4DFLA

Crystal structure of spleen tyrosine kinase complexed with a sulfonamidopyrazine piperidine inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
274
structure length
263
Chain Sequence
VYLDRKLLTLEDKELGSGTVKKGYYQMVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Pyrazine-based Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 263
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dflA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dflA01
4U42A 4O81A 1I09A 3IW4A 5CY3A 3ZC6A 3PPZA 3DNDA 4PP7A 4F7SA 3F5GA 2BVAA 3P7CA 4HJOA 4B8LA 1OPKA 4IJ9A 4DGGA 2Z02A 3Q4ZA 3OT8A 2UZWE 3R63A 4PTGA 1G8SA 3JY9A 4YMJA 4L9IA 3PXZA 5BMMA 5A4CA 5CF8A 1SMHA 4I22A 3FLWA 4RIWB 4GKHA 3BLQA 4QQTA 2OFVA 3FWQA 4C8BA 4BCHA 5DVRA 3F7WA 3BU6A 3GU4A 2YM5A 5H3QA 4YU2A 2I0EA 2YIRA 3BE9A 5D7AA 5M55A 3MPAA 2GNHA 4D5KA 3HEGA 2P2IA 4CLIA 2VX1A 3PSBA 5TT7A 5AR5A 3R73A 4LGDA 5IQDA 5H2UA 2C6MA 2W7XA 2BAQA 3G9NA 4QMPA 4WNPA 2EXEA 4ZMEA 3BYSA 5LVPA 4B99A 2NNWB 3U4UA 3DCVA 3PY0A 4K2RA 5BVOA 5IEYA 1H01A 4D55A 1URCA 4EH6A 4UALA 3R9RA 2ITQA 4BCNA 3I7BA 5DE2A 3W10A 4CG8A 4DG3E 4G6OA 5CAOA 4ZZOA 3DBCA 4CKRA 4I5MA 3LLAA 4FKTA 2W96B 4M69B 3KRJA 5HORA 4OAUC 3TKIA 3R83A 5DN3A 3QXPA 3GVUA 4OLIA 4K9YA 4QP2A 1H27A 3BHTA 3LFSA 2WMXA 1ZYSA 2IZRA 3HMOA 4C38A 2R3MA 4DEHA 1H1PA 3ACJA 5I5ZA 5HX6A 2BDWA 3BBTB 3ATTA 3WZEA 3IOPA 4U3YA 4YC3A 1W7HA 5JH6A 3T3VA 3KK8A 4YZCA 3PLAE 5E90A 3QD3A 4DG2E 5DA3A 2FGIA 3MY0A 1UU7A 1XH9A 3LFCA 4X2KA 2HY0A 4U40A 4DBXA 3C4ZA 3L8PA 4FYNA 2XM9A 2DQ7X 2W5BA 3BV2A 4ZXTA 3E8NA 5FM3A 2UW5A 3R2YA 4PF4A 2ZM4A 1SVEA 3UIBA 3FY0A 4IVAA 2UZVA 4J7BA 4BCPA 2WMBA 2EXMA 3KMMA 3LOKA 4ZSJA 3GOKA 3MFRA 1KE8A 4FTQA 2J0IA 2ZV7A 3FMLA 3EKKA 3MH1A 3QRUA 3MH0A 4FSUA 5FXRA 3DTCA 5IH5A 5DNRA 5EHYA 3PY3A 3RAKA 4CFXA 5I0BA 3EIDA 2EU9A 4JG8A 3MTLA 4F70A 5K5XA 2GTNA 2P0CA 4HPUE 2C3JA 4ENXA 3E8CA 4C36A 3GC8A 1SYKA 3FKNA 4TYHB 3IOKA 1Q5KA 2O65A 2OJ9A 3K3JA 4C37A 2IPXA 2C68A 3U4WA 2W1IA 4GEOA 4L00A 4TY1A 4I1ZA 2BDFA 3UO4A 4ZP5A 3ODYX 2J6MA 3SXRA 4EOOA 2VD5A 5CXHA 3UTOA 4D0WA 3ZUVA 4KBKA 3NUAA 3VS3A 4GYGA 3TKUA 3W55A 4FKJA 3QQJA 1BL7A 3ELJA 3RBWA 4C34A 3NVMB 5DR9A 4HYSA 2UW3A 3KVWA 2WQMA 4JT3A 4CMOA 3NZ0A 4CMUA 5HNIX 5DYJA 5AP0A 3EB0A 3OXTA 4AW5A 3MSSA 2VWVA 3FXWA 3TTIA 2HIWA 1XJDA 5HIDA 5J9LA 4CKJA 1ZYCA 1H07A 3NSZA 4QMMA 4EH3A 3OW3A 3SG9A 3FAAA 3HP2A 3QZFA 4TYJA 4WO5A 4U5JA 3TWJA 4R7HA 3FQEA 3FLYA 1R1WA 4BI1A 4M97A 2GPHA 4FZ6A 4J1RA 5F1ZA 4YUQA 3OT3A 3NW5A 4O0SA 5DIAA 4Y8DA 3NUNA 3LAUA 5ACBC 4GKIA 1OPLA 4LMNA 3FE3A 1UWHA 4EWHA 2X2LA 3CTJA 2QD9A 1RW8A 2PVNA 3EL8A 3F3UA 4IWQA 3VBVA 1RE8A 4LOQA 2PVJA 4YJPA 4E26A 1GZOA 3KKVA 4Y5QA 4U8ZA 4JAJA 4ALVA 4FIEA 4YJNA 4I0TA 2O64A 5KMOA 3PY1A 1E1VA 4FV6A 4C61A 5G6VA 2E9NA 4YTHA 3WZUA 4EQMA 5DT3A 5KCVA 5LVMA 2ETKA 3TNQB 3CPCA 3OFMA 4IWOA 4A9TA 5IQHA 4DTAA 3R8PA 2FA2A 5J5TA 2PU8A 3ZSHA 3EZRA 4EBWA 4W4WA 3T9IA 3KEXA 3QTZA 4TTHB 4ZY5A 3LJ0A 3FYJX 2C4GA 1KWPA 4FIGA 4N70A 4QYYA 4RVKA 4H3BA 5LMAA 4FKVA 4BDJA 2OBJA 3FLSA 1R39A 3ULZA 4DLIA 5IDPA 4FL2A 4FMQA 3QRJA 3PSDA 4BDAA 4F6UA 4F9WA 3CE3A 4GT4A 5K5NA 4FUYA 4MWIA 4AW0A 4S2ZA 2W1GA 3MIYA 1J1CA 2A27A 1RDQE 2QOBA 2PSQA 4ZTHA 5HD4A 1RJBA 4QMUA 4UXQA 5HNBA 3R9NA 2CGWA 5L6OA 1OUYA 1XH5A 4IM2A 3HUCA 3Q5ZA 2WFYA 3OS3A 1Y8YA 3KA0A 4FX3A 1BL6A 2QQ7A 4OW8A 4BHZA 1ZYLA 4YJRA 3JS2A 4QT1A 3GQLA 3P78A 3GENA 3QRKA 3TACA 4Y85A 4CZTA 2W1EA 3GFEA 4TZRA 3W32A 2R3RA 3ZC5A 2Y6MA 4IX3A 2GU8A 3PVGA 4U43A 3ZFXA 4CYJA 3E88A 3LFBA 1WMKA 4ZY4A 4XUFA 2Y0AA 5CT0A 5E4HA 1KE9A 2JGZA 4WNMA 1SVGA 3N4TA 4ZLOA 3PWDA 4ZIMA 4G16A 4WT6A 3CEKA 3HAMA 2DUVA 3E7OA 3A7GA 3PJ2A 5DR6A 3DAJA 5HIEA 4G6NA 2BILB 3SRVB 4A9RA 4GJ3A 4DEGA 4FR4A 3C13A 5FTGA 4DH3A 5M07A 5AAFA 4I20A 4WNKA 1MP8A 4NFMA 4CT2A 3ACKA 3HMPA 4BCMA 4BZDA 4Y5HA 2YACA 4EZ5A 3W2CA 3BZ3A 1JKSA 4CFVA 4WBBB 4RFMA 3ATSA 4FSWA 3ZONA 4E20A 3F3WA 4XRJA 1YWVA 3MJ2A 3OY3A 4LUDA 5CT7A 2VTIA 3L8VA 4XG2A 2XCHA 5F20A 5HOAA 2C3IB 3P08A 4F4PA 5IMEA 2VV9A 2WELA 5L8LA 4D2SA 4FGRA 2YJRA 5AV2A 3KRLA 3KRXA 2W99B 5DRBA 3NIEA 3QLGA 1OI9A 4MX9A 4DH7A 1O6KA 1QMZA 2IN6A 3ZLXA 1GZKA 2UW8A 4I6BA 3W2QA 4TWOA 3DAKA 2IZUA 5LCJA 1UNHA 3QKMA 3V5TA 3KXHA 5FWKK 4YLJA 3DGKA 4FZAB 5I9ZA 5KKRC 3LW0A 4Q5EA 3P9JA 4W8EA 2YM8A 4Q5HA 5HCYA 3DK7A 2C0IA 2VTOA 2UZEA 4M69A 3D5UA 3ZYAA 4CTBA 2C6KA 2X2MA 3UIXA 5G1XA 3HRFA 1T46A 4V05A 4RJ6A 4PL3A 5C27A 2C1BA 3I6WA 3JXWA 4TKSA 3DBDA 3DKCA 4N57A 5CAVA 3BGQA 3TNIA 5B2LA 1AGWA 3QQHA 5CNNA 1NXKA 3MW1A 3O8PA 3OBGA 1YOLA 3QGWA 2J90A 4GMYA 2QONA 2PTKA 4E4LA 5HTIA 3R8ZA 1YOJA 4I6HA 4EHZA 5L2TA 3ZSIA 4MD9E 3IO7A 4OT5A 3ZEWA 4II5A 5AAGA 5JN2A 4ZTLA 5L2QA 2CJMA 4FV1A 4O2ZA 1BX6A 5CSVA 1OPJA 2XNNA 3U8WA 4J53A 4D2RA 3O50A 3OP5A 4MHAA 3UVQA 4DG0E 4O0TA 1GZ8A 2F4JA 4IX4A 2CKEA 4BI0A 4O7ZA 2YAKA 3QHWA 5DLSA 5ETIA 3HYHA 4IDVA 3FSKA 3DOGA 4W4YA 2UZBA 2X2KA 5D9HA 1YRPA 3O8TA 4YR8A 4JG6A 3AC8A 4K33A 5CAUA 4I93A 3T8OA 2XIXA 4JR3A 1PJKA 2G9XA 1OL7A 3D7TA 1PXOA 1JKTA 4JOAA 4OTFA 3QHRA 5HLPA 5E9EA 4MQ2A 4EHGA 1QPDA 4M67A 3QCQA 4RWLA 3RNIA 1E1XA 5K4JA 4KD1A 2G1TA 3HX4A 2WNTA 2A2AA 3BIZA 2WPAA 