4DFLA

Crystal structure of spleen tyrosine kinase complexed with a sulfonamidopyrazine piperidine inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
274
structure length
263
Chain Sequence
b'VYLDRKLLTLEDKELGSGTVKKGYYQMVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Pyrazine-based Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 263
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dflA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dflA01
4FZ6A 2W1EA 3HDMA 2XRWA 5M4UA 5BYLA 3C7QA 4TYEA 4RPVA 4NL0A 2E9VA 2BPMA 3PJ3A 5FEQA 3VULA 2VWWA 4PL3A 1MRYA 3ZRMA 3QQLA 2H8HA 5BNJA 2WMBA 4FICA 3ZMMA 1BL7A 4FTNA 4G9RA 3H3CA 2VTLA 5L2QA 4ERKA 3ZRLA 3P7AA 5A4LA 3CLYA 4FK3A 4C02A 2VTOA 5JQ5A 2PZRA 3LVPA 3FHIA 3VRYA 2XKEA 5EW8A 3KGAA 3HV4A 2XK9A 3QZHA 5CANA 2BKKA 3LXPA 3Q53A 4QTAA 4OAVB 1WBPA 4JL9A 3IS5A 2WMRA 4ANOA 3LAUA 3BYSA 4DLJA 5HCYA 2WB8A 4JBVA 4K77A 2WEVA 5DRDA 5J8IA 3D2KA 3LLTA 3G9NA 4TY1A 2A19B 5EKOA 4ZZOA 5L3AA 4NFMA 5DRBA 5CSVA 5JRSA 3NRMA 4C4JA 1YDTE 3S0OA 2RFNA 3G0EA 2VO6A 5GNKA 4YTFA 3UIBA 2WQNA 4NM3A 4BDIA 3OOGA 1XH8A 2QO2A 3V5PA 3RAWA 4KAOA 3IOKA 3KXMA 3SKCA 3ZXZA 4I20A 3NCZA 4BDGA 1O6YA 4K6ZA 2QLQA 3QKMA 5CU0A 3F82A 4U3ZA 5AR3A 4D1ZA 1K9AA 3TZMA 2JBOA 2O64A 4D55A 1GY3A 1OL7A 3R7YA 3UPZA 4EBWA 4Y5HA 2QO7A 5FEDA 1L3RE 3QWJA 3R01A 5J87A 1H01A 2CKEA 3VNTA 4EC9A 4U45A 5BYYA 5FBNC 3LPBA 5IQCA 2BDWA 2P55A 5LMKC 4YO4A 5EDRA 3UC4A 2UZOA 1NY3A 3ZRKA 3UZPA 4DGMA 3MH3A 4JQ7A 2XMYA 2WTCA 3U51A 4JLCA 5IUGA 2GU8A 5KZ0A 1YDSE 3QKKA 3HNGA 3OWPA 5CY3A 3DXQA 3ATTA 4X2NA 1XQZA 4ZJVA 1PKDA 2PHKA 4CQGA 4HVDA 3AXWA 1SZMA 3Q9YA 5E1SA 2CKPA 1Q8YA 1MUOA 4ANQA 4MEDA 4AZSA 5AAFA 2QKWB 3FAAA 1H1WA 2VX3A 3ZFMA 5DT3A 4UN0C 4NCTC 1A06A 3DDQA 3DKCA 4BTMA 3BBWA 4JG8A 1CKIA 1PY5A 2Q0NA 3BU3A 3QHRA 4ZMFA 4X6QC 3PY0A 3UG1A 3CTQA 4S34A 2CCIA 2HY81 4KIKA 3TCPA 4XNEA 4HNFA 4E3CA 4F9BA 1R78A 5JH6A 1DS5A 2BKZA 3CY2A 3KRXA 3NLBA 4OR5A 5HU3A 5IEXA 4F63A 5IMXA 4E26A 2HWOA 4O7ZA 2VO0A 3ANQA 3MA6A 4XV3A 4MNEA 4JX7A 3EQFA 3PRFA 4FEWA 1YI3A 3KQ7A 4F1MA 1M52A 2R5TA 4CFWA 3GC8A 4FZAB 2C6IA 3V51A 5CT7A 4G9CA 1A48A 4FTRA 4CD0A 3Q96A 1OI9A 1WMKA 2WO6A 1YXVA 2DUVA 4P2KA 4RRVA 4Q9SA 3QCQA 3TNQB 3RCJA 1ZYLA 3BV3A 4ZIMA 4H3BA 3VAPA 5E8TA 4BB4A 4DH5A 4FL1A 4XHKB 3OBJA 4HCUA 4G3DA 1R1WA 2BAKA 4BR3A 5CI7A 4FSQA 2CN5A 4QMZA 3PE2A 3ORXA 2BRGA 3QTUA 4G31A 3A8WA 2XK7A 3P7CA 4C4HA 1JKSA 2YFXA 3NYNA 5LWNA 2RGPA 3BHTA 3SC1A 4RC2A 5EW9A 4YZMA 3L8SA 1H1PA 4OT5A 3D15A 4KKGA 2YIRA 2VNYA 4RSSA 4YURA 4QMLA 2QQ7A 5LMAA 4OTWA 2A4LA 4DG3E 2YLEA 3EN9A 4RX8A 3PVGA 3SW4A 4BBFA 4E73A 5KKRB 5I9WA 3ZO4A 3EFWA 4FV0A 4WD5A 4AGCA 2C0IA 3IW8A 4AW1A 4GT4A 4RC4A 4X0MA 4DC2A 3F5PA 4BDDA 2NPQA 2VTSA 2W5BA 4RJ4A 4WUNA 3WZJA 3EWHA 3AQVA 5CASA 4ID7A 4RFMA 4HZRA 4KIKB 3DBEA 2PL0A 4DEBA 1ZYDA 4RFZA 3RHKA 2CCHA 1OITA 1TQMA 4MCVA 4RWKA 3A7GA 3PA4A 4B8MA 2XIXA 3H4JA 5D12A 5IQBA 5CZHA 2X6DA 2GS2A 1TQPA 3ZONA 3OF0A 5CVFA 2OSCA 5JEBA 5GINE 2UUEA 3OCSA 5DIAA 5KMJA 3IW4A 4DN5A 3D7ZA 5B0XA 2OLCA 1XH5A 4IQ6A 1V0OA 4Z16A 3QCYA 4W8EA 5E92A 3A7HA 2J51A 5E1EA 4UALA 4MXOA 5A4CA 1M17A 3NAYA 4K2RA 4NK9A 4HW7A 4UWYA 4A06A 1F5QA 5GHVA 4GK3A 5FWKK 2EXCX 2KULA 3E92A 5C27A 4RJ6A 4C8BA 2FGIA 1M7NA 3AMBA 1REJA 3MWUA 4NJ3A 3GUBA 3ZLXA 4J52A 4O7SA 2XP2A 3AC3A 5M44A 4GJ3A 4BDKA 1FGKA 3KCKA 1OL1A 3FQSA 5IISA 5K0XA 3R9RA 3TG1A 2XJ1A 3PSBA 2WAJA 4ENXA 2OJIA 3COHA 4S30A 1Q24A 3LCSA 3SRVA 4JBPA 4CT1A 3RJCA 2WQOA 2OJJA 3AGMA 5JT2A 2P3GX 2OZAA 3K2LA 3VRZA 1GZNA 1Q97A 4W9XA 4FV3A 3QUPA 4D4VA 5HICA 3UOLA 4QMYA 4CKIA 4NKSA 4AOJA 5ANKA 3W8QA 3C5IA 3TUBA 5AP0A 1T45A 3CD3A 3TNWA 2C1AA 5K9IA 4FKVA 3O50A 1PKGA 4EI4A 2CGWA 2QU6A 4IAIA 4FSMA 2ZVAA 1PHKA 3W2SA 3CP9A 4DHFA 4ZSAA 3NDMA 4AT5A 4OLIA 4PTEA 3KF7A 2YDJA 2EXEA 4FX3A 4IC7A 3AC4A 4TN6A 2PWLA 4Y73A 4XP2A 4F7SA 4TL0A 3ZM9A 5IDNA 2ZM1A 3FZRA 4D2PA 5I9YA 2JDTA 3LFSA 3OTVA 4XV9A 4Y8DA 3Q3BA 4ZAUA 3C4FA 3D14A 3UOHA 3HAMA 1XWSA 5DWRA 3FL4A 4IAFA 4IFGA 2BROA 3UMXA 4AN2A 3RMFA 2XNEA 3TEIA 3QQHA 3ALNA 4UBAA 3FUPA 3WZUA 4TRLA 5E8ZA 3U4WA 4FK6A 5LWMA 4ZSEA 3KU2A 4M15A 3PIZA 4BZNA 2YCRA 3QL8A 2WTWA 2XM8A 4RLKA 4Y5QA 5EKNA 3MYGA 5J9LA 3DAEA 3W16A 4QQJA 5AV4A 3O8TA 2VTIA 4ZY5A 1OBDA 1WBVA 4I92A 3D94A 4F70A 5TT7A 3UOKA 5DEYA 2ONLA 3WARA 5HD4A 4QP9A 5EH0A 2XCHA 2XIRA 3L9LA 3VS3A 5FBOA 3I7CA 2UZEA 3PIXA 1P14A 5D11A 1ZYJA 4Y95A 1PXNA 2XEZA 2FSLX 2JD5A 2WD1A 3L8PA 4NEUA 5H8GA 3SRVB 4A7CA 2UZUE 3ZBFA 2XNGA 3K3JA 4YZ9A 4DAWA 3Q4UA 4FVQA 1M2RA 2I0EA 5DOSA 3BLQA 3PY1A 1JQHA 2HZ4A 3U9NA 5C8NA 5AJQA 4M97A 4HCVA 2HZIA 2C3IB 2R3QA 4L52A 4FV2A 2XKDA 4CZYB 4CMTA 3RM7A 4E7WA 2B1PA 2YIWA 3HV5A 3ATSA 1GJOA 2QU5A 4YJOA 1M14A 3MDYA 3PE1A 5E8XA 3ZM4A 1WBTA 2QC6A 3I4BA 4NM7A 5IH4A 4GKIA 3QCSA 4F09A 3DTWA 1ND4A 4Q5EA 4HVSA 2WTVA 3D2IA 3Q5IA 3Q9XA 5KNJA 1Q61A 2PVNA 3KKVA 3UO5A 4OBPA 3I7BA 4PP9A 3RAIA 2IO6A 2QG5A 1M7QA 4KIQA 1U59A 4OW8A 3HP5A 4AZVA 4BDAA 5DPVA 4BDCA 3GCPA 2UZDA 1Q41A 3NUXA 4D2SA 3BELA 1UWJA 4I1ZA 4RC3A 3P7BA 5A6OA 5ACKA 4JBQA 5EQPA 2ZV8A 3G51A 4BZDA 5EQEA 2C6EA 3LXNA 3SXRA 4DH7A 5HLPA 4QP2A 4UB7A 4DFUA 5CEIA 