1REJA

Crystal structure of camp-dependent protein kinase complexed with balanol analog 1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
335
structure length
333
Chain Sequence
KEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Balanol analogues probe specificity determinants and the conformational malleability of the cyclic 3',5'-adenosine monophosphate-dependent protein kinase catalytic subunit
pubmed rcsb
source organism Mus musculus
total genus 104
structure length 333
sequence length 335
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1rejA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1rejA02
2XBJA 3F5GA 3MH2A 3VW6A 5CNNA 5M4CA 2J50A 1JNKA 4OTHA 5BYZA 5HO6A 4DF3A 3VUGA 2ETRA 4FL1A 4HZSA 3G0EA 3S3IA 3GC7A 4UMPA 5HX6A 4AS0A 4RC3A 1B6CB 3UJGA 2C0TA 3R2YA 4O38A 2P33A 2UZVA 3PRFA 3VVHA 4QMSA 2XCHA 4J1RA 3ZEWA 2QOBA 5HVYA 2EB3A 5J9YA 1PKGA 1ATPE 3P4KA 4OTIA 4BICA 3TCPA 1MP8A 3G9LX 4IAYA 4MTAA 4WNOA 4XRLA 2W17A 5CU3A 3CQEA 3MTFA 3R1NA 3N4VA 3U55A 3QCQA 5KUPA 1A48A 1VYZA 3HRFA 2QKRA 1R1WA 4JX7A 4NKAA 5D12A 2UW9A 5EYDA 3W2RA 3L8SA 2BVAA 4FTKA 4EOMA 2Y8OA 3FMHA 3VO3A 3QKKA 5F4NA 3FI4A 4O96A 3RM6A 2O5KA 3QTIA 4TYEA 4F65A 4QQ5A 3ZC6A 2C69A 3AGMA 1FVRA 5HI2A 4FKOA 4YNEA 5EYMA 4WNKA 4C2VA 4EORA 4QO9A 4S30A 5HGIA 4IC8A 2FA2A 3Q60A 1OKZA 3MBLA 4OT5A 4QOXA 2J5FA 3IGGA 3L8PA 4S2ZA 3GC9A 4C3PA 1YI3A 2CN5A 4FICA 4FZDB 5HKMA 2PVHA 3NWWA 3PUPA 3SXRA 4RMZA 3UE4A 2G2HA 1XH9A 2WQMA 3I0OA 3C4XA 1YI4A 4DITA 4ACMA 3DJ5A 2WTKC 3OOGA 3AOXA 3E5AA 5EW3A 4EH2A 4U6RA 2QLQA 4BR3A 3NUAA 1QPDA 2EXEA 3EKNA 4XOZA 2XM9A 3I4BA 5AP7A 3W2OA 2FH9A 2OF4A 4F1TA 4IBMA 3E92A 2WB8A 1FQ1B 2YIQA 3Q3BA 3QGWA 4YTHA 4ZZOA 4IH8A 1F3MC 2FB8A 3DTCA 4BVUA 2BFYA 3KMUA 3QKLA 2NRUA 3QQGA 2XUUA 4DEBA 3FYJX 1UWHA 5J5TA 4RIYB 2HELA 4U7ZA 4N6YA 4O7RA 4WUAA 4ZIMA 1OL6A 4DEEA 1WBTA 5A54A 3NUNA 4TYGA 1JSVA 5BVWA 4DCAA 4EOKA 1BLXA 4LOPA 4F70A 5J7BA 4QMOA 1J7UA 4O82A 1ZYDA 3CGFA 5CT7A 4E6DA 2OF2A 3DLSA 5T3QA 3TWJA 5IA0A 2J2IB 1J3HA 4QT1A 5ANDA 3QZIA 3MY5A 2WHBA 3P08A 5FP5A 5HX8A 1A06A 3TTIA 2WMSA 3VHEA 5JFSA 3KA0A 4NCTA 4GUBA 3F69A 2V22A 4J7BA 4M15A 3NX8A 4L68A 4EZ3A 1KE8A 4G3DA 4QTCA 1STCE 4CZTA 1DS5A 3QRIA 1XO2B 5CAPA 5A3XA 2RG6A 3LXPA 3A7JA 4E4NA 4RGJA 1XH7A 3REPA 4UMTA 4PF4A 4E6QA 5H8GA 2ZV7A 4W4WA 2B9FA 3FSKA 1BL6A 1T46A 5FBOA 3H3CA 3HL7A 