4QQJA 4B8MA 4ORKA 4AW2A 2UZLA 2WMTA 5K4IA 3OCSA 1OL5A 4ZAUA 2BRBA 5HG5A 5E8UA 3UP7A 3H9OA 2ITZA 4DH8A 3R8LA 2XF0A 5EI2A 4ZK5A 4ARKA 2YFXA 4WG3A 3NX8A 3WE8A 4ACMA 4AT5A 5CU2A 1SNUA 3HVCA 3RPSA 4AZEA 3WBLA 5LMKC 1W84A 5M4FA 3DKFA 4NWMA 2CKOA 3DS6A 4L46A 5D12A 4I41A 3PZHA 2YEXA 3LXKA 3RNYA 2X39A 5IG1A 5CSXA 2BZIB 4X2JA 5JMSA 4IFGA 1OZ1A 3RCJA 3VWAA 3F7ZA 3W16A 3WI6A 2PMNX 4X2NA 1VR2A 2RL5A 3OTUA 2H34A 2BTRA 4Y72A 4ZJJA 5ANOA 3WZJA 2Y4IB 5E8ZA 2XVDA 4KWPA 5AM6A 5AA9A 3VS2A 4NM3A 3H30A 4ZLZA 3R7EA 4TRLA 3E8DA 3KFAA 3I5NA 5EYDA 4D28A 4KUJA 4RQKA 5I3OA 4O83A 4UWCA 3QC4A 1XBBA 3ZS5A 3NUUA 4JBPA 4F6SA 2QO2A 3CY3A 4TWCA 3FPQA 3EOCA 3LMIA 1LR4A 4XOYA 2BRNA 5A4TA 2ONLC 4C4IA 4LRKA 3RZBA 5F9EA 1J3HA 3AXWA 4C4FA 3C7QA 5DPVA 2UW0A 1FVTA 3HL7A 4J98A 4HVHA 3QRIA 3FDNA 3MB6A 4RIOA 2FYSA 4XRLA 4XCUA 2XRWA 5C8KA 1WVWA 5M08A 3Q4TA 1PXIA 4MNFA 4MWHA 4FKGA 4PP9A 4W9XA 5EDRA 4MXZA 1OKWA 4YBJA 2PUPA 4HGLA 3F2RA 2WQEA 3F82A 3MN3A 1M14A 4J8NA 3TV7A 4HW7A 5IU2A 1URWA 1MRUA 4YZ9A 5IKWA 1RQQA 4MBIA 4O27B 3AC5A 3CQUA 3DZOA 3HECA 3QUDA 3R7GA 4RA5A 3OC1A 1SNXA 3LXPA 4ITJA 2IVTA 2WQBA 2O0UA 4Y95A 1X8BA 2HXQA 1NVQA 4NFNA 4EKLA 4WHZA 1A48A 2R3HA 3VW6A 5D1JA 4GSBA 2GDOA 3VF9A 4QMQA 5A14A 4DGOA 3R1QA 4WUAA 5HCXA 4FG8A 1J7UA 5J5SA 4FT7A 5EK7A 5CX9A 1PXPA 4BC6A 5GIOE 3ORNA 5JGDA 4EOKA 5CSWA 4YJTA 3ORXA 2C5OA 5L2IA 3SA0A 1TVOA 3ODZX 4NUSA 3D5WA 3E93A 4WOVA 2YCFA 4ANLA 2OXYA 5C4KA 4UMQA 4CTCA 2GNFA 4YGAA 3RK9A 3FL4A 3TZ9A 4AA5A 4FTUA 4Z7HA 4J99A 2BAKA 5AX9A 2UZTA 4H36A 4QPAA 1YDTE 4UN0C 2C1AA 1GIJA 3I1AA 3DKGA 3RAHA 4MNEA 4DFUA 3PJCA 3KMWA 4AZSA 4FKWA 5FLFA 4MEDA 4IJPA 3FXXA 5EW9A 2J4ZA 1ZYDA 5AUTA 1LUFA 3OWPA 2CGUA 5HNGA 5CNOA 3MTFA 3BU3A 5HHWA 3SOCA 2CLXA 4B4LA 3VJOA 1OL1A 2VWWA 3MVHA 2R0UA 2IZTA 3RHXA 2ZVAA 3QXOA 4EOIA 3P86A 3MA6A 3U9CA 5EM7A 2Z7LA 4JX3A 2WMSA 1TQIA 4D4SA 4LMUA 3S3IA 4EONA 2BIYA 4EH8A 1DI8A 4DN5A 2BRHA 1H26A 4X3FC 2W1DA 3KMUA 4H3PA 3LPBA 4DGLC 2IG7A 2HY81 4RA4A 1BKXA 3IW7A 3PE1A 5L6WL 4BICA 3C4EA 1OUKA 2B7AA 1VZOA 2C6EA 3R7VA 5BYYA 5IA2A 3V5LA 2F7ZE 2ZMDA 3KN6A 3TJCA 3VBTA 3DK3A 4YHJA 1U54B 3WARA 5K0KA 3O96A 2WQNA 3ORIA 1XO2B 1YXVA 3A8XA 3NAXA 4BIDA 4C4HA 5C4LA 3TDWA 3TIYA 3LHJA 3NVKI 5FDPA 2CNVA 1DS5A 3V3VA 3D9VA 4KIQA 3RM6A 3UNKA 3AT2A 4N0SA 3ZBXA 2WMRA 3BHYA 1Q97A 4MKCA 4W8DA 3UYTA 2ITNA 4APPA 4PMMA 3R7OA 2WIPA 5IQBA 4O86A 3V5PA 4L68A 4DEEA 4I4FA 4C2WA 1E9HA 5TF9A 5DHJA 2PUUA 3F69A 4U45A 4ANQA 1W82A 1P5EA 4TNDA 1V0PA 4WNOA 3COMA 4PPCA 2Y9QA 1YI4A 1F5QA 1ZARA 4AWIA 2R2PA 5AX3A 5AFVA 3BE2A 4O22A 4LOOA 4D2TA 4K0YA 4YBKA 2E9VA 1Y6AA 5J9ZA 2RFDA 3AGLA 4TL0A 3G9LX 3ZXZA 1XHAA 2A1AB 4MXXA 1F0QA 4QP3A 4AF3A 4BRXA 4L3JA 2W5AA 3PJ3A 3P7AA 3QQLA 4TYEA 4O1PA 3VBWA 4XHKB 4JLCA 1G3NA 5KMIA 5IDNA 1PXLA 4DFXE 5BQ0A 3S1HA 3BHUA 4YURA 3C0IA 4FT9A 4O7YA 2YIXA 2YM7A 4CKIA 4AX8A 4D5HA 4PNIA 4FG9A 5GHVA 3W2RA 4TPTA 1H28A 1OKZA 4NCTA 3DXNA 2CMWA 4MK0A 4QP9A 4HPTE 3UZRA 4G34A 4QYHA 4RPVA 5E8XA 5H9BA 5KMJA 2O3PA 4ZS4A 3M11A 4AZTA 5EFQA 2X9FA 3GT8A 5AA8A 4EH5A 1M52A 1WBSA 3QF9A 2OXDA 4QTBA 1PKDA 2BMCA 2XYNA 4M7IA 5HE1A 3WIGA 4I23A 5LMBA 2O63A 3IQ7A 4U81A 1LP4A 4L44A 4C3PA 3ORMA 1P2AA 4A9YA 4GL9A 4TWPA 1MRVA 4ANNA 3V8TA 3ZMMA 4HOKA 3CJGA 5IEVA 3EN7A 2IVSA 2GNJA 3MIAA 3OUKA 5AM7A 4DT9A 1U5RA 3N4UA 2A4LA 2OIQA 5HU3A 1ZOGA 2ZMCA 2F9GA 2VX3A 3COIA 3SXSA 4QMVA 3LFFA 3FZPA 2VAGA 5CVGA 3VRZA 3W1FA 2QURA 3OCGA 4RJ4A 3R8UA 3IONA 4R5YA 3DU8A 4U97A 3C5UA 3AMYA 2R5TA 4ZOGA 3IW6A 4BZNA 3IK3A 1OIUA 5HICA 5A4LA 2WTCA 2G2IA 2H96A 1Z9XA 2VWUA 2E9UA 4G17A 2I6LA 3GBZA 4YO4A 1CTPE 1UVRA 2YWPA 3SG8A 4PDSA 1OIQA 3FQSA 4E7WA 4BL1A 4Z55A 1G5SA 1CM8A 2KULA 4Q2AA 5I9XA 1LEZA 2VTJA 3SXFA 3THBA 3PDTA 1PF8A 1YXXA 2PZ5A 3CXWA 3CLYA 4MXAA 5AR8A 2LGCA 3KXNA 2ITVA 4JDKA 4CMTA 3Q04A 4YLLA 4EK6A 3EQBA 1EH4A 3NS9A 4GH2A 4NJDA 3PA5A 3SOAA 3TZ8A 4M66A 4ANOA 4Z16A 4B7TA 5C26A 3PG1A 3U6JA 2JIIA 4EI4A 4QQ5A 1MUOA 4KBAA 3IS5A 2V62A 4ACHA 2XKFA 4MD8E 2X6DA 2BAJA 3R04A 4L67A 5J79A 4LV8A 3FBVA 3LXNA 2RKUA 3QUEA 4YPSA 5HZNA 3QCSA 4JBVA 4LYNA 2WXVA 2EWAA 2G01A 4I92A 4FA2A 4X3FB 3F6XA 4JR7A 4NH1A 5HE0A 5K9IA 4V0GB 4CV9A 3BHHA 2WZJA 5EHLA 5CEPA 4UMUA 4R8QA 2FB8A 2R3OA 3U51A 1R0EA 3B2TA 1A06A 1UV5A 4IM0A 5HLNA 1CDKA 3W2SA 3SGCA 5AEPA 2C5NA 4I0RA 4P5QA 4FGBA 3QQKA 3V51A 4XNEA 5IA0A 5M06A 3NRMA 2OKRA 1ZXEA 3QD0A 3TT0A 2FSMX 4YZDA 5AV0A 4DH5A 3B8QA 3POOA 5HVJA 3DT1A 3TV6A 2PULA 5EKOA 1OVEA 4L52A 4LRMA 5ANEA 3O0GA 5T6KA 2XK8A 3VUHA 4ONAA 2ZYBA 3VVHA 5IZFA 5M51A 1J7IA 2UUEA 3P1AA 2YIYA 5KMNA 3QTUA 4FOCA 2J2IB 4TW9A 3VNTA 4F0FA 3GOPA 3QC9A 4O6LA 1AD5A 4OTQA 4G9RA 3TDVA 1B6CB 2VWYA 3BQRA 4K77A 3AD4A 2PZRA 2XZSA 3P7BA 3BI6A 1JKLA 3NNVA 1ATPE 1REJA 3PXKA 4BCKA 4EH4A 4F9CA 5KMMA 4JXFA 4BVUA 4G9CA 3EN9A 4G2FA 1K2PA 3JPVA 2XKCA 3UNJA 1YDSE 4QMZA 5E8SA 2EUFB 4CEGA 4EOMA 4D2VA 5AIKA 4YO6A 1WBVA 4O0UA 3ZRMA 3RP9A 5CAQA 4NU1A 2PUIA 2UZOA 4E6QA 4HCVA 4WD5A 4QP1A 3HV7A 4Q9SA 3HV4A 2Q83A 2R7BA 3NYOA 2B9FA 3BYUA 3TNPC 3K54A 4D9TA 4F7NA 2BIKB 3F5XA 5DT0A 4RQVA 4DCEA 3FLZA 3CPBA 1LPUA 1OIYA 2IO6A 1U54A 3QQFA 4HYUA 3UIMA 5A9UA 4YJOA 2V7AA 4QYFA 