4BDEA 4EQMA 4CLJA 2IW8A 4FL1A 5IA2A 3COKA 5A4QA 5BX0A 4RSSA 5CAOA 2WMWA 4DN5A 3MS9A 4QMUA 1JBPE 3MV5A 3BU6A 1U5QA 3QTIA 4EH2A 4O2ZA 3FMHA 3S95A 3MJ2A 4OTWA 4FIIA 2G9XA 4WKQA 2YEXA 3ALNA 2PVHA 1T46A 3Q5ZA 5C8MA 1OPLA 3RK9A 2W1CA 4BIDA 2JFMA 3UE4A 2CKQA 3AT4A 4E5AX 5CEQA 4YLLA 4W4YA 5IA3A 3EIDA 4U5JA 3UOKA 5CX9A 1YRPA 3R7VA 4KKGA 5DEWA 4GU9A 1UV5A 4BCJA 4EOIA 3GFWA 2OJIA 4S33A 4D2TA 3P4KA 4FI1A 2Z60A 4FOBA 4E4MA 1J7LA 1YXUA 5AEPA 5LVNA 3C4XA 1Q99A 5CWZA 4XX9A 3WZDA 2F7EE 4NM0A 3VS7A 3LFAA 3UZRA 3FMLA 4BKZA 3P78A 4O7RA 4FKSA 4FMQA 1Q8UA 4RC3A 4BCPA 4BTKA 3JY0A 2C5VA 4U97A 3WYYA 4EOOA 3C9WA 3PJ3A 2PZRA 4C0TA 5JEBA 2UW0A 4HYSA 2WGJA 4NCTC 5JRQA 1VYWA 3GQLA 4G16A 2PYWA 3FJQE 3IOPA 3ORIA 4QMXA 2LAVA 3RCJA 3BYOA 2OGVA 2VU3A 2PUUA 5HNIX 2WTKB 5C01A 4JDJA 4BDDA 4E1ZA 4YU2A 3LZBA 4IAFA 5AAGA 4Y72A 4FOCA 2V0DA 2WPAA 1LUFA 4F65A 4AOTA 4NZWB 5HICA 2WTJA 3R30A 3K3IA 3SD0A 3CGOA 4D1SA 3GQIA 2BIKB 4A9SA 4C4EA 3NVMB 3DQWA 3BE9A 1ZWSA 4HPTE 1Q3WA 4WD5A 2UW7A 4MNEB 2BHHA 3VF8A 2O65A 4R1VA 4ID7A 2VGPA 3E87A 4QTEA 4GUEA 2CDZA 3FYJX 3IW6A 4YO6A 3LLTA 5EI6A 1AGWA 1VEBA 1BMKA 2J50A 2XYNA 4O7ZA 5IQIA 3W16A 2BALA 3I7CA 2V22A 5A4EA 3QLGA 2RL5A 4ONAA 4NKSA 2YITA 3F3UA 5EHOA 4ZMFA 4X3FB 4H3QA 4O0WA 1U54B 3VAPA 3L8VA 2P55A 3R28A 5CXZA 1OPKA 5C8KA 5LXMA 1WCCA 4GMYA 4IZAA 3TKIA 4YUQA 4IWOA 4FE2A 1YWNA 4HPUE 5AP3A 3R7IA 5CS6A 4DC2A 3COHA 5IH4A 2IZRA 2QI8A 4TWCA 4CFNA 3WZEA 4RWIA 4E93A 3GFEA 4XG3A 3L9MA 3AG9A 3MDYA 4ALWA 5AP7A 3TTJA 2JGZA 4C02A 2ZM4A 4FTUA 2DYLA 4NM7A 1JWHA 4I0SA 4Q5HA 5AR4A 3NR9A 4UMUA 4EQUA 5ETFA 3TZ9A 2OF4A 4DH5A 4JG7A 2HYYA 3CQEA 3ULIA 4YTFA 3DZOA 4I24A 1IA8A 1PYEA 3PJ8A 3E92A 4ZJIA 4D4YA 2PE1A 3CR0A 2XKCA 3TJCA 3RMFA 2XIYA 3RPYA 3SOCA 4FG7A 2CKPA 3QQHA 4CYIA 2WIPA 3S4QA 4DEGA 4EBWA 1H0VA 2C6TA 3ORPA 2J4ZA 3KN6A 2A0CX 5EKOA 1BKXA 4OTGA 4LRKA 2YAKA 3BHYA 2W06A 2X81A 4HZSA 3UO5A 4TN6A 5E1EA 3PJCA 4AAAA 1NT2A 5FD2A 5I3RA 3U87A 3DQXA 3F82A 5DT4A 5LVOA 4YJPA 2GNGA 4GT5A 3RZFA 4FV7A 3R00A 4GVAA 4FSRA 3H10A 3VS2A 4WG4A 5A9UA 2XYUA 4J99A 3HYHA 4RVKA 4GW8A 2WD1A 3NYOA 2VTIA 3OCTA 3OY1A 2J5EA 4OTRA 5AP0A 2YWPA 4PP9A 5ANJA 2GHGA 5EI2A 2W96B 1G8AA 2PHKA 3R9DA 4BVUA 4GU6A 2VUWA 3OD6X 3QYZA 4MCVA 4R1YA 2PPQA 3NUNA 3BV2A 3PG3A 1TQPA 3A7JA 4AN9A 2JIUA 1FMKA 2VNYA 5GNKA 4X2GA 4A9UA 4AZSA 1ND4A 4C61A 1K3AA 1W84A 4KSQA 5AV2A 3L9NA 4D55A 2CCHA 3FI8A 1Z5MA 3QA0A 4H36A 5L8JA 3BWFA 3ZHPC 3C0GA 3KMWA 3WZUA 5CLPA 4DG3E 3MBLA 2Z7LA 4ANNA 5IQAA 5C26A 4HCUA 4DITA 3F2AA 3TN8A 3LMGA 3NAXA 3IDCA 4L42A 3A2CA 5KMJA 2GNIA 4IM3A 3LCTA 