4P4CA

Human epha3 kinase domain in complex with quinoxaline derivatives
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
292
structure length
266
Chain Sequence
AKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITPSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords EPH receptor A3
publication title Pyrrolo[3,2-b]quinoxaline Derivatives as Types I1/2 and II Eph Tyrosine Kinase Inhibitors: Structure-Based Design, Synthesis, and in Vivo Validation.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 266
sequence length 292
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4p4cA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4p4cA01
2GFCA 1QL6A 2GNGA 3WZDA 5L2WA 4RFZA 3RNIA 4V01A 4EHVA 2O8YA 2P2HA 2B7AA 5CU0A 4C62A 5L3AA 4QP9A 1ZRZA 4BDHA 4JDHA 2BZJA 5HO7A 3T9IA 3AC4A 4X3FC 1PHKA 2C30A 2XYNA 3PVUA 4JBQA 2WTJA 4FL1A 4XG4A 3SW4A 2BVAA 3MFRA 3LCTA 2W9ZB 3DT1A 5IUGA 3BHYA 1JKLA 4QTCA 3ROCA 3R1QA 4JT3A 3ZEWA 3LFNA 4J52A 3AD5A 3BCEA 3RAHA 4BKYA 5HE1A 3PSBA 3UZPA 1RQQA 4YHTA 4O84A 3R7UA 3NW7A 4RJ5A 3HMIA 4PDPA 1K2PA 1MP8A 4MD7E 2PHKA 5CNNA 4AA4A 4TTHB 3LFBA 1OZ1A 1V0OA 4O0WA 1Q97A 3G6HA 2XIRA 3E93A 2QKWB 1J1BA 4RFYA 5G1XA 3LJ0A 4UMRA 3WF8A 3QXOA 2XEYA 2IJMA 2PVMA 3EB0A 5TKDA 1TKIA 4XX9A 2ZOQA 4PWNA 2YERA 4B8MA 1YHWA 3ZHPC 3VUIA 3Q4TA 3VS2A 4IB5A 4FI1A 2W4JA 1PY5A 4XLVA 4LUEA 3ZO3A 4TPTA 5IMXA 2PSQA 4G5PA 4JQ7A 1IA8A 4WG5A 3HMNA 2JDRA 2YJRA 3UOJA 4ZK5A 4D2RA 1U54A 3FJQE 2H34A 4D28A 4ZJJA 2W1FA 2PZYA 4K9YA 2GNHA 3BV3A 5LQFA 3F9NA 4H1JA 4IFCA 5HO6A 3UPXA 3QTWA 4N4SA 3FMEA 2RSVA 4IFGA 5BUEA 3S1HA 3COHA 1GJOA 2XRWA 3HV3A 3P78A 4J53A 4C59A 3K3IA 4WNKA 3EN9A 2GS6A 1OPJA 3PY0A 4C0TA 2C1AA 4C3PA 5KX8A 3NVMB 2XZSA 3DA6A 4O7ZA 3LM0A 3TCPA 3HNGA 4O0YA 2Z02A 3DDQA 3LCDA 4E20A 4LRJA 4WG4A 4D4YA 2GTMA 3UNKA 5KUPA 3OCBA 3AT3A 3KCKA 4K6ZA 2HCKA 1XBAA 4YHFA 1F3MC 4ZAUA 4XV2A 2ZV7A 4FTRA 3W1FA 3WZEA 2PVFA 4JBVA 4E4NA 4AE6A 3TUDA 4R5YA 4O91A 3FYJX 2CMWA 4G3EA 3BGPA 4FKRA 5HIDA 1PXJA 5ANKA 3NX8A 4QP3A 4RSSA 5CASA 5ETFA 5CENA 4D0XA 4G3GA 1LUFA 3KMWA 3MSSA 2XIZA 5FDXA 4IVAA 1F0QA 3UNZA 3ZLWA 4IACA 3E64A 4FTTA 4F99A 2JKQA 5JFVA 4HZSA 4TYHA 4UYAA 4EKLA 3BQCA 2JD5A 2PL0A 3GNIB 4M12A 1QPDA 1O6YA 2W5HA 3HRCA 4LGGA 5FWKK 2ZMDA 3BHUA 3I5NA 2WQEA 1AD5A 2B9HA 3ORNA 3R00A 4F7NA 5EYMA 2IPXA 4ALWA 1BLXA 5AV2A 1T46A 3SD0A 4BCPA 4EKKA 1Z5MA 4M68A 1YWRA 5CF5A 3PE2A 4KB8A 4EOQA 3HMOA 4WSYA 2P55A 4NIFB 4RWJA 4H39A 2ZDUA 1UU8A 3LFFA 3COKA 5HHWA 4XG6A 1OGUA 4YJNA 2QU6A 3RP9A 2I0VA 5BNJA 3JXWA 5EYKA 4N57A 1YDTE 4BI0A 2EU9A 2PZPA 5DMZA 4DF3A 5K4JA 4QPAA 4U3YA 4MYGA 3E8NA 2C5NA 4AG8A 3GC0A 1QCFA 3I0OA 2BPMA 4K0YA 4O0UA 2CNVA 4FTKA 2HXQA 4I5HA 4PTGA 4BCQA 4EH8A 5I5ZA 3JYAA 4PMPA 3FQHA 3PJCA 1H07A 5M4UA 2ITZA 2WU6A 1BMKA 5H2UA 5IQFA 4BRXA 4D4VA 4RJ4A 2XK4A 5LJJA 3SW7A 2VTQA 2FO0A 1J7IA 5C8MA 4CTBA 2J9MA 5DEWA 1UWHA 2C6TA 2BDFA 3BYUA 5HCYA 3FPQA 2VTPA 4IHPA 2QU5A 4BTJA 5KCVA 3RHXA 4QQJA 1ZYSA 4L3PA 3IW8A 4G3DA 4PY1A 5FBOA 2RFSA 1SVGA 5CSWA 4YLKA 2PMIA 3R7OA 2VUWA 3MH1A 3T8OA 4FGRA 4FR4A 4CFVA 4HW7A 3DFCB 4GFMA 3BWFA 1PMUA 3V6SA 5FRIA 3QD2B 4XUFA 3EN6A 4N6ZA 3RPSA 2EWAA 2YDIA 5CSVA 3W2PA 3LQ5A 2YFXA 2RFDA 4E5BA 5M44A 3KFAA 5AJQA 3TG1A 3W16A 2XIYA 2RKUA 3HMMA 2X4ZA 4QMOA 2UZVA 1U5QA 2FSLX 2YZAA 3LXKA 5DN3A 4S33A 2R3IA 5ANEA 5LMBA 5CNOA 4DLIA 5A46A 3QRIA 2ETKA 3V8WA 2IVTA 3MH0A 5DIAA 5HNBA 3IGGA 1OL7A 4OT5A 1OKVA 5BYZA 3AT2A 4DFXE 3I60A 3SC1A 4AZFA 4YJTA 3ZZWA 5HORA 4K77A 4FEXA 4FICA 4EHGA 3PXKA 4KA3A 4LM5A 2BAQA 3D94A 3TKUA 4JI9A 4O0SA 4BYIA 4TWCA 2C1BA 3JY0A 4XG8A 2XKEA 3F3UA 3D0EA 5AUTA 2UZTA 3EL8A 3GCUA 4BCKA 2O5KA 5CZHA 4FYOA 2WOUA 4ZSAA 3KF4A 2DS1A 3BIZA 4KKEA 5K5NA 2F7ZE 3MPMA 1OL5A 2BTSA 4XG7A 3TM0A 5D7AA 4AW5A 1PRYA 3NYNA 3U9CA 4R6VA 3GGFA 4QPMA 3TN8A 4OTHA 4ZSJA 1J1CA 4QP4A 4C3RA 5M09A 2ZV2A 2WNTA 2WEVA 3F82A 2R3MA 3I0QA 5B2MA 1W82A 1W98A 3CD3A 3R7GA 5HG7A 3VVHA 3Q32A 5AIKA 4FNWA 2WB8A 3SA0A 3VQUA 3OXTA 4GU9A 2XA4A 5KHXA 4GIHA 4Q9SA 4CFUA 5IUHA 4HYSA 4OAUC 3Q4CA 4EZ3A 2WTVA 3SXRA 3G6GA 4C57A 4C34A 4KINA 3UQGA 4EQUA 5M08A 3ZLXA 4U79A 5AP7A 4UZDA 4J99A 3JS2A 3EFJA 5CEPA 3D4QA 2CGVA 3OOGA 1YXSA 2OXDA 4FSWA 3BZ3A 5AADA 4CV9A 3O96A 3RWQA 2PU8A 4ZP5A 4K11A 4UWCA 3PZEA 2X7OA 4QQCA 4CMOA 5FD2A 4YZDA 4ZSEA 4DEHA 4XRJA 2CCIA 1OM1A 4BICA 4C61A 4AZVA 2QOHA 4QMZA 4NFMA 2X81A 5L6PA 3LKMA 3DKGA 4CZUA 4ZTMA 2RL5A 2QR8A 3MJ1A 3FC2A 4V0GB 1OIQA 1OVEA 4QMTA 2P4IA 3ODZX 5C27A 5AUVA 3IDPA 3C4XA 1OMWA 4BTFA 2YHVA 5EQYA 1R78A 3KXGA 1NA7A 2GSFA 4Y85A 4FZFB 4ERKA 4NW5A 1WBWA 2R5TA 5HU3A 2YLFA 2JC6A 4TN6A 1Q5KA 3LM5A 2BZIB 1SNXA 4H1MA 4PRJA 4FEWA 4DFBA 4C4IA 3RZFA 5M57A 3MPAA 4JAJA 4ALVA 4BTMA 5HIBA 4FSYA 4RIWB 1S9IA 1XBCA 2HIWA 2PVRA 4KUJA 2J90A 4LV8A 5HI2A 2IZSA 2QO9A 4QMPA 2R3NA 2YA9A 3IDBA 4BBMA 3G0FA 3MFSA 4IM3A 4OUCA 2VX1A 2CGWA 3UVQA 4RC2A 3ORLA 1BKXA 4BN1A 2VO7A 3EJ1A 2YJSA 3EOCA 1GIIA 4M7IA 3AGMA 1ZY4A 2EXCX 2X8IA 3FI3A 5C01A 3LW0A 3HECA 4L67A 2YAKA 4QYFA 4FVRA 1YXTA 5DRBA 4PNKA 2F2CB 3VBTA 3QTZA 4XG2A 3HYHA 4H3PA 5L2SA 4IC7A 4QTAA 3KKVA 3BYSA 4GFOA 5CU3A 2FB8A 3FKOA 3RI1A 4RBLA 3OUKA 4XBUA 