5IKWA 5AP1A 3II5A 4QMUA 3LCKA 2JC6A 5IA5A 5C9CA 2OIBA 1OIQA 4KINA 4FV6A 4I3ZA 3ATTA 4M84A 4MYGA 5AA8A 5A4EA 4N70A 2RKUA 1OIUA 1OKWA 1PMEA 3VBTA 3V6SA 4D4YA 2JDRA 4FE2A 2F2CB 3KL8A 1APME 2GHGA 4PWNA 4BL1A 4EK4A 4EBWA 3ALNA 3U54A 3RK7A 3LZBA 3NUUA 2IZRA 5HTIA 4YTCA 3U6HA 1BKXA 2P0CA 4IE9A 1E1VA 3EQIA 4O86A 3PZHA 2HZ4A 4CFFA 2WQOA 3CKXA 2YIYA 3R7GA 5AX3A 4JJRA 3R9DA 3VULA 2QVSE 4KIPA 2ZM3A 4R3CA 2WOTA 4JRNA 3RM7A 3O17A 4JT3A 3CCNA 4YJPA 3RP9A 1OPKA 2VTQA 3OCBA 1YWRA 3PIXA 1H01A 2CDZA 2ERZE 2QOFA 3QA0A 4WBBB 3WZJA 4DH3A 2YJRA 5KMJA 3OEFX 4M8TA 5E7RA 3QX2A 5B0XA 2G2IA 4BTMA 3G2FA 4AF3A 2C5OA 2ONLA 4OGRA 4BYJA 3UVPA 3GFWA 4L67A 3ZXZA 4YJUA 2IW6A 3RK5A 4QMQA 3CR0A 4L46A 5LVMA 4R1YA 2KTYA 5ANJA 5CQUA 5L2IA 1PXPA 2OU7A 3HZTA 4QMPA 5CSXA 4JIKA 4ZTRA 5HICA 3SC1A 2ETKA 3ZO2A 4EOSA 5LMKA 2BKKA 3OW3A 3RMFA 2YWVA 3AC3A 4E4XA 3GCUA 4TN6A 2BDJA 3PVBA 3U6IA 1M14A 3IW6A 3ZLSA 3R0TA 4FTQA 5DLSA 5BVFA 4WG4A 2PULA 1Q8TA 4M3QA 3DT1A 3EN7A 4GG5A 2QG5A 2R3HA 5JH6A 3DPKA 5J87A 4GFMA 5DR2A 3ORXA 5HE1A 4FSTA 4XBUA 3TTJA 5KNJA 3HEGA 3TKIA 4MEDA 4J96A 3RCJA 3LJ0A 4B99A 5ETCA 4LRJA 2WMXA 3QYZA 3D5WA 4FL3A 4KSQA 4KS8A 3LW0A 3UOKA 3PJ1A 4FZFB 3QTRA 4FG8A 3R21A 1ZOGA 2YWPA 2EU9A 3QAME 4PL4A 3QTQA 3HV7A 2VWUA 5HBJA 4QP4A 1H1SA 2GTNA 3RAKA 4BZDA 3O8UA 3M42A 4LG4A 3KREA 1XKKA 3C0HA 5EW9A 3PSDA 1Q24A 1XH5A 2UW0A 1YQJA 3VRZA 5GZAA 3KULA 4DFLA 2W5HA 2VWXA 5L8JA 2RGPA 4BB4A 2XRUA 4F4PA 4K8AA 4AU8A 2OG8A 3HP5A 2JITA 2FYSA 1XH6A 4LMNA 3ORTA 3SV0A 2VTTA 4R5SA 3UYSA 1F5QA 2X7GA 1Q41A 3NUSA 4BDKA 2QD9A 3TJCA 4FV0A 2J5EA 4X2JA 5C03A 1OECA 3I60A 3BBTB 4AZFA 1KE7A 3FMJA 4D1SA 4R77A 3GU7A 4IHPA 2PL0A 3V51A 5CSHA 2W1HA 3TN8A 2J0LA 4J53A 4MBLA 3CJGA 1V0OA 2CMWA 1UKHA 3ENHA 4G6NA 4MXOA 5IQBA 3F3VA 2XNOA 2V7AA 2WGJA 5A46A 4WOVA 3F5PA 5DT4A 4OBPA 4WSQA 2G01A 4OTGA 4WG5A 4WRGA 3VS7A 5IMXA 1IA9A 4F99A 3TIYA 3QD4A 1MRYA 3RJCA 3BX5A 2GTMA 4F0IA 4YC6A 5H9BA 3IECA 5GHVA 4CCBA 1OGUA 2W1CA 1OBDA 5EM5A 2PUPA 2ZDTA 3P79A 4JAIA 3LFAA 4TPTA 5B2LA 2WMUA 3EYGA 4A4OA 3OOMA 2Y4PA 3HRCA 3KXZA 3Q9YA 3VS0A 4K2RA 4RFMA 4ZSJA 4IWDA 1BI8A 1O9UA 2BAJA 4FIEA 5L8LA 2HK5A 3R1QA 2W96B 4X2FA 3ORIA 5M51A 5DE2A 4BIDA 3QHRA 2UW5A 4GS6A 4HNFA 4EC8A 4CG8A 2GNGA 4UZHA 4DT8A 2HZNA 3QCYA 3O7LB 3EL8A 4BTJA 4Y46A 2XIKA 3WZUA 4FIIA 4LL5A 4QYGA 5FEQA 4IXPA 1LR4A 4MBIA 1KOAA 4NEUA 3LFEA 2IVTA 