4JDIA 4DT8A 2DS1A 5LMKA 3MYGA 4RJ3A 2WGJA 4FVRA 4OTGA 3I5ZA 4CD0A 4XG7A 1BI7A 2PZPA 4FNWA 2CN8A 4PNKA 3QA8A 4IB1A 2E9OA 4CNHA 5KO1A 3FYKX 4JBOA 3HNGA 4AAAA 3EFJA 2DWBA 4YHFA 3FMMA 4XP3A 3V6SA 4I0SA 2WMQA 3F3ZA 1Y6BA 1IA8A 4HCTA 5A6OA 3H4JA 5CANA 2CCHA 2F2CB 3HDMA 3TUDA 3E7VA 4RIXA 4L7SA 5FGKA 3VC4A 1JNKA 4CYIA 1YQJA 3EYGA 4E8AA 4USDA 4DINA 1PKGA 4ZMFA 2PVMA 4EOPA 3IDPA 3Q96A 4AZWA 3UIUA 2OJFE 3RPRA 3H3CA 3FZOA 4AE6A 1UKHA 2WU7A 4IVDA 4EH2A 3ID6C 4O7WA 2YCQA 3R6XA 4P4CA 2R3LA 5IUGA 1Q4LA 2UZUE 1IEPA 2ONLA 3UBDA 4PDOA 4R3PA 5FBOA 2GHMA 3E5AA 4QP4A 4UYAA 3N51A 2OZOA 3TNHA 3LFNA 5J1VA 1ZY4A 5BYLA 3C4CA 1HCLA 4PUZA 2QCSA 5CEIA 3Q5IA 2CN5A 3AC1A 3LJ2A 3BBWA 5FD2A 2XNBA 2ZDUA 3KN5A 2ZB0A 4AT4A 4RVLA 5LWMA 2JC6A 4YNEA 3TUCA 1OMWA 3HRBA 4GFOA 3BV3A 3HV6A 5EOBA 4JBQA 3HMMA 1XWSA 4B9DA 4H05A 4E3CA 2QO9A 3UPXA 4YZBA 5JKGA 4EYJA 3RM7A 3G6HA 4C62A 1J1BA 2QLUA 4PTCA 1BYGA 1FMOE 2P4IA 4PMSA 3RINA 3VAPA 4JQ8A 4BB4A 2XKEA 2HZ0A 4PV0A 3AOXA 4E73A 4J8MA 3EQRA 4RJ5A 1JWHA 4O91A 5EHOA 3UE4A 4BKYA 3F2NA 4GT3A 5KX8A 4OT6A 3UO6A 4BCFA 1F3MC 5LCKA 4ACGA 3PJ1A 3G15A 1YI3A 3AC3A 5BMSA 4G3CA 3I0QA 5LVOA 4FEWA 4QMWA 3GU5A 3LE6A 3ZZWA 2XK3A 3BPRA 3MBLA 3NYVA 4FSMA 5EDPA 3QU0A 2XIKA 4FODA 5IQEA 4BGQA 1U4DA 3GUBA 4FIHA 2QOKA 4C7TA 3N4VA 4YHTA 4FIIA 4KIKB 2G15A 2HCKA 5IUHA 4V04A 4XYFA 5JFSA 4DCAA 4BN1A 2J0MB 4X6RA 1KE5A 4YLKA 4O7TA 4F9BA 2PE1A 2RFEA 3R00A 4JQ7A 5HLWA 3NNUA 5CQWA 4M3QA 4NSTA 4K1BA 4P7EA 2UZNA 5F94A 3MB7A 3ZTXA 3PRIA 3R1YA 2WMAA 3TCPA 3C5IA 4J97A 4RVTA 2Y4IC 1H0VA 3DBQA 3GXLA 3FMKA 3QX2A 5DG5A 2VO6A 1R3CA 2EXCX 5EH0A 4EL9A 4CCBA 2PVYA 3SHEA 3Q2JA 3Q9YA 5A4EA 2RF9A 2ITUA 5BYZA 3GC7A 2IVVA 4ZTSA 4BDDA 2VRXA 2XH5A 2GQGA 4FSTA 4JX7A 3SW4A 1FVRA 4F1OA 3S2PA 4FYOA 3F61A 3DJ5A 4PQNA 4CFUA 3TG1A 4DLJA 2AUHA 3WF6A 1FVVA 3LFAA 3LMGA 1WCCA 3KF7A 4RX8A 4ZSEA 5C8MA 4EH9A 1OGUA 1Y91A 1REKA 4GCJA 4RIWA 4PPBA 2PK9A 3UYSA 2G2FA 3FY2A 2QOFA 3L8SA 5AADA 5B2MA 2VN9A 3QRTA 2YLEA 4DFNA 2C5YA 4YPDA 1WZYA 4MVFA 4H3QA 5CLPA 3ZSGA 4F0GA 5EM6A 1M2QA 2OIDA 3FI4A 3LVPA 4U44A 2C0TA 5GJFA 3FPMA 4EEVA 5BVWA 5IQAA 1XBAA 4E5AX 1O6LA 3S95A 2X9EA 5FXSA 3MH3A 4ITHA 4IM3A 5FQDC 4DITA 3VS1A 5GJGA 4F7LA 2JBOA 2VTRA 3ZM9A 2R7IA 3NCGA 4RIYB 1YWNA 3KXMA 2C47A 4BHNA 5FEEA 5DH3A 4AN9A 2VNWA 3OROA 4HGSA 2WU6A 3D14A 2AYPA 4OTHA 4ZTQA 2W1HA 5JT2A 4E4NA 4L7FA 4O0VA 5AMNA 3A7JA 3Q2MA 3TXOA 4DAWA 2VTMA 2OSCA 5BVNA 3A8WA 4EC9A 5TKDA 1S9IA 1W83A 4NW5A 2UW9A 4O7VA 3WIKA 4RWIA 3FMHA 3P23A 4RG0A 3V01A 3QX4A 3ZRLA 4QMXA 1H4LA 3KK9A 3V8WA 3D2KA 3TV4A 2Z7RA 3R8MA 4XG6A 3NEWA 4ZLYA 4C3FA 2QO7A 5AP1A 1ZRZA 4IB3A 3NUSA 3O71A 2BPMA 2PMLX 3P0MA 4YSMA 4ZSGA 5GNKA 3RZFA 4FT3A 2XNOA 3NMUF 3OXZA 4QP8A 4RBLA 2FVDA 3UC3A 2UVYA 4OTRA 3CKXA 3GCSA 3L9LA 3IW5A 3Q53A 5C03A 4FKUA 3PA3A 4D4VA 3EQGA 3RWQA 3DDPA 5HG7A 4FV5A 4EC8A 3R9HA 5H8BA 1GZNA 4IAYA 4PL4A 5FUTA 4NM0A 3KC3A 5IF1A 1FOTA 1YXUA 1OITA 4I94A 2OLCA 1GNGA 3DLZA 5A4QA 5EDQA 2W17A 2J5EA 3VQHA 1OIRA 5E1EA 4QO9A 4BR3A 3O51A 3SVVA 5E8VA 3ET7A 1Q8TA 4G6LA 1STCE 4GU6A 4R3RA 3ZDUA 2BHHA 1IRKA 2YM6A 3K3IA 4DEIA 4GRBA 5I9UA 4M13A 4TYHA 4APCA 3LM0A 2PVFA 3POZA 4OTPA 2QC6A 4U6RA 4RSSA 3HZTA 5IUIA 4H58A 4QMTA 4RFZA 5C8NA 3HV5A 3BEGA 2F7XE 3FKLA 4RZVA 5FEQA 3OTVA 4IACA 4IWPA 2HXLA 4O21A 2PMOX 4I4EA 4JNWA 3ZEPA 4BBEA 2WEVA 4TWNA 4BIEA 4OUCA 4IAZA 4C59A 3D4QA 4CFMA 4XEYA 3A7IA 3RK5A 5I3RA 4LQMA 2ZAZA 4QTCA 3A4PA 4UWBA 4WG5A 3M42A 3FL5A 2ESMA 2PZYA 4XP0A 3TL8A 4BF2A 3OXIA 3PIXA 4XG9A 3QUPA 3V04A 2RG5A 3DQXA 2O8YA 3G0EA 3ZO1A 2I0VA 5JGBA 4JI9A 4WSYA 1Q62A 3QTXA 1PXKA 4HYIA 4E1ZA 2YISA 1Q24A 2PWLA 3G33A 4F09A 3OHTA 1H0WA 2XA4A 1GAGA 1G8AA 3I60A 4FV8A 4U9AA 4BCIA 4AZFA 2RFSA 4FZ7A 2J0JA 4DHFA 4E5BA 4FKQA 2OICA 4CFFA 4RC3A 2VTSA 3F88A 3RGFA 3QBNA 3WILA 4C4EA 4M12A 4LFIA 4QYGA 5L3AA 1QPCA 4WBOA 4ASZA 5IQCA 4CRSA 3PYYA 3NWWA 4ACCA 5IA4A 2R3FA 4DTBA 3FLNC 4JJRA 2CLQA 2I7QA 1SZMA 4RX9A 3ITZA 5M4CA 3HA8A 4R77A 3Q4UA 2ITWA 3R02A 3OBJA 3GCPA 2CDZA 5BUEA 3W8QA 1XH8A 1XKKA 3G6GA 4NM5A 4F63A 5CI7A 4IAKA 1FGIA 3A7FA 1PYXA 2HELA 3VS5A 1KV1A 2EB2A 4J52A 4KINA 4FSNA 3L9PA 2A19B 4BKJA 2JLDA 3KXXA 5LARA 2XM8A 3FZ1A 4EJNA 1Y57A 2GS7A 2PY3A 5F4NA 3ZLWA 4OTWA 3UNZA 5KBQA 3FI3A 5H8EA 4F6WA 1PMEA 4R3CA 3EQPA 4LOPA 3FXZA 5CU0A 4R7BA 4NTTA 4G5PA 2R3NA 3FI2A 3NR9A 5AIRA 4XOZA 5LVLA 3T3UA 4PMPA 2CNQA 3U54A 2W4JA 4TT7A 4XMOA 3MPTA 4PMTA 2X4FA 5L6PA 3S0OA 4YTIA 2WTVA 3QA0A 2JEDA 1MQ4A 1R78A 2XK9A 4CQGA 2XIYA 4UY9A 2J0KA 2C5XA 4M15A 2HW6A 1P14A 3LMHA 4MBJA 3JUHA 4O1OA 2Z2WA 4IE9A 3F3TA 4C0TA 4XV1A 5I9WA 3GI3A 2QHMA 3QYZA 4S31A 2BZJA 5J87A 3VULA 3PP0A 3CD3A 4FTNA 4QQCA 4CFWA 4UZDA 2GS6A 5CSPA 4V01A 5EI6A 3KVXA 4YTCA 5AV3A 3TNWA 4BWPA 5KE0A 3PTGA 4U79A 2FO0A 3GCQA 3VUTA 5CXZA 3UQFA 2QOIA 3MPMA 3Q9XA 5T68A 2OZAB 2PUNA 2I0YA 3LQ3A 3MH2A 5JFWA 5HO7A 2Q0NA 4JIKA 1WBWA 3C1XA 1J7LA 4EOSA 5A54A 2XRUA 2RG6A 4GUBA 2YZAA 1SVHA 5B0XA 1OL6A 5CU6A 3ZUTA 4B0GA 3PVWA 1GY3A 4GVAA 3SRVA 1CMKE 3LFQA 4AGDA 4RX5A 5GZ8A 4GVJA 1B39A 1Q8UA 2VGPA 5HGIA 2OJIA 2BRMA 4O84A 1JPAA 1QL6A 4ZTMA 3ANQA 4GU9A 1DAWA 5DFPA 3TZ7A 5JFVA 3WF9A 