5HEZA 3P08A 5EG3A 5DI1A 4O21A 3CS9A 4F4PA 5AA8A 5A6NA 3WYYA 4YJSA 4ZTNA 3MFRA 4KKHA 2J0KA 2VWVA 4CMOA 2Y4PA 4BGGA 2B0QA 2REIA 1BLXA 5DLSA 2GNJA 3CQUA 2X81A 4TXCA 2EB2A 3BBTB 3R9DA 4TWOA 3NUUA 3E8NA 4O7VA 4CFVA 3A99A 5FRIA 3DPKA 4FSUA 5G1XA 2O5KA 4TWCA 2Y0AA 5CZIA 3V5LA 3RAKA 2NO3A 3R7GA 2CLQA 3L8XA 1Q62A 4WA9A 3PSDA 5HBEA 4QQ5A 4JS8A 3W2CA 2OIQA 3NEWA 5E7RA 4DEEA 4EL9A 4EZ7A 3Q2JA 3CD8A 3VUTA 2VV9A 3KMUA 4K33A 3PXKA 3TJCA 4F64A 5J5SA 3JY0A 3GFEA 3ZZEA 5IPJA 3DBFA 2PYWA 2WPAA 3OY1A 2E9OA 3ITZA 3HMPA 3R6XA 4FL3A 4RQKA 1M2QA 4H1MA 4I41A 4QQCA 2XCKA 2XB7A 3WZDA 3ZCLA 4C36A 3C9WA 1UKIA 5J1VA 1IAJA 4RMZA 2I7QA 3OZ6A 2GNIA 4F6SA 1XH4A 1XHAA 5ANJA 2GQSA 4C2VA 5KMMA 3PLAE 2VN9A 2IN6A 4F0FA 3F66A 2UZNA 1GIHA 4FSWA 4F9YA 3Q4TA 4B8LA 1PXMA 3W2QA 3QC9A 2OO8X 3RPSA 1W83A 2QG7A 5CYIA 3Q5ZA 2C5OA 4X2KA 4R78A 3EKNA 3QTXA 3F3UA 4IZ7A 5FUTA 4C37A 1ZZLA 5HO6A 3QGYA 3QC4A 4R7HA 5C4KA 2YAAA 4ITIA 5DNRA 2FO0A 4O22A 4ZY4A 1VYZA 4GFOA 2YITA 3VBYA 2WQMA 5B2KA 3EMGA 4YZBA 3T9TA 3M11A 2IW6A 5B2MA 4WHZA 3S1HA 3OEZA 3DU8A 3VBVA 4ORKA 2YM4A 4I24A 4R1YA 4RIOA 3CXWA 5FP6A 1Y57A 5M06A 3PJ8A 3H0YA 4I0SA 4PV0A 1DI8A 3GENA 4JDIA 3OY3A 5DVRA 2XA4A 4EOLA 4MHAA 1GAGA 2IG7A 4A9YA 2UW7A 2YN8A 4F7JA 4BCQA 3TACA 3P5KA 1ZXEA 3RNYA 2OH4A 3HRBA 1AD5A 3C4XA 4XRLA 1Q8WA 2WHBA 4TTHB 4LM5A 1HOWA 2W0JA 5HG8A 2C6OA 4BCGA 1QPEA 4MBIA 3VQHA 4QYGA 4CGAA 2CMWA 3QU0A 2BRBA 4CTCA 2PVHA 3QD0A 3QGWA 3BWFA 3HA8A 1OUYA 4BTFA 3FJQE 3N4UA 3JUHA 4EBVA 4H39A 3R7EA 4MYGA 2R3HA 2C0TA 3IW6A 4FT0A 3FI4A 2W1CA 4O6EA 5LMBA 4LL5A 2UZTA 3MTLA 3N4TA 1V0PA 5LXMA 2LGCA 5AUVA 2W9ZB 4O6LA 4XRJA 3R83A 5E9EA 3P23A 4YHFA 4MH7A 5HVYA 4R8QA 1FBNA 2WTKB 1PXIA 1VZOA 5AUUA 1W98A 1U4DA 2X7GA 3GB2A 4MKCA 4W8DA 3DFAA 4DFYA 3KA0A 3LQ8A 5HD7A 3W32A 4WOVA 4FT3A 2R3OA 4OT6A 3EZRA 3GCSA 3R8UA 2F4JA 2ZV7A 3RINA 4F9AA 3OW4A 4BGQA 2EXMA 1UU9A 4R3RA 3QQJA 4ZJJA 2R3KA 3S4QA 4FE2A 2GHMA 5T68A 3NNUA 4TT7A 3QQUA 1HCKA 4ZP5A 5AUXA 5IA2A 5HORA 3CJGA 2JIVA 4ZZMA 4DH3A 2FA2A 3NSZA 3AD6A 1JVPP 2H9VA 1Q3DA 3CE3A 4IX4A 4IBMA 3PIYA 3LCKA 4J95A 3VUGA 2JDSA 4CRSA 2YDIA 5HVJA 3PP1A 4NU1A 5BVKA 3A7FA 3K3IA 5EHYA 4RJ7A 3QA8A 5IZFA 4RLLA 3OXZA 1OKWA 3IK3A 3RTPA 5HBHA 2W4OA 3ZO1A 2VWXA 4NM0A 4QTDA 1UWHA 1IASA 1YI4A 4FKOA 4NUSA 4RIWA 1WVYA 4PMMA 5K5XA 5KHXA 4DA5A 2F7XE 1KE6A 3HZTA 3GFWA 3PP0A 3ZUUA 3UBDA 4QO9A 3F7ZA 4Z55A 5IH5A 4U8ZA 2W5AA 3QRTA 2PUUA 3U54A 3FMHA 4MX9A 5JK3A 4CV8A 4JDHA 3DK6A 3FXXA 4FNXA 2Y8OA 3W10A 3UOJA 4X3FC 4EK5A 5AR5A 5CAQA 4MXXA 3V8SA 4IWDA 3K54A 4ZTSA 1ZLTA 1OECA 2QODA 3BYVA 3M1SA 4G5PA 4LOOA 5KBQA 5HX8A 4XG2A 4I6HA 4QPAA 1ZOEA 4RWLA 4ZEGA 4IC8A 4FIIA 3UO6A 3DKGA 4E6AA 4X6RA 4QTEA 4CG8A 2Z2WA 2Y6MA 4FKWA 4FODA 3UPXA 1NW1A 2RF9A 3COMA 4G3GA 4J1RA 3A2CA 1FPUA 3UZTA 4DFNA 3FKNA 3R7IA 3FLWA 4OTHA 4NZWB 5I3RA 1T46A 5HGIA 1SVHA 4F6UA 2CGVA 1YRPA 5E91A 5EK7A 3TDVA 4AE9A 5C4LA 1UU8A 4DEDA 3MY0A 4NKAA 4FSZA 4NSTA 5D7VA 3VBTA 4FKQA 2PSQA 3QD3A 3NS9A 4EZ3A 4O7YA 2ITTA 2XEYA 3R1QA 4DF3A 3AD5A 2Z7QA 4FTUA 4L6QA 4LUDA 3DK3A 1VEBA 4LG4A 1J7IA 2XIZA 4EK8A 2ZM4A 2EB3A 4O81A 1SNXA 2GQGA 3ROYA 1Q8TA 2BCJA 3OFMA 2F2UA 2WELA 3FYJX 2HW7A 1YXTA 4CKRA 4IX6A 1SYKA 3FMDA 3RPOA 3ULIA 3ODYX 4GU9A 3LMHA 4DBXA 4FV9A 1TVOA 4FG8A 3UTOA 3VJOA 3NW5A 4Y83A 2OWBA 1UNGA 5HTBA 5CI6A 2XKFA 2ERZE 3LM0A 3QXPA 4MXCA 4EJ7A 3MIYA 4F7LA 4XV1A 4J97A 3HV3A 4M3QA 4LV8A 4XUFA 3VUIA 2Z7LA 3OCBA 1A9UA 2PY3A 5FD2A 3EQIA 4PTCA 3BV2A 4EK3A 2C0OA 3MTFA 2PVYA 4LMUA 2QOQA 3R8ZA 3VWAA 2G1TA 5EM5A 4XV2A 4YC6A 2BVAA 4LL0A 1JPAA 5EOLA 5BVOA 4FG9A 4Q9ZA 3FEGA 2R0IA 5JKGA 4XOZA 2HELA 3ZTXA 3HMOA 5DHJA 2W1ZA 4GFMA 3PUPA 4IM0A 4CCUA 2X2KA 3A7IA 4FG7A 3CEKA 3KY2A 4GS6A 3NUPA 2ETMA 4N4SA 5FM3A 4GYGA 4RIXA 4WO5A 3PPKA 2P2IA 4BDJA 3T8OA 3NYOA 3REPA 3DLSA 5ANDA 5D1JA 3KVWA 3NUNA 2YCSA 4UYAA 5ACBC 5A4QA 2VZ6A 3GC9A 3KXNA 4WKQA 5M08A 3A4PA 4A07A 4APCA 2W17A 1IRKA 3A61A 4I6BA 1FQ1B 2Y4IC 3FLSA 4LUEA 5A4TA 3B8RA 1KV2A 1PMUA 3D5WA 4APPA 5IU2A 3AC8A 3ORIA 2WMSA 4A9UA 2JKOA 4XG7A 3IDCA 4O83A 3QCXA 2CHLA 3T3UA 4FUXA 5CAOA 4MVFA 5CVHA 4XLIA 2AC5A 4F65A 5KMLA 4FR4A 4CFUA 4O84A 4FV8A 1WBWA 3TTIA 3BQCA 2RFDA 3POOA 2FSMX 4YNEA 4BCHA 4OTRA 5IEYA 3JVRA 4PNKA 4AFJA 1MQBA 3MB6A 3LXKA 4YUQA 4U0IA 2FSTX 3F6XA 4M69A 4UZHA 3TUDA 2PPQA 4WRSA 4UXLA 4O2ZA 5CNOA 1RE8A 1JSVA 5H8EA 3RZFA 5HLNA 1IEPA 3QRJA 5FP5A 1IR3A 1FMOE 1RDQE 1ZWSA 2ZAZA 4OTGA 1CMKE 4R5SA 4TNDA 5HQ0A 5L2WA 5H9BA 3P86A 5L4QA 2YEXA 4GK2A 1ZRZA 4AFEA 4NW6A 1WBSA 1BKXA 4G1WA 3BYOA 2OJ9A 3MB7A 3WIKA 1ZYSA 2BZJA 4ZTHA 3F7WA 5ITAA 2XNMA 4EK4A 4E20A 3ORNA 2W7XA 1FINA 3FLNC 2OG8A 1YWRA 2BFXA 2JIIA 3QLGA 3ALOA 4O96A 4YJQA 4AACA 5KHWA 2XF0A 2F7ZE 4RIXB 4RJ3A 3UZRA 4X3JA 3D4QA 2HY0A 5BQ0A 2PU8A 4N0SA 2VGPA 5DN3A 3CKXA 4BHZA 4XP0A 1U46A 4EH7A 1SNUA 3CJFA 3C1XA 3NR9A 3QX2A 1JBPE 1KV1A 1CDKA 4YJPA 5AUYA 1WVXA 4J96A 3K5UA 4I21A 4PMPA 3A60A 5IUIA 4O82A 3WI6A 3HEGA 1WBNA 5I5ZA 4LFIA 5AX9A 3RPRA 3G15A 4O7TA 3OWLA 2C1BA 3DT1A 3GU5A 4C58A 3PZEA 3ZXTA 4HVGA 3QRUA 2F57A 2UZBA 3KN5A 2IWIA 3Q6WA 1SM2A 4JT3A 3UG2A 3MPMA 2RL5A 4J98A 3JPVA 3QQGA 2WOTA 4FKLA 3EQHA 3PZHA 