4BTFA 4DFBA 2PZPA 4IBMA 2BKZA 3RBWA 4AT3A 3D0EA 3HRBA 5G6VA 2QQ7A 4WIHA 4YJTA 2HZIA 2R3OA 3QALE 2OKRA 4N6YA 3C4FA 5CNNA 5CSWA 2R3JA 5C8NA 3R21A 3NUAA 4DCAA 4WNKA 4B8MA 1W8CA 2J6MA 4H39A 3ZSIA 4XJ0A 1SVHA 3AXWA 4I5PA 5EKNA 3T8OA 2JKMA 2R3FA 2JBPA 4E26A 3R1NA 3BHUA 4K6ZA 3UODA 1SNUA 3AOXA 4FTLA 4XHKB 2ZJWA 4L52A 3SG9A 3UOJA 3MIYA 4G3CA 1X8BA 2WQOA 3DLSA 3QWKA 5H3QA 1YDSE 4QMLA 2B9IA 5CEIA 5A14A 3FZ1A 3QKLA 2LGCA 3GT8A 3U4UA 4NW6A 5EW9A 3LQ8A 4ENYA 3L1SA 4UXQA 3DZQA 3AC5A 4F1TA 4NWMA 2YAAA 3A60A 4CGAA 2X39A 3PA3A 4RVMA 2YM8A 1FVTA 4XBUA 2XK4A 2HZ0A 3PRIA 4I0RA 3M2WA 3LMHA 3BEAA 3DB6A 4O22A 2VTNA 4TYEA 4CCUA 3OW3A 4CVAA 5GIOE 3W2PA 3QTUA 1ZOEA 3PLSA 4F7NA 5DRBA 4GK4A 2XVDA 2V7OA 4YHTA 4V0GA 2XNPA 5AP6A 2C3KA 3B8RA 4JBVA 3RVGA 3GU4A 2QVSE 1SVEA 2QG5A 4WNMA 4YZBA 4ENXA 5AA8A 4ANOA 3ERKA 5E8SA 3LM0A 3DDPA 5BPYA 3FLQA 4I1ZA 2EXEA 4BTMA 3DY7A 3ORLA 1PW2A 4LOQA 5DA3A 2YCQA 4NIFA 3NNWA 1M2RA 3G9NA 4IAKA 4FGBA 2HK5A 4DF3A 2W1FA 2HCKA 3UG1A 3FLYA 5JFXA 3C51A 3G2FA 4G3EA 4NW5A 4EK5A 4CT2A 1OL1A 2X2LA 3NUPA 4ZSAA 4O86A 1JAMA 1XH8A 2RFNA 2ZDUA 4M15A 5E1SA 4DTBA 5HNBA 4GKHA 4CEGA 3AMYA 1J7UA 1OUKA 2BZKB 3DKCA 3EYGA 3IO7A 5BMMA 2CPKE 4GK2A 2YJSA 2JKOA 5FUTA 2IVUA 4WBBB 4D2SA 3FKOA 3FKNA 4R3PA 4ZZMA 4R3CA 2BAKA 5IEXA 3FZRA 4L9IA 3V3VA 3O8TA 3OZ6A 2C47A 3PSCA 1RJBA 2ITOA 1QPEA 4QP4A 2Y9QA 3IDPA 3FSFA 4JNWA 1O6YA 3CBLA 3MGYA 1IA9A 1Q41A 1T45A 5JFVA 5K0XA 4I22A 3CJFA 3OBJA 3EFKA 3F61A 4NFMA 5A6NA 5GINE 4BL1A 4PP7A 4CFMA 3QQLA 1YI6A 2BILB 2YM3A 3GOKA 3AD4A 4PX6A 3ZC5A 4IAIA 4H3BA 3R7UA 3HMNA 2Y7JA 3PP1A 5AR2A 3PIYA 3GCSA 4BFMA 2GTMA 3GGFA 3PXQA 3IOKA 2I6LA 2WHBA 4Y8DA 5TT7A 3RALA 4Y85A 3FI3A 1OKYA 1H24A 1ZYJA 3DJ5A 3MB7A 2WQNA 3OEFX 2OFUA 3O71A 4W4WA 4PY1A 5K4JA 1ZOHA 4F9AA 3VBXA 2E9PA 3AC2A 3G9LX 3QCSA 4UN0C 4QP8A 2C5YA 1VJYA 3C5IA 1H1QA 2QO2A 3LFNA 1MQ4A 3FE3A 4BBEA 3RJCA 5L8KA 1BI8A 3MB6A 3IPHA 4LRMA 4MQ2A 3VVHA 5L3AA 2F49A 4E4XA 4L43A 5JMSA 1E1XA 1A9UA 4IVDA 3P7AA 4IZYA 2CHLA 3Q04A 3R71A 1NW1A 2BRMA 1V0PA 2XBJA 5HE0A 4I4FA 3TDVA 4B9DA 3HVCA 2DWBA 1FGIA 4FZAB 2BHEA 1Q61A 4PDPA 5E92A 3GU8A 5FXQA 1DAYA 2I0YA 3D7TB 4O1PA 3D9VA 4AZFA 4F0IA 2UW8A 4FNXA 1GZOA 3ACJA 4NKAA 3W2QA 4ZJVA 4WG3A 4UB7A 3ZS5A 5EQEA 3R8LA 4FEXA 2JFLA 1P2AA 1KV2A 3AC3A 3PY0A 4KRDA 4ZLOA 3VNTA 5AV4A 4Z7HA 3MI9A 5AX9A 2YIXA 4PMTA 5DH3A 3I0OA 4O1OA 3VS0A 4BF2A 4G2FA 1WBTA 2PVKA 4BDFA 1YHVA 1NXKA 3DNEA 3ANQA 4OTHA 3R02A 5E8YA 3R04A 1UU7A 1UWHA 3O8UA 5D10A 4A4OA 3H9OA 5TO8A 4QMMA 5HZNA 3HAVA 4GIIA 3FBVA 1ZYDA 4C34A 2BMCA 3DBCA 4RX5A 4YHFA 5K0KA 