2DUVA 1ZMUA 4FSMA 4M66A 3HA8A 2CNVA 1KOBA 1CKIA 1IA8A 4RWJA 5CI7A 5KMOA 4XMOA 1JKKA 4A4LA 3DDQA 1L3RE 2XEZA 3SRVA 5CANA 5AUXA 2O64A 4C35A 4ZMFA 5LWNA 4ACHA 4D4SA 3OY1A 2HW7A 4D5KA 2Z7RA 4FI1A 4AA0A 4DGNA 4R78A 3V3VA 2IWIA 4J52A 2OIDA 3GUBA 3H4JA 3C4CA 5F1ZA 2Q83A 5FUTA 3R02A 3G51A 3MS9A 3PJ2A 3PWYA 3CXWA 4U3ZA 5FBNC 5AUVA 4YP8A 5HOAA 4S31A 5D10A 2VGPA 4Z7HA 2WTWA 3UIBA 5E8SA 3F9NA 4FG9A 2CN8A 5CF4A 4QMWA 5DNRA 4CFUA 3QGYA 4GFGA 2YM7A 4ZLYA 2CNUA 4BDBA 4NU1A 4AE9A 1E9HA 2VTNA 4PMTA 4C58A 4KUJA 3U8WA 1KE9A 2AUHA 4FKUA 3NDMA 5DRBA 3E3BX 3UP2A 3VJNA 4CTCA 5JMSA 3IW4A 2WMBA 3DQXA 4FTJA 3QXOA 2XBAA 4YPSA 2ZB1A 4AW5A 5CEOA 5IUGA 4YHTA 4H3QA 1SMHA 2XH5A 1VEBA 3DJ7A 3OT8A 4WBOA 3OBJA 3R00A 3QLFA 3R8VA 3PLAE 3ZO3A 2CKPA 2I1MA 4YJNA 3FMKA 2ITXA 3F3ZA 3MY1A 4U45A 2R3QA 2BKZA 3M11A 1AGWA 3OWJA 3UQGA 2JDTA 5TKDA 4IDVA 4XG6A 4UY9A 5JFWA 1XWSA 2C3KA 3PXRA 2XNNA 2F7ZE 4YZBA 4F1OA 4UXLA 5KMIA 3BCEA 5CF8A 3KXHA 3TXOA 3FZPA 2IJMA 3UIXA 2W06A 2BZHB 2WTIA 5EHOA 2VTHA 1H07A 2I40A 3FMEA 5LMAA 5A9UA 1KE6A 5CQWA 3OCSA 2BILB 2OSCA 3HX4A 4EZ5A 3PP1A 4NYEA 3MA3A 5CU2A 3TNQB 3DB6A 3VQHA 2PZIA 3CQWA 4I94A 4OW8A 3ZSIA 4E93A 2X8IA 4FYNA 3GU5A 4V04A 4WSYA 4G3EA 2CCHA 2X4FA 4I93A 5DMZA 1BYGA 3IW7A 4QYFA 3R7OA 3ZUTA 3JR1A 1H08A 4EJNA 3I6UA 5JN2A 3A8WA 3RNYA 3ROYA 2C4GA 3KRXA 4TTHB 2GFSA 4R3PA 2BDWA 2GNJA 5B7VA 4QD6A 4I0TA 3HKOA 2GNLA 2FSOX 4NW5A 3FL5A 4QP6A 4QYHA 4UWYA 4FVPA 5CSWA 3UOLA 5DEWA 2YITA 5HNGA 4O0VA 3UG1A 3KFAA 5AR5A 5AV4A 3LFSA 4QMTA 2VWZA 3TZMA 3FZ1A 3ACKA 2XKCA 1V1KA 3MFRA 5TOZA 3PIYA 3ODYX 3WF9A 3MH1A 1XBAA 2WXVA 5CU0A 4KIKA 3R7UA 2VO7A 4FV9A 2CKEA 2WTCA 2BHHA 5AR2A 4Y72A 3QTSA 4OTRA 2XIYA 4BHZA 3ZRLA 4C61A 3WYXA 1TQIA 2BTRA 3TV7A 3O0GA 4RC4A 4UEUA 4WHZA 1OKVA 4I5MA 4HJOA 3TEIA 4FUYA 3C9WA 2BRGA 2B9IA 1H00A 3GEQA 4RZVA 3ZS5A 1UU7A 3KULB 4DAWA 2DYLA 4TZRA 1G3NA 2PK9A 4ITHA 3KK8A 1PXKA 4IAAA 2JEDA 2G2FA 3UG2A 3RAHA 4CMOA 4OTQA 2GFCA 4ANLA 4XX9A 2QC6A 4U97A 5C26A 3E87A 4IZYA 3ZEPA 4F1MA 3PA5A 5T68A 4MAOA 1W7HA 3IONA 4D2WA 3OD6X 2WMVA 1GIIA 1UWJA 5HZNA 5CU6A 1H1QA 4DTKA 3V8TA 3GI3A 4X0MA 4O7SA 2HYYA 2NO3A 1LUFA 1Q99A 3SG8A 5D7AA 4DBXA 3WZKA 3LCDA 2GU8A 4BBFA 3ITZA 2PZYA 3UZPA 2IW9A 3SW4A 3IO7A 4WO5A 4U43A 4FKQA 3TM0A 2GS6A 5JZJA 1OMWA 2QO9A 1GZNA 4HZRA 2UVYA 4D2TA 3TJDA 2X2LA 5KCVA 2GHLA 4L44A 1O6YA 3Q6WA 4GJ3A 3DY7A 5CVHA 4KKGA 