4RZVA 4IAYA 4ZXTA 5F9EA 5JRQA 3DK7A 3EIDA 4BYJA 4ERWA 5ANIA 3KB7A 2BILB 3NNWA 1R3CA 4FKUA 4B4LA 2C6TA 4U7ZA 4FEVA 1PJKA 4FIGA 1RQQA 3D0EA 2PVRA 5T6KA 4DGOA 4ZTMA 3NUSA 4M69B 2WIHA 3FZOA 1ATPE 4IB3A 4QNAA 3RI1A 3TNIA 4BDEA 4F0IA 4ZTRA 3MV5A 3HECA 4MXZA 5LARA 1OKZA 3IECA 5B2LA 4KRDA 3R28A 2GTNA 4O0XA 2E9PA 3C0HA 3E8EA 3OWJA 5E90A 5J9ZA 2BR1A 4LQMA 5K3YA 4RT7A 4GV1A 3HAVA 4GSBA 4AZWA 2RFEA 4CZUA 5AP2A 3JYAA 3TV6A 3FMNA 3TJDA 1B38A 4C0TA 3KXZA 3OD6X 3MS9A 3TWJA 3V3VA 2X4ZA 5EYKA 5BYZA 3PJCA 4HJOA 4ITJA 4DTBA 3SA0A 4M67A 2R3MA 5AR4A 2JFMA 5BVWA 4W9WA 5CF6A 1P2AA 2ITQA 4EHEA 2PZPA 1Z57A 2BIKB 2R3JA 3DBDA 4E5WA 2C5NA 1L8TA 5ICPA 2ITZA 4RJ5A 3E5AA 3KK8A 4EJNA 4ACCA 4FTAA 4FYOA 1YVJA 4R3PA 2UW9A 5I9ZA 5IQFA 5HG9A 5T3QA 2UW4A 3F3WA 5M4IA 3I79A 1PXLA 3G9LX 4RWJA 2F2CB 5GIOE 5CEOA 4QTBA 2VU3A 3LCDA 4EOMA 3QZIA 4FTJA 5EI2A 4AW0A 4PDYA 5JGBA 3SAYA 2VTPA 4AGDA 2NRUA 4IFCA 2W4KA 2C5VA 5CS6A 4YGAA 4JIAA 5AP3A 3CTJA 4F1TA 2P2HA 3DKOA 4QYHA 3R1SA 1ZY5A 4JQEA 3R9OA 5LVPA 5IUHA 5K0KA 1LR4A 4CZTA 3QZFA 3UQGA 1NT2A 3LIJA 4PPCA 3SOAA 3WZEA 4EH8A 4I5MA 4FV4A 2YZAA 4PWNA 5FG8A 3EQCA 5TOZA 2CDZA 3IGOA 2J2IB 3NNVA 4ZSGA 4M0ZA 4JQ8A 3C0IA 4QMMA 1R0PA 3ID6C 5I0BA 3IGGA 3VUDA 5A54A 4FGRA 2KTYA 1J3HA 1W7HA 4L8MA 4FA2A 3Q4CA 3RWQA 5HBJA 1YXXA 4LMNA 3VS6A 2FB8A 4TWNA 5BUEA 4A9SA 1URCA 3BHYA 5M07A 4F08A 3EJ1A 2O8YA 3H30A 3F2NA 4F9CA 4DLIA 4IAAA 4ASZA 4FIHA 4A4LA 2VUWA 2R3GA 3C5UA 3ERKA 4UZDA 1F0QA 3NYVA 1H25A 1OPJA 2C4GA 3C4EA 3KK9A 4L01A 2G2IA 1XBAA 4QQTA 4FVRA 5CXZA 4CFNA 3GU8A 1PXOA 4PPAA 2C6DA 4WNKA 1YKRA 2QHNA 3AT2A 4DH1A 2O65A 2YISA 4HNIA 4QP3A 4GVAA 5JFVA 3DKFA 4KBCA 2YM7A 3TL8A 4ASXA 5L8KA 5AP6A 2ERKA 3NZ0A 4K9YA 2W1DA 4G3FA 4YLJA 2XNPA 4FZDB 3BRBA 3OXIA 3MVJA 2UVXA 4KS8A 3OVVA 1BYGA 4IMYA 4MXAA 3V04A 3UIUA 4D2VA 4YSJA 3R1YA 4K18A 4W4YA 5HZNA 1H26A 4AUAA 2WMWA 3EZVA 4ANSA 3PXRA 2X0GA 2ITYA 4DTKA 1O9UA 4GIHA 4UMUA 4M68A 5BPYA 5IEVA 4XG9A 2BTRA 3ZSHA 1WBOA 3ZFXA 2CSNA 1H1QA 2JKKA 2FSOX 3MFSA 4A4XA 3UODA 3P1AA 3UO4A 3KF4A 4DG2E 2PVLA 4PQNA 4BZOA 2J0LA 2BMCA 2C30A 3DXPA 4M13A 4PDOA 4HPUE 4DFZE 4RVLA 4GEOA 4KBAA 3PSCA 4I4FA 5LQFA 2XIYA 2R0UA 4FKGA 1JKKA 4YO6A 2ZV9A 1QCFA 3KRWA 4BWXA 2IW8A 3BWJA 2IW9A 1J1BA 4M12A 4O27B 2CNQA 2XNNA 4NTTA 3RKBA 2W05A 4FTQA 3F61A 4BI2A 4IVBA 4I6QA 2NRYA 2X8IA 2PZ5A 4UWCA 3KMMA 2Y7JA 4BIBA 3R8VA 5EYMA 4D58A 3MGYA 2UVYA 4O7RA 4OAUC 4CFFA 2AYPA 4DT9A 5E8VA 4F6WA 3OXTA 4F7NA 4IVAA 1RW8A 4DE4A 1U54A 4YHJA 2OICA 1KE7A 3Q32A 1YWVA 1XBCA 3BE9A 3DS6A 4LGHA 1Y8GA 2HXLA 3JVSA 1FOTA 2QKRA 4FYNA 3KRLA 5HE3A 3R8PA 4ZS0A 2V5QA 3R2BA 3W18A 1UU7A 4ZTQA 4J8MA 4YBJA 4ANBA 5FQDC 4DG0E 5CF5A 4AP7A 4EK6A 1OM1A 2W9FB 3PWYA 5I4NA 5L8JA 4Y85A 4C4GA 4PNIA 2W06A 4Z3VA 3F88A 4AT4A 3I6UA 2XVDA 4LGDA 4BCMA 5KKRC 5AUWA 3HV7A 3R71A 5IA0A 2ZOQA 4WBOA 3NW7A 3ZS5A 5ETIA 4CVAA 2QI8A 1PYEA 2ZB1A 3OP5A 4YJTA 3DBQA 4ACMA 5KO1A 3FPQA 4DCEA 3KRRA 5CSHA 2XUUA 2B55A 4M0YA 1OB3A 1PYXA 3MFTA 4QMTA 4I0RA 1G3NA 3D7TA 2OZOA 2QOLA 5K4JA 4U81A 4BFMA 3IPHA 2WMUA 4WG5A 3TNPC 1W8CA 4CG9A 4E93A 2QD9A 2W1IA 2WQBA 4IB1A 4PRJA 4Z9LA 4FSRA 4K8AA 3O7LD 4IVDA 1OMWA 4HVHA 1FGIA 4KS7A 4CT2A 3LFQA 2OJFE 4H3PA 3RALA 4YU2A 1P4FA 3O0GA 4ZLZA 1MP8A 4C3FA 1XKKA 3HMNA 3QTZA 1JOWB 4R5YA 5DG5A 1CKJA 3G2FA 3QF9A 3FYKX 5AX3A 3BGPA 2CPKE 3OBGA 3QBNA 2VTMA 3BGZA 4P5ZA 4E5AX 5IQEA 1U54B 4EOSA 2YLFA 3LFBA 3UGCA 2VWIA 3RNIA 2RSVA 4G6LA 2BRMA 4DEGA 1XH6A 3LCTA 3OW3A 3UNZA 4BWKA 2ETKA 4IWOA 3E88A 3G6HA 3PWDA 2WMVA 4LYNA 2OXDA 5M4CA 1J7LA 2B9JA 3BQRA 2SRCA 3KEXA 3EH9A 4WNMA 2ITXA 5CALA 2JIUA 4F9WA 3MH1A 5L2SA 3IONA 3C4CA 3BEAA 1IA9A 1JWHA 2WTDA 5HVKA 3KXGA 4QTCA 1LP4A 3ZEPA 2EVAA 5D10A 4YZCA 2UW6A 4XLVA 3PJ1A 2ITPA 3DB8A 1E9HA 5KUPA 4XS2A 3VHEA 2C5YA 4YHTA 3OUKA 3E64A 4MBLA 4O0SA 4WNOA 4C7TA 4D0WA 5AP4A 4RX7A 4IANA 2A2AA 5AAEA 3S00A 3RWPA 3WZKA 4FOCA 3D7TB 1SVEA 2ZDTA 3QYZA 5CXHA 4BKYA 2ZM3A 3R63A 1YHVA 3POZA 2R7IA 1Y6AA 4EWQA 5I3OA 5JZJA 4JDJA 4YSMA 1U5QA 5TE0A 2UW5A 3E63A 3HA6A 4I94A 4O1PA 3FPMA 1J91A 1P5EA 2GNLA 2A0CX 5IQDA 4EHZA 2G01A 4MQ1A 5AR8A 3V8TA 3VC4A 2O63A 3FZTA 4RJ8A 4PL5A 2RG6A 3DV3A 4FIEA 5F95A 4N6YA 2PUIA 4FKRA 4B7TA 4A9TA 3VVHA 3EB0A 4BICA 3QTWA 1V0BA 2X7OA 4EZ5A 2CKQA 3UIXA 3VUHA 1NVSA 4OTPA 4WNPA 3GC0A 4FT5A 1X8BA 5DGZA 4ZJIA 3ZH8A 3M42A 5HCXA 2QOOA 4DTAA 4JJRA 3UQCA 1G5SA 2PVKA 2ZJWA 5B7VA 2CNVA 3ZHPC 1BUHA 4BBEA 2UV2A 4WUAA 4NIFB 2P0CA 4FKIA 3QQFA 4QP1A 2RIOA 2WMAA 2FVDA 3QRKA 1JKTA 4II5A 3U87A 4YR8A 4WG3A 4P5QA 5M56A 3Q9WA 2J6MA 2W5HA 2B4SB 3KXHA 5EDPA 4G17A 3PFQA 3F3ZA 4FI1A 5FM2A 3HMMA 5IA5A 3RGFA 2VO7A 2ITOA 5CU6A 4U97A 3IDPA 4JOAA 3A8XA 2ITVA 3I0OA 4FBXA 3EQPA 5EQYA 2JKMA 4HYHA 1ZMWA 3TDWA 5IQHA 1Y91A 1H27A 3E7VA 3GXLA 4ALVA 2XJ0A 3DZOA 3EYHA 5TO8A 3B2WA 1M2PA 2W4JA 1GZ8A 4EOKA 3A62A 5LJJA 5IDPA 4QMXA 4D1XA 3PA5A 4IIRA 4EH2A 4H05A 4YLKA 2H6DA 1PMVA 3VF9A 4AG8A 4RGJA 4DBNA 4DGLC 4FOBA 4BI0A 2I0HA 2PUNA 5BMMA 5AUZA 4HGSA 3GC7A 2OIBA 4I5PA 4EUUA 3S95A 4GKHA 3EN5A 4H58A 3ORPA 4TWPA 4TW9A 5AFVA 3NVMB 2V7OA 1OVEA 1NA7A 5DMZA 3EN6A 3FDNA 5M57A 3R73A 2YM8A 4QP6A 3SX9A 4D4YA 2WU7A 2P4IA 3AD4A 