3R28A 2W1ZA 2Z2WA 4U3ZA 4S32A 1R0PA 3QQGA 5LVOA 2OZAB 1DAWA 2OF2A 4E4XA 5KHWA 4O7YA 3NMUF 1ZARA 4DINA 3QA8A 3NZ0A 4M69A 1M7NA 2CN5A 3IS5A 5T3QA 4NYEA 1PW2A 1Y6BA 3MY0A 4FKLA 5CWZA 4BCMA 4W4YA 4EC8A 2Y9QA 4IDVA 2X7GA 2WMXA 3ZM4A 2PVLA 3ZFMA 4CFXA 4MBIA 3Q6UA 3GC7A 1H1PA 4YZMA 4U5JA 3SVVA 4IBMA 4RPVA 1SMHA 4QO9A 4J97A 3LFDA 1Y8GA 2GS7A 3PIXA 3FXXA 2G15A 2ZB0A 2R7BA 3FZOA 3D5UA 3HUCA 4KIKA 3ZRMA 4CKIA 1JSTA 2G01A 4E8AA 5AAEA 4O82A 1YI4A 3C51A 3CQUA 4TRLA 2OH0E 4FTJA 4DYMA 4FNYA 2HK5A 1PJKA 3ZUUA 4AZSA 3PE1A 2VO0A 4Q5EA 3T3UA 2CKPA 3HAMA 3W2QA 3SOAA 1XJDA 5JN2A 4DTAA 4LGHA 3RM7A 3KB7A 1R1WA 4FZ7A 4C37A 4FG7A 3ETAA 3FLSA 1P4OA 3FLWA 4KKHA 4BF2A 1UV5A 4UV0A 2DQ7X 5DT0A 4EUUA 4IMYA 2GHMA 3I79A 3PPKA 4BBEA 4WSQA 2Z7LA 2HW6A 3NIEA 2XJ2A 1WBVA 2JKOA 5EHYA 4WUAA 2BMCA 3QL8A 2ZDTA 4UXLA 3H0YA 1CKPA 4G9CA 3VAPA 4F9BA 3M1SA 2C5OA 5ITAA 2OICA 3NPCA 2IW9A 4L46A 5HE2A 4PL4A 3RZBA 2H6DA 4A9UA 3KRXA 4GJ3A 4EK4A 4A9SA 2ITYA 2VX0A 4UWBA 4FV4A 1GZNA 3S3IA 4AT4A 3MESA 4GW8A 4FK3A 3BLQA 5IQAA 4LYNA 4LOQA 4RJ7A 3GUBA 2HZ4A 3R73A 4YJUA 4FUYA 5LWNA 5D1JA 4Y72A 3MV5A 4C4JA 2I40A 2R4BA 4X3FB 3DBDA 4FKUA 1ZYCA 5D9HA 4FTAA 5L6WL 4O7TA 2FGIA 4IM2A 2OBJA 4G16A 1LP4A 1YDSE 3VS3A 2ONLC 5FQDC 3ZTXA 3P7CA 3R1NA 4PX6A 4E4MA 4EH3A 1PMVA 1TQIA 3QTXA 1FBNA 2YDJA 3VIDA 4IADA 5DVRA 2PTKA 4A9RA 4YJOA 3B2WA 4BCJA 4TKSA 1E1XA 5IH6A 2W1GA 3O23A 5AUWA 3IGOA 4O2ZA 4L7FA 2CLQA 3R8ZA 2O0UA 1ND4A 5EKNA 3C4EA 1WBTA 4TYHB 3TZ8A 3G9LX 5AFVA 4GJ2A 3PUPA 3IW7A 3Q60A 4JDJA 3WZUA 3UJGA 2GNIA 4GYIA 2ITNA 2CHLA 5AR7A 2UW7A 1BX6A 2W06A 3KRLA 3R83A 5EYCA 3IPHA 4J7BA 4ZTRA 1UNLA 4FT9A 5B0XA 2E9VA 4AZTA 3UIUA 1RW8A 5JRSA 3FLZA 4MWHA 4D2VA 2VNWA 4JG8A 2XH5A 4U42A 4PL5A 5HD4A 4JR3A 2PE2A 4BWKA 4CYIA 4K1BA 4I6QA 2QNJA 4OLIA 3ITZA 4I23A 4A4XA 3E87A 5JK3A 3NNXA 4JQ8A 4QMNA 2ZYBA 2VRXA 2VTSA 3QCYA 4UYNA 4P7EA 5E4HA 4LOPA 2UW5A 4NU1A 1Z57A 4RGJA 3S2PA 3CPCA 3CY3A 3QHRA 2QC6A 3SLSA 2UZWE 2E9OA 3QQHA 3QUPA 4FTNA 3R8UA 5LMKC 2XCKA 5ACKA 4FKQA 3UYTA 4EWHA 2PUUA 2YLEA 3R71A 5HE3A 3VBVA 4AW2A 3G5DA 5E8XA 1KUTA 1XQZA 5T68A 4YO4A 1O9UA 2FUMA 3UIBA 4QP8A 3KC3A 5JRQA 3U51A 5LVNA 3OTUA 3FHRA 3TXOA 3FZTA 3FEGA 1YRPA 3DQWA 4IM0A 3ZFXA 4ERWA 3NUYA 2IO6A 5FP6A 3PXRA 3QKMA 2QONA 3EZVA 3R9OA 3TZ7A 3NYVA 4I41A 1VYWA 4F4PA 5IQDA 2A1AB 3BE2A 4S31A 3L8SA 2UVXA 3QRKA 2QURA 1URCA 4PV0A 3R1SA 3OT3A 4UB7A 5FXQA 4DH1A 4FKJA 2W1EA 5H8GA 3TJCA 3VW8A 4FK6A 3H0ZA 1IA9A 2YISA 3E3BX 2B1PA 2EVAA 5BVFA 5KKRB 3AOXA 2R64A 1J91A 3FBVA 3CXWA 4AACA 4OW8A 3V5WA 4XG9A 4IX3A 2WIHA 2OJIA 2V22A 2O2UA 4JBOA 4RX8A 3V8TA 2H8HA 4MXAA 3UZTA 4K8AA 3QZHA 4B0GA 3QKKA 5HLPA 5J9ZA 3HAVA 3FAAA 3Q2JA 4L45A 4EOPA 2R3OA 4G31A 2UW0A 5HG9A 3VJNA 2QG7A 2WQNA 3CTQA 4FIIA 3A62A 3DZOA 3JVSA 4NM0A 3ZYAA 3CBLA 4HVDA 2Y8OA 3O17A 4JOAA 4D9TA 5T6KA 4DGGA 4U8ZA 3KN6A 4I3ZA 4IAFA 5FLFA 3UP2A 4ACMA 1Q62A 4RVTA 3PG1A 2IWIA 2J7TA 4M15A 3S95A 2YIQA 4MWIA 1SM2A 1ZZ2A 3GP0A 1YI6A 1ZZLA 1YI3A 2BALA 2XMYA 3PY3A 2F4JA 2VTNA 3QYWA 5HLWA 5KO1A 4WG3A 3QUEA 3GENA 4R3PA 3MH2A 2JKKA 4X0MA 3UP7A 2A0CX 4FT7A 2BDWA 4V05A 2OKRA 1APME 3QAME 4GK2A 2F9GA 2WQMA 1JKSA 2HELA 2X39A 5GZ9A 3NYXA 2VTLA 3DK6A 3B8QA 2J0MB 3FSKA 4WHZA 3SAYA 5CEMA 4RLKA 4HCVA 4XOZA 5EM8A 5LMAA 3UDBA 5AX9A 5AM6A 4O7SA 2I0HA 4GVJA 2JAMA 3W55A 1JWHA 1BL7A 4F6SA 1PF8A 4RX7A 5FTGA 5HVKA 4Q5HA 3EHAA 4APPA 4YZNA 5CF8A 4I6BA 2JFMA 4IVBA 2X2LA 4FYNA 4ZZOA 2B9IA 5EKOA 3FL4A 2QO2A 2UW4A 4WUNA 5EM6A 2W99B 5CXHA 4C38A 3C0IA 4DCEA 4FSZA 5DBXA 1KOAA 4GT3A 4PUZA 1NY3A 2XB7A 4E73A 4FV1A 4I0RA 2VTMA 3QALE 4CG9A 2C0IA 1VR2A 2WQOA 3FC1X 4IB1A 4U6RA 1V0PA 1YHSA 4ZTNA 4DEBA 4EHZA 5A54A 4TNDA 1NT2A 4IZAA 2R3PA 3LIJA 2XS0A 3UC3A 5HQ0A 3TIZA 5CTPA 3NLBA 4ZLZA 3MS9A 4AGWA 4U97A 4KSPA 4AWIA 2ITQA 4PDSA 3PPJA 1WAKA 3CTHA 4BDBA 3JY9A 4CZTA 3IW4A 4WKQA 1OB3A 4FIHA 1QPJA 3HDMA 3F3TA 4TWNA 5HICA 3QCQA 3W18A 4DEDA 3VBWA 2X8DA 3PIZA 4D2WA 2CKEA 3ZM9A 4MNFA 3SV0A 2QD9A 4C3FA 1XO2B 5E8WA 1JVPP 1KV1A 3SXFA 4RVKA 2IZRA 2JAVA 3U6IA 5CEOA 2QOFA 4CMTA 3PPZA 4O81A 5IQHA 3UOLA 3VS5A 4DFLA 1GY3A 2QOIA 3FYKX 5HEZA 3TZMA 3PYYA 3ZDUA 4HYIA 4IX4A 3GQLA 5LXMA 4WBOA 3QTQA 4GUBA 2VV9A 4DAWA 3BBTB 2QODA 4XV3A 4EH4A 3LLAA 2ITTA 5IUIA 4PMMA 5M51A 4BDCA 4HVHA 2XBAA 3FDNA 4LMNA 4CKRA 4CRSA 2UW8A 2WU7A 4EL9A 1OECA 5BQ0A 4QRCA 1OUYA 2G9XA 4MD8E 2Z60A 3E63A 2HZIA 5E8TA 4OAVB 3IDCA 2UW3A 4O1OA 1V1KA 5CF4A 3OT8A 3TV6A 3MN3A 4EJ7A 3OW4A 1SNUA 4G34A 4XNEA 5CANA 2R3QA 4UN0C 2X7FA 1ZAOA 1ZYJA 5FDPA 3TUBA 3LFEA 3N4VA 4MBJA 2JITA 3TUCA 4EBWA 4FKIA 5AP3A 1WZYA 5CX9A 3U9NA 4DBNA 3HRBA 4EH6A 2XIKA 3R1YA 4YNOA 4F0IA 4PMTA 4IC8A 4PDOA 3ZO1A 1Q61A 3NYOA 1GZ8A 4NJDA 2YIWA 2C5YA 2VTHA 3RVGA 1G3NA 3H30A 2IVVA 4O0RA 4UMTA 4HYUA 4F64A 3L8XA 4U80A 1T45A 3KXXA 5BVDA 5IKWA 4DN5A 4I6FA 4E4LA 3R02A 1OIYA 2RF9A 3LCSA 1NW1A 4G1WA 5IA3A 3QTRA 4L01A 3PLSA 3TTIA 4D2PA 4V04A 2Y7JA 3BGZA 4TXCA 2C5XA 1YKRA 2O65A 3QA0A 3VUDA 5I9XA 5IDNA 1H1QA 4FV9A 3FZSA 4IJ9A 4O38A 2WFYA 4YJSA 4CTCA 4PPBA 3IO7A 3UMWA 4LV5A 5JFXA 4C4HA 5JT2A 4IH8A 2E9UA 3ZDIA 1FVVA 4MF1A 5BVEA 1CKIA 2PY3A 4RWIA 4KNBA 3UOHA 5KZ0A 5HBEA 3VUGA 4J71A 3V6RA 1M2PA 4IW0A 