2VD5A 2QOHA 3MPAA 1YHWA 4IAZA 2FSMX 5AIKA 4GKIA 4R5YA 1OIQA 3A4OX 5CZHA 4AGUA 3F2RA 2HZNA 4XYFA 3OUKA 1ZRZA 4U40A 3PVUA 2QKRA 3RINA 5EM7A 5L2TA 4DBNA 2ITQA 4WUNA 4JG6A 4ANLA 1AQ1A 2GQSA 2ZOQA 3PXRA 1B6CB 3V5QA 2W1HA 1ZY5A 2OI4X 3E7OA 3I0QA 3MW1A 3RHKA 4PL3A 4AZVA 3ORXA 2HOGA 3LFQA 1B38A 3ZO3A 3WYXA 2BKKA 4XV2A 3QQKA 5DN3A 5EFQA 4QMNA 4R77A 3RKBA 1Q3DA 3EQDA 4KAOA 4ASXA 3CTJA 4DEIA 5CANA 2WOTA 3ORKA 3SQQA 2B4SB 3ZDIA 3VJOA 4M14A 4ZOGA 3R9HA 4F08A 3QKMA 2NRUA 5TKDA 3FMJA 4EH6A 4DFUA 4C3PA 2IPXA 3BGQA 3KKVA 4QP9A 3OCBA 3RAHA 3LCSA 5CZIA 1DI8A 2X4FA 3A7FA 5CF5A 3HV7A 5FEEA 1XR1A 2R4BA 4XV1A 4HNIA 5HESA 4C4JA 5M56A 3DXNA 4RIYA 4XG2A 2Z7QA 3FZTA 2WNTA 5AP5A 4AW0A 4CNHA 2W1IA 2UZDA 4IX4A 3DLZA 3TZMA 4NT4A 2FUMA 4M67A 3G6GA 3HDMA 2IJMA 3BHHA 4U45A 4JQ8A 5E8ZA 4YC6A 1V1KA 2XRWA 1YXXA 2YIQA 4GFGA 5E9EA 3KC3A 3V5JA 2UZBA 2WQEA 3ZZEA 4KNBA 3DKOA 4OT6A 2YWVA 1OBGA 4FK6A 2AYPA 2IW6A 4ZJJA 3O96A 2OZAB 4JT3A 4A06A 5DMZA 4FUYA 3DAJA 4EHZA 2OBJA 1CKPA 2Q0NA 3KF4A 4FNWA 5CEKA 3NUUA 4XH6A 4IVAA 2GNFA 5LJJA 4XV9A 3QFVA 4AE6A 1NVQA 2VO0A 4BWPA 3FI4A 3G0EA 5DEYA 3UP2A 5HE1A 4RIWA 3ZONA 3KULB 3R8PA 4XRJA 5IQEA 4OBOA 2E9NA 2XBAA 3E62A 4K0YA 2GS2A 5DRDA 5M09A 5F4NA 4GYGA 5DI1A 2XNBA 4RC4A 1URCA 2VTRA 4QYEA 3UMXA 1WBOA 4GIHA 4IX6A 1OKZA 5I9VA 3OXZA 2J0IA 2B0QA 2A4LA 3VW8A 3GCQA 4RRVA 4AW1A 3DFAA 4WBOA 2BTRA 3SRVA 2WTIA 4QYYA 5BYYA 4GG7A 3ZC6A 4GFMA 3EN5A 2HY81 4MF0A 2WQMA 4IWQA 3ZSHA 3R1SA 3MA6A 3SDJA 2PVYA 3LFDA 3H4JA 4I5MA 1IG1A 5ANOA 3VRZA 4FEVA 3FXXA 2X9EA 3TM0A 1FVVA 2HIWA 3UP7A 2XK7A 5D9HA
chains in the Genus database with same CATH superfamily
4YBKA 3VULA 2VX1A 4PDOA 2QONA 4IC8A 4BCGA 3QF9A 4ACHA 4YC3A 4AGDA 4E5BA 5CQWA 4QMZA 5EYCA 1BX6A 3Q4ZA 3U9NA 3V5TA 3I5ZA 4I20A 2P33A 4WNPA 4E7WA 3RHXA 2VWXA 3FYKX 2E2BA 5HVJA 5FP5A 4AUAA 4G6NA 1OVEA 3FY0A 4FTQA 3VBWA 4DGLC 3S0OA 3W0QA 3SXRA 3CC6A 1Y6AA 4QTCA 3TWJA 5KZIA 4CG9A 4AT5A 3QD3A 4USFA 1KOBA 1VYZA 4M7IA 2RSVA 3OP5A 1WVYA 3QD0A 1UU3A 4MEDA 4YZMA 1BUHA 3FMDA 3I7BA 5IA4A 4UWBA 2C6OA 3L8PA 1R78A 3DKGA 4O21A 3NWWA 2R3MA 5E91A 4ZS4A 2WQBA 4QTDA 2C6EA 3OTUA 3M11A 2XM9A 3TACA 3GI3A 4DH7A 3ODZX 4GCJA 4YP8A 5CVGA 4FICA 4FG8A 5HVYA 2OFVA 4BKYA 1JSTA 1ZMWA 4L7SA 4BCQA 3MTLA 3H0YA 3SGCA 4BJJA 3W2SA 3WARA 5D7AA 1QCFA 4E6CA 5HLWA 5D1JA 2ZM1A 3M42A 4QTBA 1OUYA 3NFGB 3EHAA 4EZ7A 1YI4A 4WNOA 4DE4A 5JKGA 5JH6A 4EC8A 5KKRB 4ASEA 5JGDA 4DLIA 4O96A 1WVXA 3R8UA 4KABA 1P4OA 3CEKA 4FODA 5EG3A 3NDMA 5LWNA 4G9RA 4IMYA 1SYKA 3UBDA 3V01A 5AM6A 3P7BA 4UX9A 1OIYA 3TKUA 4P5QA 5KMMA 4BY9E 5DGZA 