3R71A 1IG1A 2W5HA 4QMNA 2QR8A 4CVAA 3JYAA 3LCDA 2P2HA 4GG5A 3I7CA 3LFDA 3FZRA 4IANA 4IZAA 4PDPA 1YXTA 2GSFA 5DEYA 5HE3A 5JSMA 3RCDA 2CPKE 3QZGA 4D2PA 3W2PA 4LRJA 4QMOA 3GP0A 3DK6A 3ORPA 4DEDA 3BEAA 4BYJA 5AUUA 2DYLA 4EH7A 3FHIA 4FKIA 2OGVA 4FNYA 4YSJA 5L4QA 2R3IA 4AGWA 1UKIA 3ZBFA 3DV3A 5BX0A 5IH6A 1TKIA 2UZDA 5EYCA 3CR0A 4RC2A 4A07A 3CIKA 4EZ3A 4X6QC 3S4QA 1OM1A 4OBQA 3DB6A 2C3KA 1VEBA 2JKQA 4BCOA 4O0WA 1H1RA 4ACDA 5TR6A 5CASA 3FEGA 4C02A 4IXPA 1OBDA 4I5CA 5KUPA 4OTDA 4JRNA 4HZRA 2H6DA 4L43A 3B2WA 3Q32A 3RVGA 2OXXA 2WTIA 4QTAA 4RT7A 4R5SA 4WG4A 2QOQA 3F3VA 2YWVA 3A62A 2A0CX 4M84A 3EQDA 2CKQA 4ASDA 3PXRA 1ZWSA 4WIHA 4XS2A 4ERKA 4XG3A 5BVDA 2XJ2A 4R7IA 2YDKA 3C0HA 3ENMA 4O0XA 5HBJA 1IA9A 4BDKA 1UA2A 2CNUA 3U55A 4Y46A 1JSUA 2QU5A 4A4LA 4NYEA 3O23A 3AT4A 4KS7A 5E8TA 4FIJA 3COHA 3ZO2A 1MRYA 4W4XA 5IISA 2C6DA 5ANJA 3UDBA 5IMXA 2YIWA 4FKLA 5CZIA 3DB8A 4A4OA 2YM3A 4GW8A 4EBVA 2I40A 5LVNA 3C4WA 5IA1A 4QMYA 3PWYA 1FMKA 3VF8A 4HGEA 2JDOA 3AMAA 2ZM3A 3ZM4A 2PHKA 3DDQA 3I81A 4FTJA 3BLRA 4XP2A 3EFKA 4O7NA 4G1WA 3ZH8A 4DYMA 3L8XA 3QL8A 2QNJA 4I3ZA 5DWRA 4AUAA 5KMLA 4FSRA 3EKNA 2YAAA 4IX5A 4PRJA 4X0MA 2VTPA 4MYGA 1TQPA 3ZFMA 3QQUA 4L45A 3FZTA 4C3RA 4F9YA 3UGCA 1ZZLA 3FI8A 3G90X 3I0OA 2NRUA 1XR1A 2B9JA 4K18A 4DTKA 1YKRA 3FKOA 1U5QA 2UVZA 2W9FB 4FV4A 2WTWA 4KIOA 3V6RA 2V0DA 3E8EA 5JQ5A 3MGYA 3EWHA 4HNFA 1IASA 4WUNA 1ERKA 2Z8CA 5D7VA 4QTEA 4NKAA 4NL0A 4LGHA 2OG8A 4D1ZA 4MQ1A 1GOLA 2YJSA 2C30A 2OH4A 3EH9A 3V5QA 2V5QA 2VUWA 4KB8A 2BDJA 2XEZA 4PY1A 4OTIA 2OWBA 3CKWA 4HVSA 3R7IA 2W06A 3QKLA 2BTSA 2HWPA 3DNEA 2WO6A 3PP1A 4FVPA 3UPZA 5AUVA 4F9AA 3L9MA 4E4XA 5L8JA 4YZNA 2LAVA 4EOQA 5M53A 5JZNA 3AT3A 2WOTA 4TYGA 4NTSA 3FV8A 4ZJIA 2XJ1A 3CQEA 1M2RA 5ANIA 5DGZA 5T3QA 2GNIA 5CU3A 5IPJA 3F2AA 5KZ0A 1B38A 1VJYA 2GNLA 2XIRA 2I1MA 3MV5A 2G2HA 2HENA 4UXLA 5ETCA 4BTMA 3UOJA 4DE4A 4WRSA 2XCKA 3DAEA 4QMSA 2XUUA 2X8IA 5CZHA 2WTKC 3OF0A 3NNWA 3NAYA 1WVXA 3F5PA 3BHVA 4BI2A 3EMGA 4YJUA 2ETRA 3OWJA 4YJVA 5HG9A 3TI1A 2W4KA 4CXAA 4EWQA 4P2KA 1Q3DA 2OU7A 5HO8A 4E6DA 5J95A 4AA0A 3EN4A 3FC2A 3LIJA 2UW7A 3OCTA 4HZSA 4PPAA 1P4OA 2SRCA 3UJGA 4FTIA 2NO3A 2P3GX 5E8YA 2QOOA 4X7QA 4XLVA 2CGVA 4NEUA 4HGTA 1ZLTA 4JDHA 4Y73A 3RALA 3IKAA 3CGFA 3KY2A 4EOLA 4XLIA 4BDIA 3LCTA 3A61A 3KXZA 3RK7A 4A9SA 3BQCA 1S9JA 3LJ1A 3M2WA 3MS9A 5FP5A 2PE0A 3CC6A 3M1SA 5AUWA 2PL0A 2XKDA 4KKHA 5AP7A 3UZPA 4AE9A 2B1PA 4I5PA 3CJFA 3PZEA 1M7QA 4ZEGA 3FMDA 3LLTA 1NVRA 3A60A 4PTEA 4W4VA 1YHVA 4D2WA 1WBNA 3SX9A 4YC8A 1JSVA 3H10A 4GYIA 5EG3A 4FV2A 1YW2A 2HW7A 1L8TA 4YZMA 2C6OA 3MFUA 4FSQA 4JL9A 1A9UA 3EL7A 3UOLA 3NUXA 4NIFB 3RPYA 5C1QB 5AP6A 3TUBA 4BKZA 2BKKA 3SD0A 4JQEA 4EORA 3TJDA 3ZHPC 5FP6A 2Y7JA 4QP7A 4FTLA 3LCKA 4LL5A 3WYXA 4N6ZA 5DEWA 5JEBA 4DEBA 1Z57A 3R2BA 3SKCA 2JAMA 3P4KA 2BFXA 3BRBA 4FTOA 5FRIA 2JKOA 3KQ7A 2WEIA 3NW7A 3ZO3A 4B6LA 4FIFA 2GQRA 2WIHA 1DI9A 1YWRA 2AC5A 2REIA 4GFMA 5AR7A 5CENA 3VS7A 2C3LA 2VGOA 3N9XA 5BUJA 1VYWA 4F65A 3S00A 3MESA 3KXGA 1CKPA 3IW8A 3MWUA 2VO0A 3D94A 4F0IA 4HNIA 3ZUUA 3IG7A 3MI9A 5KMKA 3GCUA 2RGPA 1JLUE 2GTMA 2UW6A 4HYHA 4IX6A 2XEYA 3A99A 5FTOA 3VRYA 4D9UA 4EHEA 5JRQA 3FZSA 3E3BX 2RFNA 4RWJA 4FV3A 4ITIA 2VWIA 4USFA 2GNGA 3LCOA 5CWZA 2GFCA 3FUPA 3OOGA 2BZHB 4DFZE 4PX6A 3GU6A 1M17A 2W0JA 1L3RE 5BVKA 2WOUA 4ANMA 3D7ZA 3LCSA 4X2GA 4D1SA 2Q0BA 5FDXA 4X3JA 4G3DA 4FTAA 2IW6A 1UWJA 3E92A 4FEQA 4FVQA 4IVBA 2J9MA 4ZZMA 4AA4A 2CSNA 4BCQA 3DKOA 3SQQA 5HTCA 4KRDA 3QZIA 2GFSA 2F2UA 2QG5A 2ZDTA 1BUHA 4D58A 4C58A 2QVSE 4QMLA 1Z5MA 4UX9A 2OH0E 1T45A 4DEAA 1UU8A 4GK2A 4MAOA 1FPUA 3KF4A 2X1NA 3NUYA 4AXAA 3E63A 5KHWA 3DBFA 3CBLA 5CQUA 3PXYA 1WVYA 3VUIA 4ZZNA 3QD4A 4IZ7A 2HYYA 5CEOA 1JKKA 5C9CA 4AQCA 3OEZA 5D41A 4EUTA 2BUJA 3R1NA 4P5ZA 1Q8WA 5EW3A 3WF5A 3PFQA 2HZNA 2R3QA 3LXLA 3VIDA 4CV8A 2VTHA 4I6QA 4CFNA 4GIHA 4DGMA 2NRYA 3FMJA 4OR5A 3UVPA 3OUNB 3NDMA 5AAEA 3KU2A 4XBRA 2R4BA 5CVFA 3AC4A 4IADA 1JBPE 3OCBA 2E2BA 1WBTA 2P33A 3FSFA 4F64A 2YDJA 5F95A 4C4GA 5AR3A 2ITPA 3R8VA 3D0EA 4FV9A 4L3PA 5AV1A 4R6VA 3D15A 4D4YA 2QU6A 2GHLA 3QTQA 3VO3A 3EFLA 3QCYA 2VWXA 2ZV9A 3O7LD 2XBAA 3RI1A 5HQ0A 3BCEA 3HUBA 3O17A 3ENHA 3WE4A 2R3JA 3E64A 4FSYA 4IEBA 4LL0A 3GB2A 2WTKB 3QD2B 4YC6A 3R9DA 4HVDA 1U46A 1Q8YA 1HCKA 2YDIA 3BELA 2WTDA 3DA6A 3JVRA 3QZHA 4IQ6A 2F57A 4R1YA 4WRGA 2VO3A 5E91A 5EYKA 3QQGA 5AP4A 2J0LA 2JITA 5CF6A 2X6EA 4G5JA 1OKVA 2W4OA 3DY7A 3ULIA 4RWKA 4PDYA 3R22A 4CZUA 3EFWA 3KCFA 3D7TB 4ZSLA 4XV3A 1W0XC 1UU3A 4NK9A 1ZZ2A 4AT3A 4IAIA 4IH8A 2ITOA 1K9AA 4XX9A 2XNEA 2BHEA 5CI6A 1LEWA 5FXQA 4EK8A 4XJ0A 2XS0A 4E93A 2PVLA 3TEIA 5LJJA 1H1QA 3I4BA 5BVEA 5KNJA 4X21A 5CSHA 2R9SA 5J7HA 5M4IA 4FK3A 4MF0A 4C57A 4PL5A 1FGKA 3MJ1A 4F7JA 4GT5A 4O0RA 4OBOA 3R01A 1UU9A 2PE2A 4XG4A 3VS6A 3JY0A 4NM7A 2R64A 3U87A 3HP5A 3RPVA 1PMUA 3U9NA 5EW8A 3QKKA 2IW9A 4Q9ZA 3A2CA 5HE2A 3VBQA 3VUKA 1YHSA 5JK3A 1WBOA 4FNZA 4FV0A 5KHXA 5LXMA 1ZMUA 1DM2A 3BYVA 4L8MA 2CKPA 2WB8A 1PHKA 1QPEA 3SC1A 4RMZA 5AJQA 1O6YA 5IEXA 5DT4A 5M09A 4BBFA 4UEUA 1M2PA 2VZ6A 2ACXA 5DMZA 4QPSA 1YVJA 4AOTA 4I6FA 4UMTA 3BYMA 3PA4A 5H8GA 5J9YA 3QTIA 4DA5A 1OL2A 2HZIA 