2VTAA 4KS7A 4GEOA 5IH6A 2OJFE 1XR1A 3P0MA 4ONAA 2BDFA 4Y5HA 5EM7A 3V01A 4FVRA 2W99B 3UC4A 5HIEA 1DAYA 4P5QA 2VD5A 4A9SA 3IPHA 3H10A 4G5JA 4GK4A 4A9RA 4PNKA 3QU0A 4N57A 1JOWB 4H36A 3RZBA 3FLWA 4GK3A 2IO6A 2ZM1A 2WMAA 3MFUA 4L6QA 5K4IA 5K9IA 2V7OA 4RSSA 4AQCA 2W05A 4EQMA 4WT6A 4O2ZA 1VYWA 4C7TA 1OI9A 1Y57A 4RJ5A 4AXAA 4P90A 4X6RA 2FO0A 3E7VA 5IQEA 2XM8A 3RCDA 3NNVA 3SW7A 3MFSA 3FI3A 4I6FA 2P55A 4AOTA 3BPRA 2B52A 2OGVA 4FSWA 4CRSA 3HAMA 2YLEA 4D9TA 4L00A 3S1HA 1ZYCA 3GCPA 3ELJA 3R9OA 4DEDA 1Y8GA 5E92A 4DEHA 2XYUA 3AMBA 3C7QA 1DAWA 1YDSE 5GIPE 3DV3A 5E8WA 5B2KA 5A14A 5I9XA 3ZYAA 3L1SA 3HRBA 4F7JA 4JBOA 4ZTNA 3SRVB 4HYIA 3UOHA 2CGUA 3IW5A 3O51A 5K0XA 4UXQA 3V5QA 2C6DA 1O6KA 4O1PA 4RVLA 4BY9E 4ZZMA 3JYAA 4FNXA 3KRJA 4G16A 2VZ6A 5FM3A 2J0IA 3BHYA 2R3FA 5GNKA 4YNOA 4IZAA 3WE4A 1WBSA 4I4FA 2HY0A 2H96A 4RIXB 2OFVA 5DPVA 3V8SA 3QCXA 4FEUA 4BGQA 4QPAA 4FVQA 4L7FA 4YLKA 3W1FA 3OCGA 4B9DA 2B1PA 4TYIA 4UMRA 4USEA 2XYNA 3BQCA 3EL7A 4DGLC 5HTBA 4DFBA 3RWPA 3NYVA 4RVTA 1PXLA 3I0QA 2WMTA 5IQFA 4RWKA 3I7BA 2C5VA 4FODA 5AUUA 2BCJA 3CTHA 2IZUA 5C8MA 5CU4A 5CEPA 2JIVA 1CTPE 4RBLA 4ANNA 4IB0A 5KHWA 5EDRA 3CEKA 3PSBA 3C0IA 4ALUA 4NH1A 5AV3A 3POZA 3QUPA 2I0EA 5K0KA 5EQEA 5EQYA 1H26A 2Q0NA 1WVXA 4UWCA 5JK3A 3Q52A 3DKCA 3PDTA 2Z7LA 4QRCA 3MPMA 4QTDA 4HCTA 4I20A 2X7OA 3G90X 3PVGA 4D2PA 4BC6A 2J51A 3F2RA 3A61A 4NCTC 3QXPA 3ZTXA 3RTPA 4FKSA 4S32A 1H24A 4O7NA 4WRSA 4USDA 3Q2MA 4JS8A 4QMNA 3MTLA 4B4LA 5FTGA 1M2QA 4JQEA 1WMKA 3Q9WA 3AT3A 3HV4A 4O22A 3JY0A 4DG3E 3MYGA 3QTUA 4ALWA 3HV5A 1OL2A 4NWMA 2YIXA 4JDKA 3ZFXA 2OIQA 2HAKA 2OZAA 4E5BA 4W9XA 5IQAA 2GCDA 4AGWA 2PUNA 2I0YA 3KY2A 2XK9A 4HPUE 4L3PA 5FWKK 4CKJA 4A07A 3QL8A 3GENA 3PPJA 5HIBA 3RALA 4OTDA 3L8XA 2OK1A 1Q5KA 4PMSA 4CG9A 2OFUA 3PXFA 4D4RA 2Z60A 4I0SA 3QCSA 1JVPP 4ZS4A 3GGFA 3MVJA 4M14A 4FNWA 3BHTA 3O8TA 3V5LA 3NUPA 1AD5A 4U79A 2E9NA 5JQ5A 3V04A 1PXOA 4RRVA 2BAKA 4BDHA 5KMKA 1J1CA 3LCOA 4YZMA 4M0ZA 4KIKB 4X3FA 5ETAA 5J79A 4XHKB 3F2NA 1YHWA 4MWIA 5K5XA 4MCVA 2PY3A 4AAAA 1JAMA 5D11A 5LVLA 1R39A 5DR9A 3I1AA 1CMKE 1WBPA 1Q97A 4K11A 2HZIA 2VV9A 4IAIA 4RJ7A 1W0XC 3D5XA 4F08A 5IQGA 4CSVA 4ZAUA 2VTMA 4BHNA 4PPBA 2VGOA 4ID7A 2FSTX 4RT7A 2ONLC 3MJ2A 4PMPA 3W55A 3F82A 3GP0A 1ZYLA 4G6OA 5CNOA 5EDQA 4XV2A 2C6OA 2PZPA 2UVZA 5L2SA 3G15A 2XNGA 3T3VA 3NAYA 3WE8A 5CAQA 2I6LA 4DLIA 3AGLA 4JDJA 