4ZSLA 3VF8A 4KINA 3WE8A 4AOIA 3L9NA 4FMQA 5I9XA 4ZLOA 3MPAA 2V0DA 3OG7A 3OUNB 4IM3A 3GOKA 3VUMA 2QOHA 3OHTA 3FE3A 5AWMA 1VYWA 3LFAA 3W2PA 4FV6A 2ONLC 4BKZA 4DGNA 5M51A 5IQIA 1Q8ZA 3LW0A 4DINA 4RZWA 3PXQA 3ZBXA 4CRLA 3ORLA 3LFCA 1Z5MA 3I81A 4L43A 1PRYA 1LEWA 3QQKA 3FMLA 4CFXA 1APME 2H34A 4U79A 4KD1A 1O6KA 2VTJA 3ZYAA 3FZPA 4TKSA 4D2TA 4JG6A 2UZVA 4V0GA 2B52A 4BTKA 4MF1A 3KCFA 1ZYCA 4BBMA 5JQ8A 2R7BA 3EL7A 3GOPA 4DH8A 5HIDA 4MF0A 1PXJA 4JRNA 4AZTA 5LVNA 4ZLYA 4PMSA 4CCBA 3LFEA 3AGLA 3P0MA 3FHRA 3QTRA 5F94A 3W2OA 3NCGA 2BHHA 3PG3A 3UNKA 2YWVA 2I0VA 4ALWA 2HW6A 2OXXA 3LJ2A 4GW8A 3C4ZA 1AQ1A 4I5CA 2YM6A 2BALA 3DJ5A 5AP7A 4YJRA 4L44A 1Y6BA 2B53A 5BX0A 4CQEA 4IAKA 4UYNA 3QALE 4BHNA 4XMOA 5CF4A 2F49A 2YJSA 4GK4A 3Q9ZA 4DFBA 3NGAA 3PVWA 4BDHA 4C4FA 5F20A 2PMOX 5L6PA 3V5WA 3FV8A 4YZNA 1OKVA 2QR7A 3UVQA 2GFSA 3FI2A 4LI5A 3UVPA 4OBQA 3ORKA 5FDXA 2J9MA 4ZK5A 2OF4A 5EI8A 5E8UA 5LMKA 1PXKA 3O71A 2YAKA 1R0EA 2JBPA 2YABA 2YZLA 3PXYA 3KULB 5AM7A 3TZ9A 4EKKA 3CPBA 3MH2A 3UVRA 2HAKA 2WXVA 4U3YA 3BU6A 3V01A 4NM5A 3NYXA 3UE4A 3THBA 3QX4A 1ZAOA 2PMIA 5EI6A 4IWPA 3DY7A 1ZMVA 4ANLA 3FLQA 4G3EA 3V5TA 4E4XA 3RPVA 3FQEA 5DBXA 4GJ2A 1H1SA 4QT1A 5LVOA 4AGWA 4FTKA 3VJNA 5DYJA 2W1GA 4O0TA 3LMGA 3O96A 5IQAA 3SG9A 2C3KA 4NCTA 2Y9QA 3SD0A 4MD7E 3BHUA 3AMYA 3ZC5A 4NW5A 4V0GB 4EOPA 4HCTA 4EOQA 4GIIA 4WIHA 3TV7A 1IAHA 2JKQA 3I6WA 3KXXA 3QTIA 1H08A 2QCSA 3E8CA 4H36A 1QPDA 3E93A 3FKLA 4RVTA 2J0JA 2GTMA 3OMVA 5CVGA 5CNNA 5J95A 5AP1A 2V62A 4RA5A 1V1KA 3C4WA 5FDPA 4H3QA 5AV3A 3AT3A 4HPTE 4RVMA 2QHMA 5CENA 3RK5A 3S2PA 3SXFA 2GPHA 3L8VA 4IB0A 3ZSIA 4MD8E 5D41A 3VBQA 4IACA 1YI6A 1ZOHA 4DEHA 3EN7A 3QD2B 1P4OA 2FH9A 3COIA 4UWBA 4FZ7A 3EQGA 4G16A 1ZY4A 5HO8A 4CLIA 4ARKA 3CBLA 3LOKA 3R30A 5AIKA 2RFSA 4G5JA 5EFQA 1J7UA 1CKPA 3QTQA 3FSKA 4FIJA 4CFMA 2BFYA 4WG4A 3VN9A 4CMUA 4O7LA 5ETFA 3QA0A 5CSWA 4FV5A 3QYWA 2X2MA 2X2LA 4GMYA 2C5XA 3CGOA 4LOPA 5DR2A 3ELJA 5H8BA 4BIDA 3BCEA 3BPRA 4EHGA 3R22A 2WTIA 3E3BX 3PPZA 4ANMA 3R7VA 2J0IA 4C4IA 3LQ3A 2IZUA 4UV0A 1KOBA 2X1NA 4FSNA 4AOTA 5I9VA 2DS1A 4KIOA 5LCKA 5HI2A 5CEKA 2QNJA 1FVVA 1Q4LA 4R1VA 4L53A 2HXQA 5JFSA 4C59A 4AGUA 5KMKA 4QD6A 3E8DA 1QPJA 1ZARA 5EW3A 5HTIA 4JNWA 4AQCA 2Y6OA 1PF8A 3EQBA 4C34A 4PDPA 2HZNA 1JNKA 1JSTA 1YOLA 4FTOA 3UYSA 3VW8A 3H9RA 4NH1A 3FXWA 1FVRA 4GT3A 4W4XA 3BYUA 2X39A 4S2ZA 4G6OA 5IG1A 3IG7A 4IEBA 3FI3A 5LOHA 4PY1A 4FZFB 5A4EA 5JFWA 3DCVA 4GFGA 3GP0A 3LFDA 2BZHB 2CLXA 4YJVA 4BWPA 3WF5A 2XNBA 4QP8A 1UA2A 2PVMA 4O0UA 4EH9A 3BZ3A 2QONA 4OTIA 3BGQA 2XIKA 1QMZA 3FY0A 2JC6A 2VTHA 5H3QA 1DM2A 3WOWA 3PTGA 5TKDA 4F0GA 3LLAA 3ACJA 1WVWA 2B7AA 1YDRE 3W33A 2HOGA 3UIMA 3DQXA 4XG3A 3VS2A 3WE4A 1JKLA 1Z9XA 1NVQA 3D9VA 3QAME 4PUZA 5AV0A 3H9OA 3ZUTA 4J8NA 3EFKA 2VRXA 4I3ZA 4C38A 5AIRA 1ERKA 4XJ0A 4DFLA 5AR7A 2C69A 3HGKA 2H96A 4QMPA 2ETRA 2GQRA 2GHLA 3FXZA 2GS6A 4UMTA 3BE2A 4B0GA 4JR3A 4C4EA 4UXQA 2HCKA 2YWPA 3CIKA 4J7BA 5KZIA 1Y8YA 4J53A 2QOIA 3TV4A 4BCPA 3G5DA 5C8KA 5L2TA 4JBOA 3VUKA 4FKJA 4IXPA 3QRIA 1KWPA 3R7OA 1GIJA 4M7IA 3UDBA 3MPTA 4O0VA 3QXOA 3FC2A 5ANEA 3L9MA 4BC6A 4F99A 3N51A 4NT4A 3QZGA 4BCIA 4EQMA 2OU7A 5M09A 5J7BA 1KUTA 3GT8A 3KRJA 4K1BA 1GIIA 3MA3A 5JSMA 3EN4A 4L45A 3WF8A 3MSSA 2BTSA 2XBJA 4C57A 4FEXA 4CSVA 5J1WA 3MH0A 4PF4A 5A46A 4R7BA 1PXPA 3FMKA 4O0YA 5JMSA 3PVBA 5BVDA 5HE0A 5CAUA 5M55A 1FVTA 4ACDA 3A7JA 3MY5A 1UV5A 2OIDA 5BVFA 2C3JA 3FL5A 3ORTA 1PMNA 3VW6A 4YJNA 2CN8A 3R0TA 4RVKA 4XG8A 5M53A 3DAJA 4U40A 2YIXA 1OKYA 1H8FA 3VS4A 3C50A 2UW8A 3DB6A 5ETCA 2ITWA 4RBLA 3H9FA 2P33A 4KUJA 2Q0BA 2X6EA 2I6LA 4D5KA 1KE9A 1OBGA 4GL9A 4O86A 2R4BA 2WNTA 3IO7A 2R3FA 4E8AA 3VIDA 4BCOA 2YERA 4EOIA 5AV1A 2YDKA 2IZTA 1FMKA 3NUYA 4DFXE 2OFUA 3MFUA 2WEIA 1UKHA 3ZC6A 4BCJA 3VS0A 3LXLA 4ZSJA 4D2RA 4TNBA 3NIEA 4MK0A 5IA3A 2A27A 3RP9A 3I5NA 2PMLX 5A3XA 3LZBA 4BKJA 3O23A 4F1OA 3DQWA 5GZ9A 4EONA 3HX4A 5IMEA 5ANOA 4Y72A 5EM7A 1NVRA 2ZMDA 4IX3A 2VD5A 4KRCA 3F2RA 5HIEA 2W96B 2VX1A 4JX3A 4QMSA 1H07A 3UP2A 4PX6A 4QPSA 1G8SA 3PRIA 4S33A 3LJ1A 3MBLA 1MRVA 4MWIA 4ZTLA 3SHEA 3P79A 4DCAA 4BI1A 3RVGA 2J90A 1H0WA 2IZSA 5CLPA 4O2PA 4FTMA 1YOMA 5DE2A 3DFCB 5CAPA 4IZYA 3O17A 3V5JA 5DR9A 5IF1A 2IVVA 5A14A 5GZAA 2PULA 4YJUA 4E5BA 4BGHA 3ZUVA 3RM6A 1YXUA 2CNUA 1H00A 2JDVA 1UVRA 4MBJA 3C51A 3N9XA 5FXQA 3NAXA 3ZU7A 4ZS4A 4IJ9A 3TKIA 4IB5A 4HVIA 5TF9A 2OJGA 4JAIA 4EC8A 2GDOA 2GCDA 3GCQA 5CQUA 4I6FA 3ZO3A 5KCVA 2HENA 3OEFX 4BYIA 3FLYA 3G6GA 3O51A 3QFVA 4P7EA 1JAMA 3MVHA 3VBWA 3ZEWA 4Y46A 1JSUA 3GEQA 2VGOA 2J50A 5JN2A 2VWYA 2CGUA 4S31A 4RQVA 2OH0E 1GOLA 2WGJA 4DEIA 4EOOA 3II5A 1ZZ2A 4V04A 3FMEA 4I0TA 3IW5A 4XX9A 4A4OA 4AN3A 1S9JA 2C6LA 2DQ7X 3TI1A 5CEPA 2IPXA 3COKA 2B9HA 4YLLA 4EQCA 3S3IA 4YTCA 5K4IA 1O6LA 3CQWA 4FTLA 4J99A 4QMVA 4QYEA 4USEA 5GJGA 2BHEA 3GCUA 1JLUE 3TTJA 2C47A 1VR2A 2GNHA 2C68A 2WOUA 4C2WA 2JITA 4D1SA 4MQ2A 3DDPA 4M66A 1I09A 2WFYA 3G33A 4JAJA 3T9IA 1H24A 2V22A 3H0ZA 4YTIA 1Q3WA 2JLDA 2CKOA 5AAGA 3W8LA 1H1RA 3ZOSA 4USFA 3SXSA 4CV9A 4O0RA 1WAKA 4FTTA 4NJDA 3UMWA 4QRCA 5CSXA 2YIYA 2IVSA 5DR6A 3CKWA 4YMJA 4O7WA 3WILA 3FI8A 4X2JA 1PW2A 3CGFA 4IDTA 3ANRA 