4DFLA

Crystal structure of spleen tyrosine kinase complexed with a sulfonamidopyrazine piperidine inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
274
structure length
263
Chain Sequence
VYLDRKLLTLEDKELGSGTVKKGYYQMVVKTVAVKILPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyrazine-based Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
total genus 87
structure length 263
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dflA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dflA01
4L43A 2QI8A 4J98A 4O83A 2WGJA 1FQ1B 4O7ZA 4EWHA 3HP5A 4KIQA 2YIRA 5LVNA 4ITJA 4JQ8A 2JKKA 3O2MA 4OTPA 2X9FA 1NT2A 4C37A 4A07A 3DU8A 5CTPA 4KRDA 2FH9A 1FVRA 4I93A 4DFXE 4FZDB 4EJNA 5BYZA 2XBJA 3F5GA 3GVUA 3BLHA 3FMNA 2ITOA 2C69A 4OLIA 5HVYA 4U5JA 2C5NA 3VUMA 2RFNA 5I3OA 4BTKA 3IGGA 3MJ1A 4CLIA 4CZTA 2XYNA 5IPJA 4CCBA 3D83A 1Z57A 3MVLA 4F6WA 3QLGA 2UZOA 4YP8A 3LM0A 2EWAA 5EI6A 2ZV8A 5FXQA 4PUZA 3WBLA 4F6SA 4FX3A 4WA9A 1Q99A 4EH5A 2GU8A 2HCKA 2O5KA 3MPMA 2PVJA 3QALE 5CT7A 5A4TA 2X8IA 4O6LA 4GYGA 5LVOA 2UZDA 4BCNA 4EH7A 3KULA 3HGKA 2QC6A 3CGFA 4UYNA 1YOLA 2BPMA 4JIKA 4XX9A 2W1EA 4ZEGA 1OBGA 2HK5A 4PDPA 3FBVA 4IXPA 5IMEA 3A8WA 2PZYA 3LZBA 4AF3A 4FR4A 2QODA 2VWVA 2QHNA 3OROA 4FK3A 4WHZA 2ZJWA 3QQUA 5AA9A 5AUWA 3CBLA 4I23A 4I5HA 3A2CA 5AUZA 4AOJA 2Z02A 3QYZA 1VJYA 3ZMMA 4EOJA 3L9MA 4BCGA 3MVHA 4OTIA 3MW1A 4WBOA 3RVGA 2P4IA 1BI7A 2IVTA 2QD9A 4EC8A 5IQAA 2UV2A 3RK7A 4DFZE 1F0QA 3R04A 4ZK5A 4HGTA 4ACHA 1WBOA 3Q32A 3GP0A 4U43A 3U55A 3ZFMA 3IW4A 4XJ0A 1A48A 5M55A 1B6CB 3OY3A 4PMTA 4YHTA 4O7RA 4KA3A 2UVZA 5CI6A 4FTCA 3EHAA 5DA3A 4EBWA 4RQKA 4F4PA 3ATTA 4PTCA 2OO8X 5CX9A 5IQFA 5EW9A 3BBTB 4FT3A 4F7JA 5CYIA 4BDCA 2R7BA 3NIZA 3R1NA 1OIYA 3R9HA 4ASZA 3RK9A 2YIXA 2OJ9A 3DTWA 3PJ2A 3W18A 4ZLZA 3PXQA 3OOMA 4AQCA 3ZSHA 3DJ7A 3W2QA 4CT2A 4HJOA 3F7WA 3QBNA 5C1QB 5LVMA 2IJMA 3BI6A 4CG8A 2ZMDA 5GJFA 3EKNA 3QLFA 3P4KA 3FQHA 5CZHA 3VBQA 3BIZA 3V04A 3EJ1A 2ITZA 2OSCA 1PXNA 3TNWA 5DIAA 4M13A 1Z9XA 4KIKB 4ACDA 4Z3VA 5AJQA 4RX9A 5F95A 3IK3A 4I22A 4BIEA 4TW9A 3S0OA 2YM3A 4IZ7A 2YZAA 2C5VA 4BI0A 2BDFA 2QOFA 3F3VA 2O65A 3A7IA 3O51A 4QYGA 4BDEA 3BGZA 4NFNA 1HCLA 2GNIA 3BEAA 4BCPA 3LIJA 4UEUA 4WNMA 3HMNA 5DR2A 4KSPA 4XLIA 4FV1A 5EI2A 5TKDA 3ZC6A 1RE8A 3MESA 5KMOA 4AP7A 1JNKA 3GCVA 4S2ZA 4IWOA 4W4VA 5DLSA 1MQ4A 4KB8A 4IEBA 3LW0A 4CLJA 1PRYA 5J5TA 1O6LA 3ULIA 1O6KA 2B0QA 1P4FA 4QP9A 4ORKA 4FG7A 2XNEA 3NYNA 4RIYB 5FDPA 3RKBA 3ZS5A 1PJKA 1CTPE 4I6BA 3NUXA 4EH3A 3KXHA 1UNGA 4PTGA 4WRSA 3MTLA 5HNBA 4FKQA 4PNKA 3JS2A 3LCTA 4YZ9A 3NNVA 3R7VA 3EFWA 2ZM1A 3JPVA 1PF8A 2CCIA 1OPLA 4RSSA 1GIHA 2EXMA 3VQHA 5EOLA 3I5ZA 4HZRA 4RZVA 2YZLA 4WT6A 2VWXA 2R3QA 2X2LA 3NNUA 1YXVA 2VWYA 4GU9A 4ALVA 2PHKA 1K2PA 2ZM4A 3NW5A 1U54B 4O81A 2EXCX 4S32A 5HO6A 2IZUA 4EQCA 2ITQA 3NCZA 5LMKC 2PUPA 4FTJA 1YKRA 3I5NA 4KIOA 4XV3A 4YLKA 5AR5A 3R02A 3V5JA 3ENHA 3PE2A 4RT7A 4DG0E 5CEQA 2WTCA 4X6RA 3R6XA 5HKMA 5LMKA 4A9SA 3MTFA 3F9NA 3ZLXA 1ZY5A 3KFAA 3WF8A 3TDWA 4ZS4A 3LHJA 4FT9A 4G5PA 4MXYA 2C1BA 5CQWA 3S00A 3Q9WA 4UB7A 4HYIA 3BYVA 5AEPA 3I0OA 3GQLA 4DCAA 1YHVA 4WG4A 4IC8A 2QU6A 4QQCA 1H1QA 5HIEA 5J1WA 5LWNA 3UPZA 4YBKA 4RQVA 3VS4A 3Q3BA 3OXIA 3TKHA 3L8XA 2BAJA 2J9MA 2P0CA 4RJ7A 2W05A 4GS6A 3EQFA 3DFCB 2C3JA 4RVTA 5H8EA 3UVQA 4AFJA 4CD0A 3LQ3A 3QWKA 2CKEA 2CGUA 2BCJA 2J5EA 2OZOA 4GFGA 3WF6A 3QQGA 4IH8A 2DYLA 1TVOA 4J96A 3LFBA 2GNGA 5IEXA 3QA8A 4WIHA 3LKMA 3GBZA 5IF1A 3HMPA 4KAOA 2R0IA 3HMIA 3C7QA 3E8NA 4N4SA 3SX9A 3W55A 1G8SA 3NSZA 3UO4A 1ZMVA 3V5LA 4WSQA 3SXRA 1YWRA 1OL6A 4E8AA 5HX8A 3G15A 1Q97A 1OUKA 4KSQA 2OW3A 1W98A 2UUEA 2ITUA 5AAFA 3NR9A 5E8TA 1UWHA 4F1MA 3KXXA 4FZAB 3HEGA 4NJDA 1JAMA 3AG9A 3E8CA 4G3DA 4DITA 5M4FA 1SMHA 5DT4A 4M69A 3NNWA 4GK4A 4X2KA 1IEPA 2VN9A 3FZPA 3GU4A 4BBMA 2ETMA 4O7LA 2ESMA 4ZTHA 5M09A 4BB4A 4G3CA 3IQ7A 3PIYA 2GDOA 1ATPE 4FV5A 4IZYA 4IM3A 4IZAA 4NKSA 3H0ZA 4PMPA 5L2WA 3PXKA 3HA8A 3POZA 3Q04A 2YIYA 5T6KA 3WZUA 5IA0A 4XP2A 2HY81 3EN5A 3OXZA 3EYGA 5J8IA 4ZZOA 2B9IA 4FODA 2FSOX 2Y4IC 3Q96A 4G6LA 4O0XA 4YUQA 3FLQA 4FBXA 3ZSGA 3R2BA 4UWCA 3TZMA 2VX0A 3ZU7A 2WTWA 4TXCA 3RP9A 5GZAA 3KMWA 3GXLA 2IVSA 2GS7A 5M08A 5D7AA 3TIZA 2WU7A 2XK3A 2J51A 4TKSA 3BYUA 5CS6A 5G1XA 1LUFA 5C8NA 3R7UA 4OR5A 3FY2A 5ANIA 2V22A 4BDFA 4EBVA 1H8FA 1PY5A 1VYWA 2VTAA 2UW8A 3KEXA 2C3KA 1YDTE 3ZO3A 5HVJA 2J0IA 2BTSA 3MH0A 4U3YA 5M57A 3AC8A 2O63A 3DKFA 4DT9A 3GC0A 3A7GA 4A9YA 2WELA 1NA7A 5KBRA 3R8MA 4RLLA 4QQJA 4AGWA 4GVAA 4F7NA 3LFSA 3WZKA 4Y46A 1MUOA 3KF7A 5AUYA 5BUIA 4BDIA 4RIXA 3WZEA 2HYYA 4EZ5A 3B8QA 3PRIA 3BE2A 5C9CA 3NVKI 1OB3A 4JT3A 4I0RA 4IWQA 1QCFA 4CT1A 3HAVA 3WF9A 4Y72A 4QMPA 3G0EA 5H8GA 4EHVA 1BKXA 3NYVA 4ONAA 4XH6A 1XQZA 5IDNA 2BFXA 3CXWA 1XO2B 4FV9A 4FZ6A 3LXPA 4JXFA 5K4IA 2QOKA 4I0TA 2F7EE 2AUHA 3R00A 3V3VA 5CASA 3OUNB 3O8TA 3E8EA 3QD2B 4I5MA 3R7YA 1UWJA 3GFWA 4LQMA 3OWLA 3FQEA 2Y4PA 2B9JA 3ZDUA 4DEGA 5K0XA 3QQJA 5LCJA 4QNAA 4FNZA 2BZHB 5IUHA 3OHTA 5BVDA 2F9GA 4N57A 3A8XA 2OH0E 4I4EA 1J1CA 1ZXEA 4DC2A 3KREA 4IM2A 4KKGA 4JAIA 1F3MC 3VF9A 4UMQA 2QO9A 5F4NA 3QCXA 5AWMA 4CV8A 2CGWA 3VW8A 2ITVA 2F2UA 5CSVA 