5M53A 3O2MA 2QLUA 4EWHA 4CRLA 3OBGA 4I41A 3ZFYA 5H2UA 2A19B 3ZHPC 4HGTA 4TL0A 2PUIA 3UZRA 3QX4A 4FSYA 1E1XA 1KE5A 3MW1A 5AM7A 1MUOA 3WF7A 5DWRA 1FVTA 3RPVA 2UW6A 1HCKA 4AW0A 3Q4UA 4D28A 3TUCA 2PMLX 4KB8A 4ZZNA 2CNQA 2XA4A 3OY3A 3M2WA 3C4WA 3MPTA 2UZBA 3F66A 4EHZA 3QQLA 5FM2A 4RWLA 2GS2A 4F6SA 4GT3A 3QZFA 3UVQA 3COIA 3GOPA 3NGAA 2Y6MA 3LCSA 1M52A 4CLJA 5K3YA 5ANGA 3TIZA 3LFFA 3UBDA 5EOBA 4L52A 3ZRMA 5IEXA 5EKOA 3PVWA 1Q4LA 2VWYA 2GPHA 4E7WA 1NT2A 4FT0A 2WIHA 2A27A 3V5JA 4C4HA 5GIOE 4JQ7A 3EZRA 4W8DA 3WBLA 1PKDA 4FTMA 4G3GA 5CWZA 5JRQA 4ZSLA 2YDJA 3C0GA 3TKHA 4I22A 3BEGA 3QC9A 1EH4A 2QOLA 4BCHA 4U41A 2UZDA 4O2PA 3EQPA 1YRPA 2RL5A 4H1MA 1PYXA 4K1BA 4PPCA 3F3WA 1TQPA 4I4EA 2OJGA 4CCUA 4R3RA 3DNDA 4JL9A 3SKCA 4O91A 3PPKA 1U46A 2W5AA 2AYPA 3FI2A 2CHLA 4FMQA 3T9TA 3W8QA 3SOCA 4R7HA 5BPYA 3R63A 4PP9A 3FEGA 5GJGA 4MK0A 1W82A 2B54A 4RIOA 5LVPA 4HGLA 4IB1A 1TVOA 3O96A 2YZAA 4C37A 5CZHA 1K3AA 3FLQA 5JZNA 5M4UA 4C02A 3FWQA 4BDJA 4EOOA 3VS6A 3QZGA 3NIZA 3DAEA 4HYUA 2IPXA 1GZKA 1REJA 5L4QA 3WF5A 3O23A 1W98A 2Y9QA 2QCSA 3ZLXA 4H39A 4BCFA 2ITOA 2ERKA 5CEIA 2UZEA 4AN2A 4BI2A 5E8UA 2ZDUA 1O6LA 2QODA 4AWIA 3W2SA 4M97A 4MQ2A 3UNKA 4NM5A 4GKIA 3BKBA 3HP2A 3PFQA 4W4VA 4ASDA 4BWPA 2OWBA 5CYIA 5CEMA 3PY0A 2PZ5A 3LMHA 2OKRA 4AGDA 3CPBA 2F7EE 4L01A 3TDVA 3JY9A 4WNMA 4DHFA 2QOQA 4ZEGA 4PTEA 5KKRB 4QPSA 5LCJA 2PE1A 3IQ7A 4IX4A 5AV0A 4ACGA 3SG9A 1OM1A 4XOYA 2ITYA 4DG2E 3QUDA 2UZOA 1CKJA 4O0YA 4FNZA 4HCUA 5IG1A 4IM3A 5KBQA 5L6PA 4YZNA 4IQ6A 5CAUA 5AADA 5J5SA 1W8CA 2E2BA 2WKMA 2WMQA 3LVPA 1SVGA 3EZVA 5FTQA 1NVRA 5TR6A 4IJPA 4D5HA 2JDVA 4AACA 3VS2A 2PE0A 2BIKB 4F9BA 4GSBA 3M1SA 5DG5A 4YO4A 3EQHA 3OWKA 3DFAA 4BDIA 5GINE 3BHHA 3LJ1A 3C4EA 4DINA 2XIRA 3DAJA 3BLRA 2WOUA 2XKEA 3R01A 2FGIA 1KUTA 3BLQA 3H0YA 2J90A 4I5PA 1UV5A 3DXNA 3ENMA 4P7EA 4PNIA 4TW9A 2JDSA 4FZ7A 4GT5A 4BRXA 4D9UA 4DH1A 3QD0A 3V8WA 4C8BA 1NVQA 3PZEA 4RWIA 3UC3A 3MH0A 3NZ0A 5CX9A 2RG5A 4AZEA 3ZUVA 4UV0A 3DKGA 2OZAB 2LAVA 4OUCA 3BYUA 3BGZA 3BE2A 3VUDA 2ZV2A 3E93A 1OIRA 3MIAA 5KHXA 3TNPC 5DRDA 1SZMA 2WPAA 2R3KA 3TUBA 4BCPA 4EH4A 1M7NA 4MD8E 3NUXA 2A1AB 3O8PA 5IZFA 2JDOA 3FV8A 4DH8A 5FXRA 4PDSA 3QZHA 2PSQA 1FOTA 4EYJA 4TYHA 1JSUA 5L2WA 5CSPA 5EHYA 5AWMA 2GQSA 1U59A 2YCFA 5CXHA 3P7CA 1JBPE 3BWFA 5I3RA 4RQVA 4ITJA 3MIYA 4X3FB 3TACA 4K0YA 4KRCA 3U4UA 3QQFA 4XCUA 2XNMA 1OB3A 1PRYA 