3F9NA 3KL8A 2WKMA 3DJ7A 3P9JA 4WRGA 4DEAA 2R64A 1Q5KA 3V6RA 4X2GA 3OT8A 3OCTA 1J1CA 2JDOA 3TN8A 3ZLWA 2R3PA 5AADA 5G6VA 4FKTA 3CR0A 2QVSE 3FMJA 2IVUA 3DXNA 4PPBA 4FT7A 4CYJA 2ZYBA 3TNHA 5C1QB 4BL1A 5LVLA 3JS2A 4CKJA 5IKWA 4XP3A 5TR6A 3PXFA 4E4MA 4FEUA 4C35A 3TT0A 3HRFA 2OXYA 3RHXA 4IDVA 4RWIA 3WF6A 3FQHA 4MNEB 4X21A 4JRVA 1NXKA 4FV7A 5F4NA 2R3RA 4O91A 3CQEA 3FC1X 1K3AA 2Z7SA 1TKIA 3ZLYA 4D9TA 4GCJA 2IJMA 4ACGA 1UU3A 2BRNA 3P78A 4B9DA 2OBJA 3EHAA 1IG1A 3Q04A 3HV6A 5BUIA 2PTKA 4GVJA 4IZ5A 1YW2A 3PG1A 5GJDA 4G3CA 3AC1A 3E62A 5JZNA 4LRJA 5L8LA 2PE0A 4MNFA 5E8SA 5DT0A 1GNGA 5HG7A 3UQFA 2VO3A 3GGFA 4LGGA 4K11A 2V7AA 4D4RA 2X4FA 4ONAA 2UW0A 4U43A 4U5JA 2VTNA 3HUCA 1XO2B 4G2FA 4L00A 1BI8A 3SVVA 2NNWB 3OT3A 3KC3A 3HKOA 2XJ2A 5CT0A 4BDBA 4L3JA 2JEDA 3LE6A 3R02A 4L42A 4AN9A 5KBRA 5FTGA 2ITNA 4FGBA 4YPSA 4GG5A 4ALUA 3MJ2A 5FXSA 3QUEA 1XBBA 1UNHA 4PL4A 4AAAA 4Z7HA 3GU4A 1CSNA 1TQIA 4AT3A 3NUAA 3HLLA 2PVJA 3FWQA 3KFAA 4H1JA 5FEEA 3HP2A 3V8WA 3BX5A 3DNEA 3PY3A 4LRKA 2LAVA 3K5VA 2ZV2A 4EEVA 2WU6A 1YOJA 1IA8A 1WCCA 3MIAA 4O38A 4V01A 5HOAA 3LQ5A 1OPKA 3R8MA 5FGKA 1LPUA 5C03A 4IW0A 1BMKA 3OOMA 5BUJA 1VJYA 2ZMCA 4R3CA 2JAVA 3Q4ZA 3GU6A 3D5VA 3EOCA 3ET7A 4M84A 3C13A 2HWPA 3LMIA 4XEYA 2XK3A 3NIZA 4OBOA 4TPTA 3BLHA 3FSFA 4O1OA 2X8EA 2PMNX 4BVUA 4ZMEA 3W1FA 4R77A 4YBKA 5HO7A 1OL6A 2O2UA 4EQUA 1I44A 3HRCA 3U4UA 5AV2A 4QMOA 4KSQA 5BVNA 4C62A 4KB8A 5C9CA 2XS0A 4FSYA 4XG6A 2JGZA 2PVFA 2XYNA 4JG7A 2GMXA 4M8TA 5EHLA 3U6IA 1KE8A 2OFVA 3NNXA 3TXOA 3WIGA 2G9XA 5KMNA 4DITA 4Q5HA 4XBUA 1YXSA 1RJBA 4D9UA 2VTAA 3EQDA 3OTUA 5FLFA 2VWBA 4FV1A 5C01A 3UYTA 4BCFA 3FZ1A 4BCNA 4I5HA 3PXZA 4S32A 2XKCA 4U42A 3KMWA 5BMSA 2AUHA 1WZYA 2J5EA 2YM5A 4AW2A 3HDNA 2I40A 4NYEA 5LVMA 4U6RA 1PMEA 2YM3A 3AC5A 4MWHA 2BDFA 3I5ZA 4XCUA 3LM5A 4YNOA 2QOBA 3W2RA 4ANNA 2OZAB 3FMMA 2CGXA 2R3LA 5KE0A 5D9HA 4HYSA 2VX0A 3CTHA 2EWAA 4AE6A 4D4SA 3KN6A 1H4LA 4ZOGA 5KMOA 4UX9A 2GNFA 3EYGA 2Z60A 3QKLA 3TKUA 4XOYA 3ULZA 5C26A 2PUPA 4ASDA 2C6KA 2QURA 3F69A 4I4EA 5FTQA 4N57A 2E2BA 2XZSA 3V5QA 3ZZWA 2A1AB 4NIFA 4P90A 3GBZA 5L2IA 3ORMA 5EHOA 3FLZA 1AGWA 2NP8A 3HVCA 4C33A 3U6JA 4YP8A 3N4VA 5CWZA 3MY1A 4I93A 4NFNA 2HYYA 3RAHA 4CNHA 5DA3A 2UW3A 3QWKA 4X3FA 4EH6A 3NX8A 3AC2A 3UP7A 2C6MA 3G90X 4FNYA 4QMNA 3QHWA 3WYXA 4LV5A 4TYHA 4QMUA 5FTOA 3PDTA 3SDJA 4FNZA 5E8YA 3LHJA 3L9PA 4BIEA 2YJRA 4D28A 5KX8A 4EWHA 2QOCA 2ZB0A 3BYMA 3DZQA 2AC3A 4TYJA 3HYHA 5DH3A 4AXAA 5DFPA 3R04A 3Q6UA 4FTIA 4AW5A 4B99A 5HESA 5CQWA 5H2UA 1WFCA 5D7AA 5JGAA 1DI9A 5E4HA 4FT9A 2PE1A 5BVEA 3I0QA 3F5UA 3U55A 4I22A 3MVMA 4L3LA 4NTSA 4BTJA 3PYYA 3IOPA 2W1FA 3PJ2A 2JAMA 2PZYA 5FXRA 1MQ4A 4C3RA 1KSWA 1R39A 3TIZA 3EFJA 3CPCA 4BF2A 3NVKI 1KOAA 4G34A 2B9IA 4FTCA 4GUEA 1E1XA 3VS7A 4DGGA 2BAJA 3QTSA 3R00A 4IX5A 4CTBA 2Z02A 2Z7RA 3OS3A 2J5FA 2XH5A 5AR2A 5HE2A 1XH7A 2GHGA 4TZRA 3GQLA 4CEGA 3NW6A 3DLZA 4WBBB 3ODZX 3D5XA 3DGKA 4NWMA 3ZLSA 3GQIA 1W84A 4RIYA 4AA5A 2ITUA 2GS7A 3EKKA 4N6ZA 2R2PA 3BHHA 1REKA 2QO9A 4QNYA 2OI4X 4BCKA 3D5UA 2YHVA 4AA4A 3JY9A 3MN3A 3OC1A 2I1MA 4KWPA 4RA4A 3IKAA 5J5TA 4X2FA 2VTQA 4FIFA 4X3FB 3FY2A 4BY9E 2EU9A 2QR8A 4Q2AA 3JR1A 4UEUA 3Q60A 4RX5A 4GU6A 3SW7A 2BUJA 3CC6A 4FL2A 1YHWA 1S9IA 4TYHB 4D2WA 5CF8A 2XK8A 4E4NA 1HCLA 4LRMA 4GT5A 1YQJA 3A4OX 2DWBA 3GU7A 3DNDA 4HOKA 4I23A 3R1NA 4IH8A 2QOKA 4U80A 4ITHA 3RCDA 3KREA 2BIYA 4XYFA 3LFNA 4KNBA 4YTHA 1F3MC 4EH4A 1W0XC 5HE1A 3F5XA 4TYGA 4R6VA 4GH2A 2VTRA 2RKUA 3PLSA 2G2FA 3BU5A 4WSYA 3TUCA 1G8AA 4HGLA 2XRUA 5EM8A 5EYCA 5GZ8A 3BLRA 4ZY6A 2XM9A 4AX8A 1DAYA 4FUYA 3DAKA 3Q52A 4OTFA 1STCE 3I60A 3L1SA 5F1ZA 3GI3A 4E6QA 2YCQA 2IZRA 3FKOA 2CJMA 3DJ6A 3FBVA 2GNGA 5JFXA 3I1AA 5HX6A 4HYUA 2E9UA 2R3NA 4L67A 3QD4A 5KMIA 2WIPA 3R8LA 2WMQA 3ZDIA 2QLUA 4ZZNA 2X9EA 3CY3A 4TYIA 5J79A 4WT6A 3KULA 4IADA 4CLJA 4EYJA 3DA6A 4E1ZA 4EUTA 2PK9A 3G0FA 4RIYB 3RK9A 5HCZA 2I0YA 3R2YA 4PMTA 3U9CA 2B9FA 4IJPA 4KKEA 4E6CA 2IVTA 2OGVA 4CYIA 1OIQA 4M14A 4DT8A 2B54A 5CU3A 3BI6A 4HGTA 5EOBA 4YPDA 5L6OA 3TM0A 2XK4A 1OL2A 2X7FA 5CAVA 2OKRA 3ACKA 3EL8A 3NPCA 5HIBA 1DAWA 1XR1A 2ESMA 4FC0A 5HLWA 1OIYA 4FVPA 2XBAA 4FNWA 3VS5A 3F3TA 5ANGA 3PVUA 4FEQA 3RK7A 2GSFA 3O8UA 3GCVA 4XH6A 4DYMA 3WBLA 3D83A 3U6HA 3MESA 3AT4A 3RBWA 1OIUA 2RG5A 3AG9A 5EDQA 2HIWA 4ASEA 5LCJA 3CCNA 3UNJA 3IW7A 3F3VA 4L7FA 2YACA 3WF9A 1SVGA 1LEZA 2PE2A 1QPCA 3F5GA 3GNIB 4QOXA 4EYMA 5GIPE 3HUBA 4O0WA 4YZDA 3R9NA 3SG8A 4HZSA 5HTCA 3ZDUA 1YHSA 2G15A 1UNLA 4JI9A 3ENMA 2J4ZA 4IWQA 4X7QA 4EH5A 3O8PA 4G6NA 1E1VA 2VTTA 3ZSGA 1H28A 3F2AA 4GG7A 1OUKA 2YCFA 5HKMA 1W82A 4O7NA 4LOQA 3ETAA 4MXYA 3C0GA 1B6CB 3E7OA 3PA3A 5A9UA 4FKSA 4IE9A 1OL5A 5CU4A 1Q99A 2G2HA 3EFLA 2OW3A 3LFFA 1ZOGA 4BRXA 2F7EE 4FF8A 4L7SA 4ENYA 3ROCA 2C3LA 2VNWA 3IQ7A 4U9AA 5AM6A 5IA4A 3IDBA 3P4KA 1OZ1A 3V6SA 4C61A 5DT4A 2Y4IB 1MRUA 2BZKB 2XNOA 5IA1A 4A9RA 1ZMUA 1SMHA 2O0UA 3VBXA 4QP7A 5K5NA 2WQEA 3OCGA 4JDKA 4RX9A 2R3IA 4WSQA 4D0XA 2O3PA 5L6WL 3ZO2A 3WF7A 4GUBA 4AZFA 2W1HA 3BEGA 3ENHA 4W4VA 2J0MB 4QPMA 4EORA 1K2PA 3H10A 4P4CA 4AWIA 4IM2A 2QOFA 4BN1A 5CTPA 4EHVA 2HK5A 3MVLA 1BI7A 4MD9E 4PTGA 1H0VA 2VAGA 