4CYJA 4FIGA 5LVPA 5EQPA 5DYJA 2UVXA 5HZNA 4NM7A 2OGVA 1UNHA 5IH4A 3PIXA 3R8UA 3PP1A 4LL0A 4BYJA 2Y6MA 2BRNA 4CKJA 5JH6A 2W1ZA 3OF0A 3FSFA 4M97A 4EK4A 3JXWA 5E92A 2IZRA 2CKQA 1ZZ2A 4I6FA 4V0GA 4ALUA 4JAJA 4A06A 3TUBA 4U3ZA 5M06A 2HIWA 2WOUA 4IAKA 5KMIA 4YJQA 4PP9A 5C27A 2R0UA 2XMYA 5EK7A 5IEYA 3RHKA 4OGRA 2PVNA 5CALA 4CNHA 5B0XA 5FG8A 4AAAA 3QX4A 3GCSA 4F9WA 4O86A 2W4KA 4EWQA 4YJRA 1OZ1A 2ETRA 2W1IA 1ZYCA 4S30A 5HBJA 4GMYA 3ZZEA 4YBJA 2GCDA 4D4RA 4YTHA 3N4VA 2AC5A 4U0IA 5AIRA 3ORTA 4JQEA 4F99A 3D9VA 4FVQA 4D58A 2QU5A 3LJ1A 3W2OA 4FI1A 4MTAA 3DKGA 3QUEA 4RIWA 1VEBA 5HE3A 1GZOA 2PVYA 1MQBA 2A1AB 3FY0A 4TWNA 2QOLA 3TXOA 4C4GA 2PZPA 4FZ7A 5AR4A 4TY1A 3QQLA 4EQUA 5HO8A 1R39A 2JDSA 5EDRA 2IW9A 3W32A 1UNLA 1KE9A 4O38A 4W9WA 3T3VA 4B0GA 3H9RA 3C1XA 2ERKA 3DBCA 3FMHA 2I6LA 4NKAA 3QTWA 3PJ8A 5AMNA 4BI2A 1PYXA 4ZTRA 4RA5A 1UKIA 4A9TA 4EJ7A 2O0UA 2JC6A 2W9ZB 3UOHA 4C4IA 3OD6X 3QA0A 2J7TA 3QRUA 4GG5A 4F9YA 3ZM4A 1OL1A 2WMWA 4HPTE 4ACCA 4FE2A 5DR6A 4DA5A 1TQIA 3R7OA 3TNHA 3LJ2A 2JBPA 4F9AA 4HVHA 3FEGA 3VIDA 4C3PA 3F3ZA 4C3FA 4C57A 4BCMA 2X8EA 1PXOA 4QMTA 5TR6A 4AX8A 3QD4A 3BLQA 3PWDA 1R0PA 2UZTA 5DBXA 3UTOA 4WNKA 4ARKA 4YTFA 3SQQA 4W9XA 1ND4A 3HX4A 4GL9A 3FC2A 4TNBA 3DXQA 3QQFA 3DDQA 4O7YA 4FSMA 5KZ0A 1PXLA 4H58A 3TNQB 4O6EA 4B9DA 3A62A 4UMRA 1FMKA 2A0CX 4D2TA 1KUTA 3FLWA 2PULA 4B7TA 2VTNA 4LM5A 2B53A 2DWBA 4O27B 3QC4A 4L7FA 4YTCA 3Q9ZA 3HV6A 4PL5A 4OUCA 4RIXB 4NIFB 2X8DA 1NY3A 2YDJA 1H1PA 3RCJA 5IMXA 2BUJA 3B8RA 4YLLA 4P5QA 2W9FB 4P5ZA 4D28A 3FYJX 4JNWA 2I0EA 3G6GA 5DNRA 3UG1A 3DBQA 2QCSA 4BBFA 4C35A 5IQHA 5F94A 1BLXA 4QPAA 5JFVA 2G1TA 4FV3A 1J7IA 4XV9A 3MN3A 4ZIMA 5CSHA 4I21A 2QLQA 2VTIA 4GIHA 3NWWA 3BQCA 3TZ8A 3LXLA 4QP3A 3RPYA 4ANQA 4DLIA 1KE8A 3HRCA 4I0SA 4AN9A 3ENMA 4RVMA 3CTHA 2ZOQA 4X2NA 3VBXA 5CANA 2OFUA 2YM4A 3PYYA 5KNJA 2XH5A 4QMWA 4RWJA 3THBA 2X1NA 2HELA 1KE5A 3G90X 5CF8A 4H3BA 2PUIA 2E2BA 2GNFA 4BDHA 2R3LA 1KOBA 4I5CA 3SW4A 4BKZA 4BCOA 5ANEA 4BDAA 4D5HA 3OCGA 4FKOA 2GHMA 2QR7A 5J79A 1OIQA 3LQ8A 5ANKA 3DBEA 4XP3A 4QMYA 5BYLA 4NL0A 4IX5A 1Q5KA 4QTCA 4Y73A 3V6SA 1LP4A 3TKUA 4FEWA 3D7TA 2X4ZA 4P4CA 2BDWA 3FAAA 2XRUA 4B8LA 3ITZA 1WMKA 5KMKA 3MDYA 3E64A 2A2AA 1BL7A 4DH3A 3LCKA 4AUAA 4MF1A 4M0ZA 5B2MA 2C0TA 1JPAA 4BDJA 4KIKA 3IONA 4RRVA 5HG5A 4FEXA 1TQPA 3MBLA 4EOPA 4XNEA 3FJQE 2W1CA 3VULA 5HEZA 4EK8A 1Q8UA 1W0XC 5EW8A 2CLQA 1ZY4A 1GOLA 3KL8A 5IQBA 4BCKA 3ZONA 3VBVA 3VF8A 4K18A 4XHKB 2P3GX 5KHXA 4FGBA 3ALNA 3FXXA 4BTMA 5KMNA 3MWUA 3PJ1A 3FI2A 3JR1A 4N70A 4ASEA 3VS7A 3RBWA 2F2CB 3BHTA 4BCFA 4X3FB 4FIIA 4D2RA 3KXNA 3UPXA 1XH4A 4C4JA 3PSDA 3AOXA 5BMSA 5KHWA 2JDTA 4X0MA 3FI3A 3DAEA 4A7CA 3VVHA 4AW5A 5CAPA 3ORLA 3Q2JA 3HL7A 4IDTA 2O64A 4QTAA 4TWPA 4ZP5A 1OECA 2XF0A 3ACKA 2WQEA 2XKCA 4WO5A 2X6EA 4FKRA 2PY3A 2BHEA 4FGRA 1O9UA 4BICA 2XJ0A 2CNQA 5BMMA 2XCHA 4E3CA 3O17A 4KNBA 1KE7A 3NEWA 4RMZA 3W2RA 5L2IA 3U6IA 1Y57A 2R7IA 3EQBA 3L8SA 3PA3A 4UBAA 4FSNA 5CNOA 2FSTX 4MNFA 3P7CA 2XP2A 2XK8A 4NIFA 4MBJA 1HCKA 3MI9A 3I79A 4FSYA 4Q9ZA 3PJCA 4G9RA 4UYAA 3E92A 5HNGA 5EG3A 2R3GA 5CWZA 3UMWA 4RC2A 2E9UA 1H1WA 4EK6A 5CT0A 5AR7A 3SXSA 1ZRZA 5IH6A 2GSFA 3FSKA 2AYPA 3QTSA 4L53A 4FT7A 4H05A 4IZ5A 1IR3A 3A4OX 3RGFA 4H1JA 3D5XA 4ZJJA 5HVKA 4OT6A 4CV9A 2JIIA 1YXTA 3P7AA 4PDOA 2VWZA 2PPQA 1VR2A 2YWPA 3H9FA 2GPHA 4ZS0A 4NTTA 2C5XA 2VWUA 1PXMA 2C3IB 2LGCA 2WTVA 3LFCA 3QF9A 4GVJA 4U97A 4DGNA 3PY0A 2CSNA 1RJBA 2FSMX 2B9HA 3MVJA 4NZWB 2IVUA 4RX7A 2A4LA 2GHLA 2Y6OA 3LAUA 4FV8A 3FMJA 2AC3A 5CXHA 3F66A 3QCQA 4FIJA 3UZTA 3D4QA 3QTIA 1ZYJA 5GIOE 2RSVA 3W1FA 1OKYA 3HUCA 3FI4A 1YRPA 3D7TB 4FUXA 2EVAA 3Q4TA 3QHRA 4C58A 3U6HA 1E1VA 4G3EA 3M1SA 3V8TA 4A4LA 3ZUTA 3ACJA 4L44A 4EH9A 4LOQA 3ZLWA 2RFDA 2WMSA 3RWQA 2R3FA 4QYFA 4BFMA 5AUUA 4O84A 4CCUA 3ULZA 2I0VA 3ANQA 3NUUA 4GK3A 3QTZA 3VN9A 4DG3E 5KBQA 1GIIA 3K3IA 4DE4A 4CEGA 3BPRA 2DQ7X 4PWNA 3VO3A 3DNEA 5D1JA 5EKNA 4ZSGA 2CN8A 4CTBA 1ZARA 2XNGA 4X2FA 2QNJA 4Z9LA 4F9BA 1ZYDA 4U81A 5D9HA 4D1ZA 4TYJA 3R1SA 3FWQA 4NH1A 4QO9A 1UU7A 5TE0A 4CFUA 4A9UA 3AD4A 4IVBA 1CDKA 2WTKB 3U54A 4G1WA 1GJOA 3SRVA 5FXRA 3VUIA 3UNJA 5HCXA 4ANMA 2R3IA 4QNYA 4APCA 4L00A 5KO1A 4C2WA 2H8HA 2ZB0A 1U54A 1WBSA 2QO2A 4J99A 4CMOA 4C8BA 2Z7SA 2WMBA 4FVPA 3GGFA 4O96A 3RJCA 3BYOA 1J7UA 5CF5A 5J1VA 4UZHA 5A54A 2CGXA 5HIBA 1KSWA 4F1OA 2Z7QA 4FSRA 2PZ5A 1Y91A 4AA5A 1H25A 2ITYA 3FDNA 1REKA 3ZRMA 4FA2A 1REJA 3H30A 4FSTA 4LRMA 4R7HA 5FBNC 2Z8CA 4MD8E 2BRBA 1A06A 3ZUUA 4EKLA 4XLVA 2WTKC 3CR0A 3IOPA 1KE6A 2JFLA 4F0FA 2B54A 4O1PA 5EHOA 4IAZA 3DAKA 4GSBA 3ZRKA 4NM0A 3ZFXA 2QOIA 3EWHA 3QCYA 4MAOA 3BRBA 4BHNA 4WG3A 4GYIA 5KE0A 2PZIA 4IM0A 5J5SA 4Y83A 4BZNA 5EHYA 1OM1A 2VTJA 4D0XA 2VTMA 4AA0A 4PL4A 2GQRA 2IO6A 4R5YA 3FKLA 3DKOA 2OWBA 3OW4A 3FLZA 1H01A 3KULB 4TNDA 3WF5A 5HNIX 3TUCA 4O7SA 1GIJA 3TM0A 4DEAA 1GZNA 3IS5A 2JDOA 1NVSA 4I6HA 3TV4A 5I9ZA 1ZLTA 2R3RA 2XS0A 3WIGA 4DT8A 4GEOA 4GJ3A 4B99A 1CMKE 3BHVA 2GHGA 5CAQA 3A4PA 1O6YA 3AD6A 5IA2A 3RAIA 3NW6A 1G5SA 4BCQA 3DNDA 2OIQA 1OL5A 4TPTA 2YACA 3AXWA 4Z7GA 3JVRA 4DH5A 3PTGA 4KKEA 3EFKA 4MQ2A 4MX9A 2R3PA 2ZVAA 4FF8A 3O7LB 3ROYA 4JG7A 2F7XE 