4KS7A 3E8DA 2IVSA 3A4PA 1OKWA 4ZTMA 5JFSA 2WB8A 2CGWA 4EH8A 3PUFC 3OS3A 2OXYA 2E9VA 4MX9A 1KUTA 4FTOA 5CU2A 2PY3A 2WKMA 5B2KA 3CD8A 3DBDA 3LAUA 1XHAA 2GS6A 4DFLA 2R9SA 3ACKA 4EOQA 5HOAA 2W1EA 2Z7SA 2YCSA 3SXSA 2QOKA 3BRBA 3KVXA 2YZLA 3DPKA 4QYGA 3U51A 3D5UA 4YJNA 3HV3A 5M44A 1H25A 3E8NA 4JMQA 2QLQA 3E5AA 4CFWA 5AUUA 3ENMA 3CY3A 4YJUA 5E8XA 5IA5A 4BHNA 4RJ5A 3F3ZA 3GVUA 2G01A 4E6QA 2PZYA 3AD6A 1GOLA 3O7LB 3LFBA 3AMAA 4MF1A 3AT3A 2GSFA 2C5OA 3FI2A 5I9ZA 4QP2A 3I5NA 4F99A 2X7OA 5K5XA 3AGMA 3OWKA 4Q5EA 3LE6A 4PV0A 5HG7A 3ENHA 4DHFA 5FBOA 4O7LA 1OGUA 4BGGA 2FH9A 4PQNA 4YTIA 3WILA 5K5NA 3LXLA 5ANGA 2X0OA 2RG6A 3HEGA 4D2VA 4EUUA 4E3CA 3W55A 4BDAA 2NP8A 2J0JA 4F1MA 3ZH8A 1Q8ZA 4BI2A 2W5HA 1J1CA 3DKFA 5IA1A 3U6HA 4M69A 3KK8A 2RKUA 2WIHA 2CJMA 5C03A 3T3VA 4TNDA 1XBBA 2UUEA 4L53A 3ZCLA 4DCEA 1XH5A 1P14A 2I0EA 4JQEA 4NU1A 3LJ2A 3EQGA 1PXKA 4IVCA 5CENA 5GIPE 2YERA 1TZDA 3CTQA 5HCYA 3EYHA 3UNKA 2FYSA 2HAKA 1JKLA 2W9FB 4ITHA 4YZDA 4R7BA 5CU0A 5DFPA 4BCNA 5ITAA 3GC9A 5CAUA 4AW2A 4MBJA 4IB0A 2UZTA 4FV1A 3TIZA 4DEHA 3NIEA 3VJNA 4H05A 1B39A 2QOFA 2J51A 3E64A 4H58A 3PG1A 5HG9A 4LV5A 3W32A 1FBNA 4EORA 1PXNA 4GT4A 4ZS0A 1E1VA 2ETMA 4RVTA 5CU4A 3I60A 1PXOA 3D2KA 3PIZA 4TYHA 2PUPA 4CFUA 4OTPA 4U6RA 3UJGA 2HWOA 3QTXA 1WBPA 3HUBA 2UZUE 3ZFXA 3CQWA 1UNHA 4BDKA 1JSVA 4DFZE 2Q83A 4AZEA 3BLAA 2RG5A 4ACMA 3AC4A 3OWLA 3MH2A 5HD7A 1SM2A 4C57A 3N51A 3P86A 4PUZA 4ASDA 4OTIA 3PVBA 1BL7A 4HW7A 3KY2A 4MXAA 5ETIA 3WZKA 5HI2A 3E3BX 4BDGA 3FC2A 3PUPA 1TKIA 5H2UA 1O6KA 5C1QB 2IN6A 2XP2A 2YLFA 1JVPP 4O91A 5EQYA 2XIKA 5J5SA 1RE8A 2G15A 2QD9A 3A7GA 3E63A 4L01A 5FXRA 3VUMA 2XAMA 5ANEA 2BFYA 2R3KA 4CMUA 3DNDA 3RM7A 5DYJA 3OWPA 4O7TA 5HBJA 4J7BA 2EXCX 5FRIA 3SAYA 3IG7A 4HGEA 4S2ZA 4J96A 4BCFA 4H1JA 3OXIA 1Q8TA 3L9PA 5I9UA 4RQVA 1YI3A 1YXTA 3EQPA 3RNIA 2OZOA 4FC0A 4QQ5A 2BTSA 4J8MA 4R7IA 4L45A 4MXXA 4XS2A 3FQSA 4PMSA 4AXAA 3GENA 4FNYA 1OPJA 2CSNA 4F6WA 2NRYA 5DLSA 2CGUA 5AR5A 2VTAA 3EZVA 5K9IA 3VWAA 4D9UA 3P7CA 2V5QA 5EM8A 4DH3A 2CMWA 3KEXA 4LFIA 2CN8A 1Q4LA 2R7IA 3NYVA 3QGWA 3O7LD 4ZSEA 3D2IA 3TUBA 2XIXA 4YNOA 2DS1A 3F6XA 2JKQA 4FL3A 3QX2A 5EYDA 3CSVA 3KIOC 3OC1A 3TCPA 4GEOA 5M06A 4ZY6A 1REKA 1TQMA 3TNHA 1H01A 3QQFA 1FVRA 2X0QA 4XOZA 5HHWA 3ULZA 3VQHA 2YM6A 4UZHA 4CMTA 5EHYA 3BI6A 4IH8A 5AJQA 3UDZA 3A8WA 4QOXA 3AC1A 2BZJA 4Y73A 4HVHA 3UVPA 3KXNA 4XBRA 3G0FA 3F7WA 3Q9WA 2H9VA 4OAUC 2J0LA 1Q8YA 2PU8A 3CGFA 4C62A 2VV9A 5FLFA 3ZEWA 3QTRA 4BIBA 3MYGA 4JS8A 4OTDA 2HZ4A 4C35A 4V0GB 3HECA 4J8NA 4PWNA 3NUSA 4C37A 1QL6A 4QQJA 2YIYA 4I6BA 4NFNA 