2WMTA 3T3VA 4L46A 4UMRA 2XK6A 5AUTA 2FUMA 5EM6A 2UZWE 3Q2MA 5ETAA 4AA0A 5HU9A 5CEMA 5I9UA 3CSVA 2JFLA 4OUCA 3EQRA 3SGCA 1URWA 3ORZA 3LCOA 2Z8CA 4KBKA 5AP5A 4EKLA 5DEWA 5J9YA 2UVZA 3JXWA 3VQUA 3KVXA 4E6DA 1Q8UA 4PDSA 1LUFA 3SQQA 1U5RA 2WMXA 3QUDA 5IH6A 4CXAA 2BAQA 4IAZA 2OK1A 4C3PA 3M2WA 2BRHA 4IZAA 4OGRA 1KE5A 4E4LA 1GZKA 4B6LA 2X9FA 3U8WA 4PP7A 2W99B 4GRBA 2HZ0A 2OF2A 2FYSA 1CTPE 2ZDUA 4MTAA 5HNGA 4AU8A 5HHWA 3O7LB 2WTKC 4L3PA 4AF3A 1B39A 4JIKA 1OGUA 3HMIA 4ACHA 5C8MA 1YWNA 3UC3A 1QL6A 3DOGA 4RIWB 3E3PA 3RPYA 3UJGA 2GFCA 3MW1A 4FKPA 2J7TA 2WTJA 1GZOA 4FSTA 3PPJA 4AZEA 3BKBA 4IVCA 3AOXA 3R9HA 3HL7A 3SLSA 3B8QA 5E8WA 4QMQA 3AMAA 4R7IA 1BX6A 4KABA 3SOCA 1BL6A 4K0YA 5IQGA 1EH4A 3SV0A 3RZBA 4Z7GA 2VWZA 5AA9A 5CX9A 2WZJA 4U44A 3GVUA 2UZLA 4U41A 4XG4A 2XYUA 2YIQA 4JVGA 2VWUA 4IHPA 3TZ7A 2Q83A 5AMNA 4QYFA 2EUFB 3LJ0A 5HG5A 2F9GA 3DTCA 4AS0A 5GJFA 2YA9A 4UMQA 4BDFA 2BDJA 5CEQA 5CU2A 3DBCA 3NMUF 4KSPA 3VO3A 4KA3A 4KIPA 4UMPA 4USDA 2E9NA 4HYIA 4QYYA 1OPLA 2BZIB 1XJDA 3MJ1A 4L9IA 2DYLA 2X8DA 2PZIA 3ZFYA 5HNIX 5JGDA 5AEPA 4EOJA 3R7UA 3MI9A 4YC3A 3BHVA 3B2TA 3FZSA 3TZ8A 4MAOA 4JXFA 3R21A 4UY9A 3BIZA 4OTDA 4W4WA 4QMWA 3TIYA 1CM8A 4J71A 4OTQA 3OWKA 3LKMA 4JR7A 4L68A 5J7HA 3OROA 4V05A 5EYDA 4HGEA 4QP4A 5HNBA 4N70A 3NWWA 4XBRA 4EH3A 1XH9A 3W55A 3O2MA 5CSPA 4YC8A 3VHKA 4GYIA 5M4FA 3VS1A 2ACXA 3E87A 2R9SA 4RFYA 3QLFA 2JDRA 2V55A 4RG0A 1OIRA 4D5HA 3TKHA
chains in the Genus database with same CATH superfamily
4FZ6A 2W1EA 3HDMA 2XRWA 5M4UA 5BYLA 3C7QA 4TYEA 4RPVA 4NL0A 2E9VA 2BPMA 3PJ3A 5FEQA 3VULA 2VWWA 4PL3A 3PUFC 1MRYA 3ZRMA 3QQLA 2H8HA 5BNJA 2WMBA 4FICA 3ZMMA 1BL7A 4FTNA 4G9RA 3H3CA 2VTLA 5L2QA 4ERKA 3ZRLA 3P7AA 5A4LA 4AXDA 3CLYA 4FK3A 4C02A 2VTOA 5JQ5A 2PZRA 3LVPA 3FHIA 3VRYA 2XKEA 5EW8A 3KGAA 3HV4A 2XK9A 3QZHA 4O4DA 5CANA 3LXPA 3Q53A 4QTAA 4OAVB 2BKKA 1WBPA 4JL9A 3IS5A 2WMRA 4ANOA 3LAUA 3BYSA 4DLJA 5HCYA 2WB8A 4JBVA 4K77A 2WEVA 5DRDA 5J8IA 3D2KA 3LLTA 3G9NA 4TY1A 2A19B 5EKOA 4ZZOA 5L3AA 4NFMA 5DRBA 5CSVA 5JRSA 3NRMA 4C4JA 1YDTE 3S0OA 1G8JA 2RFNA 3G0EA 2VO6A 5GNKA 4YTFA 3UIBA 2WQNA 4NM3A 4BDIA 5BV3A 3OOGA 1XH8A 2QO2A 3V5PA 3RAWA 4KAOA 3IOKA 3KXMA 3SKCA 3ZXZA 4I20A 3NCZA 4BDGA 1O6YA 4K6ZA 2QLQA 3QKMA 5CU0A 3F82A 4U3ZA 5AR3A 4D1ZA 1K9AA 3TZMA 2JBOA 2O64A 4D55A 1GY3A 1OL7A 3R7YA 3UPZA 4EBWA 4Y5HA 2QO7A 5FEDA 1L3RE 3QWJA 3R01A 5J87A 1H01A 2CKEA 3VNTA 4EC9A 4U45A 5BYYA 5FBNC 3LPBA 5IQCA 4AXCA 2BDWA 2P55A 5LMKC 4YO4A 5EDRA 3UC4A 2UZOA 1NY3A 3ZRKA 3UZPA 4DGMA 3MH3A 4JQ7A 2XMYA 2WTCA 3U51A 4JLCA 5IUGA 2GU8A 5KZ0A 1YDSE 3QKKA 3HNGA 3OWPA 5CY3A 3DXQA 3ATTA 4X2NA 1XQZA 4ZJVA 1PKDA 2PHKA 4CQGA 4HVDA 3AXWA 1SZMA 3Q9YA 5E1SA 2CKPA 1Q8YA 1MUOA 4ANQA 4MEDA 4AZSA 5AAFA 2QKWB 3FAAA 1H1WA 2VX3A 3ZFMA 5DT3A 4UN0C 4NCTC 1A06A 3DDQA 3DKCA 4BTMA 3BBWA 4JG8A 1CKIA 1PY5A 2Q0NA 3BU3A 3QHRA 3UDZA 4AXEA 4ZMFA 4X6QC 3PY0A 3UG1A 3CTQA 4S34A 2CCIA 2HY81 4KIKA 3TCPA 4XNEA 4HNFA 4E3CA 4F9BA 1R78A 5JH6A 1DS5A 2BKZA 3CY2A 3KRXA 3NLBA 4OR5A 5HU3A 5IEXA 4F63A 5IMXA 4E26A 2HWOA 4O7ZA 2VO0A 3ANQA 4AXFA 3MA6A 4XV3A 4MNEA 4JX7A 3EQFA 3PRFA 4FEWA 1YI3A 3KQ7A 4F1MA 1M52A 2R5TA 4LDTA 4CFWA 3GC8A 4FZAB 2C6IA 3V51A 5CT7A 4G9CA 1A48A 4FTRA 4CD0A 3Q96A 1OI9A 1WMKA 2WO6A 1YXVA 2DUVA 4P2KA 4RRVA 4Q9SA 3QCQA 3TNQB 3RCJA 1ZYLA 3BV3A 4ZIMA 4H3BA 3VAPA 5E8TA 4BB4A 4DH5A 4FL1A 4XHKB 3OBJA 4HCUA 4G3DA 1R1WA 2BAKA 4BR3A 5CI7A 4FSQA 2CN5A 4QMZA 3PE2A 3ORXA 2BRGA 3QTUA 4G31A 3A8WA 2XK7A 3P7CA 4C4HA 1JKSA 2YFXA 3NYNA 5LWNA 2RGPA 3BHTA 3SC1A 4RC2A 5EW9A 4YZMA 3L8SA 1H1PA 4OT5A 3D15A 4KKGA 2YIRA 2VNYA 4RSSA 4YURA 4QMLA 2QQ7A 3W0PA 5LMAA 4OTWA 2A4LA 4DG3E 2YLEA 3EN9A 4RX8A 3PVGA 3SW4A 4BBFA 4E73A 5KKRB 2XANA 5I9WA 3ZO4A 3TYKA 3EFWA 4FV0A 4WD5A 4AGCA 2C0IA 3IW8A 4AW1A 4GT4A 4RC4A 4X0MA 4DC2A 3F5PA 4BDDA 2NPQA 2VTSA 2W5BA 4RJ4A 4WUNA 3WZJA 3EWHA 3AQVA 5CASA 4ID7A 4RFMA 4HZRA 4KIKB 3DBEA 2PL0A 4DEBA 1ZYDA 4RFZA 3RHKA 2ZFYA 2CCHA 1OITA 1TQMA 4MCVA 4RWKA 3A7GA 3PA4A 4B8MA 2XIXA 3H4JA 5D12A 5IQBA 5CZHA 2X6DA 2GS2A 1TQPA 3ZONA 3OF0A 5CVFA 2OSCA 5JEBA 5GINE 2UUEA 3OCSA 1OGYA 5DIAA 5KMJA 3IW4A 4DN5A 3D7ZA 5B0XA 2OLCA 1XH5A 4IQ6A 1V0OA 4Z16A 3QCYA 4W8EA 5E92A 3A7HA 2J51A 5E1EA 4UALA 4MXOA 5A4CA 1M17A 3NAYA 4K2RA 4NK9A 4HW7A 4UWYA 4A06A 1F5QA 5GHVA 4O4BB 4GK3A 5FWKK 2EXCX 2KULA 3E92A 5C27A 4RJ6A 4C8BA 2FGIA 1M7NA 3AMBA 1REJA 3MWUA 4NJ3A 3GUBA 3ZLXA 4J52A 4O7SA 2XP2A 3AC3A 5M44A 4GJ3A 4BDKA 1FGKA 3KCKA 1OL1A 3FQSA 5IISA 5K0XA 3R9RA 3TG1A 2XJ1A 3PSBA 2WAJA 4ENXA 2OJIA 3COHA 4S30A 1Q24A 3LCSA 3SRVA 4JBPA 4MUQA 4CT1A 3RJCA 2WQOA 2OJJA 3AGMA 5JT2A 2P3GX 2OZAA 3K2LA 3VRZA 1GZNA 1Q97A 4W9XA 4FV3A 3QUPA 4D4VA 5HICA 3UOLA 4QMYA 4CKIA 4NKSA 4AOJA 5ANKA 3W8QA 3C5IA 3TUBA 5AP0A 1T45A 3CD3A 3TNWA 2C1AA 5K9IA 4FKVA 3O50A 1PKGA 4EI4A 2CGWA 2QU6A 4IAIA 4FSMA 2ZVAA 1PHKA 3W2SA 3CP9A 4DHFA 4ZSAA 3NDMA 4AT5A 4OLIA 4PTEA 3KF7A 2YDJA 2EXEA 4FX3A 4IC7A 3AC4A 4TN6A 2PWLA 4Y73A 4XP2A 4F7SA 4TL0A 3ZM9A 5IDNA 4QDEA 2ZM1A 3FZRA 4D2PA 5I9YA 2JDTA 3LFSA 3OTVA 4XV9A 4Y8DA 3Q3BA 4ZAUA 3C4FA 3D14A 3UOHA 3HAMA 1XWSA 5DWRA 3FL4A 4IAFA 4IFGA 2BROA 3UMXA 