3ORPA 4CG9A 2VO7A 2OH4A 4O22A 3EKKA 4D2WA 2ZMCA 3DS6A 4QYEA 4QRCA 2V55A 1P14A 4TRLA 3CD3A 4M69B 4U80A 4WD5A 3UYTA 3UIMA 1J91A 5AV2A 2WMQA 3QRKA 4MNEB 5EYKA 5JZJA 3OW3A 3D94A 3ORKA 4ANSA 3F69A 4DAWA 2CJMA 2VV9A 2OLCA 2E9PA 4IAYA 1W82A 4HPUE 4O0UA 1IAJA 3W2SA 5IISA 2C4GA 3C4EA 3FL4A 3BHYA 2C3LA 3DXNA 2C1AA 4PF4A 2RGPA 4ZJVA 4YNOA 1S9JA 4FSWA 3VUTA 3H0YA 3PIZA 1SZMA 2OG8A 5IEVA 5E4HA 2VAGA 4YURA 3JYAA 3DLSA 4CFVA 3NLBA 2RFEA 2XJ1A 3MB7A 4D1SA 3U51A 4V0GB 4HVGA 3CSVA 3UGCA 2YWVA 4W4XA 1V1KA 4MXCA 5I9UA 3QKMA 3KK8A 3PXZA 4KRCA 3JUHA 2R3KA 3WARA 3A7JA 4LGGA 3PXYA 4BKYA 3LMIA 4RFZA 2G2FA 4D2PA 1BX6A 1Y8GA 1UU3A 2I0YA 4A4XA 3LFDA 2PVMA 3RM7A 5E7RA 4FSQA 3VHKA 4AT4A 5E9EA 3ANRA 3HV4A 2J90A 2WTJA 5CNNA 2JLDA 4O82A 2YCFA 5EYCA 3PZHA 4ASDA 1JKTA 2XYUA 3PP0A 2ZV2A 4OTDA 2HZ0A 4FOCA 1H1SA 3HNGA 5A6OA 1H26A 3R7EA 3O50A 5F20A 4ZY5A 3VS1A 3FMEA 5I0BA 4FT0A 4JI9A 3GU5A 4E1ZA 4RIYA 5C8MA 1FPUA 2W7XA 4ZSEA 3FZOA 3UODA 4PPAA 4ZLOA 4D4SA 4ZTSA 2R2PA 3IECA 3QZHA 4GT4A 3RNYA 4O7TA 2UZVA 4XG7A 4BCIA 4K8AA 4EH2A 4ITHA 4B4LA 3SLSA 3QHWA 2Y7JA 4LV8A 3RINA 4DFYA 2OZAB 3RPRA 4C4FA 4FKPA 3AT4A 4HGSA 4C33A 3FLNC 4KUJA 2XK9A 4F63A 1JKKA 3EQDA 1SYKA 1YDSE 5A46A 4L68A 3MA3A 4FVRA 3FMDA 5FEDA 4R78A 4DBXA 3UIUA 3ORIA 1IAHA 3C4CA 2C30A 3R30A 5GHVA 3TZ9A 4ITIA 3C50A 2Q0BA 5L6OA 3H10A 4HCUA 1WBNA 3OWJA 4MKCA 5CXZA 3F3WA 4FEVA 4DTAA 4JRNA 3TTIA 4AZFA 4RWIA 3HP2A 2WXVA 3CKXA 4PPCA 4DEHA 2BKZA 3LFEA 5JGAA 2GQGA 4HVDA 1Q62A 3IDPA 2JKMA 4X21A 5K5XA 3WYXA 3I60A 1FINA 3DK3A 5C03A 3H9OA 2VO0A 5BUEA 4FMQA 2NRUA 4EHGA 2C6KA 3R9OA 2VO6A 5FD2A 5T68A 5CEPA 2UW5A 3QGWA 4O0VA 2BMCA 3EQIA 2QG7A 2JDRA 2WNTA 3G2FA 2VTSA 1OBDA 3UVRA 4M66A 1CM8A 4C0TA 2UZWE 3QQHA 4V05A 3FQSA 3A7FA 1YW2A 5HE2A 2VZ6A 2W1FA 5EM7A 3S95A 4EZ3A 5M51A 4TTHB 2ZYBA 4NSTA 5HGIA 3HDMA 3P78A 3MPAA 5E1SA 3UC4A 4QTEA 4IDVA 4AOIA 2UW4A 3TKIA 4YO6A 4YLJA 3AT2A 3QD3A 5J7HA 4IMYA 4HW7A 3NX8A 3NYOA 5E91A 5E8XA 2O2UA 5BVKA 2IG7A 4G2FA 4FKIA 3C4FA 4IANA 3K3JA 5GZ9A 4MYGA 4F0IA 3LFFA 4UALA 3LXKA 3R0TA 4BIDA 2XK7A 3U87A 3OMVA 3VUKA 3ZZWA 3NAXA 2IW8A 4J71A 2YITA 3AMYA 3I1AA 1ZOHA 4M84A 4O1OA 4IFGA 3O71A 2WU6A 4JDIA 4YSMA 5TO8A 3KXGA 4EOQA 4BZOA 2C68A 2XIZA 1OL7A 4BZDA 3F3TA 4CZYB 5I3RA 2PVHA 3QUPA 3FHIA 3COHA 1T46A 1UKHA 1YHWA 1ZAOA 2X81A 5L2SA 5AFVA 4XUFA 1W7HA 4MBIA 5K5NA 3Q52A 4PDSA 1DS5A 4TYIA 4RJ4A 4RG0A 5EI8A 1YWNA 2XEZA 1EH4A 3WIKA 4LL5A 3NS9A 1ZWSA 4YC3A 3OFMA 3CCNA 4W8EA 4AE6A 3LVPA 2GFSA 4M12A 4OTQA 2HW7A 4D55A 4Z55A 4BTJA 3F61A 3LCOA 1Q3DA 2GNLA 5JRSA 2QURA 3FMKA 3QWJA 5A4QA 5C26A 5FTGA 3HUBA 4C7TA 3IOKA 3E62A 3KCKA 4AWIA 1V0OA 5A9UA 1MRYA 3BBWA 4G9CA 2PVLA 4Y5QA 4ZXTA 5HO7A 4PL3A 4Q5HA 4L46A 3QUDA 4EKKA 4J95A 3N51A 4XG3A 3HYHA 3KQ7A 4FYOA 1M2QA 4EHEA 4UX9A 5H9BA 1LR4A 5L4QA 3ERKA 3WOWA 4UMUA 1YI6A 4ERWA 2XB7A 3GT8A 2FYSA 5JQ8A 3PFQA 2HXQA 5CU2A 5DVRA 5CEIA 1PHKA 4DF3A 2XIRA 3TV7A 3QGYA 4GK2A 3ZDIA 1WBVA 3LFNA 2OJIA 3WE4A 4ZSJA 5CSXA 4RFMA 2Q83A 4EL9A 3FKNA 1K9AA 3VS5A 2PMIA 2XNNA 3E3BX 4J1RA 4UWBA 4AU8A 3SW7A 5C4KA 3HLLA 3LE6A 4PMMA 4WOVA 3FZSA 5A3XA 3KKVA 3V51A 3FV8A 2C0IA 4QMVA 4EYJA 4U7ZA 4G16A 4QMXA 4BN1A 4QMOA 2I1MA 4RIOA 3S1HA 2NP8A 4GW8A 3L1SA 1H0VA 4YPSA 5KZIA 5AP2A 3VBWA 4DFNA 3HECA 4AW2A 4DLJA 3M11A 2A19B 1ZYLA 2A27A 3F6XA 1BUHA 1JWHA 2W17A 3WYYA 1TQMA 2HWPA 1J3HA 2WMRA 2XUUA 3HMMA 4QP8A 3O7LD 2EB2A 5AX9A 3SDJA 1R1WA 1J7LA 5B2KA 4MF0A 4H36A 4I92A 4JBQA 5AV0A 3Q6UA 3MH1A 4JDJA 4YSJA 4H39A 4XG6A 3LFQA 4U9AA 4YTIA 4MBLA 2YM7A 3TWJA 4DGGA 5ETAA 3RCDA 3TV6A 3QXPA 3NUSA 2VWWA 2XJ2A 4TWOA 1Q8WA 4QMQA 5K4JA 4JR7A 3HV7A 5DGZA 2ITWA 3O8PA 2PVRA 3MB6A 4LRKA 2C6IA 5LCKA 3ZC5A 2XIYA 4X3FC 1XBBA 3AQVA 3ELJA 4FV2A 4U40A 3ZH8A 5JQ5A 5AX3A 5J95A 3UOLA 1JSUA 4Y5HA 4C38A 4DBNA 4F6UA 3WILA 1STCE 2FO0A 4AN2A 2Z7RA 1PXPA 2OXYA 2B1PA 5AR8A 3CJFA 3NCGA 4WUNA 3VRYA 4OAUC 3R22A 4BYIA 2HXLA 2H96A 4I6QA 5EQEA 5D11A 3SOAA 2X39A 5HTIA 2JIUA 4AOTA 4DGLC 5IA4A 3NZ0A 4ZTMA 5AP5A 5DMZA 2Q0NA 4QYHA 3GQIA 4R5SA 3OEFX 5GIPE 1SVGA 2PE1A 4AGUA 5DH3A 2E9NA 3SG8A 4N0SA 4EHZA 3MY5A 4BDKA 4WKQA 3DJ5A 3FMLA 3PG1A 4YJNA 4F65A 2EUFB 4DH7A 3D0EA 3RZFA 2CMWA 4APPA 5HTBA 5M07A 3Q4ZA 3R7GA 4FNYA 1XHAA 3FZ1A 3OWPA 2OF4A 5DEYA 4FSZA 5EM5A 4JDHA 2HW6A 2R3OA 5HG9A 2XNOA 5HBEA 1QPEA 3W8LA 2UW9A 5DR9A 3LM5A 4RC3A 4FC0A 3R73A 5CEKA 4V04A 4GU6A 1YXXA 2VRXA 3QZFA 2X2MA 3FHRA 3E88A 2XZSA 3Q4UA 1OPJA 4XRLA 3NIEA 5CVFA 4ZZNA 5JT2A 4P2KA 3V5TA 3LPBA 4F64A 4LOPA 3I7CA 4XOYA 3PPJA 5GZ8A 2Y4IB 3RPSA 1UV5A 4OBPA 3FXZA 3VNTA 4Q5EA 2ZDTA 3CIKA 3S2PA 4FTRA 2XBAA 4TT7A 2C5OA 4R7IA 4CFWA 4IVCA 5HCZA 5HESA 3PSCA 4QP6A 4DN5A 5KMLA 3TDVA 3OXTA 3W2PA 2P33A 5AP7A 4LOOA 4GIIA 1BI8A 5HLWA 1YWVA 4QTDA 2C6TA 4R3PA 4CVAA 5J9ZA 2BFYA 3SD0A 2VX3A 4KBCA 2ITNA 1MP8A 4ZJIA 3W8QA 5IUGA 2QO7A 5E8UA 2G2HA 1WFCA 2W4OA 1URCA 3ZUVA 3JVSA 1JSVA 5BYYA 3GU7A 4M15A 4RZWA 3V5PA 4LGHA 1R78A 4IW0A 1SNXA 4L67A 4EOSA 3KCFA 2UZBA 1PKGA 3COMA 4FT5A 4IBMA 3ZFYA 4ERKA 5HORA 1M17A 3EOCA 5DE2A 4EC9A 3ZO4A 2B55A 3PVBA 3Q6WA 4L45A 3SKCA 3TTJA 2GTMA 2ITXA 2JAMA 3NAYA 2QOCA 2XK6A 2OF2A 4FZFB 4FEUA 3EZVA 4FV0A 4YZNA 