1Q5KA 2PTKA 4FNZA 3KQ7A 4N6ZA 4NIFB 4DH1A 2XNGA 4CFVA 4MYGA 5CALA 4JR3A 1F5QA 2X1NA 3ZBFA 2JEDA 3RAWA 2WMVA 4UYAA 4RA4A 4EH4A 3BGZA 4NSTA 3DS6A 2IVTA 2UW4A 1OM1A 2UW3A 4FZ6A 3RZBA 4CQGA 4JBQA 4P90A 3H3CA 5BNJA 2WZJA 3TEIA 3P23A 2PULA 2W0JA 2FVDA 3MIAA 4LRJA 1GZ8A 2BRNA 3VHEA 4BRXA 1CM8A 3A99A 3LFEA 2BIYA 2ZDTA 2XKFA 4C4GA 1LPUA 2YCFA 4PPAA 1WZYA 2VGOA 3CJGA 4OTQA 2PVRA 5L6WL 4O0SA 3VS1A 4CFXA 4U44A 1UWJA 1W2FA 5EH0A 3FV8A 1KE7A 2Y6OA 3FDNA 3PXZA 4WRGA 3SHEA 2XNEA 5AA9A 2QOQA 3PPZA 3PXKA 1J91A 4LDTA 3ZM9A 4BZOA 3GUBA 4BDHA 5AUXA 5A46A 3PFYA 4DEEA 4LOOA 1AD5A 2A19B 2O0UA 3FZOA 4O4FA 2FSTX 3RTPA 4G9CA 3ZUVA 4EH3A 1XWSA 3A8XA 3EQBA 5JFWA 4IZ7A 3U8WA 4BN1A 4DGOA 4AP7A 4AXFA 2OK1A 3W2CA 4C4IA 1EH4A 5EDRA 4PNIA 2GFSA 4IQ6A 4BDJA 4F7SA 5A4TA 3UVQA 3Q9ZA 4L7FA 4FV5A 3FHIA 3QD2B 2XK6A 3Q5IA 5T68A 4CKRA 4RX8A 4CRLA 3CIKA 5IPJA 5BYLA 4ZTSA 5CEMA 2O8YA 2R7BA 3HNGA 3PTGA 5T3QA 1H4LA 4UY9A 2OF2A 4EWQA 1UVRA 3BL9A 3NX8A 4FT7A 3ZUUA 5GHVA 4EOMA 5JGAA 3ZDUA 1YDRE 3EN4A 2E9UA 4QNYA 3TV7A 3DV3A 4CZUA 3IW8A 1DS5A 2NNWB 3M1SA 4FA2A 4A07A 3BQCA 5LVMA 5ANKA 3V04A 2V62A 5CQUA 4Q9SA 3GP0A 5M4IA 2JAVA 2VX3A 4H3PA 3NW7A 5AP1A 3VHKA 3NVKI 3D15A 4XG8A 2JAMA 5DT3A 4QMQA 4DDGA 5EI8A 4HYUA 3IGGA 3MY1A 4KWPA 4D0XA 5CAPA 2C4GA 3PE1A 5DIAA 1URWA 5ICPA 3GU6A 1IAJA 3H30A 4ANBA 4IJ9A 3I6WA 5GJGA 2QOCA 2JD5A 3KB7A 3MH0A 3ZYAA 3LJ0A 3ANRA 4CQEA 5BV3A 3IECA 4FIEA 4WOVA 3ZOSA 3EB0A 2C0TA 2R3HA 3CXWA 5I4NA 2XMYA 2NO3A 3WBLA 5IQGA 1REJA 2RGPA 5HIBA 3TZ8A 3LKMA 3W0MA 4EKLA 1XO2B 1IEPA 3EJ1A 2HELA 3OHTA 3WE8A 5KCVA 3BE2A 4RIOA 4UEUA 3OMVA 3RNYA 2VO3A 2I0HA 3EL7A 4ZAUA 2PUNA 4CTCA 1CKIA 2VWUA 2FA2A 3ZXTA 4NM3A 5FP6A 3BWJA 5HIDA 3ZLYA 4IX5A 2WMRA 4FTMA 5HU9A 3CKXA 3R63A 4RFYA 3Q2MA 4RJ3A 4EHEA 3RWPA 5EW8A 4R6VA 4O4BB 3WF6A 2OJFE 5HEZA 3DFCB 3QTWA 5B0XA 5HO8A 4HJOA 1IASA 4ZK5A 5H8EA 3K3JA 5A6OA 2B55A 2W1GA 4OLIA 3R9RA 3DA6A 2Y4IC 3ET7A 4OGRA 3G15A 4UXLA 4NK9A 2OXDA 2A98A 4Y5QA 4BZNA 3BU3A 2PVJA 3ML1A 4FSUA 1OL6A 3D83A 3Q9YA 4NTTA 4YR8A 4O7WA 1XKKA 3PWYA 4QYHA 2RF9A 2C1BA 2ZV2A 4ZSLA 2CNVA 3DB8A 4F7LA 2ZAZA 2X2KA 1LEWA 4F6UA 3EZRA 4OT5A 2YJRA 1NVRA 4MNEA 4RT7A 4ERKA 4AG8A 2QOOA 2X0GA 2WMBA 5LWMA 4LL5A 5BUJA 4U3YA 1PMNA 4N4SA 5AM7A 2G2FA 2PL0A 2PZ5A 3DXQA 4N57A 5KHWA 3U54A 2WOUA 2BPMA 4BBMA 2XKDA 4B7TA 3N9XA 2YA9A 3R6XA 2GTNA 4IACA 4ZSGA 3NS9A 5IF1A 4CTBA 3OT3A 3EN9A 3R8MA 4DHIB 3HV4A 3LFSA 1NY3A 4WG5A 3VBQA 3W33A 3MWUA 4DFNA 4Z16A 2P0CA 3EMGA 4P5ZA 1PJKA 4YHJA 4BWKA 2VTOA 4Z7GA 3MY0A 4X3FA 1OKVA 3U4WA 1FQ1B 4EK4A 2VTMA 3WOWA 1ST4A 4LGGA 