4AN2A 3RMFA 2XNEA 3TEIA 3QQHA 3ALNA 4UBAA 3FUPA 3WZUA 4TRLA 5E8ZA 3U4WA 4FK6A 5LWMA 4ZSEA 3KU2A 4M15A 3PIZA 4BZNA 2YCRA 3QL8A 2WTWA 2XM8A 4RLKA 4Y5QA 5EKNA 3MYGA 5J9LA 3DAEA 3W16A 4QQJA 5AV4A 3O8TA 2VTIA 4ZY5A 1OBDA 1WBVA 4I92A 3D94A 4F70A 5TT7A 3UOKA 5DEYA 2ONLA 3WARA 5HD4A 4QP9A 5EH0A 2XCHA 2XIRA 3L9LA 3VS3A 5FBOA 3I7CA 2UZEA 3PIXA 1P14A 5D11A 1ZYJA 4Y95A 1PXNA 2XEZA 2FSLX 2JD5A 2WD1A 3L8PA 4NEUA 5H8GA 3SRVB 4A7CA 2UZUE 3ZBFA 2XNGA 3K3JA 4YZ9A 4DAWA 3Q4UA 4FVQA 1M2RA 2I0EA 5DOSA 3BLQA 3PY1A 1JQHA 2HZ4A 1W2DA 3U9NA 5C8NA 5AJQA 4M97A 4HCVA 2HZIA 2C3IB 2R3QA 4L52A 4FV2A 2XKDA 4CZYB 4CMTA 3RM7A 4E7WA 2B1PA 2YIWA 3HV5A 3ATSA 1GJOA 2QU5A 4YJOA 1M14A 3MDYA 3PE1A 5E8XA 3ZM4A 1WBTA 2QC6A 3I4BA 4NM7A 5IH4A 4GKIA 3QCSA 4F09A 3DTWA 1ND4A 4Q5EA 4HVSA 2WTVA 3D2IA 3Q5IA 3Q9XA 5KNJA 1Q61A 4O4FA 2PVNA 3KKVA 3UO5A 4OBPA 3I7BA 4PP9A 3RAIA 2IO6A 2QG5A 1M7QA 4KIQA 1U59A 4OW8A 3HP5A 4AZVA 4BDAA 5DPVA 4BDCA 4JMQA 3PFYA 3GCPA 2NYAA 2UZDA 1Q41A 3NUXA 4D2SA 3BELA 1UWJA 4I1ZA 2A98A 4RC3A 3P7BA 5A6OA 5ACKA 4JBQA 5EQPA 2ZV8A 3G51A 4BZDA 5EQEA 2C6EA 3LXNA 3SXRA 4DH7A 5HLPA 4QP2A 4UB7A 4DFUA 5CEIA 5HEZA 3P08A 5EG3A 5DI1A 4O21A 3CS9A 4F4PA 5AA8A 5A6NA 3WYYA 1W2CA 4YJSA 4ZTNA 3MFRA 4KKHA 2J0KA 2VWVA 4CMOA 2Y4PA 4BGGA 2B0QA 2IF8A 2REIA 1BLXA 5DLSA 2GNJA 3CQUA 2X81A 4TXCA 2EB2A 3BBTB 3R9DA 4TWOA 3NUUA 3E8NA 4O7VA 4CFVA 4DHZA 3A99A 5FRIA 3DPKA 4FSUA 5G1XA 2O5KA 4TWCA 2Y0AA 5CZIA 3V5LA 4BJJA 4DHIB 3RAKA 2NO3A 3R7GA 2CLQA 3L8XA 1Q62A 4WA9A 3PSDA 5HBEA 4QQ5A 4JS8A 3W2CA 2OIQA 3NEWA 5E7RA 4DEEA 4EL9A 4EZ7A 3Q2JA 3CD8A 3VUTA 2VV9A 3KMUA 4K33A 3PXKA 3TJCA 4F64A 5J5SA 3JY0A 3GFEA 3ZZEA 5IPJA 3DBFA 2PYWA 2WPAA 3OY1A 2E9OA 3ITZA 3HMPA 3R6XA 4FL3A 4RQKA 1M2QA 4H1MA 4I41A 4QQCA 2XCKA 2XB7A 3WZDA 3ZCLA 4C36A 3C9WA 1UKIA 5J1VA 1IAJA 4RMZA 2I7QA 4AQKA 3OZ6A 2GNIA 4F6SA 1XH4A 1XHAA 5ANJA 2GQSA 4C2VA 5KMMA 3PLAE 2VN9A 2IN6A 4F0FA 3F66A 2UZNA 1GIHA 4FSWA 4F9YA 3Q4TA 4B8LA 1PXMA 3W2QA 3QC9A 2OO8X 3RPSA 1W83A 2QG7A 5CYIA 3Q5ZA 2C5OA 4X2KA 4R78A 3EKNA 3QTXA 4DHJA 3F3UA 4IZ7A 5FUTA 4C37A 1ZZLA 5HO6A 3QGYA 3QC4A 4R7HA 5C4KA 2YAAA 4ITIA 5DNRA 2FO0A 4O22A 4ZY4A 1VYZA 4GFOA 2YITA 3VBYA 2WQMA 5B2KA 3EMGA 4YZBA 3T9TA 3M11A 2IW6A 5B2MA 4WHZA 3S1HA 3OEZA 3DU8A 3VBVA 4ORKA 2YM4A 4I24A 4R1YA 4RIOA 3CXWA 5FP6A 1Y57A 5M06A 3PJ8A 3H0YA 4I0SA 4PV0A 1DI8A 3GENA 4JDIA 3OY3A 5DVRA 2XA4A 4EOLA 4MHAA 1GAGA 2IG7A 1ST4A 4A9YA 2UW7A 2YN8A 4F7JA 4BCQA 3TACA 4BJJB 3P5KA 1ZXEA 3RNYA 2OH4A 3HRBA 1AD5A 4LV7A 3C4XA 4XRLA 1Q8WA 2WHBA 4TTHB 4LM5A 1HOWA 2W0JA 5HG8A 2C6OA 4BCGA 1QPEA 4MBIA 3VQHA 4QYGA 4CGAA 2CMWA 3QU0A 2BRBA 4CTCA 2PVHA 3QD0A 3QGWA 3BWFA 3HA8A 1OUYA 4BTFA 3FJQE 3N4UA 3JUHA 4EBVA 4H39A 3R7EA 4MYGA 2R3HA 2C0TA 3IW6A 4FT0A 3FI4A 2W1CA 4O6EA 5LMBA 4LL5A 2UZTA 3MTLA 3N4TA 1V0PA 5LXMA 2LGCA 5AUVA 2W9ZB 4O6LA 4XRJA 3R83A 1XMMA 5E9EA 3P23A 4YHFA 4MH7A 5HVYA 4R8QA 1FBNA 2WTKB 1PXIA 1VZOA 5AUUA 1W98A 1U4DA 2X7GA 3GB2A 4MKCA 4W8DA 3DFAA 4DFYA 3KA0A 3LQ8A 5HD7A 3W32A 4WOVA 4FT3A 2R3OA 4OT6A 3EZRA 4QDVA 3GCSA 3R8UA 2F4JA 2ZV7A 3RINA 4F9AA 3OW4A 4BGQA 2EXMA 1UU9A 4R3RA 3QQJA 4ZJJA 2R3KA 3S4QA 4FE2A 2GHMA 5T68A 3NNUA 4TT7A 3QQUA 1HCKA 4ZP5A 5AUXA 5IA2A 5HORA 3CJGA 2JIVA 4ZZMA 4DH3A 2FA2A 3NSZA 3AD6A 1JVPP 2H9VA 1Q3DA 3CE3A 4IX4A 4IBMA 3PIYA 3LCKA 4J95A 3VUGA 2JDSA 4CRSA 2YDIA 5HVJA 3PP1A 4NU1A 5BVKA 3A7FA 3K3IA 5EHYA 4RJ7A 3QA8A 5IZFA 4RLLA 3OXZA 1OKWA 3IK3A 3RTPA 5HBHA 2W4OA 3ZO1A 2VWXA 4NM0A 4QTDA 1UWHA 1IASA 1YI4A 4FKOA 4NUSA 4RIWA 1WVYA 4PMMA 5K5XA 5KHXA 4DA5A 2F7XE 1KE6A 3HZTA 3GFWA 3PP0A 3ZUUA 3UBDA 4QO9A 3F7ZA 4Z55A 5IH5A 4U8ZA 2W5AA 3QRTA 2PUUA 3U54A 3FMHA 4MX9A 5JK3A 4CV8A 4JDHA 3DK6A 3FXXA 4FNXA 2Y8OA 3W10A 3UOJA 4X3FC 4EK5A 5AR5A 5CAQA 4MXXA 3V8SA 4IWDA 3K54A 4ZTSA 1ZLTA 1OECA 2QODA 3BYVA 3M1SA 4G5PA 4LOOA 5KBQA 5HX8A 4XG2A 4I6HA 4QPAA 1ZOEA 4RWLA 4ZEGA 4IC8A 4FIIA 3UO6A 3DKGA 4E6AA 4X6RA 4QTEA 4CG8A 2Z2WA 2Y6MA 4FKWA 4FODA 3UPXA 1NW1A 2RF9A 3COMA 4G3GA 4J1RA 3A2CA 1FPUA 3UZTA 4DFNA 3FKNA 3R7IA 3FLWA 4OTHA 4NZWB 5I3RA 1T46A 5HGIA 1SVHA 4F6UA 2CGVA 1YRPA 5E91A 5EK7A 3TDVA 4AE9A 5C4LA 1UU8A 4DEDA 3MY0A 4NKAA 4FSZA 4NSTA 5D7VA 3VBTA 2IEWA 4FKQA 2PSQA 3QD3A 3NS9A 4EZ3A 4O7YA 2ITTA 2XEYA 3R1QA 4DF3A 3AD5A 2Z7QA 4FTUA 4L6QA 4LUDA 3DK3A 1VEBA 4LG4A 1J7IA 2XIZA 4EK8A 2ZM4A 2EB3A 4O81A 1SNXA 2GQGA 3ROYA 1Q8TA 2BCJA 3OFMA 2F2UA 2WELA 3FYJX 2HW7A 1YXTA 4CKRA 4IX6A 1SYKA 3FMDA 3RPOA 3ULIA 3ODYX 4GU9A 3LMHA 4DBXA 4FV9A 1TVOA 4FG8A 3UTOA 3VJOA 3NW5A 4Y83A 2OWBA 1UNGA 5HTBA 3P5JC 5CI6A 2XKFA 2ERZE 3LM0A 3QXPA 4MXCA 4EJ7A 3MIYA 4F7LA 4XV1A 4J97A 3HV3A 4M3QA 4LV8A 4XUFA 3VUIA 2Z7LA 3OCBA 1A9UA 2PY3A 5FD2A 3EQIA 4PTCA 3BV2A 4EK3A 2C0OA 3MTFA 2PVYA 4LMUA 2QOQA 3R8ZA 3VWAA 4I6LA 2G1TA 5EM5A 4XV2A 4YC6A 2BVAA 4LL0A 1JPAA 5EOLA 5BVOA 4FG9A 4Q9ZA 3FEGA 2R0IA 5JKGA 4XOZA 2HELA 3ZTXA 3HMOA 5DHJA 2W1ZA 4GFMA 3PUPA 4IM0A 4CCUA 2X2KA 3A7IA 4FG7A 3CEKA 3KY2A 4GS6A 3NUPA 2ETMA 4N4SA 5FM3A 1XMLA 4GYGA 4RIXA 4WO5A 3PPKA 2P2IA 4BDJA 3T8OA 3NYOA 3REPA 3DLSA 5ANDA 5D1JA 3KVWA 3NUNA 1W2FA 2YCSA 4UYAA 5ACBC 5A4QA 2VZ6A 3GC9A 3KXNA 