4CTCA 3E8DA 2WEVA 2ACXA 2IZTA 3CY3A 3BWJA 2VTOA 4FV6A 4B6LA 1Q8TA 3A99A 1YI3A 3KN5A 4CFXA 4L42A 3BELA 2QR8A 4DEIA 5JGBA 3UQCA 3DJ6A 5FBOA 4AG8A 4CFMA 2OK1A 4TYGA 1U59A 1ZOEA 4L52A 4OBOA 4S33A 3KXMA 1G8AA 2X0GA 4G34A 4OTGA 2BAQA 4MXXA 3HV3A 2F4JA 2W1DA 4EOLA 5DI1A 5DN3A 3L8VA 3KRXA 1W83A 4KS8A 3DKCA 3DDPA 2JD5A 2X6DA 2SRCA 4N6YA 4BDDA 3K54A 2RKUA 1NVRA 2Y8OA 4NFMA 3QCSA 5CU6A 4EK5A 1PKDA 5FM2A 5J9YA 1M14A 5IA5A 3UG2A 2OZAA 4E5AX 3P5KA 1P4OA 2XKFA 3H4JA 3LCDA 3LCSA 5ANOA 3AMAA 3DK7A 3KMUA 3G5DA 5AP4A 4A9RA 4D9TA 5CI7A 5AP3A 4F70A 3PVWA 4CYIA 2X2KA 5IH5A 3PA4A 2CNVA 3QAME 1F5QA 3PVGA 3FC1X 1UU9A 5GJGA 4IADA 1YXSA 3ZO1A 3MFRA 3L9LA 4RIWB 3TNPC 4UZDA 2QKRA 1PMEA 2HZNA 1PMUA 2W0JA 4XYFA 5JEBA 3C4WA 3F2NA 3R2YA 3GCQA 5K0KA 5L8KA 2HAKA 1IASA 5D12A 3IDBA 3AGLA 5JGDA 3MFUA 3PZEA 4HVIA 5DRBA 4CKRA 3P79A 4CRLA 2W1GA 4O0SA 3S3IA 3QKLA 4C61A 1BMKA 4DTBA 5IQCA 2UZUE 3UO6A 2R9SA 3UO5A 4QQTA 3EN6A 2Z7LA 2BZJA 3GC9A 4FTKA 1FVTA 4USFA 3CQEA 3B2WA 4FV7A 4C02A 3QTXA 4RJ5A 4JBVA 3AGMA 4DFBA 3LXNA 4R3CA 5CF6A 3CTQA 5HTCA 2XA4A 2BAKA 4AW0A 4RC4A 1M2RA 2BRHA 3DV3A 2NNWB 3F3UA 5EFQA 2VGPA 2ETKA 2XNPA 1H24A 3OS3A 3SAYA 5JN2A 3BCEA 4USDA 2C6MA 3MVMA 5AAEA 2GTNA 2RG6A 4EOKA 3UVPA 1NVQA 1L3RE 4JBPA 1OL2A 4M7IA 2YEXA 4RFYA 3PVUA 2QOBA 4N6ZA 1K3AA 3ZOSA 3EL7A 5TF9A 4YU2A 4ZTLA 1YXUA 1XH9A 3BLRA 4MEDA 4PTEA 2XIKA 3BV3A 4EH6A 3ODZX 4ASXA 3GOKA 4BF2A 4RA4A 3BU5A 4NWMA 2FA2A 4RWLA 4YGAA 4QTBA 5AIKA 4FG9A 4AW1A 4BL1A 2PVFA 4D2VA 3SVVA 4ZTQA 1OUYA 2XKEA 5J87A 2G15A 3R1YA 3OG7A 3U8WA 3AT3A 2Z60A 2GS2A 3R9RA 3R8VA 2CGVA 2FSLX 3R8ZA 4LV5A 5FTOA 2R3JA 4I1ZA 4BWXA 2JITA 5D10A 2XK4A 2QG5A 3MJ2A 2P2HA 4GFOA 5HBHA 4NCTA 5C01A 1JLUE 1AQ1A 3DCVA 3I81A 4AT5A 1AD5A 3AC3A 5DT0A 2BZIB 2HY0A 2QOOA 2YCSA 3FPMA 3C0GA 4YJPA 3TJDA 3CP9A 3F7ZA 3FLYA 4PP7A 3P7BA 1RW8A 4ANNA 4L7SA 1IRKA 5DFPA 3KC3A 5FGKA 4UN0C 3R1QA 2JIVA 4J8NA 5E90A 4D9UA 2OIBA 5CU3A 5HG7A 4ZOGA 4QP1A 4Y95A 1M52A 3MIAA 3UZPA 4DH1A 3AC4A 3VAPA 2PU8A 3NUPA 3MPTA 4EUTA 5CAUA 4UMPA 1SM2A 2NO3A 3EZRA 3PY3A 5LOHA 3R21A 2WHBA 3M42A 1M2PA 4C34A 4RPVA 5F1ZA 3ZBFA 3UDBA 3OWKA 3L9NA 2BROA 2WD1A 1BYGA 4CXAA 2WPAA 2J0LA 4IB3A 4KIPA 5M4IA 1OIUA 3D7ZA 3MH3A 5I4NA 4YHFA 5A4EA 3A60A 4EEVA 2CHLA 4JX3A 4D2SA 2J0JA 5I9XA 4C36A 3HAMA 2CKOA 5GINE 3CY2A 3MA6A 2JEDA 4FL2A 3F5UA 3UNZA 4QYYA 3U4UA 2W5AA 5C8KA 2W5HA 2YJSA 5B2LA 2RF9A 3HZTA 4AN3A 2YAAA 3U6JA 4H1MA 1H1RA 4G3FA 4AA4A 5LMBA 3OP5A 3UE4A 4XRJA 4YJSA 3UOJA 4GJ2A 4J53A 3ZYAA 4R7BA 2WTDA 5FLFA 1JOWB 2OIDA 3CPBA 3P86A 3EYHA 4FKTA 3OTUA 2HZ4A 4Y85A 2JKOA 3UP2A 3DQXA 3GNIB 1M7NA 1W84A 3DZQA 3TJCA 3ZLSA 3R28A 4E7WA 4BR3A 2YCRA 4IJ9A 4GKHA 3CGOA 4RGJA 2W96B 4MHAA 2NPQA 1QL6A 4MWHA 2WMVA 3PSBA 4TYEA 4BBEA 4L6QA 5HIDA 4FK6A 3MY1A 4HYHA 5LVLA 3ORXA 1H28A 3NRMA 4QMUA 4RJ6A 5BVOA 3GEQA 4UXLA 4DCEA 2VWBA 1Q61A 3IPHA 3M2WA 4EK3A 3EFJA 4QD6A 2H6DA 4L3LA 2E9VA 3CS9A 4C4HA 3PLSA 5BX0A 1R3CA 5I9WA 5LXMA 2C5YA 3RWPA 4MXOA 3ROCA 1WVXA 2YLFA 3E7VA 4O0RA 3PLAE 3KA0A 4XG9A 1R0EA 2WMTA 4YMJA 5GJDA 2CDZA 3F5PA 3FZTA 1OITA 4DGMA 2JFMA 3D5WA 2C47A 4LUEA 4TWCA 3UC3A 3RPOA 4ZY4A 1E9HA 3TEIA 3T3UA 5A6NA 4IQ6A 4PDYA 2XRWA 3BKBA 3DOGA 5IQIA 4LFIA 3VS6A 3ZHPC 2VTTA 3Q2MA 1VZOA 3W10A 3MH2A 1DM2A 4D5KA 2WMUA 1MRVA 4CQEA 2FB8A 4E4LA 3EL8A 5IQDA 4P90A 4WBBB 3C51A 3RMFA 2B7AA 2RFSA 1QPDA 4G3GA 4ZZMA 3HMOA 5D7VA 4RBLA 2IVVA 5ETCA 2C6LA 3EH9A 1XH7A 2XIXA 2P55A 3LMGA 4XS2A 3R8PA 1E1XA 3SGCA 4K2RA 2CLXA 1GAGA 1PXJA 5DRDA 3T9IA 4DEBA 4E5WA 5BVWA 4YR8A 2YCQA 5IA1A 5A4LA 4X6QC 1JKSA 2VTQA 3QRIA 5EYDA 5HX6A 3FE3A 5AP1A 5G6VA 4QMSA 2WOTA 4MH7A 2KTYA 4AZEA 3QD0A 5AUTA 1KOAA 2NRYA 4ZTNA 4JR3A 4XBRA 3D14A 2WO6A 5M4CA 2YHVA 3C4XA 4BGQA 2PE0A 4KBKA 4R3RA 5DG5A 3HRBA 2W4JA 4DHFA 3I0QA 4U44A 5EHLA 4BC6A 5E8WA 3DB8A 1I44A 1YVJA 4M3QA 4U6RA 5BVNA 3TT0A 5IQGA 3EQPA 4ZAUA 1P5EA 1QMZA 1X8BA 2ERZE 2J0MB 2YDKA 4X3JA 3UQFA 4FTAA 5JK3A 4QMMA 2R3HA 1NXKA 2YA9A 5AR3A 3EN9A 4ACGA 4BHZA 1TKIA 4ANBA 1Q8ZA 2X7OA 3MYGA 4FSUA 5JMSA 4NTSA 4XP0A 4LMUA 3O23A 3B2TA 3OCSA 2XNBA 5IKWA 2ZV9A 4Z7HA 5DWRA 2G01A 2WFYA 4M8TA 4MCVA 2VTPA 1Q4LA 2QOHA 4JL9A 3WF7A 4CFFA 4F09A 2ITTA 3O8UA 3Q5IA 4GT5A 3FPQA 5TT7A 4G31A 3BX5A 4LG4A 3GOPA 2F7ZE 2PL0A 4NW5A 5AP0A 3DK6A 4EOIA 3AC2A 5BVFA 3V6RA 3IW8A 3DLZA 2IWIA 2OXDA 5IA3A 3TZ7A 3KN6A 1CKJA 3ZO2A 4YZMA 3FYKX 4R77A 4FNXA 3MFTA 4F0GA 3OY1A 4E5BA 4I94A 2XEYA 1ZOGA 3I6UA 5JSMA 3HVCA 3KXZA 4XG2A 4S34A 3U4WA 2OFVA 3QTUA 1XWSA 4IB1A 3PPKA 4JVGA 4U45A 5EW3A 5KCVA 5GNKA 5FRIA 4O2ZA 3E7OA 3KVXA 4TYHA 3VUHA 4IWPA 3IGOA 4M14A 5BQ0A 3QKKA 4AZSA 5ANJA 5DHJA 4K33A 2OJFE 4HZSA 4IX3A 4FV4A 3P08A 3D2IA 1ZYSA 1H07A 4L3PA 4J52A 2RL5A 2WQOA 4EYMA 2EXEA 4AGDA 4B8MA 2GMXA 4OT5A 4ENXA 1H27A 4AZVA 1U4DA 4IVAA 5EQYA 2PMOX 5B7VA 4OTRA 2DUVA 3A7HA 3DY7A 1OMWA 3A61A 3UBDA 4YZDA 5CAVA 4AGCA 1UVRA 4FIEA 3CE3A 4XCUA 5CZIA 5AV4A 4PNIA 5FQDC 4CFNA 4ANOA 4QOXA 2I0HA 3KRJA 2V5QA 1JQHA 4FUYA 4V01A 3NUNA 4NYEA 3CQWA 4PX6A 3VUDA 3V8SA 4EOOA 4W8DA 5CVGA 1B38A 4FKSA 3KF4A 3UMXA 3P23A 3PA5A 1SNUA 3PG3A 4IFCA 3MIYA 3NPCA 4FOBA 2V7AA 4E73A 1FMOE 5CEOA 4CKIA 4R6VA 2XKDA 