3E88A 1KSWA 3Q60A 4RIYB 5J79A 2Y6MA 3GBZA 4IANA 2UV2A 3RWQA 1PXJA 5M51A 4KRCA 3KK9A 4ZTLA 1H1PA 4TY1A 1GIHA 3HP2A 5LQFA 4BZDA 5HG8A 1VR2A 5FTOA 3R0TA 2JIVA 4LI5A 3Q4TA 1YOLA 5TE0A 3VUHA 1QMZA 4N0SA 5E8TA 3KXGA 5FDPA 4IWDA 3BL7A 4A9RA 4EZ5A 4O7VA 2EB3A 1UA2A 4WA9A 3ITZA 2GNHA 1KOAA 2B52A 3S00A 3SC1A 4LV7A 4UBAA 4LUEA 1YOJA 4FKIA 4UYNA 1PMVA 4R8QA 5LMAA 1APME 2R3IA 2WMUA 3FKLA 4DYMA 3CLYA 3PZHA 4ACGA 2VNWA 4CSVA 4O0UA 3UTOA 2QC6A 4A4LA 3EQCA 2BDFA 2JDSA 4FV3A 3QUEA 3TNIA 1TQIA 2OICA 4TRLA 3QCQA 1PHKA 3AGLA 3HMMA 2RFEA 5DNRA 2XAOA 4EH9A 4BI1A 2IW9A 2F4JA 3ZO1A 5BQ0A 3DK3A 4KINA 2C6MA 2G2IA 4FYOA 3BKBA 2XUUA 1DI9A 4IE9A 3SRVB 3UDBA 3P5KA 1CDKA 5IA0A 2QO9A 2ITZA 2R3QA 4QQCA 4QMVA 4L00A 3UZPA 4MWIA 2C6DA 4HCTA 2YFXA 2C30A 2ESMA 3NZ0A 4I92A 4B6LA 3AKKA 3Q3BA 4JDIA 3QYWA 4NUSA 2F57A 3RP9A 4Z55A 3DK6A 3DJ6A 5CYIA 1CKJA 4F09A 5J8IA 3N4UA 2F7XE 2ITWA 4C7TA 4YGAA 4X2JA 4DGMA 4EK6A 4ACDA 3R7GA 2Z02A 1XQZA 3NNUA 1V0BA 2QHNA 2UW9A 4AOJA 2H6DA 4RWJA 2OH0E 2BROA 4PTEA 3ZO4A 1GJOA 3V6RA 3ZLWA 5CEPA 3E7VA 3NLBA 4FZ7A 4QP7A 2RFDA 1L3RE 1KV1A 4WRSA 2ZVAA 3OOMA 4FV8A 4KIQA 5I3OA 4ITIA 4PRJA 3TI1A 4ZZNA 4DLJA 4J53A 4FTTA 4L8MA 5JT2A 2QNJA 2JC6A 4RMZA 4FGRA 1GAGA 4M97A 2ZM3A 3OBGA 3ORZA 2X2MA 2W7XA 3BIZA 2PVMA 3NYXA 3EKKA 3PY1A 5J5TA 3PY3A 4G34A 3LCKA 1P4FA 2GHLA 2XNOA 3QHWA 4II5A 3QL8A 4GSBA 4LGHA 4RC2A 4TWNA 5L2WA 3SVVA 3UO6A 1U5RA 4XUFA 1F3MC 1Y57A 2FSLX 4OBPA 3ZUTA 5DG5A 3R9NA 5CU3A 3KXMA 1G5SA 4CZYB 2YM7A 4YSJA 2ITXA 3EL8A 3NW6A 1ZLTA 1Z57A 1BL6A 3L8XA 3BX5A 1MRUA 5CVHA 2RIOA 3ALOA 2VTQA 3KXHA 3SXFA 2O3PA 4FVRA 4FSYA 2BAQA 5E8WA 1J3HA 2JDOA 2R3RA 5FQDC 1S9JA 3QX4A 3C13A 3KXZA 2H8HA 3FAAA 4W8DA 4JX3A 2GU8A 4YZCA 4A9TA 2R5TA 3T9IA 3LXPA 4C58A 5JGBA 5AP4A 5EOLA 2X7FA 3GCPA 2QURA 4FIJA 4IWPA 5ACBC 3KN5A 3VS5A 2ERZE 2WTWA 1MRYA 3MH1A 4YJRA 2QR7A 5CSPA 3A61A 1NVSA 3VF9A 5IUHA 1ZYLA 3V5LA 2IVVA 3ORTA 2ZV8A 3LXKA 5CSHA 2BFXA 5AUTA 2A1AB 4N70A 3MFTA 5F9EA 3QC9A 1ZMUA 2YLEA 4KSPA 2IO6A 5AUWA 4YTCA 3OF0A 4QYFA 5EW3A 4TL0A 4JR7A 1YWRA 3MFSA 4Y5HA 1ZY4A 4IW0A 4GJ3A 3LIJA 4RX9A 3R1YA 5BVNA 1U59A 4G31A 3KU2A 4QNAA 4EBVA 4RIXB 4D4SA 3F2NA 4TYGA 1KE6A 5J9ZA 3R7OA 5IDNA 3UPXA 2P2HA 3F5XA 1K2PA 3FUPA 4PTGA 5DVRA 3UVRA 4MXYA 4BC6A 5HO7A 1H0WA 4AQKA 4C2WA 4ZLZA 2YISA 2DQ7X 2W99B 4IADA 1WBSA 4E8AA 2GNLA 2JDTA 5CF6A 1G8SA 5ETCA 3FLSA 3VUGA 2OO8X 3DTCA 4X2NA 5AMNA 5BUEA 3LQ3A 2P2IA 3O0GA 2XNMA 3H9FA 3QGYA 2NYAA 1FOTA 3LCOA 1WAKA 2QOLA 4IFCA 3VO3A 1PXPA 3PYYA 3TV4A 5AWMA 4M69B 4ZTRA 1DAWA 2WAJA 4BR3A 4PMPA 4FVQA 4TTHB 4RFZA 2QKWB 3Q9XA 