5BNJA 3QFVA 3KB7A 2XMYA 1H00A 1Q41A 4L3LA 1ND4A 3NCZA 3E62A 2X7FA 4ZS0A 2WAJA 2B55A 2QOHA 2FUMA 3EJ1A 2X7GA 2XBJA 4KABA 4AFEA 1H24A 2QOCA 4MXYA 2IVUA 2RIOA 4H39A 4MF1A 4JRVA 3NLBA 5HESA 4EQCA 1VYZA 4TXCA 3ZO4A 3PLSA 4IIRA 2PMIA 3W33A 4BCGA 3PPJA 4O7SA 5TE0A 4DFLA 2VO7A 5JGAA 3PJ8A 5HTBA 4H1JA 1XH6A 4KA3A 2ZJWA 2C5VA 4BWKA 4CT1A 4F1TA 1FBNA 3VQUA 4D4RA 2B4SB 3LM5A 2R0IA 4IB0A 2HAKA 4MH7A 4EK4A 2ERZE 2O2UA 4U41A 2VWZA 4EOJA 4ERWA 3OW4A 2IWIA 3ZLSA 3DBEA 4BGHA 3ZLYA 2V7OA 3MFSA 4BDHA 5IQFA 3VJNA 4NCTC 4GJ2A 2QLQA 5B7VA 4EKKA 4DBNA 3QGYA 4AACA 2XK7A 2YCRA 4L53A 5ANGA 3KCKA 3V5JA 3PIYA 4ZY6A 3GU8A 3UMWA 2WD1A 4FT0A 3C0GA 4X3FA 4FTRA 5ETAA 4AFJA 5BUIA 4NIFA 3R9OA 2YZLA 4J95A 4BYIA 4IC8A 4V0GA 1IR3A 4FEUA 1IAJA 3QWJA 4AGCA 3EN5A 4RGJA 3PIZA 4JAIA 3I79A 4DFYA 1CKIA 4NKSA 3FJQE 4FK6A 3QYWA 2JAVA 5EQPA 3I6UA 5EM8A 3EN6A 1YXSA 3H0YA 4QYEA 1ZAOA 2X8DA 1JAMA 2PZIA 3H9FA 3TKHA 3ALNA 4QP6A 5E7RA 4E4MA 3HV3A 3PG3A 3ERKA 3C50A 4AZVA 4C2VA 4WKQA 3ZU7A 4IAAA 4FTKA 4R1VA 2JD5A 4DF3A 1Q61A 2YN8A 4S33A 2Z7QA 4M0ZA 4UBAA 2OJGA 5CTPA 4HVIA 5CF4A 2W1FA 1CKJA 4KIPA 4MXOA 2OO8X 2QI8A 5I9YA 2XK6A 5AUZA 3BGZA 4BTFA 5D10A 2V55A 4W9WA 1WFCA 4O0YA 4RFYA 4MNEB 4GIIA 4NZWB 4P90A 5J7BA 3DJ6A 4KS8A 2XYUA 3AD6A 3L9NA 2VX0A 3IECA 2F49A 3NUPA 1HOWA 4JVGA 2XJ0A 5LQFA 3D83A 3GQIA 1ZOHA 2EB3A 2Z60A 3G2FA 3GGFA 4GV1A 2VNYA 2O5KA 2QR7A 2X0GA 3EZVA 4BY9E 1AQ1A 5CEKA 5GZAA 3NGAA 3VS4A 2E9PA 2Z7SA 3ANRA 3RJCA 4MD7E 4RJ7A 2PPQA 3HDNA 4IZYA 1PXNA 4FKOA 4FKSA 2VTLA 4JG7A 5AP5A 5CF5A 1QPJA 2P55A 3HMNA 3F9NA 2CGXA 3VHEA 3IPHA 4GFGA 4NJ3A 5AR2A 4IHPA 4Z9LA 5AR4A 3D2IA 1JQHA 1P4FA 2B53A 2PVRA 4FBXA 4WSQA 3UG2A 3Q6UA 2BRGA 4RJ8A 3B8RA 2OJJA 1FQ1B 3COKA 3VN9A 3SDJA 4EUUA 3CSVA 4EK3A 1MQBA 3U6HA 3JVSA 5A46A 1PXJA 4KNBA 3BLHA 2J50A 5E1SA 4FKPA 4LM5A 2B9HA 3H9RA 3ORTA 4MBLA 4UZHA 4RRVA 5J1WA 3WF7A 3CCNA 2ITYA 4GK4A 3F5UA 1BI8A 4BCJA 2J7TA 4LG4A 3VBYA 5HX8A 2C0OA 4UMRA 3IGOA 4J71A 4KRCA 2C6TA 3GC0A 5M4UA 2CHLA 5LOHA 3Q52A 1KE7A 3BGPA 2RSVA 3G51A 1PMVA 3WOWA 4GG7A 2QOLA 2C6IA 3RAWA 2JBPA 5AUXA 5CAPA 4A4XA 2BR1A 4O38A 2JFLA 5L8KA 3KULB 2F7EE 3RPOA 4K6ZA 1I44A 3VUGA 3QWKA 3QTRA 4QD6A 3DFCB 3PVBA 1IAHA 1PRYA 1K3AA 1XH4A 4UV0A 3ALOA 3EQFA 4G31A 4JDJA 4LV5A 4F99A 5AP3A 1PW2A 3GU7A 2JDRA 3ETAA 3UODA 2PVHA 2B9IA 3R0TA 4D0XA 4ASXA 3NPCA 2WMVA 2OF4A 2VTAA 5KZIA 5DR2A 5ITAA 5D11A 2XNGA 4OAVB 3R7UA 5CVHA 3Q9WA 3BWFA 4ENYA 4TYIA 3ORZA 3EQHA 3II5A 3G0FA 4RLKA 3AC2A 4U0IA 4ZTRA 3GCVA 4QPMA 2WMWA 4EZ7A 5JRSA 1PMNA 4CLJA 5JQ8A 4FE2A 3Q9ZA 2B0QA 4U80A 3K5UA 4TNBA 1YOMA 4ZTNA 4YTFA 2QKRA 3ZZEA 4FTCA 2YLFA 4RC4A 3VUDA 3OD6X 2OF2A 4KKEA 4M8TA 5DBXA 2BKZA 5C01A 3AMBA 2H8HA 4CGAA 5CEQA 4FEVA 1BLXA 2ITXA 3QCXA 3MY1A 3REPA 4BZOA 1ZOEA 4XH6A 4Z7GA 2FH9A 1ZY5A 1H08A 3TZMA 3DXQA 1NT2A 3R30A 3ORLA 5ANDA 1WAKA 5ACKA 3TM0A 3LFEA 2GMXA 2W1CA 1XQZA 2KTYA 1PYEA 3Q3BA 4AN3A 4IC7A 3A7HA 3HA6A 3WZDA 1KE6A 4RZWA 5L2WA 3R1SA 1V1KA 4IW0A 1GIHA 4AU8A 3SAYA 2YITA 5HG8A 3BWJA 2J51A 1H1WA 2UV2A 2Y4PA 2J5FA 4FG7A 4BDFA 3HRCA 4EYMA 4QOXA 5E8WA 3W18A 4EHVA 5ICPA 1SM2A 4ANSA 1H25A 4R78A 4DC2A 4S30A 3EYHA 3TN8A 2Y6OA 3UO5A 3PXFA 4FSZA 5LWNA 3NYNA 4M14A 5A3XA 1PXMA 4KIKA 2PVKA 4IZ5A 2C69A 2YM4A 4AOIA 4FUXA 1KSWA 1WBPA 3D5XA 2NPQA 2XK4A 3ZDIA 3MVJA 1KOAA 4U3ZA 5EQYA 4XV9A 3QALE 2GS2A 3UQCA 4RX7A 4HCUA 4IDTA 3KL8A 4C35A 2X81A 4BTJA 2HZ4A 2PYWA 2OIBA 5DOSA 3NYXA 3PE2A 4G3FA 4DH1A 5DRDA 3TTJA 4EJ7A 5BPYA 5HIBA 2JIVA 4FICA 3KGAA 5HD7A 5AP2A 4BBMA 1YHWA 4E6CA 4EQUA 2HWOA 4CQEA 2JDSA 2JKMA 4IMYA 4TN6A 5M56A 4ANBA 3QTSA 4IAFA 3C9WA 2XIZA 2ERKA 1UNLA 3PSCA 3DQWA 3PVUA 4C4JA 3FLQA 2YABA 4CSVA 5AV4A 3G5DA 2CCIA 1M7NA 3F66A 3L1SA 4LUEA 3TIZA 4L6QA 4GS6A 2IW8A 4FKRA 4AW1A 4CRLA 5KKRB 5BVFA 1XBCA 3WYYA 1O9UA 5CS6A 2FSTX 3D5VA 4GK3A 1Q3WA 4A06A 3E87A 1KOBA 3DJ7A 3QTWA 4O2PA 3UOHA 5FG8A 4LI5A 2ZB1A 5A6NA 3WZKA 1GIIA 1W98A 1JSTA 5I4NA 5K0XA 3VBXA 2QODA 5GJDA 5HKMA 1NY3A 4S34A 5EKNA 4Z3VA 4FI1A 3DPKA 2WKMA 4UWYA 2JKKA 3CGOA 3UC4A 4U7ZA 4L01A 2ZV2A 4OBPA 3RHKA 3V8SA 4BDBA 2X7OA 2V22A 5CALA 4JS8A 3IDBA 1OBGA 4XV2A 4CZYB 5EM5A 2ZV8A 4KBCA 4X2FA 2B52A 3CTHA 1JVPP 5EI8A 3HGKA 3OG7A 4RIYA 4F08A 3QLFA 5HCZA 2VTTA 4XG8A 4RVMA 2BFYA 3O2MA 3PXQA 4UYNA 4IFCA 4O6EA 5HU9A 5FEDA 1GJOA 4NT4A 3ZRKA 1W8CA 3W8LA 2OW3A 4XBUA 4FZDB 2GHGA 3CD8A 3FMEA 2ZOQA 3MA3A 4MTAA 3OWKA 4L42A 3RMFA 2QKWB 4G3EA 3Q6WA 3CQWA 5ETFA 1V0BA 3KRRA 4USEA 4O82A 3NIZA 2FSOX 3FQHA 1KUTA 5IH4A 3UG1A 1YDRE 2VU3A 4QRCA 3CTQA 1ZMWA 2YA9A 3Q4CA 3O7LB 3LQ8A 2W9ZB 2NP8A 4KSQA 5HEZA 3UQGA 4E5WA 2XNMA 1ZMVA 3AD5A 3V5WA 3ZCLA 2BROA 3PPKA 3BKBA 4I5HA 1R0PA 4F1MA 4FZFB 2FSLX 4KAOA 4MCVA 1J91A 3VW8A 3UOKA 4IB5A 2UW4A 3O8UA 4YJSA 3ROYA 3OZ6A 3GFWA 3VS0A 4DGNA 5JZJA 5M57A 1OKYA 4BIBA 2B54A 2XNPA 3MDYA 3OWLA 5IQIA 3CY2A 2VWBA 3SLSA 3CP9A 2WQOA 5EYMA 4QNAA 2QHNA 4JIAA 5HO6A 3SV0A 4QTDA 3Q60A 3BX5A 5FTQA 2HK5A 4J96A 4A9UA 5IQGA 4FT5A 4BTKA 3P5KA 1H8FA 1FINA 4MXCA 5FM2A 5L2SA 4FTTA 4S32A 5B2KA 3AQVA 3DTWA 2GCDA 1PY5A 3ORKA 2YHVA 4FF8A 4BDCA 2YCSA 4CG9A 5E92A 3MVLA 1OECA 4AP7A 2ZM1A 5KBRA 4NW6A 4FEXA 4RIXB 4FTMA 