2C6OA 2H9VA 2WQBA 3QZGA 4GUBA 4AZWA 1CKIA 5IQEA 4BY9E 1PW2A 3C0IA 4AFEA 4O91A 2VWIA 5K9IA 5HE0A 3I6WA 4JBOA 4KINA 5CENA 4BCJA 4QQ5A 4DFUA 4WSYA 3SC1A 3L8PA 2BKKA 3OT8A 3UNKA 3DA6A 4DYMA 4NM5A 2YIQA 4EZ7A 5HHWA 1H0WA 1OGUA 3KRLA 4DG2E 4P7EA 2YDIA 2BRMA 4YJTA 5LQFA 4PRJA 4U42A 4NM3A 2IZSA 4G17A 3KB7A 5H8BA 3GUBA 3QL8A 4FKVA 3KY2A 2YM8A 3KVWA 3DBDA 4IB0A 4KWPA 4QMLA 4RX8A 3VBTA 2W06A 3IW6A 2G9XA 3SRVB 1FVVA 4X2GA 3H3CA 3HDNA 5JFXA 4LRJA 4I3ZA 4E6QA 4EORA 3N4TA 5HICA 3R9DA 4FKUA 1H00A 4GH2A 5KX8A 4F7SA 5D41A 3PJ3A 4GCJA 3EN7A 4QP7A 3NDMA 4RVKA 4E26A 3BHHA 1OIRA 2J4ZA 4CGAA 4MQ1A 3G33A 4IAIA 2PMNX 4X7QA 2JBOA 5FM3A 2QONA 3IDCA 4UXQA 5EKOA 3SV0A 2XVDA 2UZEA 3F88A 3BU6A 3GCPA 5AAGA 1YI4A 1GZKA 3II5A 3TUDA 3Q9XA 2RIOA 2J0KA 4IAFA 5JKGA 2KULA 1M7QA 4C62A 1FBNA 3NMUF 3AC1A 3T8OA 4D1XA 2OJJA 3ALOA 4MNEA 2B9FA 4FG8A 4L9IA 1OKZA 2PVKA 4ZMEA 5K3YA 1SVHA 1PMNA 2C0OA 4FIHA 2YISA 3ETAA 3SA0A 4ZLYA 4I20A 5AUXA 2PZRA 3BEGA 3OT3A 3Q60A 5J7BA 1FGKA 1YHSA 3ID6C 5C4LA 3P0MA 5AR2A 4X3FA 3F82A 4QP2A 2B52A 4MXAA 2WMAA 3R9NA 4BRXA 2YERA 2HOGA 4E6AA 5I9VA 1W8CA 2YFXA 5A4CA 1KV2A 1V0BA 2PSQA 2WQNA 2WMXA 3EQHA 3BQRA 4K6ZA 4O7VA 4GG7A 2QOQA 1FGIA 2J5FA 4OTFA 1OKVA 1CKPA 3IG7A 2GNJA 4F08A 3OCTA 1H4LA 3EQCA 1DI8A 3FMMA 3LQ5A 5H2UA 4ZMFA 4UWYA 5ACBC 2IN6A 1GZ8A 5BUJA 1V0PA 3AMBA 3SXFA 3OC1A 4ID7A 4RJ8A 5EOBA 4FNWA 2E9OA 2J2IB 5AM7A 4RX5A 5CSPA 1P2AA 4K0YA 2C6EA 2GNHA 5CQUA 1Q8YA 3CKWA 2JGZA 4HNIA 3WZDA 4ACMA 4PMSA 4NCTC 2Y9QA 3IO7A 2X7FA 5I9YA 1XJDA 5M44A 1GY3A 1S9IA 2YABA 4H3PA 4YO4A 2BALA 3D15A 3EMGA 5HCYA 5L3AA 4PPBA 2ZB1A 4RWKA 4Q9SA 3U9CA 3R63A 4FTLA 2OU7A 3KU2A 4PV0A 3VS3A 1YDRE 3GENA 2XM8A 4BGHA 1APME 3GC7A 4FTTA 3ZEPA 4JS8A 3VQUA 3QRTA 2V7OA 2VX1A 5BPYA 3FKOA 3FXWA 1MRUA 1ZMUA 3GC8A 1Y6AA 1L8TA 3UJGA 4YZBA 3WE8A 3ORMA 1WVYA 5EM6A 4GUEA 3ZBXA 3IKAA 3Q4CA 3RPVA 4MVFA 3R71A 4IX6A 3RAHA 3TN8A 2CCHA 4WUAA 2W99B 1YOJA 1ZZLA 3F2RA 4ZSAA 3EQRA 3VBYA 3KMMA 3E63A 2CN5A 3D2KA 5FEEA 3ZLYA 5KKRC 4XV1A 1XBAA 4XV2A 3LLTA 2CPKE 2VGOA 5DPVA 2JKQA 4QMZA 4E20A 2GFCA 3C9WA 3LFAA 4E93A 1XBCA 3W2CA 2HENA 3TNIA 3VS0A 4MK0A 4PQNA 4OW8A 2VTLA 3W33A 4KABA 3NW7A 4MWIA 2VO3A 4HCVA 1DAWA 3CQUA 3O96A 1RQQA 4UMTA 4WNPA 5IUIA 2DS1A 3N9XA 1OKWA 4FKLA 2HWOA 3RTPA 4WNOA 4TL0A 4NK9A 2CNUA 2XCKA 3PXFA 4CQGA 3LMHA 4FL1A 3OTVA 4GV1A 4YZCA 4LUDA 2EU9A 3BGPA 1JBPE 2FUMA 3BHUA 4IIRA 5FWKK 4DINA 2ITPA 4CMTA 5BNJA 4EOMA 1U5QA 3CLYA 4Z16A 3FL5A 4O2PA 4Q2AA 2ZDUA 3BGQA 2R5TA 5EDQA 1PMVA 4AZTA 1U46A 4FEQA 4O0TA 5L2TA 3ZSIA 2REIA 2UZNA 3QXOA 2WAJA 5L6WL 5IDPA 1G3NA 5AA8A 5I5ZA 4AXAA 5M4UA 4GT3A 3SOCA 2UVYA 2YN8A 2GQSA 4TN6A 3BYSA 4U41A 5DOSA 5CF4A 4O0YA 3DFAA 3N4UA 3JY9A 5ETIA 2WQMA 3R01A 3C0HA 3DTCA 2ONLA 4FKJA 5AADA 3KRRA 2FVDA 2OBJA 3PY1A 5HD7A 1UU8A 4JOAA 5F9EA 3V8WA 4DGOA 2BIKB 2ZM3A 4RVLA 3KK9A 2BVAA 4BGGA 4QMNA 5A14A 4XMOA 4L8MA 3T9TA 5M53A 3RZBA 2I7QA 3ODYX 2WKMA 1Q24A 3DBFA 4U8ZA 3TCPA 3GFEA 4JG6A 3EB0A 2QHMA 4JDKA 3RM6A 4FTUA 4YC6A 3C5IA 2WZJA 4XBUA 4C59A 4EH4A 4HYSA 4WRGA 5LARA 1H08A 3GCUA 3GU8A 2VNWA 2F49A 4GFMA 5JFWA 3CEKA 5EH0A 2VUWA 3QFVA 3W16A 5AP6A 2X7GA 4IVDA 3VJNA 4DFLA 4L01A 4S31A 3MSSA 5JRQA 3QZIA 2BZKB 5CAOA 4MD7E 4HGEA 3OOGA 4O0WA 5ETFA 5CEMA 1SVEA 4PY1A 4IB5A 3OEZA 3ZTXA 5AM6A 2PE2A 3CJGA 2PTKA 1DAYA 4BIBA 4HCTA 4IACA 4MD9E 1PYEA 4JJRA 4F9CA 3DZOA 3L9PA 4YJUA 5ANGA 1B39A 3CD8A 4EUUA 5LMAA 3E3PA 3JY0A 4OTHA 4JRVA 5DT3A 5FP5A 5JFSA 3QQKA 2EB3A 3VUGA 5IZFA 1UA2A 3MV5A 3GU6A 3CC6A 2R3MA 2ONLC 3ATSA 2UW0A 1WZYA 4A4OA 4E4NA 2XNMA 1DI9A 5FXSA 2BR1A 2HZIA 3MS9A 2PUUA 3EQGA 4ENYA 1QPJA 1WVWA 4FTMA 1OI9A 4BKJA 4QPMA 5LWMA 4HVSA 2VNYA 3P1AA 5M56A 4KBAA 2B4SB 3RNIA 3OBGA 3LOKA 5JZNA 2XM9A 1FOTA 4D4YA 3EIDA 4TYHB 4OAVB 3CPCA 3POOA 1IA8A 2C6DA 3HA6A 2F57A 4F1TA 4Y8DA 4E6DA 3G6HA 3RAKA 3C4ZA 3BWFA 3LLAA 3O0GA 3TL8A 4NEUA 2OKRA 5FDXA 1JKLA 2UW3A 3DXPA 3NUAA 1LEWA 5HU3A 3QRJA 4ZY6A 2VU3A 2WIPA 4AT3A 1Y8YA 4OTWA 3ORNA 3U9NA 1U5RA 4C3RA 4FKWA 5CU4A 3VHEA 1HOWA 1WBWA 4IE9A 5CVHA 4M0YA 3Q53A 1ZMWA 2BDJA 1I09A 2UW6A 5L6PA 1BL6A 5E8YA 5H3QA 1XH8A 3HV5A 4G6NA 4DTKA 1KV1A 2Y0AA 4BDGA 1ERKA 4HGLA 3D5UA 3NGAA 1IA9A 5ANDA 5DEWA 1YOMA 4I5PA 3VW6A 4H3QA 2V62A 5HLPA 2H34A 2PMLX 4BCHA 3KRWA 1IG1A 3FLSA 3QC9A 1JSTA 4CSVA 4NT4A 2W5BA 5ACKA 2FGIA 4E4MA 4TZRA 1WBPA 2I40A 2GS6A 3G9LX 1WCCA 5HE1A 4EI4A 5HLNA 4ALWA 3DB6A 1Z5MA 4E4XA 1AGWA 1GNGA 3OVVA 5HOAA 2JAVA 2UW7A 4IWDA 5ITAA 4FYNA 4XEYA 3REPA 3HKOA 3EN4A 3PWYA 3QX2A 4HYUA 3ZCLA 1VYZA 4YJVA 2YLEA 4JIAA 5BVEA 4FICA 3OBJA 4K9YA 4J97A 2YJRA 4NU1A 5E8SA 3BU3A 3BYMA 3ZRLA 4I24A 3WI6A 4FIFA 4FTQA 1XR1A 4QT1A 3PPZA 3G9NA 4BI1A 3QYWA 4EONA 4IC7A 3C13A 3E87A 4QPSA 2OICA 4C4EA 3QU0A 4F7LA 2BHHA 4R1VA 5HG8A 3VWAA 4K1BA 4JX7A 3S4QA 3PDTA 2WB8A 2X4FA 4YC8A 4LYNA 3TG1A 3PXRA 3NUYA 1PXKA 4RJ3A 4GRBA 3RK5A 1XH5A 4X2JA 4NUSA 3E5AA 2OXXA 2R4BA 3FI8A 3K5VA 3GI3A 1URWA 4W4YA 4IAAA 5AV3A 2IPXA 5KMMA 1JVPP 5LJJA 3CTJA 3P9JA 1YQJA 5CY3A 5EYMA 2PYWA 1A9UA 4MXZA 3DPKA 5CSWA 1OVEA 5T3QA 4GKIA 2WTIA 3EFLA 5IU2A 3OUKA 3F2AA 4R8QA 4EQMA 2YAKA 4II5A 4JQ7A 4KKHA 3VJOA 3UIBA 4BVUA 3ZEWA 4IJPA 3WZJA 