5EK7A 4BYJA 4HGEA 3QHWA 4CZYB 3KU2A 1O6LA 4FIJA 3V5QA 2B4SB 3SRVA 5I0BA 4XG3A 1Q8YA 2H9VA 2HYYA 3KVWA 3PVGA 5IF1A 3D2IA 3F61A 1PXOA 4MK0A 2BIKB 2X2KA 4XMOA 3ZCLA 3QRJA 5FGKA 2BROA 4KAOA 4AFJA 1PXKA 1SVEA 2QO7A 5E7RA 2Z7SA 5E91A 1YWVA 3BYVA 2C6LA 4IB0A 4CNHA 4AT5A 5GINE 2C0OA 3QXPA 3ZC6A 4L7SA 3F3ZA 5EW9A 2QHMA 4AT3A 4UBAA 1ZXEA 4E7WA 3M42A 3BYMA 5L2IA 4FBXA 2Y0AA 5HVJA 3U55A 5BUIA 4DA5A 3C4CA 2GTNA 1HCLA 2WMSA 1X8BA 2VWIA 4ALUA 5GZAA 4CFNA 2QVSE 1XWSA 4HGLA 4HVSA 5FM3A 3E8DA 4NCTA 4YPSA 3AXWA 4G9RA 5M4FA 2X9FA 4AN2A 2BFYA 3HA8A 4RIYB 3R7VA 5I3RA 4PTCA 2XKDA 3IW5A 5CSXA 4DH8A 4KRDA 3IKAA 1XH7A 3NWWA 4ANBA 4RRVA 2HW7A 4HPUE 4KRCA 4AFEA 5IH4A 5HCZA 4NEUA 3FZPA 2JIUA 4F9WA 1LEZA 4YU2A 4ZXTA 2PZIA 4EQCA 4YURA 2BAJA 4I24A 4YHJA 4GKIA 5AV3A 5AX3A 4X3JA 4E6AA 2OZOA 1MRVA 1PMEA 2JFLA 2QOBA 4FODA 3V01A 5M06A 3GT8A 2W1DA 3HLLA 4ANOA 3G15A 2ZVAA 4FUXA 4BI2A 4Z3VA 2Y6MA 3GBZA 4U44A 4C4FA 4MKCA 2J2IB 5C03A 5DA3A 3BHHA 4AUAA 3KXZA 4L68A 5CU6A 5H8BA 3LCKA 2C6OA 2WIPA 4ZIMA 3RPOA 3EQIA 2ZM3A 3FMKA 5DE2A 5A4EA 5EYDA 2BKZA 1OKWA 3I5ZA 4NKAA 1DS5A 3Q9WA 3VHKA 3KULA 4BDDA 4EZ5A 1MUOA 2QLQA 3NUXA 4X2KA 4BIDA 3L9NA 4ZLYA 1REKA 1PXNA 2IG7A 4BCFA 2YM4A 4GK3A 3R9HA 3RTPA 3ZO2A 5CY3A 2V5QA 4HNFA 3OF0A 3RBWA 2B0QA 5JZNA 4FEUA 1ZYDA 2FA2A 3DLZA 3ACKA 2PULA 4FKPA 3CGFA 4GVAA 5CAOA 4O7RA 4FZ6A 3E5AA 2YITA 3A8XA 3CP9A 2F49A 3R0TA 4UALA 4CD0A 4DHFA 1J3HA 2ZMCA 2FVDA 4IQ6A 2W0JA 3AGLA 3PFQA 3F6XA 5LVLA 1FVTA 4KKGA 4GG5A 2DUVA 4E26A 4E5AX 2E9PA 3TKIA 4CMUA 4D4SA 4EBVA 2QOQA 2YWVA 4BGGA 2OH4A 4FSRA 1NXKA 5JGBA 4CFWA 2W5BA 1H0VA 2UVYA 3OCSA 3QGYA 3VHEA 3N9XA 4ANQA 2XM9A 4EK6A 1TQMA 2OWBA 3AD6A 3DXNA 1I44A 3PA3A 5DOSA 3P86A 3F2RA 3A4OX 3KXHA 3POZA 4NUSA 4HZRA 4GU6A 4E93A 3CKXA 3VW6A 1F5QA 5EI2A 3ZSGA 4ZMFA 1W83A 3KXNA 2X8EA 1DAYA 5B2KA 5E90A 1SYKA 3Q53A 2XK8A 4MNEA 3GCSA 4QQ5A 5L8LA 3ZH8A 1H0WA 4MXCA 4BHNA 2R3GA 3A7IA 4C2WA 1A06A 3NAXA 3OC1A 3PJ1A 3GCQA 4PDYA 3D7ZA 3EH9A 3DY7A 3HV7A 3LXPA 1LPUA 2LAVA 3R22A 4Z55A 2W1HA 3DXPA 3BU6A 3RK5A 5ANGA 2JDSA 5L8JA 2C4GA 2R9SA 2V0DA 4WNOA 3ZXTA 5E92A 2GHLA 4JQEA 1Z9XA 4RA5A 1LEWA 4ASEA 2PMLX 4HOKA 3HUBA 4H3BA 4U9AA 4EWQA 4E3CA 5AP2A 4CFFA 2IZTA 4R77A 2VTJA 3TNWA 2J5EA 5HTCA 3QKLA 4EK8A 5LCJA 4LL0A 3R04A 4USFA 3FQSA 4FV5A 3QQKA 5DPVA 2X6DA 3FI4A 5L2QA 3VN9A 3ZLSA 4MQ1A 2BRHA 2BR1A 5M53A 5AUZA 1P5EA 4CXAA 5JQ8A 4FGBA 4BDFA 5GNKA 1YXVA 4YMJA 2P2IA 2PMNX 4FTLA 5HIEA 4RJ8A 3CPBA 3KMMA 1WBPA 4EOSA 2BAKA 4X2JA 3AC8A 4J96A 4ANMA 4DH5A 3MYGA 3V04A 3GXLA 3VQHA 4OTIA 3MVMA 3MW1A 4BGQA 3EN7A 2HWPA 3IOPA 4OR5A 3HV4A 4MQ2A 4QMWA 3IW6A 4FG8A 2C6MA 4OBOA 3QLFA 5CEQA 2BZKB 4FTOA 4KWPA 2E9NA 5IA1A 3OW3A 5CXZA 5TO8A 3F3WA 4QPSA 5AR8A 3O0GA 4JG6A 3GU4A 3QWKA 5J87A 3WF6A 5HTBA 4IAIA 2XKCA 5ACBC 2R3RA 4YPDA 5AMNA 2FYSA 4X6RA 5J95A 3RWPA 2CGUA 3CJFA 4OT6A 3K3JA 1DI9A 2A2AA 5TE0A 4AU8A 1M2RA 3K5UA 3GI3A 2G1TA 3SHEA 5M4IA 4FV3A 4M0YA 4O21A 1MQ4A 1QPEA 4XLIA 3PJ8A 4DEAA 1G8AA 2HY81 3NR9A 1OI9A 3QD3A 2FSOX 3PDTA 2UV2A 4ANLA 4NWMA 2F7XE 1QMZA 2JGZA 2WMWA 4YJPA 4YP8A 2A19B 4F1OA 3OWPA 3VF8A 4I5MA 4JR7A 5CSPA 2BFXA 3ANRA 2YCRA 5LCKA 4ENXA 2OXXA 3UQCA 1OIUA 4KIPA 5CQWA 4RG0A 4KSQA 4J98A 2ITWA 5HX8A 3UQFA 3UIXA 3CR0A 3EQCA 3QX4A 1WFCA 4K33A 2CDZA 4WT6A 4RIXB 2EB2A 3AQVA 3ENMA 5ETAA 4BCIA 4C7TA 3LFSA 4Y46A 4RZVA 1GNGA 2W05A 3WYYA 2HAKA 4JVGA 2ACXA 1DM2A 4NL0A 5CYIA 4BIEA 1AGWA 3FXWA 4G6OA 4MX9A 4PP9A 2BIYA 4YZCA 3WF7A 3V5JA 3Q04A 1J7LA 4FOBA 3R8VA 4L3LA 5JQ5A 4MXYA 3KRRA 3W2RA 4YBJA 1ZMUA 3EQDA 2VTAA 2VU3A 3MDYA 2WPAA 2RFEA 3F69A 2C3KA 3D7TA 2O64A 3VRYA 4BGHA 4EONA 3W2SA 3W8QA 5E1EA 2ZM1A 4TNBA 3W32A 4EOOA 2VTOA 2YM3A 3FPMA 4O7LA 2PE1A 5DT3A 5AUXA 3DNEA 3TT0A 3G33A 3LQ3A 3MBLA 5FXSA 4W9XA 4S34A 5B2LA 3MPTA 4TYJA 2VD5A 5D10A 2WMUA 5GHVA 5B7VA 1KV2A 2P0CA 3QC9A 4BKJA 5GJGA 4F9AA 4C58A 5DNRA 1DI8A 2W1IA 5HX6A 5FBNC 5IH5A 4O1PA 4BZOA 2RFNA 4GEOA 1B6CB 4FTCA 3DQXA 4FL3A 1UNGA 5E1SA 4I0SA 5IA0A 5E8SA 1CSNA 2PVKA 3HGKA 2GNFA 3NIZA 2QLUA 4I21A 4MHAA 2PUIA 3TIYA 4JX3A 5CAPA 3SQQA 2C6KA 2UZDA 3PJ2A 4IANA 2NP8A 1R0EA 4YC6A 1B38A 2Z7QA 4L00A 3CSVA 3DGKA 4D2SA 2HZ0A 4L6QA 2YM6A 2V62A 3C5UA 2CN8A 3GU7A 4XEYA 3DB8A 4NTSA 2VTTA 4YGAA 4A9YA 3CIKA 2Y4IC 3TWJA 4OTDA 4ZOGA 2WGJA 3PG3A 2ITXA 3NW6A 4F0FA 4CYJA 4C4GA 3SG8A 1OKYA 3OBJA 1OL1A 4FV8A 5EW8A 4EH2A 4FKGA 5F4NA 2IW8A 1XH6A 3LOKA 3Q9ZA 1ZMVA 2HWOA 3OD6X 4FIGA 4GFGA 1YWNA 3ZMMA 4AAAA 3QD4A 4RA4A 4YSMA 1OBDA 4DCAA 4KIQA 1H27A 5A6NA 2ITUA 3NRMA 3KL8A 4LL5A 3F66A 1U54B 5AV0A 3FMJA 5EM7A 3C7QA 3ZOSA 4I4FA 2CSNA 4WO5A 3UBDA 3WF9A 3QRUA 4M13A 2OJFE 3W10A 2XIXA 3BKBA 1IR3A 4F7SA 4FNZA 3DLSA 4X7QA 2PK9A 3UIMA 2XNBA 3WF5A 4BIBA 4GV1A 4AA5A 3LVPA 5J79A 3F88A 2YCFA 2GNLA 3PXQA 2JDTA 1BUHA 5EG3A 3EKKA 3FY0A 3ZRLA 5K5XA 5BYLA 2LGCA 1YHVA 3JPVA 2VWBA 3W33A 1JOWB 3OROA 4AOJA 4GRBA 2WZJA 5C9CA 3F7WA 3CY2A 3G90X 3ZO4A 4D1SA 1KOBA 4UY9A 5C26A 2XNNA 3LMHA 4O0XA 2VAGA 1I09A 5AP4A 2Q83A 3AC5A 4E1ZA 4F1MA 4ANSA 3GU5A 4ZTQA 4W4VA 2V55A 4P2KA 2WMQA 1IAHA 4E5WA 3HV6A 4DH7A 4RC4A 4FVQA 2PUNA 3PA5A 4CQEA 1P2AA 3Q96A 4YUQA 4RZWA 4FZDB 5JEBA 2VGPA 2CNQA 3DPKA 2W9FB 3HL7A 5IQCA 