3RKBA 3HAVA 4AGUA 3VUMA 4FV7A 3KULA 4QNYA 3DZQA 4FOBA 1Q8ZA 2Y8OA 2WTJA 3T9TA 3OOMA 2WHBA 5CEMA 5M44A 4H1MA 5HBEA 3KRWA 3UZTA 2GQSA 3LQ5A 5GIPE 4FL1A 4FC0A 2I0HA 2JFMA 3MY5A 2JDTA 4M68A 1BMKA 5GZ9A 5DI1A 3MVMA 5AUYA 5EOLA 3MFTA 4UMPA 4YP8A 4BDEA 3C4FA 3K5VA 4WA9A 2OFUA 2VTNA 3PRFA 4E6AA 3R7YA 4M0YA 4FL3A 4YJQA 2H9VA 2X4ZA 3LKMA 4AN2A 2IJMA 3U6IA 5ANKA 4N6YA 2ITTA 3ROCA 3C51A 3AGMA 3DFAA 1CSNA 2BALA 1OB3A 4ID7A 5I9VA 4PWNA 1QCFA 4RLLA 3HKOA 3HLLA 3OVVA 4I21A 2X8EA 4ALWA 4FNXA 2IZSA 2QG7A 4IVCA 4LGGA 5CYIA 3SW7A 5FBNC 4C33A 1XH7A 5HVKA 1V0OA 1Q99A 3GC9A 3BYOA 4K8AA 1YI6A 3DXPA 2EVAA 4AS0A 4BFMA 5IA3A 5AWMA 3FC1X 4Y83A 5CU4A 3UP2A 4BDGA 3GNIB 4AG8A 3EQIA 1DAYA 3W2OA 4I24A 4DFBA 2AC3A 4IBMA 3RWPA 3ZFYA 4UB7A 3EQCA 2WMUA 1NVSA 2W1ZA 3E3PA 4YNOA 4A7CA 3LZBA 5TO8A 2HOGA 3BU5A 3C4XA 5J8IA 5K3YA 3EHAA 3R21A 3UVRA 4CCUA 2XB7A 1APME 3A4OX 3FMNA 2JIUA 1ZYJA 4O96A 3RTPA 1NA7A 4BWXA 1H1SA 4GUEA 3H0ZA 3NW6A 3R28A 1Y8GA 5HI2A 4ASEA 1KV2A 4OGRA 4ZJVA 2C6LA 3ZXTA 4O7LA 4ALUA 5GINE 1TQMA 3AG9A 3HMIA 3UMXA 2YIQA 3KREA 2VTQA 2OK1A 5HVYA 3P79A 3QAME 4N4SA 3CS9A 2BZKB 1JOWB 5JFXA 2YERA 2R3PA 5IA5A 2OI4X 2R3GA 3GEQA 3OMVA 3OEFX 1UNGA 3ZOSA 2UVXA 3JR1A 4K11A 4EK5A 2W05A 3IDCA 4KKGA 3VHKA 5TOZA 2XP2A 4HVGA 3NNXA 3OY1A 3PUPA 2ETMA 4BGGA 4G3GA 3K2LA 4KSPA 3RAIA 1NW1A 4O7RA 5EQEA 4D1XA 4ZSAA 4IWDA 3WF8A 2OZAA 3FHRA 4AOJA 2BCJA 2R3KA 5HBHA 1U59A 3IGGA 2JDVA 3DLSA
chains in the Genus database with same CATH superfamily
4U42A 4O81A 1I09A 3IW4A 5CY3A 3ZC6A 3PPZA 3DNDA 4PP7A 4F7SA 3F5GA 3P5JC 2BVAA 3P7CA 4HJOA 4B8LA 1OPKA 4IJ9A 4DGGA 2Z02A 3Q4ZA 3OT8A 2UZWE 3R63A 4PTGA 1G8SA 3JY9A 4YMJA 4L9IA 3PXZA 5BMMA 5A4CA 5CF8A 1SMHA 4I22A 3FLWA 4RIWB 4GKHA 3BLQA 4QQTA 2OFVA 3FWQA 4C8BA 4BCHA 5DVRA 3F7WA 3BU6A 3GU4A 2YM5A 5H3QA 4YU2A 2I0EA 2YIRA 3BE9A 5D7AA 5M55A 3MPAA 2GNHA 4D5KA 3HEGA 2P2IA 4CLIA 1VLRA 2VX1A 3PSBA 5TT7A 5AR5A 3R73A 4LGDA 5IQDA 5H2UA 2C6MA 2W7XA 2BAQA 3G9NA 4QMPA 4WNPA 2EXEA 4ZMEA 3BYSA 5LVPA 4B99A 2NNWB 3U4UA 3DCVA 3PY0A 4K2RA 5BVOA 5IEYA 1H01A 4D55A 1URCA 4EH6A 4UALA 3R9RA 2ITQA 4BCNA 3I7BA 5DE2A 3W10A 4CG8A 4DG3E 4G6OA 5CAOA 4ZZOA 3DBCA 4CKRA 4I5MA 3LLAA 4FKTA 2W96B 4M69B 3KRJA 5HORA 4OAUC 4DDIA 3TKIA 3R83A 5DN3A 3QXPA 3GVUA 4OLIA 4K9YA 4QP2A 1H27A 3BHTA 3LFSA 2WMXA 1ZYSA 2IZRA 3HMOA 4C38A 2R3MA 4DEHA 1H1PA 3ACJA 5I5ZA 5HX6A 2BDWA 3BBTB 3ATTA 3WZEA 3IOPA 4U3YA 4YC3A 1W7HA 5JH6A 3T3VA 3KK8A 4YZCA 3PLAE 5E90A 3QD3A 4DG2E 5DA3A 2FGIA 3MY0A 1UU7A 1XH9A 3LFCA 4X2KA 2HY0A 4U40A 4DBXA 3C4ZA 3L8PA 4FYNA 2XM9A 2DQ7X 2W5BA 3BV2A 4ZXTA 3E8NA 5FM3A 2UW5A 3R2YA 4PF4A 2ZM4A 1SVEA 3UIBA 3FY0A 4IVAA 2UZVA 4J7BA 4BCPA 2WMBA 2EXMA 3KMMA 3LOKA 4ZSJA 3GOKA 3MFRA 1KE8A 4FTQA 2J0IA 2ZV7A 3FMLA 3EKKA 3MH1A 3QRUA 3MH0A 4FSUA 5FXRA 3DTCA 5IH5A 5DNRA 5EHYA 3PY3A 3RAKA 4CFXA 5I0BA 3EIDA 2EU9A 4JG8A 3MTLA 4F70A 5K5XA 2GTNA 2P0CA 4HPUE 2C3JA 4ENXA 3E8CA 4C36A 3GC8A 1SYKA 3FKNA 4TYHB 3IOKA 1Q5KA 2O65A 2OJ9A 3K3JA 4C37A 3W0PA 2IPXA 2C68A 3U4WA 2W1IA 4GEOA 4O4DA 4L00A 4TY1A 4I1ZA 2BDFA 3UO4A 4ZP5A 3ODYX 2J6MA 3SXRA 4EOOA 2VD5A 5CXHA 3UTOA 4D0WA 3ZUVA 4KBKA 3NUAA 3VS3A 4GYGA 3TKUA 3W55A 4FKJA 3QQJA 1BL7A 3ELJA 3RBWA 4C34A 3NVMB 2X0QA 5DR9A 4HYSA 2UW3A 3KVWA 2WQMA 4JT3A 4CMOA 3NZ0A 4CMUA 5HNIX 5DYJA 5AP0A 3EB0A 3OXTA 4AW5A 3MSSA 2VWVA 3FXWA 3TTIA 2HIWA 1XJDA 5HIDA 5J9LA 4CKJA 1ZYCA 1H07A 3NSZA 4QMMA 4EH3A 3OW3A 3SG9A 3FAAA 3HP2A 3QZFA 4TYJA 4WO5A 4U5JA 3TWJA 4R7HA 3FQEA 3FLYA 1R1WA 4BI1A 4M97A 2GPHA 4FZ6A 4J1RA 5F1ZA 4YUQA 3OT3A 3NW5A 4O0SA 5DIAA 4Y8DA 3NUNA 3LAUA 5ACBC 4GKIA 1OPLA 4LMNA 3FE3A 1UWHA 4EWHA 3TMOA 2X2LA 3CTJA 2QD9A 1RW8A 2PVNA 3EL8A 3F3UA 4IWQA 3VBVA 1RE8A 4LOQA 2PVJA 4YJPA 4E26A 1GZOA 3KKVA 4Y5QA 4U8ZA 4JAJA 4ALVA 4FIEA 4YJNA 4I0TA 2O64A 5KMOA 3PY1A 1E1VA 4FV6A 4C61A 5G6VA 2E9NA 4YTHA 3WZUA 4EQMA 5DT3A 5KCVA 5LVMA 2ETKA 3TNQB 3CPCA 3OFMA 4IWOA 4A9TA 5IQHA 4DTAA 3R8PA 2FA2A 5J5TA 2PU8A 3ZSHA 3EZRA 3PUFC 4EBWA 4W4WA 3T9IA 3KEXA 3QTZA 4TTHB 4ZY5A 3LJ0A 3FYJX 2C4GA 1KWPA 4FIGA 4N70A 4QYYA 4RVKA 4H3BA 5LMAA 4FKVA 4BDJA 3O5AA 2OBJA 3FLSA 1R39A 3ULZA 4DLIA 5IDPA 4FL2A 4FMQA 3QRJA 3PSDA 4BDAA 4F6UA 4F9WA 3CE3A 4GT4A 5K5NA 4FUYA 4MWIA 4AW0A 4S2ZA 2W1GA 3MIYA 1J1CA 2A27A 1RDQE 2QOBA 2PSQA 4ZTHA 5HD4A 1RJBA 4QMUA 4UXQA 5HNBA 3R9NA 2CGWA 5L6OA 1OUYA 1XH5A 4IM2A 3HUCA 3Q5ZA 2WFYA 3OS3A 1Y8YA 3KA0A 4FX3A 1BL6A 4AXCA 4O4BB 2QQ7A 4OW8A 4BHZA 1ZYLA 4YJRA 3JS2A 4QT1A 3GQLA 3P78A 3GENA 3QRKA 3TACA 4Y85A 4CZTA 2W1EA 3GFEA 4TZRA 3W32A 2R3RA 3ZC5A 2Y6MA 4IX3A 2GU8A 3PVGA 4U43A 3ZFXA 4CYJA 3W0MA 3E88A 3LFBA 1WMKA 4ZY4A 4XUFA 2Y0AA 5CT0A 5E4HA 1KE9A 2JGZA 4WNMA 1SVGA 3N4TA 4ZLOA 3PWDA 4ZIMA 4G16A 4WT6A 3CEKA 3HAMA 2DUVA 3E7OA 3A7GA 3PJ2A 5DR6A 3DAJA 5HIEA 4G6NA 2BILB 3SRVB 4A9RA 4GJ3A 4DEGA 4FR4A 3C13A 5FTGA 4DH3A 5M07A 5AAFA 4I20A 4WNKA 1MP8A 4NFMA 4CT2A 3ACKA 3HMPA 4BCMA 4BZDA 4Y5HA 2YACA 4EZ5A 3W2CA 3BZ3A 1JKSA 4CFVA 4WBBB 4RFMA 3ATSA 4FSWA 3ZONA 4E20A 3F3WA 4XRJA 1YWVA 3MJ2A 3OY3A 4LUDA 5CT7A 2VTIA 3L8VA 4XG2A 2XCHA 5F20A 5HOAA 2C3IB 3P08A 4F4PA 5IMEA 2VV9A 2WELA 5L8LA 4D2SA 4FGRA 2YJRA 5AV2A 