3ZLYA 3R73A 1XBCA 4YMJA 1ZXEA 3C13A 4M7IA 2Q0BA 1DI9A 2J4ZA 2RSVA 5AUWA 4QP3A 2YLFA 3OT3A 2J0KA 2X39A 3EFWA 3SVVA 1HCLA 3DXPA 3TNIA 4D2RA 4BCKA 5BUEA 1FGKA 1QL6A 4HOKA 4EONA 4F7NA 4GFOA 3HNGA 4IANA 3S4QA 3ZMMA 4ENXA 3N4TA 3N51A 5C4KA 3MN3A 3CQUA 2EUFB 3PXQA 4LV8A 2YIRA 4ZY4A 3R04A 5IUIA 1OUKA 3OF0A 1VZOA 1VJYA 4N6ZA 4LL0A 4BDGA 3EFLA 3QRTA 4BDAA 4KSPA 4U0IA 1Y8YA 1ERKA 2PWLA 3PXZA 3VBWA 2X0GA 3VUMA 2Z7QA 3EYHA 4BI0A 2VNYA 3A2CA 4LGHA 1FMOE 2UVXA 3OMVA 4XLVA 5IF1A 3BZ3A 3E7OA 3AC1A 4C2WA 1URCA 3QWKA 3DNEA 4FK3A 4L53A 4G6LA 4U42A 4AT4A 2IVUA 4UALA 3MB7A 4F9WA 3NW6A 1J91A 4CT1A 2VTOA 4BZOA 3W2CA 4FIGA 2C0IA 2Y0AA 4CV9A 2BMCA 4AT3A 5CTPA 5TF9A 4CQGA 3QUEA 2ESMA 3T8OA 4RJ8A 5A4QA 4GU6A 3AT4A 5IA4A 4EJ7A 2YCRA 1Z9XA 3QQKA 3UP7A 1IG1A 4F6WA 1M2RA 3MSSA 5J7HA 1AQ1A 5FRIA 3UIMA 4ERWA 4PDYA 1QPEA 4Y5QA 3A62A 4A9UA 2W9ZB 3GC8A 5KZ0A 2JAVA 1P4FA 3BLHA 3KEXA 1G5SA 1PF8A 2F7XE 4O0RA 5EKNA 2VTJA 3GU4A 4K18A 3BGQA 1KV2A 2QO7A 4JBVA 4HVDA 1H0VA 3IGOA 2WMRA 3FYKX 2R7IA 3HMIA 4NM3A 4I21A 4W9WA 2XJ0A 3PA4A 4C4IA 2YCSA 5I3OA 3BI6A 5BVDA 2R3RA 4M68A 3NCGA 5AP3A 4C38A 4X2NA 3C4FA 4RVMA 2KULA 3OZ6A 3JS2A 2OICA 4E73A 3UNZA 1Q61A 4YR8A 4MXXA 4USFA 3VW8A 1U54A 2F57A 3QALE 4DFYA 4GV1A 4GIHA 1YOJA 1ZRZA 2JFLA 5LOHA 4NKSA 5M57A 5LXMA 3HMMA 3A60A 3CGOA 4EWQA 3OEZA 3GC0A 4FTUA 5T6KA 2WNTA 4EK5A 3AD4A 1R78A 3ORMA 3FXZA 1GIJA 1SYKA 2VTSA 3RPSA 1ZOHA 4GK2A 2J9MA 4BIEA 1H27A 2V0DA 4LOOA 4P5ZA 1GOLA 3FQHA 2WFYA 3QQUA 4RX8A 2HENA 4ENYA 4U5JA 3IOKA 5LWMA 3TNWA 4CGAA 2BROA 2YM8A 2FUMA 5AP5A 2H8HA 3K2LA 4KD1A 4GT4A 5HG7A 2OXDA 4OBQA 1PXIA 1CDKA 3GQIA 1J7IA 3A7IA 3DCVA 2X1NA 2WO6A 4E6AA 4C4GA 3QD2B 5DBXA 4CLIA 4O7ZA 4W4XA 2BHEA 4IAZA 5FEDA 2F9GA 1Q8WA 2NRYA 3A99A 3E8CA 2GDOA 2PVKA 4FIHA 3V5TA 3VF8A 4DTAA 3HV6A 1S9JA 3EJ1A 4PQNA 2BZIB 2OJJA 4BDDA 5HU9A 5E1EA 3UIUA 2WTDA 5KMLA 4CFNA 2Y6OA 3ZRKA 1UU8A 4E6CA 1F0QA 1FBNA 4TWNA 3HAVA 2CGWA 5CALA 2GMXA 4TNBA 5IEYA 3FKNA 4M67A 4P4CA 5AP6A 1G8SA 3W18A 4IFGA 4KKHA 4BWKA 4F0GA 3HV3A 4RA5A 3GU6A 4XG4A 1RE8A 2BRBA 4GW8A 3LM0A 1WBVA 3NSZA 2BZKB 2R7BA 3R8UA 2QG7A 2A4LA 3G5DA 3SD0A 5AR8A 4YZ9A 5DR6A 5EI8A 4UX9A 5HQ0A 4W8EA 3ZBXA 4XEYA 3E8EA 5DN3A 3F7ZA 3MPAA 2QOKA 4DE4A 4YC8A 1GNGA 2FSLX 3PTGA 3DKOA 4IDTA 4A9YA 2W1DA 3VS4A 2BPMA 4O0XA 5L6WL 4ZSAA 4M12A 4CFMA 4CKRA 3UO5A 3BELA 4ZY5A 3CBLA 5CXZA 3G9NA 1LEWA 