4N6YA 1Q4LA 4NIFA 2FH9A 5A3XA 5AP1A 1OL2A 5GJFA 1SVHA 3E92A 3I81A 4QMXA 4LUDA 3ORIA 3P79A 5HZNA 1NVSA 4N0SA 1E9HA 4QP1A 2PVYA 5I9YA 2JBOA 3GVUA 3PSCA 2VZ6A 3OFMA 1FVRA 2WMAA 3CE3A 4Z16A 4EH5A 5BVNA 3DAKA 1CM8A 4XH6A 2OW3A 5FEDA 3FKLA 4CKJA 5ETIA 5L2TA 3ATSA 4FV0A 2XNMA 3DKOA 3I1AA 3R63A 1S9JA 5H3QA 4AP7A 4FSTA 3DJ7A 3IG7A 4DFNA 3BBWA 1UVRA 2O63A 4FSNA 4L43A 3AD4A 5AEPA 2RG5A 4FE2A 4IWPA 3NDMA 5FEEA 4QNAA 2F2UA 3AG9A 3SG9A 3C9WA 3HVCA 4YSJA 3FMNA 3GFWA 5A4LA 3D5WA 5AR4A 4CRLA 4O22A 2SRCA 4HCUA 3NUUA 2YABA 4X2GA 4X2NA 4FVPA 3ULZA 4BTKA 4YTCA 5JSMA 5L8KA 4L44A 3RINA 5IZFA 1U5RA 2ZV8A 2XJ1A 2PWLA 3F7ZA 4KBCA 4RJ6A 3BHTA 2UZNA 3COMA 4QTDA 3RCDA 4BB4A 3D5XA 3BLRA 1VYZA 3OTVA 2GMXA 3GCVA 2YM5A 3LJ2A 3ENHA 4GG7A 4MH7A 4O6LA 2PE0A 4U43A 4BCGA 1Q8WA 2J0LA 3NW5A 3OEFX 2VWUA 4CQGA 4NZWB 3SKCA 3L9MA 5IA2A 2OJJA 1YW2A 3O8TA 4EEVA 3E7VA 3EFWA 4FT0A 5I9UA 4YJQA 4R7HA 5CT7A 3RPRA 3R01A 5DLSA 3P08A 4IVDA 2WTKC 1RE8A 5HOAA 4RIOA 4BCHA 1PYXA 2OFVA 3QX2A 1ZYLA 4O27B 3HRFA 3LXNA 4ZLOA 4F0GA 4BHZA 4JRVA 3MGYA 2XNEA 3RGFA 4M97A 2C69A 2PVJA 5LARA 5KBRA 2GDOA 2O3PA 3DTCA 1W84A 3RK9A 3TL8A 2AC3A 2ZJWA 4FT5A 2GHGA 4B8LA 4FT3A 4B9DA 3ALOA 1RDQE 4G3FA 3OWLA 3TTJA 4FTIA 2UZEA 4CEGA 4APCA 1QPCA 4FC0A 3ZUVA 5HBHA 3ORXA 4F7JA 5HTIA 3SX9A 5HKMA 2YAAA 3A7GA 3ODYX 4U0IA 5BMSA 5ICPA 5C1QB 4GK4A 4IZYA 3L9PA 2OJ9A 4B99A 3PVWA 4PNIA 3AMYA 3C50A 1W0XC 5HO8A 4ACDA 5HNIX 4QMSA 2XNOA 3NS9A 3P23A 1WBNA 4A4LA 3MWUA 3NNVA 3P5KA 2R3KA 5AWMA 4U81A 3R6XA 1HOWA 4AS0A 1VZOA 4AQCA 4EOMA 3D5VA 1UKHA 3HDNA 1UNHA 4EJNA 3DBFA 2BCJA 5AR3A 2X0GA 5FTOA 4B4LA 1WVYA 4CT2A 3GCPA 2JIVA 4DG2E 3FL5A 4G5JA 3RAKA 2XNPA 3OHTA 4KABA 1TVOA 1M14A 3IECA 4JAIA 4NFNA 4PF4A 4XP0A 3UTOA 4NJ3A 3OEZA 4O0TA 3W8LA 3S4QA 5A14A 2WTDA 3CCNA 3EWHA 4F9YA 2C3LA 3UMXA 3WZJA 5ANJA 2J5FA 4D0WA 2EUFB 3HZTA 1W7HA 3MI9A 3QD0A 4WBBB 4XCUA 1JAMA 3OCTA 3PP1A 4FSUA 5CT0A 3COIA 5DFPA 2VWWA 4AW0A 3UZRA 3QQUA 5JGAA 2C0TA 2XVDA 3Q2MA 3I4BA 5I9WA 5IPJA 1R3CA 4G3CA 4RJ3A 1IEPA 1CDKA 5IEXA 1PXPA 3C0HA 4EK5A 4BDAA 3BEGA 3HX4A 5KE0A 3QQJA 4R3CA 2YWPA 4V0GA 3VBYA 2X9EA 3F2NA 1OPKA 1NVRA 3R8PA 5A4QA 3CD8A 1H4LA 5JFSA 1GZKA 4QTBA 5AM7A 1FMKA 3GEQA 1G8SA 3CC6A 1JKKA 3A99A 2W5AA 3BRBA 4AN9A 1FGKA 4FA2A 1E1VA 5IMEA 3POOA 3GOKA 3HV5A 2R3HA 4RVMA 2YIXA 1WVXA 2C3IB 5EDRA 5AUYA 4HVGA 2J0KA 2OSCA 4O0VA 5KMKA 5F95A 3OP5A 3CKWA 3II5A 3EQFA 4MD9E 5EFQA 4A9TA 4RIWA 1IASA 2C6EA 1M2QA 2G2FA 5J8IA 4D58A 2OG8A 2QOOA 5FG8A 2PVHA 1JSVA 1GIJA 4FV6A 1M7QA 1GOLA 3K2LA 2RIOA 4Y95A 5DI1A 3KRJA 1JKTA 3F5GA 4H3QA 5E8YA 2VNYA 4ZZMA 5EI6A 3VWAA 5L4QA 3PTGA 4IAZA 5CU2A 4C35A 3FWQA 3PXYA 2VX3A 3DDPA 4R1YA 4TYIA 3O50A 3RM6A 3MY1A 1XHAA 4YJRA 4OTFA 3SOCA 3P1AA 3O8UA 5I3OA 1ZOHA 3V51A 3VUHA 3UG1A 4M8TA 5I9VA 1GAGA 2QOCA 3HKOA 1A9UA 2WQBA 1GZOA 4E6CA 2VN9A 3BI6A 3TDVA 4KIOA 2OZAA 3UVPA 4EOJA 2JBPA 5BYYA 3EQPA 3PRFA 5D41A 4PP7A 2GS2A 3OG7A 2UW6A 3BV2A 3SDJA 2WO6A 5CS6A 4A07A 2AYPA 5LWMA 1IAJA 4JBPA 4FSMA 4LMUA 4M84A 4Y5QA 2YZLA 1PMNA 3BX5A 5J7HA 5IQIA 5M56A 3A8WA 1Q3WA 5AP6A 4TW9A 5J9YA 4DTKA 4I93A 3QU0A 4FZAB 4DFYA 5AR2A 5F9EA 3BGQA 4NCTC 3C4ZA 4BC6A 5DHJA 2WMTA 1CMKE 2WD1A 1MQBA 2HXLA 4JRNA 3DKCA 5M4CA 4QT1A 2B9FA 3U87A 3TZ9A 5HNGA 5C4KA 2I0EA 3CJGA 3D7TB 3ERKA 4BBFA 3EYHA 1MRUA 4WD5A 1XKKA 3WI6A 2E2BA 3KVXA 4USEA 4YR8A 4IE9A 5L6OA 4H05A 3QZIA 4I20A 4R5SA 3QF9A 3PWDA 2ERZE 2G2HA 2NRYA 4M69B 4ZS0A 3VS6A 4XJ0A 2CPKE 4W4XA 5DR2A 5KNJA 4S2ZA 4YLLA 1UWJA 4H36A 5E8UA 3I7BA 2ETRA 2Z7RA 1CTPE 4IAAA 4KS7A 4LQMA 4O7WA 1Y6AA 3LHJA 3UO5A 5EI8A 4ACHA 5F1ZA 3DU8A 5CAQA 5JH6A 4R7BA 4IAYA 4DG3E 4U7ZA 3PZHA 4GMYA 3KCFA 5FTQA 2KTYA 5I4NA 3MJ2A 4HCTA 5GIOE 1U59A 4JG7A 4LI5A 3QCSA 4JS8A 3KMUA 4TYEA 3QBNA 4FKSA 4KIKB 4P4CA 3FZ1A 4DEEA 1IRKA 2YDKA 3OVVA 4DGLC 2KULA 4ITHA 3L8PA 1BL6A 4OBQA 3CTJA 4G17A 4NTTA 4C8BA 4L9IA 2AUHA 1H26A 4D2TA 3DJ6A 4M67A 2GPHA 5AV1A 2H96A 1OIRA 4C02A 5J5SA 3R8LA 4ZY6A 2C68A 4PL3A 3V5PA 2QOKA 2GQRA 4AOTA 3VRZA 3DKFA 2NPQA 1BYGA 3FZRA 4O96A 4G6LA 4A7CA 2QG5A 2C3JA 4X3FA 4UX9A 2OI4X 3FI8A 4X21A 3TJDA 3CS9A 3QTSA 4F1TA 1JPAA 4I4EA 3T3VA 4DT8A 1AQ1A 3F3VA 3MB7A 3R21A 4J95A 5IEYA 1ERKA 3FKNA 4IIRA 4L53A 5HCXA 3OUNB 5C4LA 3H4JA 4BVUA 3A7JA 3F5XA 4EOKA 3DXQA 3CGOA 1XH5A 4IX5A 4FTQA 3RHKA 4CG8A 1CKJA 2CJMA 3LCOA 3OCGA 4GSBA 4BWPA 4OTQA 1YXXA 2W1CA 4BCOA 5KKRC 4KBAA 2OIQA 2GQSA 5HGIA 4ZEGA 3TNIA 2JLDA 3EFKA 3DK3A 2ITVA 1VEBA 2BRGA 2F57A 4HPTE 3QTIA 5DYJA 4CFMA 3GQIA 3VULA 4P90A 2UZOA 4NM5A 1WVWA 3DOGA 4XHKB 5EOBA 5HU9A 3HEGA 2YM8A 2PUPA 3A7HA 1O6KA 2R7IA 5K0XA 1EH4A 2ETMA 4YTIA 1PKGA 4A4OA 4II5A 3QYZA 4LRMA 2WAJA 3AT4A 4F70A 4WA9A 3EL7A 3MVJA 2BRBA 3R2YA 5HE0A 3VS1A 5AAGA 3NUAA 2WMRA 1WMKA 5DR6A 2Y4IB 2IW6A 2W4OA 5EQEA 2W17A 3BWJA 5KMOA 1H1RA 4P5QA 4AA0A 3ZC5A 3L9LA 3NUSA 5ANDA 4NH1A 2YCQA 3O7LD 3OS3A 4MVFA 5CAVA 3PJ3A 2I7QA 2EXEA 3Q4UA 4CSVA 3ULIA 5KMMA 1URWA 5K4IA 4S30A 4U40A 3AC1A 1H25A 5F94A 2Z8CA 4ARKA 3A61A 2J6MA 2IVSA 3DNDA 4WNMA 3GU6A 4PPAA 4FL2A 3OY1A 1YOMA 4YZBA 2Q0BA 5IG1A 1KWPA 3UG2A 3VBXA 3S00A 2VO6A 2I6LA 3F5UA 4LG4A 5CF6A 4DT9A 3TNQB 3ZEPA 3BEAA 2OK1A 3L1SA 3RNYA 4IX6A 3E88A 