3RALA 1Q3WA 3RHXA 4FTIA 5FUTA 1LEZA 3NVMB 2ZAZA 3ORZA 5TOZA 4BTFA 2OI4X 3DT1A 2W1HA 3SHEA 2X9EA 4FTNA 4J7BA 5L8JA 1WBTA 3I7BA 3RI1A 4YPDA 3PRFA 5E8ZA 4FTOA 4BDBA 1J1BA 4C2VA 3D5VA 2IW6A 5HQ0A 2PWLA 3KGAA 1WAKA 4W4WA 5HU9A 5J9LA 4NW6A 3BZ3A 3TIYA 2LAVA 3V5WA 3G51A 2WIHA 2ZV7A 4HNFA 3E93A 4O7WA 3TACA 3MFSA 4K11A 5L8LA 2QKWB 2QLUA 2CKPA 3SG9A 3ET7A 1RDQE 4HOKA 3UOKA 3VC4A 3NYXA 3UQGA 5IG1A 4YHJA 3Q9YA 3UZRA 1Y6BA 4YNEA 4UY9A 4NJ3A 3UIXA 5FP6A 5FTQA 3GB2A 3UYSA 2JDVA 3VRZA 3NNXA 4E6CA 4XG4A 4BWKA 4G6OA 2VD5A 4JG8A 2R64A 5HD4A 2O3PA 3BV2A 3QTRA 5AUVA 3R7IA 5E8VA 3RAWA 4OBQA 4DEEA 3LJ0A 4L3JA 5L2QA 1CSNA 2PK9A 4AS0A 3G0FA 4I41A 2WEIA 4CMUA 1QPCA 3K2LA 4WG5A 1OPKA 4LI5A 5KMJA 5KKRB 3HRFA 2YM5A 3C5UA 3BE9A 3OZ6A 4M67A 5EM8A 2BIYA 4AACA 3MY0A 4J8MA 3R8LA 5E1EA 3V01A 4O21A 2BRGA 4AE9A 2V0DA 4K77A 2BTRA 3PE1A 4QP4A 3VS2A 4IHPA 3AD5A 5CLPA 4YJOA 4KD1A 5HI2A 4CZUA 5CU0A 5KUPA 4FL3A 1KWPA 2RG5A 4DH8A 4EH8A 3ZM9A 1PXIA 2O8YA 2G2IA 3I4BA 3DQWA 3PUPA 3Q5ZA 2Z2WA 3R83A 4D0WA 2UZLA 1LPUA 4I4FA 3ZXZA 4BWPA 3DAJA 2P2IA 5ICPA 3ZXTA 4CRSA 3F5XA 5FEQA 2R3NA 4LGDA 5EDPA 3TI1A 4ANLA 4M68A 4USEA 4JLCA 4O7NA 3AC5A 5AV1A 2J50A 2QQ7A 4LMNA 3UP7A 4FKGA 2J6MA 4XOZA 2PUNA 4RLKA 3IW5A 4IX4A 4ZSLA 3FZRA 4D4VA 2BILB 2YM6A 2OJGA 2YIWA 2QVSE 1XKKA 3MGYA 4G5JA 4KS7A 1XH6A 3K5UA 4DEDA 4UV0A 4R1YA 4U79A 3V5QA 3QTQA 3COKA 3COIA 3IW7A 4XG8A 2VTRA 3FUPA 1NW1A 3OCBA 1T45A 1Q41A 2VTHA 3DGKA
chains in the Genus database with same CATH superfamily
4L43A 2QI8A 4J98A 4O83A 2WGJA 1FQ1B 4O7ZA 4EWHA 3HP5A 4KIQA 2YIRA 5LVNA 4ITJA 4JQ8A 2JKKA 3O2MA 4OTPA 2X9FA 1NT2A 4C37A 4A07A 3DU8A 5CTPA 4KRDA 2FH9A 1FVRA 4I93A 3AKLA 4DFXE 4FZDB 4EJNA 5BYZA 2XBJA 3F5GA 3GVUA 3BLHA 3FMNA 2ITOA 2C69A 4OLIA 5HVYA 4U5JA 2C5NA 3VUMA 2RFNA 5I3OA 4BTKA 3IGGA 3MJ1A 4CLIA 4CZTA 2XYNA 5IPJA 4CCBA 3D83A 1Z57A 3MVLA 4F6WA 3QLGA 2UZOA 4YP8A 3LM0A 2EWAA 5EI6A 2ZV8A 5FXQA 4PUZA 3WBLA 4F6SA 4FX3A 4WA9A 1Q99A 4EH5A 2GU8A 2HCKA 2O5KA 3MPMA 2PVJA 3QALE 5CT7A 5A4TA 2X8IA 4O6LA 4GYGA 5LVOA 2UZDA 4BCNA 4EH7A 3KULA 3HGKA 2QC6A 3CGFA 4UYNA 1YOLA 2BPMA 4JIKA 4XX9A 2W1EA 4ZEGA 1OBGA 2HK5A 4PDPA 3FBVA 4IXPA 5IMEA 3A8WA 2PZYA 3LZBA 4AF3A 4FR4A 2QODA 2VWVA 2QHNA 3OROA 4FK3A 4WHZA 2ZJWA 3QQUA 5AA9A 5AUWA 3CBLA 4I23A 4I5HA 3A2CA 5AUZA 4AOJA 2Z02A 3QYZA 1VJYA 3ZMMA 4EOJA 3L9MA 4BCGA 3MVHA 4OTIA 3MW1A 4WBOA 3RVGA 2P4IA 1BI7A 2IVTA 2QD9A 4EC8A 5IQAA 2UV2A 3RK7A 4DFZE 1F0QA 3R04A 4F78A 4ZK5A 4HGTA 4ACHA 1WBOA 3Q32A 3GP0A 4U43A 3U55A 3ZFMA 3IW4A 4XJ0A 1A48A 5M55A 1B6CB 3OY3A 4PMTA 4YHTA 4O7RA 4KA3A 2UVZA 5CI6A 4FTCA 3EHAA 5DA3A 4EBWA 4RQKA 4F4PA 3ATTA 4PTCA 2OO8X 5CX9A 5IQFA 5EW9A 3BBTB 4FT3A 4F7JA 5CYIA 4O4CA 4BDCA 2R7BA 3NIZA 3R1NA 1OIYA 3R9HA 4ASZA 3RK9A 2YIXA 2OJ9A 3DTWA 3PJ2A 3W18A 4ZLZA 3PXQA 3OOMA 4AQCA 3ZSHA 3DJ7A 3W2QA 4CT2A 4HJOA 3F7WA 3QBNA 5C1QB 5LVMA 2IJMA 3BI6A 4CG8A 2ZMDA 5GJFA 3EKNA 3QLFA 3P4KA 3FQHA 5CZHA 3VBQA 3BIZA 3V04A 3EJ1A 2ITZA 2OSCA 1PXNA 3TNWA 5DIAA 4M13A 1Z9XA 4KIKB 4ACDA 4Z3VA 5AJQA 4RX9A 5F95A 3IK3A 4I22A 4BIEA 4TW9A 3S0OA 2YM3A 4IZ7A 2YZAA 2C5VA 4BI0A 2BDFA 2QOFA 3F3VA 2O65A 3A7IA 3O51A 4QYGA 4BDEA 3BGZA 4NFNA 1HCLA 2GNIA 3BEAA 4BCPA 3LIJA 4UEUA 4WNMA 3HMNA 5DR2A 4KSPA 4XLIA 4FV1A 5EI2A 5TKDA 3ZC6A 1RE8A 3MESA 5KMOA 4AP7A 1JNKA 3GCVA 4S2ZA 4IWOA 4W4VA 5DLSA 5BV3A 1MQ4A 4KB8A 4IEBA 3LW0A 4CLJA 1PRYA 5J5TA 1O6LA 3ULIA 1O6KA 2B0QA 1P4FA 4QP9A 4ORKA 4FG7A 2XNEA 3NYNA 4RIYB 5FDPA 3RKBA 3ZS5A 4O4BB 1PJKA 1CTPE 4I6BA 3NUXA 4EH3A 3KXHA 1UNGA 4PTGA 4WRSA 3W0QA 3MTLA 5HNBA 4FKQA 4PNKA 3JS2A 3LCTA 4YZ9A 3NNVA 3R7VA 3EFWA 2ZM1A 3JPVA 1PF8A 2CCIA 1OPLA 4RSSA 1GIHA 2EXMA 3VQHA 5EOLA 3I5ZA 4HZRA 4RZVA 2YZLA 4WT6A 2VWXA 2R3QA 2X2LA 3NNUA 1YXVA 2VWYA 4GU9A 4ALVA 2PHKA 1K2PA 2ZM4A 3NW5A 1U54B 4O81A 2EXCX 4S32A 5HO6A 2IZUA 4EQCA 2ITQA 3NCZA 5LMKC 2PUPA 3W0NA 4FTJA 1YKRA 3I5NA 4KIOA 4XV3A 4YLKA 5AR5A 3R02A 3V5JA 3ENHA 3PE2A 4RT7A 4DG0E 5CEQA 2WTCA 4X6RA 3R6XA 5HKMA 5LMKA 4A9SA 3MTFA 3F9NA 3ZLXA 1ZY5A 3KFAA 3WF8A 3TDWA 4ZS4A 3LHJA 4FT9A 4G5PA 4MXYA 2C1BA 5CQWA 3S00A 3Q9WA 4UB7A 4HYIA 3BYVA 5AEPA 3I0OA 3GQLA 4DCAA 1YHVA 4WG4A 4IC8A 2QU6A 4QQCA 1H1QA 2XAMA 5HIEA 5J1WA 5LWNA 3UPZA 4YBKA 4RQVA 3VS4A 3Q3BA 3OXIA 3TKHA 3L8XA 2BAJA 2J9MA 2P0CA 4RJ7A 2W05A 4GS6A 3EQFA 3DFCB 2C3JA 4RVTA 5H8EA 3UVQA 4AFJA 4CD0A 3LQ3A 3QWKA 2XALA 2CKEA 2CGUA 2BCJA 2J5EA 2OZOA 4GFGA 3WF6A 3QQGA 4IH8A 2DYLA 1TVOA 4J96A 3LFBA 2GNGA 5IEXA 3QA8A 4WIHA 1TFFA 3GBZA 5IF1A 3LKMA 3HMPA 4KAOA 3PUFC 2R0IA 3HMIA 3C7QA 3E8NA 4N4SA 3SX9A 3W55A 1G8SA 3NSZA 3UO4A 1ZMVA 3V5LA 4WSQA 3SXRA 1YWRA 1OL6A 4E8AA 5HX8A 3G15A 1Q97A 1OUKA 4KSQA 2OW3A 3W0RA 1W98A 2UUEA 2ITUA 5AAFA 3NR9A 5E8TA 1UWHA 4F1MA 3KXXA 4FZAB 3HEGA 4NJDA 1JAMA 3AG9A 3E8CA 4G3DA 4DITA 5M4FA 1SMHA 5DT4A 4M69A 3NNWA 4GK4A 4X2KA 1IEPA 2VN9A 3FZPA 3GU4A 4BBMA 2ETMA 4O7LA 2ESMA 4ZTHA 5M09A 4BB4A 4G3CA 3IQ7A 3PIYA 2GDOA 1ATPE 4FV5A 4IZYA 4IM3A 4IZAA 4NKSA 3H0ZA 4PMPA 5L2WA 3PXKA 3HA8A 3POZA 3Q04A 2YIYA 5T6KA 3WZUA 5IA0A 4XP2A 2HY81 3EN5A 3OXZA 3EYGA 5J8IA 4ZZOA 2B9IA 4FODA 2FSOX 2Y4IC 3Q96A 4G6LA 4O0XA 4YUQA 3FLQA 