2BRHA 4IMYA 4BCQA 3FLYA 5KKRC 2XNPA 2B55A 5AIRA 4JVGA 4NJ3A 2UV2A 2W5BA 1UNGA 4B6LA 4F0FA 3MFTA 5A6NA 5HO8A 4FL2A 4ZP5A 5AR4A 4O81A 3SOAA 4CZUA 3UO4A 3GFEA 4QMXA 2XK4A 4IFCA 4O7YA 4DH5A 1YW2A 4KA3A 3HMOA 4J8NA 4QP8A 5AP2A 4TYHB 4WUNA 2QURA 4QMZA 4Q2AA 4RG0A 4X2KA 5DYJA 4AT5A 1KSWA 5IA3A 5AFVA 2R5TA 3BRBA 4NFMA 5BMSA 1UNHA 2YM4A 4C4JA 4D1ZA 5I9WA 4BTKA 2WZJA 2QOHA 3KN6A 4FEVA 1ZMVA 4AOIA 4F6UA 4HVSA 4KBCA 2ZV9A 3D7ZA 4J97A 5FEEA 4E5AX 4YU2A 4F9CA 4FKLA 5AIKA 3UPZA 3LXKA 5C8NA 4OT6A 5KX8A 4I92A 1MQ4A 3RHKA 3VS1A 4B7TA 4EQCA 4XP0A 3KF7A 3LOKA 1ZYJA 2NP8A 3EQRA 4APCA 3CY3A 3LFBA 2R2PA 4OTPA 3FE3A 4L3LA 4OTWA 3OUNB 3W2PA 1OZ1A 1NW1A 2UZTA 3N9XA 2JIUA 4ARKA 2YABA 5I0BA 5JEBA 3F3UA 4A06A 3ZBFA 4HW7A 1PXNA 2X4ZA 1L8TA 4D4VA 3VHKA 4ZJVA 2G15A 3IDBA 2C5XA 2F4JA 3MB6A 4YO6A 2PVLA 5JGDA 3ZSHA 4YTIA 3EN5A 5JFXA 4WG3A 4OBOA 4HVGA 3K5UA 3PG1A 3FLNC 2GS7A 4AA4A 5M09A 5IPJA 1OBGA 4RLKA 2X9FA 5E1SA 4FSZA 5DHJA 2OI4X 3KQ7A 2J0MB 3QTWA 4AW1A 3I5ZA 3FPMA 2VO0A 4FKRA 4N4SA 1V0BA 2ZM4A 2ITQA 5ACBC 4XG8A 3T9IA 3AQVA 3NW7A 3A7HA 2E9OA 4TRLA 3GCQA 4X3FC 4JQ8A 2BALA 3OXIA 2WEIA 5ICPA 4ZXTA 1Z57A 5IQIA 1T45A 3ZUUA 4DGOA 4IWOA 2R3GA 2C6IA 4O21A 5C4LA 1Y6AA 3ALOA 1P4OA 2RF9A 1UA2A 3BYVA 3Q6UA 4JDHA 3DA6A 1H28A 4QQCA 5E8TA 3VNTA 4FG7A 3PJ3A 2R3MA 2UUEA 5EYKA 5M4FA 3RK9A 4BF2A 4IEBA 2REIA 3DBEA 4FKWA 1K2PA 3R71A 1BI7A 5M56A 3TZ8A 3IOPA 4FA2A 2C5NA 3QTXA 3PLSA 4PL3A 4V01A 2E9PA 1M2PA 3PY1A 4GUEA 4YJQA 4BBMA 3DBCA 2CGXA 2UZWE 3OP5A 5JRSA 4D2SA 5AJQA 4FGBA 1LP4A 1VR2A 5F95A 5AV1A 1SVHA 3FSFA 4YURA 3PVUA 4TNDA 4ZJIA 4OTFA 4YZCA 4FEWA 3ERKA 3WF6A 1Z5MA 4YBKA 3ZONA 5FDPA 1KV1A 3IDPA 4M69A 5H8EA 3Q96A 3KF4A 3KVXA 4MHAA 4JNWA 3QC4A 3R9RA 5DT3A 4CT2A 4YUQA 5DGZA 3OXZA 5I9UA 1U54B 4JIAA 5EQPA 5C27A 3HUBA 5DEYA 4A7CA 2C5YA 5HCYA 3DS6A 3FC1X 2C3LA 3VS3A 2C30A 1M17A 4E26A 2PHKA 2ZAZA 4IZ7A 3UQCA 5A4CA 3UYTA 2CGVA 4GYGA 4LUEA 5J9LA 4YJVA 4KBAA 3F6XA 2PVRA 2C6KA 3P7BA 3C1XA 4C4EA 1PMUA 1NY3A 1WFCA 3H30A 4AZVA 3ZH8A 2C68A 5BX0A 1B38A 5HD7A 5M55A 4H58A 1FPUA 2JBPA 5HO7A 5HE3A 4FTRA 5HVKA 2XNBA 4TWOA 2LGCA 3E88A 3G6HA 2ZOQA 2EWAA 1JKLA 2VTRA 3LCTA 4LRKA 5FD2A 5HE0A 1YHSA 2OJ9A 3KRRA 4FNYA 3D2IA 3R1SA 4LRMA 4O6LA 3ZLWA 4FBXA 1ZZLA 4UZDA 2Y7JA 4UYAA 3DZOA 3MVLA 1H1PA 5IH4A 2HIWA 2XVDA 3FZRA 3SQQA 3C5IA 4EOLA 4EOJA 2QR8A 2XK7A 2GSFA 2H6DA 4LUDA 3FBVA 3ZDIA 