3FMHA 4I22A 3RMFA 4RC3A 4D55A 4F9CA 4QP6A 3Q3BA 2WOTA 4IZ5A 4DE4A 1XH9A 4AXAA 3NSZA 3WIKA 3Q5ZA 3ZLYA 3DZQA 1YQJA 4U41A 5CAUA 1J7UA 2NO3A 4FNXA 5J1WA 1L8TA 3PXFA 3ZZEA 3NUPA 4NKSA 2GQGA 3QC4A 2B52A 2VO3A 4FEQA 5CSHA 5KMJA 2ZAZA 1P4FA 4XP2A 4AZWA 4DH3A 4FG9A 5D11A 4BDIA 4K2RA 4XS2A 4BDKA 4EOLA 3FLQA 3VC4A 1OL6A 3OZ6A 5HBJA 3EQGA 4BZNA 1KE6A 2CCHA 4J8MA 5F20A 4DEGA 2WXVA 1JBPE 3NGAA 3ORMA 4YTHA 3UNJA 4ZY4A 2X1NA 4RMZA 3DBCA 5EHOA 4BDEA 3E62A 5DT4A 3G9NA 4GUEA 5HD7A 4DGNA 5EDPA 3WZKA 3DFAA 4LOOA 3AMAA 3BU3A 5D7VA 5IISA 3QFVA 4L42A 4WRGA 3U4WA 4RFMA 4E6QA 3RCJA 5FEQA 4AGUA 3O8PA 1KE8A 4FF8A 2IZUA 3MFTA 1H08A 4FIEA 5EHLA 3P9JA 4HJOA 1FINA 4FKWA 3UO4A 1YOLA 4ZTLA 4YNEA 3ZSIA 4C33A 3M11A 3MIYA 3LFAA 3ZBFA 3R8MA 3BELA 3BHVA 4RQKA 4IEBA 4QYHA 3JUHA 4IZ7A 3ZRKA 4UWYA 4RX5A 5BUJA 5FXRA 4BR3A 3HP5A 1WCCA 4ZSLA 3UPZA 4MTAA 3V5TA 4I94A 4ACGA 4E6DA 1H28A 5DH3A 2WHBA 2V7OA 2JEDA 3MH3A 4ASDA 2I1MA 4YJVA 3TI1A 2PZ5A 4I0TA 5CZIA 3VF9A 4XV9A 2WTIA 4CVAA 1XH4A 5GZ8A 2C6DA 4IWDA 5DEYA 1ZLTA 2QOLA 2YIRA 3FQEA 2XJ0A 4EYJA 2BZHB 2HOGA 3VBQA 4QMMA 1OKZA 2BRMA 3ORZA 1HCKA 2C5VA 4JX7A 4LRKA 5E8ZA 3S0OA 4Q2AA 5J5TA 3OMVA 3R9RA 3BE9A 3P7AA 4ITJA 5FP5A 4AGCA 2UUEA 4O2PA 4EORA 2IN6A 4QOXA 3DAEA 4KS8A 2HENA 5CI6A 4ZTHA 3TACA 4BDJA 5DRDA 3UODA 1SZMA 4NT4A 2EXMA 3LAUA 3IONA 3RALA 5KMLA 5HG8A 5H8EA 3WIGA 4GS6A 3EN5A 1P14A 3QWJA 3E7OA 1PYEA 1H1SA 2JDOA 4L3JA 4QMYA 4FEVA 2W7XA 3VS4A 4BL1A 4FKOA 2ERKA 3WBLA 1XBBA 4FIFA 4CV8A 2XP2A 3VS0A 2J0JA 3H9RA 2YEXA 3E3PA 2WTKB 4BDGA 5C8NA 5LVPA 4JDKA 3DBQA 3O7LB 1ZOGA 2EB3A 5A9UA 4JNWA 4WRSA 1Q24A 4D4RA 4I1ZA 4PMSA 4XYFA 4ZSGA 4UMPA 4AN3A 4YC8A 3W2CA 3C1XA 3PIYA 3P4KA 4IWQA 3ATTA 2OF4A 2R3JA 5GJDA 4EHEA 2WTWA 4FKVA 1NVQA 2WTCA 3H3CA 4YLJA 4DGMA 5CEKA 4O86A 1WBSA 2CGXA 4Y73A 2B55A 4W8DA 3PXZA 2XK6A 3U6HA 3FMMA 4TWOA 1VJYA 2RG6A 4R1VA 2UZLA 4L52A 3LMGA 3LE6A 4OTPA 5J7BA 5TT7A 1Y91A 2C6IA 1H8FA 3KEXA 3RJCA 2ZV9A 3ZBXA 3ID6C 5GIPE 3LZBA 4DC2A 4I92A 3OWJA 4TYGA 1KE5A 3DS6A 5CU4A 3GB2A 3RPVA 4UXQA 3GC8A 3IK3A 3PLAE 2XNGA 4OTGA 4QMQA 2XYUA 4Z7HA 3FV8A 4QMUA 5CI7A 3AC3A 2XK7A 3VS7A 2VWVA 3MTLA 2HY0A 4MXZA 1YXUA 3D2KA 4B7TA 3TDWA 3FMDA 3IQ7A 3FMLA 5EH0A 1Y8YA 2BTRA 2OFUA 2J50A 3R30A 4FOCA 5M55A 3O2MA 3EFLA 1RJBA 2J51A 5BPYA 4DEIA 2OLCA 4D1ZA 2VWXA 5CALA 4QYGA 3FUPA 3OWKA 4DGOA 5J1VA 5AA8A 2XEZA 1UU9A 4BCNA 3P0MA 2BHEA 1TQPA 4CCBA 3B2TA 1XH8A 4KBKA 3GU8A 4QMLA 4I5PA 5AR5A 1BI8A 4I5CA 4AZEA 2CNUA 4DFUA 3MY5A 4JJRA 4FTUA 1Q99A 2GU8A 3HA6A 3DV3A 5K0KA 3UO6A 5BX0A 5M07A 1ATPE 4RWKA 3EKNA 2Y4PA 2Y6OA 3LXLA 3PVBA 4XP3A 3FSFA 5H9BA 2QCSA 4OTRA 3Q6WA 3ZU7A 4ZJVA 2REIA 1PXLA 3K5VA 4CLJA 2JDVA 4HGSA 3CEKA 2WMBA 5CLPA 3QCXA 4UZHA 5ANOA 4X2FA 4QMVA 3RKBA 3BPRA 3TKHA 5FUTA 4M0ZA 5E8VA 3TV4A 3ZUTA 2A27A 2B9JA 2DYLA 4AF3A 3KN5A 3OOMA 3ZSHA 2W96B 3WE4A 4EZ7A 5IEVA 2JKMA 1OBGA 2IVUA 5KMNA 4I6HA 4QP2A 4QYEA 4USDA 3PA4A 2BKKA 3MA6A 3ELJA 3WOWA 1OUKA 2PYWA 3U8WA 2DWBA 4BFMA 3Q52A 5HLNA 4QD6A 4RLLA 5IQEA 3MVLA 1Q8ZA 4NM7A 2YIYA 5A4CA 4PPCA 3LFQA 3RAIA 3A7FA 5JKGA 3G51A 3Q9XA 4GYGA 4OBPA 4ZY5A 5HG5A 4O7VA 2XF0A 4RWLA 4IB3A 2AC5A 1UA2A 4EH9A 3A4PA 3VNTA 1A48A 3U4UA 3CLYA 5IA5A 2B54A 5A6OA 3T9TA 3QZGA 4M14A 3WE8A 3PY1A 4O7NA 4L8MA 3E8EA 3U54A 3KY2A 4TT7A 3DB6A 4ZS4A 1R39A 3HMPA 2OU7A 4QTEA 3V3VA 4FTMA 4WIHA 5K3YA 3BYOA 5IDPA 3O51A 4MF0A 1V0BA 1KE7A 4MBLA 2W4KA 4PQNA 4ENYA 1ZWSA 3V8SA 1KE9A 3NUNA 3HP2A 3SRVB 4F6WA 4QNYA 2J0IA 2OJGA 3D15A 3I6WA 4RIYA 5IA4A 4WNPA 3QTUA 2OIDA 2XBJA 2YM7A 3MTFA 4GIIA 2X2MA 4TL0A 4ZZNA 1FPUA 4MXXA 3C4WA 3FE3A 1REJA 3KA0A 4X6QC 2OIBA 3C4FA 3R9NA 3VJOA 3NCGA 5AP5A 3TNPC 1WBOA 3MVHA 4N70A 2OGVA 3PRIA 4M3QA 3PP0A 2CKOA 4G2FA 4HGTA 3UVRA 3IOKA 3GFEA 3MIAA 3CQEA 5DR9A 5EOLA 2NNWB 3CQWA 3G0EA 2UVZA 3AC2A 2XM8A 1UU7A 5IQBA 4FSQA 3P7BA 5JFWA 3GOPA 3THBA 2CKQA 3WILA 2QI8A 2GNJA 3NNUA 5FM2A 4ORKA 5LOHA 2FSTX 3R2BA 4KD1A 2R2PA 4YBKA 5TR6A 5DG5A 2XRUA 5CEIA 5EM5A 4UMQA 3UYSA 3REPA 3GC9A 4QP7A 3FLYA 2XK3A 2HZNA 4RVLA 4C2VA 4BY9E 3I6UA 3BU5A 3DK7A 2R3FA 3KF7A 5AIRA 3D14A 1LR4A 2ITPA 4JDIA 4AW1A 4D9UA 4YTFA 5BVOA 3NCZA 4NM3A 3PSDA 1U4DA 3ZS5A 4MCVA 5D12A 2J4ZA 3QQLA 3VUMA 4YO6A 3I7CA 2WELA 3EIDA 2PVNA 5EW3A 2BUJA 4CLIA 4W4WA 3TV7A 4IJPA 4LGDA 3RK7A 3KXMA 2XK9A 2PPQA 5A4TA 3NNWA 5DWRA 3R7EA 4G6NA 1B39A 3MFUA 3U6JA 4AX8A 1K9AA 1W8CA 5ETCA 4NSTA 4BI1A 5AV4A 4QQTA 2B53A 2PMOX 4CT1A 4ASZA 3ET7A 3NEWA 1ZMWA 3A60A 3ACJA 5BMMA 3KQ7A 4DLJA 2OO8X 5IQGA 1GIHA 3UC4A 2QKRA 5EQPA 3A2CA 4GL9A 4ACCA 4DITA 1MRYA 3C5IA 2JIIA 4FKTA 4QYYA 3KULB 4ZTSA 1FMOE 1YDRE 3F2AA 5AUUA 4C36A 3R7IA 4K18A 2QQ7A 4PTEA 2GFSA 3V5LA 3BQRA 4GKHA 3EQRA 5JGDA 4CGAA 4WOVA 5DGZA 5BVWA 3RPYA 2WMVA 4FV2A 2P33A 3R9DA 1H24A 4FX3A 4HYHA 2XCHA 4RQVA 3G2FA 1Q3DA 4TZRA 2PZRA 3QGWA 2VGOA 4TY1A 2Q0NA 4Z9LA 3ZONA 4BKZA 1G5SA 3OXIA 2VWYA 2ONLA 5KZIA 4XBRA 3VUTA 3QQFA 2FSMX 4EQMA 2X4FA 5KBQA 4H58A 1UKIA 2G2IA 3OXZA 4ZMEA 2VTRA 4FV7A 4R8QA 4D1XA 4F6UA 4U45A 5IU2A 1M52A 5CVGA 3QZFA 4EK3A 4EI4A 1FQ1B 4W8EA 3ZXZA 3KGAA 4W9WA 4F7LA 3QRTA 4Y83A 4ZJIA 1PXIA 3UOKA 4IAKA 5CVFA 3OBGA 4CCUA 1L3RE 4D5KA 3E8CA 3EZRA 4ANNA 1IG1A 3ALNA 2I0YA 