3KRLA 3KRXA 2W99B 5DRBA 3NIEA 3QLGA 1OI9A 4MX9A 4DH7A 1O6KA 1QMZA 2IN6A 3ZLXA 1GZKA 2UW8A 4I6BA 3W2QA 4TWOA 3DAKA 2IZUA 5LCJA 1UNHA 3QKMA 3V5TA 3KXHA 5FWKK 4YLJA 4BJJB 3DGKA 4FZAB 5I9ZA 5KKRC 3LW0A 4Q5EA 3P9JA 4W8EA 2YM8A 4Q5HA 5HCYA 3DK7A 2C0IA 2VTOA 2UZEA 4M69A 3D5UA 3ZYAA 4CTBA 2C6KA 2X2MA 3UIXA 5G1XA 3HRFA 1T46A 4V05A 4RJ6A 4PL3A 5C27A 2C1BA 3I6WA 3JXWA 4TKSA 3DBDA 3DKCA 4N57A 5CAVA 3BGQA 3TNIA 5B2LA 1AGWA 3QQHA 5CNNA 1NXKA 3MW1A 3O8PA 3OBGA 1YOLA 3QGWA 2J90A 4GMYA 2QONA 2PTKA 4E4LA 5HTIA 3R8ZA 1YOJA 4I6HA 4EHZA 5L2TA 3ZSIA 4MD9E 3IO7A 4OT5A 3ZEWA 4II5A 5AAGA 5JN2A 4ZTLA 5L2QA 2CJMA 4FV1A 4O2ZA 1BX6A 5CSVA 1OPJA 2XNNA 3U8WA 4J53A 4D2RA 3O50A 3OP5A 4MHAA 3UVQA 4DG0E 4O0TA 1GZ8A 2F4JA 4IX4A 2CKEA 4BI0A 4O7ZA 2YAKA 3QHWA 5DLSA 4QEBA 4QDVA 5ETIA 3HYHA 4IDVA 3FSKA 3DOGA 4W4YA 2UZBA 2X2KA 5D9HA 1YRPA 3O8TA 4YR8A 4JG6A 3AC8A 4K33A 5CAUA 4I93A 3T8OA 2XIXA 4JR3A 1PJKA 2G9XA 1OL7A 3D7TA 1PXOA 1JKTA 4JOAA 4OTFA 3QHRA 5HLPA 5E9EA 4MQ2A 4EHGA 1QPDA 4M67A 3QCQA 4RWLA 3RNIA 1E1XA 5K4JA 4KD1A 2G1TA 3HX4A 2WNTA 2A2AA 3BIZA 2WPAA 4QQJA 4B8MA 4ORKA 4AW2A 2UZLA 2WMTA 5K4IA 3OCSA 1OL5A 4ZAUA 2BRBA 5HG5A 5E8UA 3UP7A 3H9OA 2ITZA 4DH8A 3R8LA 2XF0A 5EI2A 4ZK5A 4ARKA 2YFXA 4WG3A 3NX8A 3WE8A 4ACMA 4AT5A 5CU2A 1SNUA 3HVCA 3RPSA 4AZEA 3WBLA 5LMKC 1W84A 5M4FA 3DKFA 4NWMA 2CKOA 3DS6A 4L46A 5D12A 4I41A 3PZHA 2YEXA 3LXKA 3RNYA 2X39A 5IG1A 5CSXA 2BZIB 4X2JA 5JMSA 4IFGA 1OZ1A 3RCJA 3VWAA 3F7ZA 3W16A 3WI6A 2PMNX 4X2NA 1VR2A 2RL5A 3OTUA 2H34A 2BTRA 4Y72A 4ZJJA 5ANOA 3WZJA 2Y4IB 5E8ZA 2XVDA 4KWPA 5AM6A 5AA9A 3VS2A 4NM3A 3H30A 4ZLZA 3R7EA 4TRLA 3E8DA 3KFAA 3I5NA 5EYDA 4D28A 4KUJA 4RQKA 5I3OA 4O83A 4UWCA 3QC4A 1XBBA 3ZS5A 3NUUA 4JBPA 4F6SA 2QO2A 3CY3A 4TWCA 3FPQA 3EOCA 3LMIA 1LR4A 4XOYA 4DHJA 2BRNA 5A4TA 2ONLC 4C4IA 4LRKA 3RZBA 5F9EA 1J3HA 3AXWA 4C4FA 3C7QA 5DPVA 2UW0A 1FVTA 3HL7A 4J98A 4HVHA 3QRIA 3FDNA 3MB6A 4RIOA 2FYSA 4XRLA 4XCUA 2XRWA 5C8KA 1WVWA 5M08A 3Q4TA 1PXIA 4MNFA 4MWHA 4FKGA 4PP9A 4W9XA 5EDRA 4MXZA 1OKWA 4YBJA 2PUPA 4HGLA 3F2RA 2WQEA 3F82A 3MN3A 1M14A 4J8NA 3TV7A 4HW7A 5IU2A 1URWA 3UDSA 1MRUA 4YZ9A 5IKWA 1RQQA 4MBIA 4O27B 3AC5A 3CQUA 3DZOA 3HECA 3QUDA 3R7GA 4RA5A 3OC1A 1SNXA 3LXPA 4ITJA 2IVTA 2WQBA 2O0UA 4Y95A 1X8BA 2HXQA 1NVQA 4NFNA 4EKLA 4WHZA 1A48A 2R3HA 3VW6A 5D1JA 4GSBA 2GDOA 3VF9A 4QMQA 5A14A 4DGOA 3R1QA 4WUAA 5HCXA 4FG8A 1J7UA 5J5SA 4FT7A 5EK7A 5CX9A 1PXPA 4BC6A 5GIOE 3ORNA 5JGDA 4EOKA 5CSWA 4YJTA 3ORXA 2C5OA 5L2IA 3SA0A 1TVOA 3ODZX 4NUSA 3D5WA 3E93A 4WOVA 2YCFA 4ANLA 2OXYA 5C4KA 4UMQA 4CTCA 2GNFA 4YGAA 3RK9A 3FL4A 3TZ9A 4AA5A 4FTUA 4Z7HA 4J99A 2BAKA 5AX9A 2UZTA 4H36A 4QPAA 1YDTE 4UN0C 2C1AA 1GIJA 3I1AA 3DKGA 3RAHA 4MNEA 4DFUA 3PJCA 3KMWA 4AZSA 4FKWA 5FLFA 4MEDA 4IJPA 3FXXA 5EW9A 2J4ZA 1ZYDA 5AUTA 1LUFA 3OWPA 2CGUA 5HNGA 5CNOA 3MTFA 3BU3A 5HHWA 3SOCA 2CLXA 4B4LA 3VJOA 1OL1A 2VWWA 3MVHA 2R0UA 2IZTA 3RHXA 2ZVAA 3QXOA 4EOIA 3P86A 3MA6A 3U9CA 5EM7A 2Z7LA 4JX3A 2WMSA 1TQIA 4D4SA 4LMUA 3S3IA 4EONA 2XANA 2BIYA 4EH8A 1DI8A 4DN5A 2BRHA 1H26A 4X3FC 2W1DA 3KMUA 4H3PA 3LPBA 4DGLC 2IG7A 2HY81 4RA4A 1BKXA 3IW7A 3PE1A 5L6WL 4BICA 3C4EA 1OUKA 2B7AA 1VZOA 2C6EA 3R7VA 5BYYA 5IA2A 3V5LA 2F7ZE 2ZMDA 3KN6A 3TJCA 3VBTA 3DK3A 4YHJA 1U54B 3WARA 5K0KA 3O96A 2WQNA 3ORIA 1XO2B 1YXVA 3A8XA 3NAXA 4BIDA 4C4HA 5C4LA 3TDWA 3TIYA 3LHJA 3NVKI 5FDPA 2CNVA 1DS5A 3V3VA 3D9VA 4KIQA 3RM6A 3UNKA 3AT2A 4N0SA 3ZBXA 2WMRA 3BHYA 1Q97A 4MKCA 4W8DA 3UYTA 2ITNA 4APPA 4PMMA 3R7OA 2WIPA 5IQBA 4O86A 3V5PA 4L68A 4DEEA 4I4FA 4C2WA 1E9HA 5TF9A 5DHJA 2PUUA 3F69A 4U45A 4ANQA 1W82A 1P5EA 4TNDA 1V0PA 4WNOA 3COMA 4PPCA 2Y9QA 1YI4A 1F5QA 1ZARA 4AWIA 2R2PA 5AX3A 5AFVA 3BE2A 4O22A 4LOOA 4D2TA 4K0YA 4YBKA 2E9VA 1Y6AA 5J9ZA 2RFDA 3AGLA 4TL0A 3G9LX 3ZXZA 1XHAA 2A1AB 4MXXA 1F0QA 4QP3A 4AF3A 4BRXA 4L3JA 2W5AA 3PJ3A 3P7AA 3QQLA 4TYEA 4O1PA 3VBWA 4XHKB 4JLCA 1G3NA 5KMIA 5IDNA 1PXLA 4DFXE 5BQ0A 3S1HA 3BHUA 4YURA 3C0IA 4FT9A 4O7YA 2YIXA 2YM7A 4CKIA 4AX8A 4D5HA 4PNIA 4FG9A 5GHVA 2XARA 3W2RA 4TPTA 1H28A 1OKZA 4NCTA 3DXNA 2CMWA 4MK0A 4QP9A 4HPTE 3UZRA 4G34A 4QYHA 4RPVA 5E8XA 5H9BA 5KMJA 2O3PA 4ZS4A 3M11A 4AZTA 5EFQA 2X9FA 3GT8A 5AA8A 4EH5A 3W0NA 1M52A 1WBSA 3QF9A 2OXDA 4QTBA 1PKDA 2BMCA 2XYNA 4M7IA 5HE1A 3WIGA 4I23A 5LMBA 2O63A 3IQ7A 4U81A 1LP4A 4L44A 4C3PA 3ORMA 1P2AA 4A9YA 4GL9A 4TWPA 1MRVA 4I6LA 4ANNA 3V8TA 3ZMMA 4HOKA 3CJGA 5IEVA 3EN7A 2IVSA 2GNJA 3MIAA 3OUKA 5AM7A 4DT9A 1U5RA 3N4UA 2A4LA 2OIQA 5HU3A 1ZOGA 2ZMCA 2F9GA 2VX3A 3COIA 3SXSA 4QMVA 3LFFA 3FZPA 2VAGA 5CVGA 3VRZA 3W1FA 2QURA 3OCGA 4RJ4A 3R8UA 3IONA 4R5YA 3DU8A 4U97A 3C5UA 3AMYA 2R5TA 4ZOGA 3IW6A 4BZNA 3IK3A 1OIUA 5HICA 5A4LA 2WTCA 2G2IA 2H96A 1Z9XA 2VWUA 2E9UA 4G17A 2I6LA 3GBZA 4YO4A 1CTPE 1UVRA 2YWPA 4LV7A 3SG8A 4PDSA 1OIQA 3FQSA 4E7WA 4BL1A 4Z55A 1G5SA 1CM8A 2KULA 4Q2AA 5I9XA 1LEZA 2VTJA 3SXFA 3THBA 3PDTA 1PF8A 1YXXA 2PZ5A 3CXWA 3CLYA 4MXAA 5AR8A 2LGCA 3KXNA 2ITVA 4JDKA 4CMTA 3Q04A 4YLLA 4EK6A 3EQBA 1EH4A 3NS9A 4GH2A 4NJDA 3PA5A 3SOAA 3TZ8A 4M66A 4ANOA 4Z16A 4B7TA 5C26A 3PG1A 3U6JA 2JIIA 4EI4A 4QQ5A 1MUOA 4KBAA 3IS5A 2V62A 4ACHA 2XKFA 4MD8E 2X6DA 