4FBXA 3ZSGA 3R2BA 4UWCA 3TZMA 2VX0A 3ZU7A 2WTWA 4TXCA 3RP9A 5GZAA 3KMWA 3GXLA 2IVSA 2GS7A 5M08A 5D7AA 3TIZA 2WU7A 2XK3A 2J51A 4TKSA 3BYUA 5CS6A 5G1XA 1LUFA 5C8NA 3R7UA 4OR5A 3FY2A 5ANIA 2V22A 4BDFA 4EBVA 1H8FA 1PY5A 1VYWA 2VTAA 2UW8A 3KEXA 2C3KA 1YDTE 3ZO3A 5HVJA 2J0IA 2BTSA 3MH0A 4U3YA 5M57A 3AC8A 2O63A 3DKFA 4DT9A 3GC0A 3A7GA 4A9YA 2WELA 1NA7A 5KBRA 3R8MA 4RLLA 4QQJA 4AGWA 4GVAA 4F7NA 3LFSA 3WZKA 4Y46A 1MUOA 3KF7A 5AUYA 5BUIA 4BDIA 4RIXA 3WZEA 2HYYA 4EZ5A 3B8QA 3PRIA 3BE2A 5C9CA 3NVKI 1OB3A 4JT3A 4I0RA 4IWQA 1QCFA 4CT1A 3HAVA 3WF9A 4Y72A 4QMPA 3G0EA 5H8GA 4EHVA 1BKXA 3NYVA 4ONAA 4XH6A 1XQZA 5IDNA 2BFXA 3CXWA 1XO2B 4FV9A 4FZ6A 3LXPA 4JXFA 5K4IA 2QOKA 4I0TA 2F7EE 2AUHA 3R00A 4DDGA 3V3VA 5CASA 3OUNB 3O8TA 3E8EA 3QD2B 4I5MA 3R7YA 1UWJA 3GFWA 4LQMA 3OWLA 3FQEA 2Y4PA 2B9JA 3ZDUA 4DEGA 5K0XA 3QQJA 5LCJA 4QNAA 4FNZA 2BZHB 5IUHA 3OHTA 5BVDA 2F9GA 4N57A 3A8XA 2OH0E 4I4EA 1J1CA 1ZXEA 4DC2A 3KREA 4IM2A 4KKGA 4JAIA 1F3MC 3VF9A 4UMQA 2QO9A 5F4NA 3QCXA 5AWMA 4CV8A 2CGWA 3VW8A 2ITVA 2F2UA 3W0SA 5CSVA 4CYJA 4FIGA 5LVPA 5EQPA 5DYJA 2UVXA 5HZNA 4NM7A 2OGVA 1UNHA 5IH4A 3PIXA 3R8UA 3PP1A 4LL0A 4BYJA 2Y6MA 2BRNA 4CKJA 5JH6A 2W1ZA 3OF0A 3FSFA 4M97A 4EK4A 3JXWA 5E92A 2IZRA 2CKQA 1ZZ2A 4I6FA 4V0GA 4ALUA 4JAJA 4A06A 3TUBA 4U3ZA 5M06A 2HIWA 2WOUA 4IAKA 5KMIA 4YJQA 4PP9A 5C27A 2R0UA 2XMYA 5EK7A 5IEYA 3RHKA 4OGRA 2PVNA 5CALA 4CNHA 5B0XA 5FG8A 4AAAA 3QX4A 3GCSA 4F9WA 4O86A 2W4KA 4EWQA 4YJRA 1OZ1A 2ETRA 2W1IA 1ZYCA 4S30A 5HBJA 4GMYA 3ZZEA 4YBJA 2GCDA 4D4RA 4YTHA 3N4VA 2AC5A 4U0IA 5AIRA 3ORTA 4JQEA 4F99A 3D9VA 4FVQA 4D58A 2QU5A 3LJ1A 3W2OA 4FI1A 4MTAA 3DKGA 3QUEA 3NFGB 4RIWA 1VEBA 5HE3A 1GZOA 2PVYA 1MQBA 2A1AB 3FY0A 3VONA 4TWNA 2QOLA 3TXOA 4C4GA 2PZPA 4FZ7A 5AR4A 4TY1A 3QQLA 4EQUA 5HO8A 4JMQA 1R39A 2JDSA 5EDRA 2IW9A 3W32A 1UNLA 1KE9A 4O38A 4W9WA 3T3VA 4B0GA 3H9RA 3UDTA 3C1XA 2ERKA 3DBCA 3FMHA 2I6LA 2XANA 4NKAA 3QTWA 3PJ8A 5AMNA 4BI2A 1PYXA 4ZTRA 4RA5A 1UKIA 4A9TA 4EJ7A 2O0UA 2JC6A 2W9ZB 3UOHA 4C4IA 3OD6X 3QA0A 2J7TA 3QRUA 4GG5A 4F9YA 3ZM4A 1OL1A 1G8JA 2WMWA 4HPTE 4ACCA 4FE2A 5DR6A 4DA5A 1TQIA 3R7OA 3TNHA 3LJ2A 2JBPA 1XMLA 4F9AA 4HVHA 3FEGA 3VIDA 4C3PA 3F3ZA 4C3FA 4C57A 4BCMA 2X8EA 1PXOA 4QMTA 5TR6A 4AX8A 3QD4A 3BLQA 3PWDA 1R0PA 2UZTA 5DBXA 3UTOA 4WNKA 4ARKA 4YTFA 3SQQA 4W9XA 1ND4A 3HX4A 4GL9A 3FC2A 4TNBA 3DXQA 3QQFA 3DDQA 4O7YA 4FSMA 5KZ0A 1PXLA 4H58A 3TNQB 4O6EA 4B9DA 3A62A 4UMRA 1FMKA 2A0CX 4D2TA 1KUTA 3FLWA 2PULA 4B7TA 2VTNA 4LM5A 2B53A 2DWBA 4O27B 3BL9A 3QC4A 4L7FA 4YTCA 3Q9ZA 3HV6A 4PL5A 4OUCA 4RIXB 4NIFB 2X8DA 1NY3A 2YDJA 1H1PA 3RCJA 5IMXA 2BUJA 3B8RA 4YLLA 4P5QA 2W9FB 4P5ZA 4D28A 3FYJX 4JNWA 2I0EA 3G6GA 1TZDA 5DNRA 3UG1A 3DBQA 2QCSA 4I6LA 4BBFA 4C35A 5IQHA 5F94A 1BLXA 4QPAA 5JFVA 2G1TA 4FV3A 1J7IA 4XV9A 3MN3A 4ZIMA 5CSHA 4I21A 2QLQA 2VTIA 4GIHA 3NWWA 3BQCA 3TZ8A 3LXLA 4QP3A 3RPYA 4ANQA 4DLIA 3UDSA 1KE8A 3HRCA 4I0SA 4AN9A 3ENMA 4RVMA 3CTHA 2ZOQA 4X2NA 3VBXA 5CANA 2OFUA 2YM4A 3PYYA 5KNJA 2XH5A 4QMWA 4RWJA 3THBA 2X1NA 2HELA 1KE5A 3G90X 5CF8A 4H3BA 2PUIA 2E2BA 2GNFA 4BDHA 2R3LA 1KOBA 4I5CA 3SW4A 4BKZA 4BCOA 5ANEA 4BDAA 4D5HA 3OCGA 4FKOA 2GHMA 2QR7A 5J79A 1OIQA 3LQ8A 5ANKA 3DBEA 4XP3A 4QMYA 5BYLA 4NL0A 4IX5A 1Q5KA 4QTCA 4Y73A 3V6SA 1LP4A 3TKUA 4FEWA 3D7TA 2X4ZA 4P4CA 2BDWA 3FAAA 2XRUA 4B8LA 3ITZA 1WMKA 5KMKA 3MDYA 3E64A 2A2AA 1BL7A 4DH3A 3LCKA 4AUAA 4MF1A 4M0ZA 5B2MA 2C0TA 1JPAA 4BDJA 4KIKA 3IONA 4RRVA 5HG5A 4FEXA 1TQPA 3MBLA 4EOPA 4XNEA 3FJQE 2W1CA 3VULA 5HEZA 4EK8A 1Q8UA 1W0XC 5EW8A 2CLQA 1ZY4A 1GOLA 3KL8A 5IQBA 4BCKA 3ZONA 3VBVA 3VF8A 4K18A 4XHKB 2P3GX 5KHXA 4FGBA 3ALNA 3FXXA 4BTMA 5KMNA 3MWUA 3PJ1A 3FI2A 3JR1A 4N70A 4ASEA 3VS7A 3RBWA 2F2CB 3BHTA 4BCFA 4X3FB 4FIIA 4D2RA 3KXNA 3UPXA 1XH4A 4C4JA 3PSDA 3AOXA 5BMSA 5KHWA 2JDTA 4X0MA 3FI3A 3DAEA 4A7CA 3VVHA 4AW5A 5CAPA 3ORLA 3Q2JA 3HL7A 4IDTA 2O64A 4QTAA 4TWPA 4ZP5A 1OECA 2XF0A 3ACKA 2WQEA 2XKCA 4WO5A 2X6EA 4FKRA 2PY3A 2BHEA 4FGRA 1O9UA 4BICA 2XJ0A 2CNQA 5BMMA 2XCHA 4E3CA 3O17A 4KNBA 1KE7A 3NEWA 4RMZA 3W2RA 5L2IA 3U6IA 1Y57A 2R7IA 3EQBA 3L8SA 3PA3A 4UBAA 4FSNA 5CNOA 2FSTX 4MNFA 3P7CA 2XP2A 2XK8A 4NIFA 4MBJA 1HCKA 3MI9A 3I79A 4FSYA 4Q9ZA 3PJCA 4G9RA 4UYAA 3E92A 5HNGA 5EG3A 2R3GA 5CWZA 3UMWA 4RC2A 2E9UA 1H1WA 4EK6A 5CT0A 5AR7A 3SXSA 1ZRZA 5IH6A 2GSFA 3FSKA 2AYPA 3QTSA 4L53A 4FT7A 4H05A 4IZ5A 1IR3A 3A4OX 3RGFA 4H1JA 3D5XA 4ZJJA 5HVKA 4OT6A 4CV9A 2JIIA 4QEBA 1YXTA 3P7AA 4PDOA 2VWZA 2PPQA 1VR2A 2YWPA 3H9FA 2GPHA 4ZS0A 4NTTA 2C5XA 2VWUA 4O4EA 1PXMA 2C3IB 2LGCA 2WTVA 3LFCA 3QF9A 4GVJA 4U97A 4DGNA 3PY0A 2CSNA 1RJBA 2FSMX 2B9HA 3MVJA 4NZWB 2IVUA 4RX7A 2A4LA 2GHLA 2Y6OA 3LAUA 4FV8A 3FMJA 2AC3A 5CXHA 3F66A 3QCQA 4FIJA 3UZTA 3D4QA 3QTIA 1ZYJA 5GIOE 2RSVA 3W1FA 1OKYA 3HUCA 3FI4A 1YRPA 3D7TB 4FUXA 2EVAA 3Q4TA 3QHRA 4C58A 3U6HA 1E1VA 4G3EA 3M1SA 3V8TA 4A4LA 3ZUTA 3ACJA 4L44A 4EH9A 4LOQA 3ZLWA 2RFDA 2WMSA 3RWQA 2R3FA 4QYFA 4BFMA 5AUUA 4O84A 4CCUA 3ULZA 2I0VA 3ANQA 3NUUA 4GK3A 3QTZA 4AQKA 3VN9A 4DG3E 5KBQA 1GIIA 3K3IA 4DE4A 4CEGA 3BPRA 2DQ7X 4PWNA 3VO3A 3DNEA 5D1JA 5EKNA 4ZSGA 2CN8A 4CTBA 1ZARA 2XNGA 4X2FA 2QNJA 4Z9LA 4F9BA 