4EOIA 3R7YA 3UE4A 3K54A 2UZUE 4NK9A 5AA9A 5JMSA 2CLXA 4R7IA 1M17A 4MNEB 3TNHA 1H1WA 4EUTA 3Q4ZA 3LFCA 3UGCA 4DTBA 1PKDA 1Y57A 2C47A 3B8RA 4TWPA 4HNIA 3LQ8A 4ONAA 5HVYA 3SGCA 2R3LA 3F5PA 4GT5A 4AE9A 4P5ZA 1KSWA 3M2WA 5AP0A 3ORPA 4JLCA 4AGDA 2R0UA 1JSUA 3N51A 2YACA 3NAYA 4DBXA 4F65A 2NRUA 3EN4A 4Y5HA 2V7AA 3H9FA 5HESA 3ROYA 2R0IA 3DJ5A 2WEIA 5ANIA 3O71A 4UMUA 3JR1A 4HVIA 2WKMA 3KREA 3N4TA 3AMBA 1OPLA 3BLHA 3LLTA 3SXSA 4DFZE 4Q9ZA 2ZB1A 4DG0E 5K9IA 4O6EA 3EQBA 5LMKA 2VTIA 1YVJA 2YN8A 3W2OA 4GT4A 3JVRA 2BDJA 3ZFYA 2QR7A 3Q5IA 4UEUA 1Q41A 3EMGA 2BHHA 4O83A 3TEIA 5J9LA 3VUKA 4Y8DA 4JIKA 4BWXA 3NVKI 3RAWA 5TF9A 3ORKA 1ZOEA 2UZBA 1JLUE 2ESMA 3DCVA 4J1RA 5TOZA 3H9OA 2ITOA 4XRLA 4EYMA 5EDQA 4JXFA 3FXZA 4ASXA 4M66A 3EQHA 3VO3A 3WARA 3C13A 1Q8TA 4IWOA 4IVCA 4F09A 1K3AA 4GH2A 4RT7A 4BZDA 3DTWA 5E9EA 2QHNA 3D83A 3ORTA 3PWYA 3QLGA 2OXYA 1PXMA 1U46A 5JZJA 1H00A 2UW9A 3OY3A 2P3GX 3Q9YA 4XV1A 2RGPA 3QUDA 2A4LA 4GCJA 4RX9A 4OGRA 4MXOA 3WYXA 4LFIA 4MEDA 4C4EA 1UU3A 4R78A 4D5HA 1OITA 4AOIA 3FLNC 4F63A 4EC9A 4JL9A 4RIXA 4FMQA 5KMIA 5CQUA 1JQHA 4YC3A 2BILB 4MAOA 1FGIA 4ID7A 4IDTA 5LVMA 3C0GA 4A06A 1ZY5A 2BRNA 5I9ZA 3D9VA 2XUUA 4EH7A 3LPBA 4IXPA 2XKFA 4J8NA 3KRWA 3KK9A 1H01A 1BI7A 1FOTA 4Z7GA 3ANQA 3H10A 2VWZA 5BVKA 4B6LA 3N4UA 3FHIA 3MB6A 2ZM4A 3DAJA 4ITIA 2GCDA 4YZ9A 4XOYA 3EYGA 5CVHA 1YOJA 5G6VA 4F08A 1XR1A 3KK8A 4NW6A 1STCE 1Q8UA 4R3RA 3FI2A 2X6EA 3DBEA 3LMIA 3FY2A 5AAFA 2F7EE 1JNKA 3MA3A 2YCSA 4JIAA 5C8KA 4OTWA 3LJ1A 3L8VA
chains in the Genus database with same CATH superfamily
2GFCA 1QL6A 2GNGA 3WZDA 5L2WA 4RFZA 3RNIA 4V01A 4EHVA 2O8YA 2P2HA 2B7AA 5CU0A 4C62A 5L3AA 4QP9A 1ZRZA 4BDHA 4JDHA 2BZJA 5HO7A 3T9IA 3AC4A 4X3FC 1PHKA 2C30A 2XYNA 3PVUA 4JBQA 2WTJA 4AXCA 4FL1A 4XG4A 3SW4A 2BVAA 3MFRA 3LCTA 2W9ZB 3DT1A 5IUGA 3BHYA 1JKLA 4QTCA 3ROCA 3R1QA 4JT3A 3ZEWA 3LFNA 4J52A 3AD5A 3BCEA 3RAHA 4BKYA 5HE1A 3PSBA 3UZPA 1RQQA 4YHTA 4O84A 3R7UA 3NW7A 4RJ5A 3HMIA 4PDPA 1K2PA 1MP8A 4MD7E 2PHKA 5CNNA 4AA4A 4TTHB 3LFBA 1OZ1A 1V0OA 4O0WA 1Q97A 3G6HA 1W2FA 2XIRA 3E93A 2QKWB 1J1BA 4RFYA 5G1XA 3LJ0A 4UMRA 3WF8A 3QXOA 2XEYA 2IJMA 2PVMA 3EB0A 5TKDA 1TKIA 4XX9A 2ZOQA 4PWNA 2YERA 4B8MA 1YHWA 3ZHPC 3VUIA 3Q4TA 3VS2A 4IB5A 4FI1A 2W4JA 1PY5A 4XLVA 4LUEA 3ZO3A 4TPTA 5IMXA 2PSQA 4G5PA 4JQ7A 1IA8A 4WG5A 3HMNA 2JDRA 2YJRA 3UOJA 4ZK5A 4D2RA 1U54A 3FJQE 2H34A 4D28A 4ZJJA 2W1FA 2PZYA 4K9YA 2GNHA 3BV3A 5LQFA 1W2DA 3F9NA 4H1JA 4IFCA 5HO6A 3UPXA 3QTWA 4N4SA 3FMEA 2RSVA 4IFGA 5BUEA 3S1HA 3COHA 1GJOA 2XRWA 3HV3A 3P78A 4J53A 4C59A 3K3IA 4WNKA 3EN9A 2GS6A 1OPJA 3PY0A 4C0TA 2C1AA 4C3PA 5KX8A 3NVMB 2XZSA 3DA6A 4O7ZA 3LM0A 3TCPA 3HNGA 4O0YA 2Z02A 3DDQA 3LCDA 4E20A 4LRJA 4WG4A 4D4YA 2GTMA 3UNKA 5KUPA 3OCBA 3AT3A 3KCKA 4K6ZA 3BL9A 2HCKA 1XBAA 4YHFA 1F3MC 4ZAUA 4XV2A 2ZV7A 4FTRA 3W1FA 3WZEA 2PVFA 4JBVA 4E4NA 4AE6A 3TUDA 4R5YA 4O91A 3FYJX 2CMWA 4G3EA 3BGPA 4FKRA 5HIDA 1PXJA 5ANKA 3NX8A 4QP3A 4RSSA 5CASA 5ETFA 5CENA 4D0XA 4G3GA 1LUFA 3KMWA 3MSSA 2XIZA 5FDXA 4IVAA 1F0QA 3UNZA 3ZLWA 4IACA 3E64A 4FTTA 4F99A 2JKQA 5JFVA 4HZSA 4TYHA 4UYAA 4EKLA 3BQCA 2JD5A 2PL0A 3GNIB 4AXFA 4M12A 1QPDA 1O6YA 2W5HA 3HRCA 4LGGA 5FWKK 2A98A 2ZMDA 3BHUA 3I5NA 2WQEA 1AD5A 2B9HA 3ORNA 3R00A 4O4EA 4F7NA 5EYMA 2IPXA 4ALWA 1BLXA 4BJJA 5AV2A 1T46A 3SD0A 4BCPA 4EKKA 1Z5MA 4M68A 1YWRA 5CF5A 3PE2A 4KB8A 4EOQA 3HMOA 4WSYA 2P55A 4NIFB 4O4DA 4RWJA 4H39A 2ZDUA 1UU8A 3LFFA 3COKA 5HHWA 4XG6A 1OGUA 4YJNA 2QU6A 3RP9A 2I0VA 5BNJA 3JXWA 5EYKA 4N57A 1YDTE 4BI0A 2EU9A 2PZPA 5DMZA 4DF3A 5K4JA 4QPAA 4U3YA 4MYGA 3E8NA 2C5NA 4AG8A 3GC0A 1QCFA 3I0OA 2BPMA 4K0YA 4O0UA 2CNVA 4FTKA 2HXQA 4I5HA 4PTGA 4BCQA 4EH8A 5I5ZA 3JYAA 4PMPA 3FQHA 3PJCA 1H07A 5M4UA 2ITZA 2WU6A 1BMKA 5H2UA 5IQFA 4BRXA 4D4VA 4RJ4A 2XK4A 5LJJA 3SW7A 2VTQA 2FO0A 1J7IA 5C8MA 4CTBA 2J9MA 5DEWA 1UWHA 2C6TA 2BDFA 3BYUA 5HCYA 3FPQA 2VTPA 2X0PA 4IHPA 2QU5A 4BTJA 5KCVA 3RHXA 4QQJA 1ZYSA 4L3PA 3IW8A 4G3DA 4PY1A 5FBOA 2RFSA 1SVGA 5CSWA 4YLKA 2PMIA 3R7OA 2VUWA 3MH1A 3T8OA 4FGRA 4FR4A 4CFVA 4HW7A 3DFCB 4GFMA 3BWFA 1PMUA 3V6SA 5FRIA 3QD2B 4XUFA 3EN6A 4N6ZA 3RPSA 2EWAA 2YDIA 5CSVA 3W2PA 3LQ5A 2YFXA 2RFDA 4E5BA 5M44A 3KFAA 5AJQA 3TG1A 3W16A 3W0SA 2XIYA 2RKUA 3HMMA 2X4ZA 4QMOA 2UZVA 1U5QA 2FSLX 2YZAA 4LV7A 3LXKA 5DN3A 4S33A 2R3IA 5ANEA 5LMBA 5CNOA 4DLIA 5A46A 3QRIA 2ETKA 3V8WA 2IVTA 3MH0A 5DIAA 5HNBA 3IGGA 1OL7A 4OT5A 1OKVA 5BYZA 3AT2A 4DFXE 3I60A 3SC1A 4AZFA 4YJTA 3ZZWA 5HORA 4K77A 4FEXA 4FICA 4EHGA 3PXKA 4KA3A 4LM5A 2BAQA 3D94A 3TKUA 4JI9A 4O0SA 4BYIA 4TWCA 2C1BA 3JY0A 4XG8A 2XKEA 3F3UA 3D0EA 5AUTA 2UZTA 3EL8A 3GCUA 4BCKA 2O5KA 5CZHA 4FYOA 2WOUA 4ZSAA 3KF4A 2DS1A 3BIZA 4KKEA 5K5NA 2F7ZE 3MPMA 1OL5A 2BTSA 4XG7A 3TM0A 5D7AA 4AW5A 1PRYA 3NYNA 3U9CA 4R6VA 3GGFA 4QPMA 3TN8A 4OTHA 4ZSJA 1J1CA 4QP4A 4C3RA 5M09A 2ZV2A 1G8JA 2WNTA 2WEVA 3F82A 2R3MA 3I0QA 5B2MA 1W82A 1W98A 3CD3A 3R7GA 5HG7A 3VVHA 3Q32A 5AIKA 4FNWA 2WB8A 3SA0A 5BV3A 3VQUA 3OXTA 4GU9A 2XA4A 5KHXA 4GIHA 4Q9SA 4CFUA 5IUHA 4HYSA 4OAUC 3Q4CA 4EZ3A 2WTVA 2AQXA 3SXRA 3G6GA 4C57A 4C34A 4KINA 3UQGA 4EQUA 5M08A 3ZLXA 4U79A 5AP7A 4UZDA 4J99A 3JS2A 3EFJA 5CEPA 3D4QA 2CGVA 