5BYZA 3KMMA 3UQFA 4JIAA 4EEVA 3A62A 4HNFA 3BLRA 3ZLSA 3GB2A 4IB3A 5JZJA 3VONA 4HOKA 4AGWA 5JZNA 3GCUA 2C3IB 4MD9E 4EH5A 5HORA 4U8ZA 5L2IA 5AADA 4XEYA 4FKRA 2B1PA 1FINA 4CD0A 3FWQA 4UMQA 5D12A 1KWPA 4FSNA 2VWBA 2I0VA 4F1OA 1YW2A 5LMKC 5ETAA 4E4NA 3B2TA 3QC4A 4IDVA 4YLKA 2CNUA 2IG7A 4EOLA 5M4UA 5E4HA 1HCLA 3FL4A 4K11A 4BYIA 1OECA 3C4ZA 5BVWA 1H08A 3KL8A 3JY9A 5J1WA 3JR1A 5CASA 4O7YA 5DHJA 5I9YA 1PKGA 2XIZA 5G1XA 1OIUA 4OUCA 3CY2A 5K3YA 4XG9A 4R5SA 5GZ9A 3O2MA 4RLKA 3MVLA 3PSBA 3CQUA 4GT3A 3IK3A 3W18A 1M7NA 4WSQA 2VWVA 5IH6A 5FGKA 1PMEA 4W9XA 1S9IA 2CN5A 2GQRA 4FF8A 2R3GA 3I81A 2B7AA 2QHMA 4ANQA 3OFMA 2PMOX 4BDIA 5IQHA 3QZFA 4I6FA 3TG1A 5HQ0A 2YCRA 2J5FA 4JX7A 3ZBXA 5ANIA 4EUTA 3UPZA 1GZKA 3FLWA 3QHRA 4L68A 4LOPA 5HGIA 1MQBA 1OL7A 4YZ9A 5A3XA 4AF3A 3GCVA 2VN9A 3HA8A 3NUYA 4YJVA 3JUHA 1W82A 1OL5A 1UKIA 4K1BA 1G3NA 4XG4A 3WIGA 4GVJA 3R7YA 3VUKA 3QRJA 3P79A 4FV9A 2A2AA 1H28A 2CGXA 4L46A 1UKHA 4MKCA 5M53A 4ZLYA 3BYVA 5EOBA 2PE2A 1F0QA 3KRWA 3EH9A 3I1AA 3VS3A 2PE0A 1PRYA 3QBNA 5AV1A 3KXXA 4JRVA 3D7ZA 3RK5A 4DG0E 1VLRA 4L44A 2C6IA 4JG8A 3ZRMA 4J97A 1PYXA 4LYNA 2G2HA 4KBCA 2PMLX 2OLCA 4JQ7A 3JVSA 4KIKA 5LARA 3MVHA 3TUCA 3QCYA 4FSZA 2YDJA 3RPSA 2XJ1A 3OVVA 3DDQA 1BLXA 2O63A 3DK7A 3HV5A 3KRLA 5KHXA 4DEAA 5IDPA 2RFSA 2I7QA 3AMBA 3AT2A 1H00A 4JVGA 4CCBA 4W4XA 2VTJA 2EU9A 1ZOGA 2OH4A 1M52A 4HVGA 3MFRA 4FR4A 2VZ6A 2ZB1A 3DGKA 1OI9A 3MFUA 4FKUA 2FSOX 4JJRA 4O27B 4D5HA 3SA0A 3JXWA 3TL8A 1RDQE 2OJGA 4FTCA 2REIA 2BRBA 1R39A 4PL5A 4EHVA 2XEZA 4FKGA 3KF7A 2VO6A 3DJ7A 2BZIB 4RWKA 4CV8A 3W0OA 4BCHA 4FSTA 2AC5A 4PMMA 4I0TA 2HXLA 2X0PA 3QQGA 5J1VA 4QP1A 4YURA 3BYSA 4W4VA 3LOKA 4S34A 3EQFA 4IFGA 1UNGA 4D5KA 4G1WA 5L6PA 3MSSA 4V01A 1SVGA 5KO1A 5A4LA 3R1QA 4Y95A 3KA0A 3P9JA 3QLFA 5BVOA 1KE5A 1W0XC 3S2PA 4UALA 4TWPA 3RPRA 3TNPC 4JAIA 4CYJA 4CT1A 4F78A 3F69A 1WFCA 2QU6A 1KE9A 5IMEA 3W0NA 1QPCA 2OJ9A 4DT9A 4TWOA 4AXEA 4KD1A 1XH6A 3QTZA 5J87A 4ORKA 3Q6UA 4XNEA 4RWLA 4AZWA 2WTDA 4NM5A 4BTJA 4EOJA 2ZB0A 3K5UA 3RAKA 2GMXA 4CMOA 3QKKA 4X6RA 4E5WA 3MESA 2CNQA 3VBVA 4MHAA 5LMKA 1JKSA 4K8AA 3PPKA 3LCDA 2HWPA 3MY5A 4O4DA 4O6EA 5IEVA 3TNWA 3BELA 2OZAA 4P4CA 4USEA 5M57A 1A48A 4YBJA 1OITA 4KBKA 3R8VA 1PKDA 3NCZA 5DBXA 3VS4A 4FEWA 5ACKA 2PVFA 2GDOA 2X6EA 4K9YA 4RZVA 4OW8A 3I79A 2CKOA 4AX8A 4BI0A 3ZRKA 3QRIA 3HP5A 4TYIA 5TOZA 3TIYA 5JQ8A 1YKRA 1L8TA 3JVRA 3LXNA 3B8QA 4U9AA 3FSKA 2XCKA 4U80A 3UGCA 3QZIA 4ITJA 4MD7E 4XOYA 3W8LA 4XLIA 4AE9A 4MXZA 1M2PA 1YHSA 5E8VA 4BB4A 5AV0A 3BQRA 3QD4A 5FTGA 2ITTA 3W10A 4F7JA 4YMJA 3R01A 2OJJA 5DWRA 