1ZYDA 4U81A 5D9HA 4D1ZA 4TYJA 3R1SA 3FWQA 4NH1A 4QO9A 1UU7A 5TE0A 4CFUA 4A9UA 3AD4A 4IVBA 1CDKA 2WTKB 3U54A 4G1WA 3TYKA 1GJOA 3SRVA 5FXRA 3VUIA 3UNJA 5HCXA 4ANMA 2R3IA 4QNYA 4APCA 4L00A 5KO1A 4C2WA 2H8HA 2ZB0A 4LDTA 1U54A 1WBSA 2QO2A 4J99A 4CMOA 4C8BA 4BJJB 2Z7SA 2WMBA 4FVPA 3GGFA 4O96A 3RJCA 3BYOA 1J7UA 5CF5A 5J1VA 4UZHA 5A54A 2CGXA 5HIBA 1KSWA 4F1OA 2Z7QA 4FSRA 2PZ5A 1Y91A 4AA5A 1H25A 2ITYA 3FDNA 1REKA 3ZRMA 4FA2A 1REJA 3H30A 4FSTA 4LRMA 4R7HA 5FBNC 2Z8CA 4MD8E 2BRBA 1A06A 3ZUUA 4EKLA 4XLVA 2WTKC 3CR0A 3IOPA 1KE6A 2JFLA 4F0FA 2B54A 4O1PA 5EHOA 4IAZA 3DAKA 4GSBA 3ZRKA 4NM0A 3ZFXA 2QOIA 3EWHA 3QCYA 4MAOA 3BRBA 4BHNA 4WG3A 4GYIA 5KE0A 2PZIA 4IM0A 5J5SA 4Y83A 4BZNA 5EHYA 1OM1A 2VTJA 4D0XA 2VTMA 4AA0A 4PL4A 2GQRA 2IO6A 4R5YA 3FKLA 3DKOA 2OWBA 3OW4A 3FLZA 1H01A 3KULB 4TNDA 3WF5A 5HNIX 3TUCA 4O7SA 1GIJA 3TM0A 4DEAA 1GZNA 3IS5A 2JDOA 1NVSA 4I6HA 3TV4A 1ST0A 5I9ZA 1ZLTA 2R3RA 2XS0A 3WIGA 4DT8A 4GEOA 4GJ3A 4B99A 1CMKE 3BHVA 2GHGA 5CAQA 3A4PA 1O6YA 3AD6A 5IA2A 3RAIA 3NW6A 1G5SA 4BCQA 3DNDA 2OIQA 1OL5A 4TPTA 2YACA 3AXWA 4Z7GA 3JVRA 4DH5A 3PTGA 4KKEA 3EFKA 4MQ2A 4MX9A 2R3PA 2ZVAA 4FF8A 3O7LB 3ROYA 4JG7A 2F7XE 3ORPA 4CG9A 2VO7A 2OH4A 4O22A 3EKKA 4D2WA 2ZMCA 3DS6A 4QYEA 4QRCA 2V55A 1P14A 4TRLA 3CD3A 4M69B 4U80A 4WD5A 3UYTA 3UIMA 1J91A 5AV2A 3ML1A 2WMQA 3QRKA 4MNEB 5EYKA 5JZJA 3OW3A 3D94A 3ORKA 4ANSA 3F69A 4DAWA 2CJMA 2VV9A 2OLCA 2E9PA 4IAYA 1W82A 4HPUE 4O0UA 1IAJA 3W2SA 5IISA 2C4GA 3C4EA 3FL4A 3BHYA 2C3LA 3DXNA 2C1AA 4PF4A 2RGPA 4ZJVA 4YNOA 1S9JA 3BL7A 4FSWA 3VUTA 3H0YA 4LV7A 3PIZA 1SZMA 2OG8A 5IEVA 5E4HA 2VAGA 4YURA 3JYAA 3DLSA 4CFVA 3NLBA 2RFEA 2XJ1A 3MB7A 4D1SA 3U51A 4V0GB 4HVGA 3CSVA 3UGCA 2YWVA 4W4XA 1V1KA 4MXCA 5I9UA 3QKMA 3KK8A 3PXZA 4KRCA 3JUHA 2R3KA 3WARA 3A7JA 4LGGA 3PXYA 4BKYA 3LMIA 4RFZA 2G2FA 4D2PA 1BX6A 1Y8GA 1UU3A 2I0YA 2X0QA 3LFDA 4A4XA 2PVMA 3RM7A 5E7RA 4FSQA 3VHKA 4AT4A 5E9EA 3ANRA 3HV4A 2J90A 2WTJA 5CNNA 2JLDA 4O82A 2YCFA 5EYCA 1OGYA 3PZHA 4ASDA 1JKTA 2XYUA 3PP0A 2ZV2A 4OTDA 2HZ0A 4FOCA 1H1SA 3HNGA 5A6OA 1H26A 3R7EA 3O50A 5F20A 4ZY5A 3VS1A 3FMEA 5I0BA 4FT0A 4JI9A 3GU5A 4E1ZA 4RIYA 5C8MA 1FPUA 2W7XA 4ZSEA 3FZOA 3UODA 4PPAA 4ZLOA 4D4SA 4ZTSA 2R2PA 3IECA 3QZHA 4GT4A 3RNYA 4O7TA 2UZVA 4XG7A 4BCIA 4K8AA 4EH2A 4ITHA 4B4LA 3SLSA 3QHWA 2Y7JA 4LV8A 3RINA 4DFYA 2OZAB 3RPRA 4C4FA 4FKPA 3AT4A 4HGSA 4C33A 3FLNC 4KUJA 2XK9A 4F63A 1JKKA 3EQDA 1SYKA 1YDSE 5A46A 4L68A 3MA3A 4FVRA 3FMDA 5FEDA 4R78A 4DBXA 3UIUA 3ORIA 1IAHA 3C4CA 2C30A 3R30A 5GHVA 3TZ9A 4ITIA 3C50A 2Q0BA 5L6OA 3H10A 4HCUA 1WBNA 3OWJA 4MKCA 5CXZA 3F3WA 1ST4A 4FEVA 4JRNA 3TTIA 4AZFA 4DTAA 4RWIA 3HP2A 2WXVA 3CKXA 4PPCA 4DEHA 2BKZA 3LFEA 5JGAA 4AXEA 2GQGA 4HVDA 1Q62A 3IDPA 2JKMA 4X21A 5K5XA 3WYXA 3I60A 1FINA 3DK3A 5C03A 3H9OA 2VO0A 5BUEA 4FMQA 2NRUA 4EHGA 2C6KA 3R9OA 2VO6A 5FD2A 1W2DA 5T68A 2UW5A 3QGWA 4O0VA 2BMCA 3EQIA 5CEPA 2QG7A 2JDRA 2WNTA 3G2FA 2VTSA 1OBDA 3UVRA 3BLAA 4M66A 1CM8A 4C0TA 2UZWE 3QQHA 4DHIB 4V05A 3FQSA 3A7FA 1YW2A 5HE2A 2VZ6A 2W1FA 5EM7A 3S95A 4EZ3A 5M51A 4TTHB 2ZYBA 4NSTA 5HGIA 3HDMA 3P78A 3MPAA 5E1SA 3UC4A 4QTEA 4IDVA 4AOIA 2UW4A 3TKIA 4YO6A 4YLJA 3AT2A 3QD3A 5J7HA 4IMYA 4HW7A 3NX8A 3NYOA 5E91A 5E8XA 2O2UA 5BVKA 2IG7A 4G2FA 4FKIA 3C4FA 4IANA 3K3JA 5GZ9A 4MYGA 4F0IA 3LFFA 4UALA 3LXKA 3R0TA 4BIDA 2XK7A 3U87A 4DHJA 3OMVA 3VUKA 3ZZWA 3NAXA 2IW8A 4J71A 2YITA 3AMYA 3I1AA 1ZOHA 4M84A 4O1OA 4IFGA 3O71A 2WU6A 4JDIA 4YSMA 5TO8A 3KXGA 4EOQA 4BZOA 2C68A 2XIZA 1OL7A 4BZDA 3F3TA 4CZYB 5I3RA 2PVHA 3QUPA 3FHIA 3COHA 1T46A 1UKHA 1YHWA 1ZAOA 2X81A 5L2SA 5AFVA 4XUFA 1W7HA 4MBIA 5K5NA 3Q52A 4PDSA 1DS5A 4TYIA 4RJ4A 4RG0A 5EI8A 1YWNA 2XEZA 1EH4A 3WIKA 4LL5A 3NS9A 1ZWSA 4YC3A 3OFMA 4FRFA 3CCNA 4W8EA 4AE6A 3LVPA 2GFSA 4M12A 4OTQA 2HW7A 4D55A 4Z55A 3AKKA 4BTJA 3F61A 3LCOA 1Q3DA 2GNLA 5JRSA 2QURA 3FMKA 3QWJA 5A4QA 5C26A 5FTGA 3HUBA 4C7TA 3IOKA 3E62A 3KCKA 4AWIA 1V0OA 5A9UA 1MRYA 3BBWA 4G9CA 2PVLA 4Y5QA 4ZXTA 5HO7A 4PL3A 4Q5HA 4L46A 3QUDA 4EKKA 4J95A 3N51A 4XG3A 3HYHA 3KQ7A 4FYOA 1M2QA 4EHEA 4UX9A 5H9BA 1LR4A 5L4QA 3ERKA 3WOWA 4UMUA 1YI6A 4ERWA 2XB7A 3GT8A 2FYSA 5JQ8A 3PFQA 2HXQA 5CU2A 5DVRA 5CEIA 1PHKA 4DF3A 2XIRA 4QDVA 3TV7A 3QGYA 4GK2A 3ZDIA 1WBVA 3LFNA 2OJIA 3WE4A 4ZSJA 5CSXA 4RFMA 2Q83A 4EL9A 3FKNA 1K9AA 3VS5A 2PMIA 2XNNA 3E3BX 4J1RA 4UWBA 4AU8A 3SW7A 5C4KA 3HLLA 3LE6A 4PMMA 4WOVA 3FZSA 5A3XA 3KKVA 3V51A 3FV8A 2C0IA 4QMVA 2A98A 4EYJA 4U7ZA 4G16A 4QMXA 4BN1A 4QMOA 2I1MA 4RIOA 3S1HA 2NP8A 4GW8A 3L1SA 1H0VA 4YPSA 5KZIA 5AP2A 3VBWA 4DFNA 3HECA 4AW2A 4DLJA 3M11A 2A19B 1ZYLA 2A27A 3F6XA 1BUHA 1JWHA 2W17A 3WYYA 1TQMA 2HWPA 1J3HA 2WMRA 2XUUA 3HMMA 4QP8A 3O7LD 2EB2A 5AX9A 3SDJA 1R1WA 1J7LA 5B2KA 4MF0A 4H36A 4I92A 4JBQA 5AV0A 3Q6UA 3MH1A 4JDJA 4YSJA 4H39A 4XG6A 3LFQA 4U9AA 4YTIA 4MBLA 2YM7A 3UDZA 3TWJA 4DGGA 5ETAA 3RCDA 3TV6A 3QXPA 3NUSA 2VWWA 2XJ2A 4TWOA 1Q8WA 4QMQA 5K4JA 4JR7A 3HV7A 5DGZA 2ITWA 3O8PA 2PVRA 3MB6A 4LRKA 2C6IA 5LCKA 3ZC5A 2XIYA 4X3FC 1XBBA 3AQVA 3ELJA 4FV2A 4U40A 3ZH8A 5JQ5A 5AX3A 5J95A 3UOLA 1JSUA 4Y5HA 4C38A 4DBNA 4F6UA 3WILA 1STCE 2FO0A 4AN2A 2Z7RA 1PXPA 2OXYA 2B1PA 5AR8A 3CJFA