4WKQA 5M08A 3A4PA 4A07A 4APCA 2W17A 1IRKA 3A61A 4I6BA 1FQ1B 2Y4IC 3FLSA 4LUEA 5A4TA 2XALA 3B8RA 1KV2A 1PMUA 3D5WA 4APPA 5IU2A 3AC8A 3ORIA 2WMSA 4A9UA 2JKOA 4XG7A 3IDCA 4O83A 3QCXA 2CHLA 3T3UA 4FUXA 5CAOA 4MVFA 5CVHA 3W0QA 4XLIA 2AC5A 4F65A 5KMLA 4FR4A 4CFUA 4O84A 4FV8A 1WBWA 3TTIA 3BQCA 2RFDA 3POOA 2FSMX 4YNEA 4BCHA 4OTRA 5IEYA 3JVRA 4PNKA 4AFJA 1MQBA 3MB6A 3LXKA 4YUQA 4U0IA 2FSTX 3F6XA 4M69A 4UZHA 3TUDA 2PPQA 4WRSA 4UXLA 4O2ZA 5CNOA 1RE8A 1JSVA 5H8EA 3RZFA 5HLNA 1IEPA 3QRJA 5FP5A 1IR3A 1FMOE 1RDQE 1ZWSA 2ZAZA 4OTGA 1CMKE 4R5SA 4TNDA 5HQ0A 5L2WA 5H9BA 3P86A 5L4QA 2YEXA 4GK2A 1ZRZA 4AFEA 4NW6A 1WBSA 1BKXA 4G1WA 3BYOA 2OJ9A 3MB7A 3WIKA 1ZYSA 2BZJA 4ZTHA 3F7WA 5ITAA 2XNMA 4EK4A 4E20A 3ORNA 2W7XA 1FINA 3FLNC 2OG8A 1YWRA 2BFXA 2JIIA 3QLGA 3ALOA 4O96A 4YJQA 4AACA 5KHWA 2XF0A 2F7ZE 4RIXB 4RJ3A 3UZRA 4X3JA 3D4QA 2HY0A 5BQ0A 2PU8A 4N0SA 3VONA 2VGPA 5DN3A 3CKXA 4BHZA 4XP0A 1U46A 4EH7A 1SNUA 3CJFA 3C1XA 3NR9A 3QX2A 1JBPE 1KV1A 1CDKA 4YJPA 5AUYA 1WVXA 4J96A 3K5UA 4I21A 4PMPA 3A60A 5IUIA 4O82A 3WI6A 3HEGA 1WBNA 5I5ZA 4LFIA 5AX9A 3RPRA 3G15A 4O7TA 3OWLA 2C1BA 3DT1A 3GU5A 4C58A 3PZEA 3ZXTA 4HVGA 3QRUA 2F57A 2UZBA 3KN5A 2IWIA 3Q6WA 1SM2A 4JT3A 3UG2A 3MPMA 2RL5A 4J98A 3JPVA 3QQGA 2WOTA 4FKLA 3EQHA 3PZHA 4RZVA 4IAYA 4ZXTA 5F9EA 5JRQA 3DK7A 3EIDA 4BYJA 4ERWA 5ANIA 3KB7A 2BILB 3NNWA 1R3CA 4FKUA 4B4LA 2C6TA 4U7ZA 4FEVA 1PJKA 4FIGA 1RQQA 3D0EA 2PVRA 5T6KA 4DGOA 4ZTMA 3NUSA 4M69B 2WIHA 3FZOA 1ATPE 4IB3A 4QNAA 3RI1A 3TNIA 4BDEA 4F0IA 4ZTRA 3MV5A 3HECA 4MXZA 5LARA 1OKZA 3IECA 5B2LA 4KRDA 3BL9A 3R28A 2GTNA 4O0XA 2E9PA 3C0HA 3E8EA 3OWJA 5E90A 5J9ZA 2BR1A 4LQMA 5K3YA 4RT7A 4GV1A 3HAVA 3ML1A 4GSBA 4AZWA 2RFEA 4CZUA 5AP2A 3JYAA 3TV6A 3FMNA 3TJDA 1B38A 4C0TA 3KXZA 3OD6X 3MS9A 3TWJA 3V3VA 2X4ZA 5EYKA 5BYZA 3PJCA 4HJOA 4ITJA 4DTBA 3SA0A 4M67A 2R3MA 5AR4A 2JFMA 5BVWA 4W9WA 5CF6A 1P2AA 2ITQA 4EHEA 2PZPA 1Z57A 2BIKB 2R3JA 3DBDA 4E5WA 2C5NA 1L8TA 5ICPA 2ITZA 4RJ5A 3E5AA 3KK8A 4EJNA 4ACCA 4FTAA 4FYOA 1YVJA 4R3PA 2UW9A 5I9ZA 5IQFA 5HG9A 5T3QA 2UW4A 3F3WA 5M4IA 3I79A 1PXLA 3G9LX 4RWJA 2F2CB 5GIOE 5CEOA 4QTBA 2VU3A 3LCDA 4EOMA 3QZIA 4FTJA 5EI2A 4AW0A 4PDYA 5JGBA 3SAYA 2VTPA 4AGDA 2NRUA 4IFCA 2W4KA 2C5VA 5CS6A 4YGAA 4JIAA 5AP3A 3CTJA 4F1TA 2P2HA 3DKOA 4QYHA 3R1SA 1ZY5A 4JQEA 3R9OA 5LVPA 5IUHA 3NFGB 5K0KA 1LR4A 4CZTA 3QZFA 3UQGA 1NT2A 3LIJA 4PPCA 3SOAA 3WZEA 4EH8A 4I5MA 4FV4A 2YZAA 4PWNA 5FG8A 3EQCA 5TOZA 2CDZA 3IGOA 2J2IB 3NNVA 4ZSGA 4M0ZA 4JQ8A 3C0IA 4QMMA 1R0PA 3ID6C 5I0BA 3IGGA 3VUDA 5A54A 4FGRA 2KTYA 1J3HA 1W7HA 4L8MA 4FA2A 3Q4CA 3RWQA 5HBJA 1YXXA 4LMNA 3VS6A 2FB8A 4TWNA 5BUEA 4A9SA 1URCA 3BHYA 5M07A 4F08A 3EJ1A 2O8YA 3H30A 3F2NA 4F9CA 4DLIA 4IAAA 4ASZA 4FIHA 4A4LA 2VUWA 2R3GA 3C5UA 3ERKA 4UZDA 1F0QA 3NYVA 1H25A 1OPJA 2C4GA 3C4EA 3KK9A 4L01A 2G2IA 1XBAA 4QQTA 4FVRA 5CXZA 4CFNA 3GU8A 1PXOA 4PPAA 2C6DA 4WNKA 1YKRA 2QHNA 3AT2A 4DH1A 2O65A 2YISA 4HNIA 4QP3A 4GVAA 5JFVA 3DKFA 4KBCA 2YM7A 3TL8A 4ASXA 5L8KA 5AP6A 2ERKA 3NZ0A 4K9YA 2W1DA 4G3FA 4YLJA 2XNPA 4FZDB 3BRBA 3OXIA 3MVJA 2UVXA 4KS8A 3OVVA 1BYGA 4IMYA 4MXAA 3V04A 3UIUA 4D2VA 4YSJA 3R1YA 4K18A 4W4YA 5HZNA 1H26A 4AUAA 2WMWA 3EZVA 4ANSA 3PXRA 1G8KA 2X0GA 2ITYA 4DTKA 1O9UA 4GIHA 4UMUA 4M68A 5BPYA 5IEVA 4XG9A 2BTRA 3ZSHA 1WBOA 3ZFXA 2CSNA 1H1QA 2JKKA 2FSOX 3MFSA 4A4XA 3UODA 3P1AA 3UO4A 3KF4A 4DG2E 2PVLA 4PQNA 4BZOA 2J0LA 2BMCA 2C30A 3DXPA 4M13A 4PDOA 4HPUE 4DFZE 4RVLA 4GEOA 4KBAA 3PSCA 4I4FA 5LQFA 2XIYA 2R0UA 4FKGA 1JKKA 4YO6A 2ZV9A 1QCFA 3KRWA 4BWXA 4FRFA 2IW8A 3BWJA 2IW9A 1J1BA 4M12A 4O27B 2CNQA 2XNNA 4NTTA 3RKBA 2W05A 4FTQA 3F61A 4BI2A 4IVBA 4I6QA 2NRYA 2X8IA 2PZ5A 4UWCA 3KMMA 2Y7JA 4BIBA 3R8VA 5EYMA 4D58A 3MGYA 2UVYA 4O7RA 4OAUC 4CFFA 2AYPA 4DT9A 5E8VA 4F6WA 3OXTA 4F7NA 4IVAA 1RW8A 4DE4A 1U54A 4YHJA 2OICA 1KE7A 3Q32A 1YWVA 1XBCA 3BE9A 3DS6A 4LGHA 1Y8GA 2HXLA 3JVSA 1FOTA 2QKRA 4FYNA 3KRLA 5HE3A 3R8PA 4ZS0A 2V5QA 3R2BA 3W18A 1UU7A 4ZTQA 4J8MA 4YBJA 4ANBA 5FQDC 4DG0E 5CF5A 4AP7A 4EK6A 1OM1A 2W9FB 3PWYA 5I4NA 5L8JA 4Y85A 4C4GA 4PNIA 2W06A 4Z3VA 2XAOA 3F88A 4AT4A 3I6UA 2XVDA 4LGDA 4BCMA 5KKRC 1ST0A 5AUWA 3HV7A 3R71A 5IA0A 2ZOQA 4WBOA 3NW7A 3ZS5A 5ETIA 4CVAA 2QI8A 1PYEA 2ZB1A 3OP5A 4YJTA 3DBQA 4ACMA 5KO1A 3FPQA 4DCEA 3KRRA 5CSHA 2XUUA 2B55A 4M0YA 1OB3A 4F78A 1PYXA 3MFTA 4QMTA 4I0RA 1G3NA 3D7TA 2OZOA 2QOLA 5K4JA 4U81A 4BFMA 3IPHA 2WMUA 4WG5A 3TNPC 1W8CA 4CG9A 4E93A 2QD9A 2W1IA 2WQBA 4IB1A 4PRJA 4Z9LA 4FSRA 2XAMA 4K8AA 3O7LD 4IVDA 1OMWA 4HVHA 1FGIA 4KS7A 4CT2A 3LFQA 2OJFE 4H3PA 3RALA 4YU2A 1P4FA 3O0GA 4ZLZA 1MP8A 4C3FA 1XKKA 3HMNA 3QTZA 2X0OA 1JOWB 4R5YA 5DG5A 1CKJA 3G2FA 3QF9A 3FYKX 5AX3A 3BGPA 2CPKE 3OBGA 3QBNA 2VTMA 3BGZA 4P5ZA 4E5AX 5IQEA 1U54B 4EOSA 2YLFA 3LFBA 3UGCA 2VWIA 3RNIA 2RSVA 4G6LA 2BRMA 4DEGA 1XH6A 3LCTA 3OW3A 3UNZA 4BWKA 2ETKA 4IWOA 3E88A 3G6HA 3PWDA 2WMVA 4LYNA 2OXDA 5M4CA 1J7LA 2B9JA 3BQRA 2SRCA 3KEXA 3EH9A 4WNMA 2ITXA 5CALA 2JIUA 4F9WA 3MH1A 5L2SA 3IONA 3C4CA 3BEAA 1IA9A 1JWHA 2WTDA 5HVKA 3KXGA 4QTCA 1LP4A 3ZEPA 2EVAA 5D10A 4YZCA 2UW6A 4XLVA 3PJ1A 2ITPA 3DB8A 1E9HA 5KUPA 4XS2A 3VHEA 2C5YA 4YHTA 3OUKA 3E64A