3OOGA 1YXSA 2OXDA 4FSWA 3BZ3A 5AADA 4CV9A 3O96A 3RWQA 2PU8A 4ZP5A 4K11A 4UWCA 3PZEA 2X7OA 4QQCA 4CMOA 5FD2A 4YZDA 4ZSEA 4DEHA 4XRJA 2CCIA 1OM1A 4BICA 4C61A 4AZVA 2QOHA 4QMZA 4NFMA 2X81A 5L6PA 3LKMA 3DKGA 4CZUA 4ZTMA 2RL5A 2QR8A 3MJ1A 3FC2A 4V0GB 1OIQA 1OVEA 4QMTA 2P4IA 3ODZX 5C27A 5AUVA 3IDPA 3C4XA 1OMWA 4BTFA 2YHVA 5EQYA 1R78A 3KXGA 1NA7A 2GSFA 4Y85A 4FZFB 4O4BB 4NW5A 4ERKA 1WBWA 2R5TA 5HU3A 2YLFA 2JC6A 4TN6A 1Q5KA 3LM5A 2BZIB 1SNXA 4H1MA 4PRJA 4FEWA 4DFBA 4C4IA 3RZFA 5M57A 3MPAA 4JAJA 4ALVA 4BTMA 5HIBA 4FSYA 4RIWB 1S9IA 1XBCA 2HIWA 2PVRA 3NFGB 2J90A 4KUJA 4LV8A 5HI2A 2IZSA 2QO9A 4QMPA 2R3NA 2YA9A 3IDBA 4BBMA 3G0FA 3MFSA 4IM3A 4OUCA 2VX1A 2CGWA 3UVQA 4RC2A 3ORLA 1BKXA 4BN1A 2VO7A 3EJ1A 2YJSA 3EOCA 1GIIA 4M7IA 3AGMA 1ZY4A 2EXCX 2X8IA 3FI3A 5C01A 3LW0A 3HECA 4L67A 2YAKA 4QYFA 4FVRA 1YXTA 5DRBA 4PNKA 2F2CB 3VBTA 3QTZA 4XG2A 3HYHA 4H3PA 5L2SA 4IC7A 4QTAA 3KKVA 3BYSA 4GFOA 5CU3A 2FB8A 3FKOA 3RI1A 4RBLA 3OUKA 4XBUA 3R28A 1G8KA 2W1ZA 2Z2WA 4U3ZA 4S32A 1R0PA 3QQGA 5LVOA 2OZAB 1DAWA 2OF2A 4E4XA 5KHWA 4O7YA 3NMUF 1ZARA 4DINA 3QA8A 3NZ0A 4M69A 1M7NA 2CN5A 3IS5A 5T3QA 4NYEA 1PW2A 1Y6BA 3MY0A 4FKLA 5CWZA 4BCMA 4W4YA 4EC8A 2Y9QA 4IDVA 2X7GA 2WMXA 3ZM4A 2PVLA 3ZFMA 4CFXA 4MBIA 3Q6UA 3GC7A 2XAMA 1H1PA 4YZMA 4U5JA 3SVVA 4IBMA 4RPVA 1SMHA 4QO9A 4J97A 3LFDA 1Y8GA 2GS7A 3PIXA 3FXXA 2G15A 2ZB0A 2R7BA 3FZOA 3D5UA 3HUCA 4KIKA 3ZRMA 4CKIA 1JSTA 2G01A 4E8AA 5AAEA 4O82A 1YI4A 3C51A 3CQUA 4TRLA 2OH0E 4FTJA 4DYMA 4FNYA 2HK5A 1PJKA 3ZUUA 4AZSA 3PE1A 2VO0A 4Q5EA 3T3UA 2CKPA 3HAMA 3W2QA 3SOAA 1XJDA 5JN2A 4DTAA 4LGHA 3RM7A 3KB7A 1R1WA 4FZ7A 4C37A 4FG7A 3ETAA 3FLSA 1P4OA 3FLWA 4KKHA 4BF2A 1UV5A 4UV0A 2DQ7X 5DT0A 4EUUA 4IMYA 2GHMA 3I79A 3PPKA 4BBEA 4WSQA 2Z7LA 2HW6A 3NIEA 2XJ2A 1WBVA 2JKOA 5EHYA 4WUAA 2BMCA 3QL8A 2ZDTA 4UXLA 3H0YA 1CKPA 4G9CA 3VAPA 4F9BA 3M1SA 2C5OA 5ITAA 2OICA 3NPCA 2IW9A 4L46A 1ST4A 5HE2A 4PL4A 3RZBA 2H6DA 4A9UA 3KRXA 4GJ3A 4EK4A 4A9SA 2ITYA 2VX0A 4UWBA 4FV4A 1GZNA 3S3IA 4AT4A 3MESA 4GW8A 4FK3A 3BLQA 5IQAA 4LYNA 4LOQA 4RJ7A 3GUBA 2HZ4A 3R73A 4YJUA 4FUYA 5LWNA 5D1JA 4Y72A 3MV5A 4C4JA 3ML1A 2I40A 2R4BA 4X3FB 3DBDA 4FKUA 1ZYCA 5D9HA 4FTAA 5L6WL 4O7TA 2FGIA 4IM2A 2OBJA 4G16A 1LP4A 1YDSE 3VS3A 3AKLA 2ONLC 5FQDC 3ZTXA 3P7CA 3R1NA 4PX6A 4E4MA 4EH3A 1PMVA 1TQIA 3QTXA 1FBNA 2YDJA 3VIDA 4IADA 5DVRA 2PTKA 4A9RA 4YJOA 3B2WA 4BCJA 4TKSA 1E1XA 5IH6A 2W1GA 3O23A 5AUWA 3IGOA 4O2ZA 4L7FA 2CLQA 3R8ZA 2O0UA 3UDSA 1ND4A 5EKNA 3C4EA 1WBTA 4TYHB 3TZ8A 3G9LX 5AFVA 4GJ2A 3PUPA 3IW7A 3Q60A 4JDJA 3WZUA 3UJGA 2GNIA 4GYIA 2ITNA 2CHLA 5AR7A 2UW7A 1BX6A 2W06A 3KRLA 3R83A 5EYCA 3IPHA 4J7BA 4ZTRA 1UNLA 4FT9A 5B0XA 2E9VA 4AZTA 3UIUA 1RW8A 5JRSA 3FLZA 4MWHA 4D2VA 2VNWA 4JG8A 2XH5A 4U42A 4PL5A 5HD4A 4JR3A 2PE2A 2ZFYA 4BWKA 4CYIA 4K1BA 4I6QA 2QNJA 4OLIA 3ITZA 4I23A 4A4XA 3E87A 5JK3A 3NNXA 4JQ8A 4QMNA 2ZYBA 2VRXA 2VTSA 3QCYA 4UYNA 4P7EA 5E4HA 4LOPA 2UW5A 4NU1A 1Z57A 4RGJA 3S2PA 3CPCA 3CY3A 3QHRA 2QC6A 3SLSA 2UZWE 2E9OA 3QQHA 3QUPA 4FTNA 3R8UA 5LMKC 2XCKA 5ACKA 4FKQA 3UYTA 4EWHA 2PUUA 2YLEA 3R71A 5HE3A 3VBVA 4AW2A 3G5DA 5E8XA 1KUTA 1XQZA 5T68A 4YO4A 1O9UA 2FUMA 3UIBA 4QP8A 3KC3A 5JRQA 3U51A 5LVNA 3OTUA 3FHRA 3TXOA 3FZTA 3FEGA 1YRPA 3DQWA 4IM0A 3ZFXA 4ERWA 3NUYA 2IO6A 5FP6A 3PXRA 3QKMA 2QONA 3EZVA 3R9OA 3TZ7A 3NYVA 4I41A 1VYWA 4F4PA 5IQDA 2A1AB 3BE2A 4S31A 3L8SA 2UVXA 3QRKA 2QURA 1URCA 4PV0A 3R1SA 3OT3A 4UB7A 5FXQA 4DH1A 4FKJA 2W1EA 5H8GA 3TJCA 3VW8A 4FK6A 3H0ZA 1IA9A 2YISA 3E3BX 2B1PA 2EVAA 5BVFA 5KKRB 3AOXA 2R64A 1J91A 3FBVA 3CXWA 4AACA 4OW8A 3V5WA 4XG9A 4IX3A 2WIHA 2OJIA 2V22A 2O2UA 4JBOA 4RX8A 3V8TA 2H8HA 4MXAA 3UZTA 4K8AA 3QZHA 4B0GA 3QKKA 5HLPA 5J9ZA 3HAVA 3FAAA 3Q2JA 4L45A 4EOPA 2R3OA 4G31A 3TMOA 2UW0A 5HG9A 3VJNA 2QG7A 2WQNA 3CTQA 4FIIA 3A62A 3DZOA 3JVSA 4NM0A 3ZYAA 3CBLA 4HVDA 2Y8OA 3O17A 4JOAA 4D9TA 5T6KA 4DGGA 4U8ZA 3KN6A 4I3ZA 4IAFA 5FLFA 3UP2A 4ACMA 1Q62A 4RVTA 3PG1A 2IWIA 2J7TA 4M15A 3S95A 2YIQA 4MWIA 1SM2A 1ZZ2A 3GP0A 1YI6A 1ZZLA 1YI3A 2BALA 2XMYA 3PY3A 2F4JA 2VTNA 3QYWA 5HLWA 5KO1A 4WG3A 1XMLA 3QUEA 3GENA 3BL7A 4R3PA 3MH2A 2JKKA 4X0MA 3UP7A 2A0CX 4FT7A 2BDWA 4V05A 2OKRA 1APME 3QAME 4GK2A 2F9GA 2WQMA 1JKSA 2HELA 2X39A 5GZ9A 5L8KA 3NYXA 2VTLA 3DK6A 3B8QA 2J0MB 3FSKA 4WHZA 3SAYA 5CEMA 4RLKA 4HCVA 4XOZA 5EM8A 5LMAA 3UDBA 5AX9A 5AM6A 4O7SA 2I0HA 4GVJA 2JAMA 3W55A 1JWHA 1BL7A 4F6SA 1PF8A 4RX7A 5FTGA 5HVKA 4Q5HA 3EHAA 4APPA 4YZNA 5CF8A 4I6BA 2JFMA 4IVBA 2X2LA 4FYNA 4ZZOA 2B9IA 5EKOA 3FL4A 2QO2A 2UW4A 4WUNA 5EM6A 2W99B 5CXHA 4C38A 3C0IA 4DCEA 4FSZA 5DBXA 1KOAA 4GT3A 4PUZA 1NY3A 2XB7A 4E73A 4FV1A 4I0RA 2VTMA 3QALE 4CG9A 3AKKA 2C0IA 1VR2A 2WQOA 3FC1X 4IB1A 4U6RA 1V0PA 1YHSA 4ZTNA 4DEBA 4EHZA 5A54A 4TNDA 1NT2A 4IZAA 2R3PA 3LIJA 2XS0A 3UC3A 5HQ0A 3TIZA 5CTPA 3NLBA 4ZLZA 3MS9A 4AGWA 4U97A 4KSPA 4AWIA 2ITQA 4PDSA 3PPJA 1WAKA 3CTHA 4BDBA 3JY9A 4CZTA 3IW4A 4WKQA 1OB3A 4FIHA 1QPJA 3HDMA 3F3TA 4TWNA 5HICA 3QCQA 3W18A 4DEDA 3VBWA 2X8DA 3PIZA 4D2WA 2CKEA 3ZM9A 4MNFA 3SV0A 2QD9A 4C3FA 1XO2B 5E8WA 1JVPP 1KV1A 3SXFA 4RVKA 2IZRA 2JAVA 3U6IA 5CEOA 2QOFA 4CMTA 3PPZA 4O81A 5IQHA 3UOLA 3VS5A 4DFLA 1GY3A 2QOIA 3FYKX 