2BAJA 3R04A 4L67A 5J79A 4LV8A 3FBVA 3LXNA 2RKUA 3QUEA 4YPSA 5HZNA 3QCSA 4JBVA 4LYNA 2WXVA 2EWAA 2G01A 4I92A 4FA2A 4X3FB 3F6XA 4JR7A 4NH1A 5HE0A 5K9IA 4V0GB 4CV9A 3BHHA 2WZJA 5EHLA 5CEPA 4UMUA 4R8QA 2FB8A 2R3OA 3U51A 1R0EA 3B2TA 1A06A 1UV5A 4IM0A 5HLNA 1CDKA 3W2SA 3SGCA 5AEPA 2C5NA 4I0RA 4P5QA 4FGBA 3QQKA 3V51A 4XNEA 5IA0A 5M06A 3NRMA 2OKRA 1ST4A 1ZXEA 3QD0A 3TT0A 2FSMX 4YZDA 5AV0A 4DH5A 3B8QA 3POOA 5HVJA 3DT1A 3TV6A 2PULA 5EKOA 1OVEA 4L52A 4LRMA 5ANEA 3O0GA 5T6KA 2XK8A 3VUHA 1ST0A 4ONAA 2ZYBA 3VVHA 5IZFA 5M51A 1J7IA 2UUEA 3P1AA 2YIYA 5KMNA 3QTUA 4FOCA 2J2IB 4TW9A 3VNTA 4F0FA 3GOPA 3QC9A 4O6LA 1AD5A 4OTQA 4G9RA 3TDVA 1B6CB 2VWYA 3BQRA 4K77A 3AD4A 2PZRA 2XZSA 3P7BA 3BI6A 1JKLA 3NNVA 1ATPE 1REJA 3PXKA 4BCKA 4EH4A 4F9CA 5KMMA 4JXFA 4BVUA 4G9CA 3EN9A 4JMQA 4G2FA 1K2PA 3JPVA 2XKCA 3UNJA 1YDSE 4QMZA 5E8SA 2EUFB 4CEGA 4EOMA 4D2VA 5AIKA 4YO6A 1WBVA 4O0UA 3ZRMA 3RP9A 5CAQA 4NU1A 4MUQA 2PUIA 2UZOA 4E6QA 4HCVA 4WD5A 4QP1A 3HV7A 4Q9SA 3HV4A 2Q83A 2R7BA 3NYOA 2B9FA 3BYUA 3TNPC 3K54A 4D9TA 4F7NA 2BIKB 3F5XA 5DT0A 2X0OA 4RQVA 4DCEA 3FLZA 3CPBA 1LPUA 1OIYA 2IO6A 1U54A 3QQFA 4HYUA 3UIMA 5A9UA 4YJOA 2V7AA 4QYFA 4JDIA 4DT8A 2DS1A 5LMKA 3MYGA 4RJ3A 2WGJA 4FVRA 4OTGA 3I5ZA 4CD0A 4XG7A 1BI7A 2PZPA 4FNWA 2CN8A 4PNKA 3QA8A 4IB1A 2E9OA 4CNHA 5KO1A 3FYKX 4JBOA 3HNGA 1W2CA 4AAAA 3EFJA 2DWBA 4YHFA 3FMMA 4XP3A 3V6SA 4I0SA 2WMQA 3F3ZA 1Y6BA 1IA8A 4HCTA 5A6OA 3H4JA 5CANA 2CCHA 2F2CB 3HDMA 3TUDA 3E7VA 4RIXA 4L7SA 5FGKA 3VC4A 1JNKA 4CYIA 1YQJA 3W0SA 3EYGA 4E8AA 4USDA 4DINA 1PKGA 4ZMFA 2PVMA 4EOPA 3IDPA 3Q96A 4AZWA 3UIUA 2OJFE 3RPRA 3H3CA 3FZOA 4AE6A 1UKHA 2WU7A 4IVDA 4EH2A 3ID6C 4O7WA 2YCQA 1W2DA 3R6XA 4P4CA 2R3LA 5IUGA 1Q4LA 2UZUE 1IEPA 2ONLA 3UBDA 4PDOA 4R3PA 5FBOA 2GHMA 4AXDA 3E5AA 4QP4A 4UYAA 3N51A 2OZOA 3TNHA 3LFNA 5J1VA 1ZY4A 5BYLA 3C4CA 1HCLA 4PUZA 2QCSA 5CEIA 3Q5IA 2CN5A 3AC1A 3LJ2A 3BBWA 5FD2A 2XNBA 2ZDUA 3KN5A 2ZB0A 4AT4A 4RVLA 5LWMA 2JC6A 4YNEA 3TUCA 1OMWA 3HRBA 4GFOA 3BV3A 3HV6A 5EOBA 4JBQA 3HMMA 1XWSA 4B9DA 4H05A 4E3CA 2QO9A 3UPXA 4YZBA 4F78A 4FRFA 5JKGA 4EYJA 2IF8A 3RM7A 3G6HA 4C62A 1J1BA 2QLUA 4PTCA 1BYGA 1FMOE 2P4IA 4PMSA 3RINA 3VAPA 4JQ8A 2IEWA 4BB4A 2XKEA 2HZ0A 1TZDA 4PV0A 3AOXA 4E73A 4J8MA 3EQRA 4RJ5A 1JWHA 4O91A 5EHOA 3UE4A 4BKYA 3F2NA 4GT3A 5KX8A 4OT6A 3UO6A 4BCFA 1F3MC 5LCKA 4ACGA 3PJ1A 3G15A 1YI3A 3AC3A 5BMSA 4G3CA 3I0QA 5LVOA 4FEWA 4QMWA 3GU5A 3LE6A 3ZZWA 2XK3A 3BPRA 2AEGA 3MBLA 3NYVA 4FSMA 5EDPA 3QU0A 2XIKA 4FODA 5IQEA 4BGQA 1U4DA 3GUBA 4FIHA 2QOKA 4C7TA 3N4VA 4YHTA 4FIIA 4KIKB 2G15A 2HCKA 5IUHA 4V04A 4XYFA 5JFSA 4DCAA 4BN1A 2J0MB 4X6RA 1KE5A 4YLKA 4O7TA 4F9BA 2PE1A 2RFEA 3R00A 4JQ7A 5HLWA 3NNUA 5CQWA 4M3QA 4NSTA 4K1BA 4P7EA 2UZNA 5F94A 4DHIB 3MB7A 3ZTXA 3PRIA 3R1YA 2WMAA 3TCPA 3C5IA 4J97A 4RVTA 2Y4IC 1H0VA 3DBQA 3GXLA 3FMKA 3QX2A 5DG5A 2VO6A 1R3CA 2EXCX 5EH0A 4EL9A 4CCBA 2PVYA 3SHEA 3Q2JA 3Q9YA 5A4EA 2RF9A 2ITUA 5BYZA 3GC7A 2IVVA 4ZTSA 4BDDA 2VRXA 2XH5A 2GQGA 4FSTA 4JX7A 3SW4A 1FVRA 4F1OA 3BLAA 3S2PA 4FYOA 3F61A 3DJ5A 4PQNA 4CFUA 3TG1A 4DLJA 2AUHA 3WF6A 1FVVA 3LFAA 3LMGA 1WCCA 3KF7A 4RX8A 4ZSEA 5C8MA 4EH9A 1OGUA 1Y91A 1REKA 4GCJA 4RIWA 4PPBA 2PK9A 3UYSA 2G2FA 3FY2A 2QOFA 3L8SA 5AADA 5B2MA 2VN9A 3QRTA 2YLEA 4DFNA 2C5YA 4YPDA 1WZYA 4MVFA 4H3QA 5CLPA 3ZSGA 4F0GA 5EM6A 1M2QA 2OIDA 3FI4A 3LVPA 4U44A 2C0TA 5GJFA 3FPMA 4EEVA 5BVWA 5IQAA 1XBAA 4E5AX 1O6LA 3S95A 2X9EA 5FXSA 3MH3A 4ITHA 4IM3A 5FQDC 4DITA 3VS1A 5GJGA 4F7LA 2JBOA 2VTRA 3ZM9A 2R7IA 3NCGA 4RIYB 1YWNA 3KXMA 5BV3A 2C47A 4BHNA 5FEEA 5DH3A 4AN9A 2VNWA 3OROA 4HGSA 2WU6A 3D14A 2AYPA 4OTHA 4ZTQA 2W1HA 5JT2A 4E4NA 4L7FA 4O0VA 5AMNA 3A7JA 3Q2MA 3TXOA 4DAWA 2VTMA 2OSCA 5BVNA 3TYKA 3A8WA 4EC9A 5TKDA 1S9IA 1W83A 4NW5A 2UW9A 4O7VA 3WIKA 4RWIA 3FMHA 3P23A 4RG0A 3V01A 3QX4A 3ZRLA 4QMXA 1H4LA 3KK9A 3V8WA 3D2KA 3TV4A 2Z7RA 3R8MA 4XG6A 3NEWA 4ZLYA 4C3FA 2QO7A 5AP1A 1ZRZA 4IB3A 3NUSA 3O71A 2BPMA 2PMLX 3P0MA 4YSMA 4ZSGA 5GNKA 3RZFA 4FT3A 2XNOA 3NMUF 3OXZA 4QP8A 4RBLA 2FVDA 3UC3A 2UVYA 4OTRA 3CKXA 3GCSA 3L9LA 3IW5A 3Q53A 5C03A 4FKUA 3PA3A 4D4VA 3EQGA 4O4EA 3RWQA 3DDPA 5HG7A 4FV5A 4EC8A 3R9HA 5H8BA 1GZNA 4IAYA 4PL4A 5FUTA 4NM0A 3KC3A 5IF1A 1FOTA 1YXUA 1OITA 4I94A 2OLCA 1GNGA 3DLZA 5A4QA 5EDQA 2W17A 2J5EA 3VQHA 1OIRA 5E1EA 4QO9A 4BR3A 3O51A 3SVVA 5E8VA 3ET7A 1Q8TA 4G6LA 1STCE 4GU6A 4R3RA 3ZDUA 2BHHA 1IRKA 2YM6A 3K3IA 4DEIA 4GRBA 5I9UA 4M13A 4TYHA 4APCA 3LM0A 2PVFA 3POZA 4OTPA 2QC6A 1XMLA 4U6RA 4RSSA 3HZTA 5IUIA 4H58A 4QMTA 4RFZA 5C8NA 3HV5A 3BEGA 2F7XE 3FKLA 4RZVA 5FEQA 3OTVA 4IACA 4IWPA 2HXLA 4O21A 2PMOX 4I4EA 4JNWA 3ZEPA 4BBEA 2WEVA 4TWNA 4BIEA 4OUCA 4IAZA 4C59A 3D4QA 4CFMA 4XEYA 3A7IA 3RK5A 5I3RA 4LQMA 2ZAZA 4QTCA 3A4PA 4UWBA 4WG5A 3M42A 3FL5A 2ESMA 2PZYA 4XP0A 3TL8A 4BF2A 3OXIA 3PIXA 4XG9A 3QUPA 3V04A 2RG5A 3DQXA 2O8YA 3G0EA 3ZO1A 2I0VA 5JGBA 4JI9A 4WSYA 1Q62A 3QTXA 1PXKA 4HYIA 4E1ZA 2YISA 1Q24A 2PWLA 3G33A 4F09A 3OHTA 1H0WA 2XA4A 1GAGA 1G8AA 3I60A 4FV8A 4U9AA 4BCIA 4AZFA 2RFSA 4FZ7A 2J0JA 4DHFA 4E5BA 4FKQA 2OICA 4CFFA 4RC3A 2VTSA 3F88A 3RGFA 3QBNA 3WILA 4C4EA 4M12A 4LFIA 4QYGA 5L3AA 1QPCA 4WBOA 4ASZA