3GNIB 4UWCA 5GZAA 5KUPA 2JBOA 4DAWA 3UIBA 5E7RA 3Q53A 3FXWA 3KCFA 4Y46A 4O7SA 3TT0A 3PP0A 3AD5A 2X4ZA 3GC7A 3ZFYA 5HX8A 2JITA 4QMYA 2AQXA 3NRMA 2J7TA 1JKKA 2V55A 4G6OA 2IWIA 4XP3A 3N4TA 1XH9A 2C68A 2C5NA 2VWIA 3VBYA 4FYNA 1XH7A 4DEBA 5BMSA 4W9WA 5D7VA 4E20A 4QMTA 5AUVA 2YACA 2H96A 4JDHA 4FL2A 4RX7A 5EDPA 3ZMMA 5B2MA 5F1ZA 3SX9A 4TZRA 5LCJA 3MTFA 4ZTQA 5M55A 3UIUA 2I40A 4QMPA 5L4QA 1U46A 3BHTA 3LHJA 4QT1A 4RPVA 4ZY5A 3KGAA 2J0KA 3N4VA 2X7GA 3UG2A 4F4PA 3BHVA 4CKIA 4IXPA 5HCZA 3LFCA 3LM5A 1Z9XA 4ZTNA 4FZDB 4F9WA 2Z8CA 4JBPA 5EK7A 2ACXA 5J95A 1CMKE 2EUFB 4EOPA 3PRFA 4FT3A 2BDJA 1H26A 4QO9A 5FEDA 3C1XA 3HL7A 2HENA 1Q24A 5KZ0A 5L2SA 2QO7A 3WF5A 4D58A 1A06A 5IUGA 5LOHA 4QP3A 4AXCA 4ZMEA 4P7EA 3VW6A 3C4CA 4FIFA 4GV1A 4PL4A 5AR3A 5AR8A 4TT7A 4QPSA 1FMOE 4EL9A 3HRFA 4TNBA 4LMUA 2JLDA 4I93A 2OG8A 4EOKA 1JLUE 4QMWA 2P4IA 2WEVA 3UNZA 4FSQA 2VWWA 5HIEA 4HCVA 2HY0A 1P5EA 2HW6A 4G3FA 5B7VA 4G3DA 4YPSA 5FEQA 4EJ7A 4FKOA 2O2UA 2R3PA 3NNXA 4YJSA 2UW5A 2ETRA 4YLJA 2YM5A 2QLUA 2ZYBA 4AW5A 2WTCA 2FGIA 4KKHA 1U4DA 4Y83A 4R78A 5EQPA 3HA6A 4FG9A 4CZTA 1ZYSA 2CLQA 5IQBA 2ETKA 2WTKC 2PVNA 4QMOA 5GZ8A 3V6SA 5J9LA 2XS0A 2ZMDA 3WE4A 3W0PA 3PE2A 2R64A 5DE2A 2HXQA 3QCXA 2H34A 3KMUA 3POZA 4MD8E 3SKCA 4X3JA 4JXFA 5IQCA 3H0ZA 5CNOA 3CKWA 5FM2A 4ZEGA 4XP2A 4KB8A 4L6QA 1IRKA 4KS8A 4JRNA 2XK8A 4FSMA 4M12A 5KNJA 3ROYA 3RM6A 2C3JA 4O84A 4KKEA 3C0HA 2A27A 2YN8A 3EFJA 5JSMA 4B99A 2VRXA 4FIHA 4APPA 2E9OA 3VUTA 4UWYA 5AFVA 4LUDA 2NPQA 5BVEA 2GS7A 3L8SA 3IS5A 4DG2E 3LFFA 4NTSA 4C2VA 1R0PA 5A54A 4PPBA 3W1FA 2ZV9A 2C5XA 2ITVA 5M07A 3HMIA 4AU8A 5KE0A 3U55A 5BVKA 5CVFA 2XEYA 2Z7RA 4O81A 1OB3A 4BDCA 3NIZA 4X3FC 4A7CA 5B2LA 4HVIA 4L3JA 2PWLA 3S1HA 3FZSA 4MBLA 4HGLA 5HLNA 3FQEA 1MRVA 3UDTA 3RI1A 1UNLA 2WMXA 4A9YA 4C8BA 2AC3A 1GIIA 2UVYA 3C50A 4GUBA 3ETAA 4ANMA 2J2IB 4IC7A 1R3CA 4RJ4A 4XG6A 4I5CA 4AS0A 3P08A 3FXZA 2W17A 3ZSGA 1HOWA 4ZTHA 1MP8A 2HW7A 2BR1A 3NUXA 2P3GX 4ZY4A 4C36A 4HGTA 4EH7A 1OGYA 3C5UA 3LVPA 3OW4A 4IJPA 4RQKA 3TTIA 3CS9A 4M8TA 4PF4A 4W8EA 5HKMA 4EZ3A 2XRUA 4BICA 4WUAA 2WMTA 3D5VA 1WBWA 4C38A 4CRSA 2CCIA 1KE8A 5M08A 1JNKA 4KIPA 3G51A 2XARA 1LEZA 4KBAA 3V8SA 1JKTA 4PPCA 5FXSA 3VUDA 3ZZWA 3NGAA 3ROCA 4CV9A 4I6QA 3T3UA 3ATTA 4FV4A 4G3GA 2WXVA 2B9HA 4AA4A 4U0IA 4PDYA 2CKEA 3O5AA 3GU5A 5CU6A 5IU2A 4NYEA 2AEGA 5FTQA 2UZEA 4QMSA 2F7ZE 5CY3A 5IUIA 4ASZA 1H07A 1YVJA 3NYNA 2KTYA 4G17A 2Z2WA 2X6DA 4IDTA 4JOAA 4F9YA 5CAVA 5KMIA 4M3QA 2PSQA 1WBVA 4MVFA 4F6SA 4NL0A 5IKWA 2R3NA 2XCHA 4IVBA 3HKOA 4XP0A 3QUDA 2G1TA 4U42A 4OTFA 3FQHA 3QA8A