5HEZA 3TZMA 3PYYA 3ZDUA 4HYIA 4IX4A 3GQLA 5LXMA 4WBOA 3QTQA 4GUBA 2VV9A 4DAWA 3BBTB 2QODA 4XV3A 4EH4A 3LLAA 2ITTA 5IUIA 4PMMA 5M51A 4BDCA 4HVHA 2XBAA 3FDNA 4LMNA 4CKRA 4CRSA 2UW8A 2WU7A 4EL9A 1OECA 5BQ0A 4QRCA 1OUYA 2G9XA 4MD8E 2Z60A 3E63A 2HZIA 5E8TA 4OAVB 3IDCA 2UW3A 4O1OA 1V1KA 5CF4A 3OT8A 3TV6A 3MN3A 4EJ7A 3OW4A 1SNUA 4G34A 4XNEA 5CANA 2R3QA 4UN0C 2X7FA 1ZAOA 1ZYJA 5FDPA 3TUBA 3LFEA 3N4VA 4MBJA 2JITA 3TUCA 4EBWA 4FKIA 5AP3A 1WZYA 5CX9A 3U9NA 4DBNA 3HRBA 4EH6A 2XIKA 3R1YA 4YNOA 4F0IA 4PMTA 4IC8A 4PDOA 3ZO1A 3PFYA 1Q61A 3NYOA 1GZ8A 4NJDA 2YIWA 2C5YA 2VTHA 3RVGA 4O4FA 4DHIB 1G3NA 3H30A 2IVVA 4O0RA 4UMTA 4HYUA 4F64A 3L8XA 4U80A 1T45A 3KXXA 5BVDA 5IKWA 4DN5A 4I6FA 4E4LA 3R02A 1OIYA 2RF9A 3LCSA 1NW1A 4G1WA 5IA3A 3QTRA 4L01A 3PLSA 3TTIA 4D2PA 4V04A 2Y7JA 3BGZA 4TXCA 2C5XA 1YKRA 2O65A 3QA0A 3VUDA 5I9XA 5IDNA 1H1QA 4FV9A 3FZSA 4IJ9A 4O38A 2WFYA 4YJSA 4CTCA 4PPBA 3IO7A 3UMWA 4LV5A 5JFXA 4C4HA 5JT2A 4IH8A 2E9UA 3ZDIA 1FVVA 4MF1A 5BVEA 1CKIA 2PY3A 4RWIA 4KNBA 3UOHA 5KZ0A 5HBEA 3VUGA 4J71A 3V6RA 1M2PA 4IW0A 5EK7A 4BYJA 4HGEA 3QHWA 4CZYB 3KU2A 1O6LA 4FIJA 3V5QA 2B4SB 3SRVA 5I0BA 4XG3A 1Q8YA 2H9VA 2HYYA 3KVWA 3PVGA 5IF1A 3D2IA 3F61A 1PXOA 4MK0A 2BIKB 2X2KA 4XMOA 3ZCLA 3QRJA 5FGKA 2BROA 4KAOA 4AFJA 1PXKA 1SVEA 2QO7A 5E7RA 2Z7SA 5E91A 1YWVA 3BYVA 2C6LA 4IB0A 4CNHA 4AT5A 5GINE 2C0OA 3QXPA 3ZC6A 4L7SA 3F3ZA 5EW9A 2QHMA 4AT3A 4UBAA 1ZXEA 4E7WA 3M42A 3BYMA 5L2IA 4FBXA 2Y0AA 5HVJA 3U55A 5BUIA 4DA5A 3C4CA 2GTNA 1HCLA 2WMSA 1X8BA 2VWIA 4ALUA 5GZAA 4CFNA 2QVSE 1XWSA 4HGLA 4HVSA 5FM3A 3E8DA 4NCTA 4YPSA 3AXWA 4G9RA 5M4FA 1OGYA 2X9FA 4AN2A 2BFYA 3HA8A 4RIYB 3R7VA 5I3RA 4PTCA 2XKDA 3IW5A 5CSXA 4DH8A 4KRDA 3IKAA 1XH7A 3NWWA 4ANBA 4RRVA 2HW7A 4HPUE 4KRCA 4AFEA 5IH4A 5HCZA 4NEUA 3FZPA 2JIUA 4F9WA 3BLAA 1LEZA 3UDTA 4YU2A 4ZXTA 3W0NA 2PZIA 4EQCA 4YURA 2BAJA 4I24A 4YHJA 4GKIA 5AV3A 5AX3A 4X3JA 4E6AA 2OZOA 1MRVA 1PMEA 2JFLA 2QOBA 4FODA 3V01A 5M06A 3GT8A 2W1DA 3HLLA 4ANOA 3G15A 3UDZA 2ZVAA 4FUXA 4BI2A 4Z3VA 2Y6MA 3P5JC 3GBZA 4U44A 4C4FA 4MKCA 2J2IB 5C03A 5DA3A 3BHHA 4AUAA 2XARA 3KXZA 4L68A 5CU6A 5H8BA 3LCKA 2C6OA 2WIPA 4ZIMA 3RPOA 3EQIA 2ZM3A 3W0PA 3FMKA 5DE2A 5A4EA 5EYDA 2BKZA 1OKWA 3I5ZA 4NKAA 1DS5A 3Q9WA 3VHKA 3KULA 4BDDA 4EZ5A 1MUOA 2QLQA 3NUXA 4X2KA 4BIDA 3L9NA 4ZLYA 1REKA 1PXNA 2IG7A 4BCFA 2YM4A 4GK3A 3R9HA 3RTPA 3ZO2A 5CY3A 2V5QA 4HNFA 3OF0A 3RBWA 2B0QA 5JZNA 4FEUA 1ZYDA 2FA2A 3DLZA 3ACKA 2PULA 4FKPA 3CGFA 4GVAA 5CAOA 4O7RA 4FZ6A 3E5AA 2YITA 3A8XA 3CP9A 2F49A 3R0TA 4UALA 4CD0A 4DHFA 1J3HA 2ZMCA 2FVDA 4IQ6A 2W0JA 3AGLA 3PFQA 3F6XA 5LVLA 1FVTA 4KKGA 4GG5A 2DUVA 4E26A 4E5AX 2E9PA 3TKIA 4CMUA 4D4SA 4EBVA 2QOQA 2YWVA 4BGGA 2OH4A 4FSRA 1NXKA 5JGBA 4CFWA 2W5BA 1H0VA 2UVYA 2IF8A 3OCSA 3QGYA 3VHEA 3N9XA 4ANQA 2XM9A 4EK6A 1TQMA 2OWBA 3AD6A 3DXNA 1I44A 3PA3A 5DOSA 3P86A 3F2RA 3A4OX 3KXHA 3POZA 4NUSA 4HZRA 4GU6A 4E93A 3CKXA 3VW6A 1F5QA 5EI2A 3ZSGA 4ZMFA 1W83A 3KXNA 2X8EA 1DAYA 5B2KA 5E90A 1SYKA 3Q53A 2XK8A 4MNEA 3GCSA 4QQ5A 5L8LA 3ZH8A 1H0WA 4MXCA 4BHNA 2R3GA 3A7IA 4C2WA 1A06A 3NAXA 3OC1A 3PJ1A 3GCQA 4PDYA 3D7ZA 3EH9A 3DY7A 3HV7A 3LXPA 1LPUA 2LAVA 3R22A 4Z55A 2W1HA 3DXPA 3BU6A 3RK5A 5ANGA 2JDSA 5L8JA 2C4GA 2R9SA 2V0DA 4WNOA 3ZXTA 5E92A 2GHLA 4JQEA 1Z9XA 4RA5A 1LEWA 4ASEA 2PMLX 4HOKA 3HUBA 4H3BA 4U9AA 4EWQA 4E3CA 5AP2A 4CFFA 2IZTA 4R77A 2VTJA 3TNWA 2J5EA 5HTCA 3QKLA 4EK8A 5LCJA 4LL0A 3R04A 4USFA 3FQSA 4FV5A 3QQKA 5DPVA 2X6DA 3FI4A 5L2QA 3VN9A 3ZLSA 4MQ1A 2BRHA 2BR1A 5M53A 5AUZA 1P5EA 4CXAA 5JQ8A 4FGBA 4BDFA 5GNKA 1YXVA 4YMJA 2P2IA 2PMNX 4FTLA 5HIEA 4RJ8A 3CPBA 3KMMA 1WBPA 4EOSA 2BAKA 4X2JA 3AC8A 4J96A 4ANMA 4DH5A 3MYGA 3V04A 3GXLA 3VQHA 4OTIA 3MVMA 3MW1A 4BGQA 3EN7A 2HWPA 3IOPA 4OR5A 3HV4A 4MQ2A 4QMWA 3IW6A 4FG8A 2C6MA 4OBOA 3QLFA 5CEQA 2BZKB 4FTOA 4KWPA 2E9NA 5IA1A 3OW3A 5CXZA 5TO8A 3F3WA 4QPSA 5AR8A 3O0GA 4JG6A 3GU4A 3QWKA 5J87A 3WF6A 5HTBA 4IAIA 2XKCA 5ACBC 2R3RA 4YPDA 5AMNA 2FYSA 4X6RA 5J95A 3RWPA 2CGUA 3CJFA 4OT6A 3K3JA 1DI9A 2A2AA 5TE0A 4AU8A 1M2RA 3K5UA 3GI3A 2G1TA 3SHEA 5M4IA 4FV3A 4M0YA 4O21A 1MQ4A 1QPEA 4XLIA 3PJ8A 4DEAA 1G8AA 2HY81 3NR9A 1OI9A 4AXDA 3QD3A 2FSOX 3PDTA 2UV2A 4ANLA 4NWMA 2F7XE 1QMZA 2JGZA 2WMWA 4YJPA 4YP8A 2A19B 4F1OA 3OWPA 3VF8A 4I5MA 4JR7A 5CSPA 2BFXA 3ANRA 2YCRA 5LCKA 4ENXA 2OXXA 3UQCA 1OIUA 4KIPA 5CQWA 4RG0A 4KSQA 4J98A 2ITWA 5HX8A 3UQFA 3UIXA 3CR0A 3EQCA 3QX4A 1WFCA 4K33A 2CDZA 4WT6A 4RIXB 2EB2A 3AQVA 3ENMA 5ETAA 4BCIA 4C7TA 3LFSA 4Y46A 4RZVA 1GNGA 2W05A 3WYYA 2HAKA 4JVGA 2ACXA 1DM2A 4NL0A 5CYIA 4BIEA 1AGWA 3FXWA 4G6OA 4MX9A 4PP9A 2BIYA 4YZCA 3WF7A 3V5JA 3Q04A 1J7LA 4AAYA 4FOBA 3R8VA 4L3LA 5JQ5A 4MXYA 3KRRA 3W2RA 4YBJA 1ZMUA 3EQDA 2VTAA 2VU3A 3MDYA 2WPAA 2RFEA 3F69A 2C3KA 3D7TA 2O64A 3VRYA 4BGHA 4EONA 3W2SA 3W8QA 5E1EA 2ZM1A 4TNBA 3W32A 4EOOA 2VTOA 2YM3A 3FPMA 4O7LA 2PE1A 5DT3A 5AUXA 3DNEA 3TT0A 3G33A 3LQ3A 3MBLA 5FXSA 4W9XA 4S34A 5B2LA 3MPTA 4TYJA 2VD5A 5D10A 2WMUA 5GHVA 5B7VA 1KV2A 2P0CA 3QC9A 4BKJA 5GJGA 4F9AA 4C58A 5DNRA 1DI8A 2W1IA 5HX6A 5FBNC 5IH5A 4O1PA 4BZOA 2RFNA 4GEOA 1B6CB 4FTCA 3DQXA 4FL3A 1UNGA 5E1SA 4I0SA 5IA0A 5E8SA 1CSNA 2PVKA 3HGKA 2GNFA 3NIZA