3G33A 5FG8A 4APPA 3VUTA 1H8FA 4IIRA 4AX8A 3FHRA 3EQFA 1U5QA 3DK3A 4BGGA 2W0JA 2W4JA 3GU8A 2OZOA 3R7YA 3KMWA 3VN9A 3Q04A 2IW8A 3HECA 3R7VA 3NMUF 4XH6A 5FGKA 2XIZA 2YDIA 3DBDA 5FLFA 4FV7A 5IA2A 3OTVA 3ZFMA 5J9ZA 3FJQE 2ZYBA 2Y4IB 4O0WA 1HOWA 1UKIA 4LGGA 1UU9A 4JXFA 2O63A 3Q5IA 4CQEA 5EH0A 2CSNA 4ZTLA 4XLIA 4FV3A 4I6QA 5CLPA 2HWOA 3ZM4A 1WBNA 3DQWA 3FZTA 3OC1A 3LAUA 2R3LA 4AZSA 3I79A 2W1FA 3FHIA 3NCZA 1YWNA 4GL9A 1FVVA 1WCCA 1JKSA 2VWVA 3D9VA 3KB7A 4XUFA 2HY81 4DC2A 4PP7A 5F20A 3KMMA 2XJ1A 3I7CA 2PVJA 4C34A 3DKFA 2YCQA 4FOCA 1LPUA 2EXCX 3K3JA 3QFVA 3AC5A 4U80A 2B53A 3E8NA 2QR7A 4RQKA 4TY1A 4U44A 3LKMA 1FGIA 3COMA 3COKA 4UN0C 4QMVA 4IVAA 4Y8DA 2XIXA 3ORPA 5HCXA 4C62A 2R64A 2QNJA 5K4JA 3HMPA 4KRDA 4O7TA 4ZSGA 1Q62A 2PMOX 4FKJA 3U9CA 3R6XA 2BIYA 3EIDA 5BUJA 3LMIA 4EBVA 4BDCA 1IRKA 3R1YA 4NUSA 4G1WA 2JKKA 4ZK5A 2OO8X 1IAHA 3RVGA 4QPMA 4I5CA 1OUYA 3DDPA 3VIDA 3N4UA 4L43A 3SGCA 2VTPA 4BCNA 3GCVA 1R0PA 2P4IA 3WILA 2VNWA 1DI8A 3LFNA 4AZWA 5LARA 5TO8A 4OR5A 3CJFA 4G9CA 4PDOA 3RPYA 3GBZA 4LV5A 4CD0A 2WEVA 4FIFA 4IAKA 2VO6A 3W8LA 4ANQA 2QO2A 4BKZA 5K5NA 4MXYA 4ANOA 4O7WA 4FEXA 3DBQA 4U8ZA 1YHVA 3IS5A 2BZJA 2QKWB 4HVHA 3WIGA 5HCZA 3LLAA 3H0ZA 5CI6A 4EOQA 4LM5A 4EHGA 2W4OA 3MVMA 2PMNX 4L3JA 5BVEA 4AA5A 1QPJA 3QBNA 3OS3A 4JI9A 3DK6A 4KABA 4ZJJA 3GT8A 4IWPA 3ET7A 4EH8A 4M0YA 3FKLA 4CFXA 2PVYA 2OLCA 2WQNA 2FSMX 3EN9A 5HEZA 4AW2A 3HA6A 4BCJA 3NNXA 4JAJA 1OITA 2XZSA 4S34A 3Q32A 3TV6A 3QF9A 4FT7A 4GG7A 4QP2A 3V5PA 5HTCA 4C0TA 3D0EA 1IEPA 1FMKA 4MQ1A 5ETIA 3WYYA 1WVWA 2YM3A 3UTOA 3LQ3A 2P2IA 5EK7A 3FKOA 1YXVA 3VBYA 5F9EA 4E8AA 2ZB0A 3MJ1A 3OWLA 2VU3A 3ZOSA 5HVJA 2YEXA 2I0HA 4J71A 4QNYA 4I6HA 3KN5A 3PG3A 4HCVA 5CSVA 2PUUA 2DWBA 5AMNA 4NIFA 4BCOA 3JPVA 3LXLA 4XS2A 4S33A 4O1OA 2QOCA 4R1VA 4X21A 3R9NA 3EMGA 3WZEA 4FV4A 4RX5A 4KKEA 3DB8A 4ZLZA 4FOBA 1PHKA 1GAGA 1Q3DA 4IVCA 4PMMA 5EDPA 5BVNA 4QTEA 2JD5A 4G9RA 4CXAA 1RDQE 2JLDA 2IVSA 2PE2A 3EQGA 3BU5A 4MWHA 4YLLA 3ZDUA 5AA9A 2VWBA 5IQDA 3R8ZA 2A0CX 4FT3A 2EXMA 2XS0A 3DBFA 1XHAA 3ZC5A 3BYOA 3AC8A 1X8BA 2PZRA 2EB2A 4JG6A 3CC6A 4O6EA 4AOJA 3FQSA 4TWCA 3UPXA 1ZYSA 4HYSA 2O65A 2WQBA 3RNIA 3IKAA 3NYXA 2ITNA 3I6WA 3DZQA 2GHMA 2WQEA 4PTCA 4RIWA 5HU3A 5M44A 1SVEA 4YJTA 4KBKA 4M69B 2VX3A 4NTSA 4Q5EA 3DAKA 4YJSA 5M07A 2X7FA 3W16A 3NVMB 4I23A 4BIBA 4YTFA 4DEAA 3D7TA 1XH4A 4Z9LA 3C51A 2YHVA 1UNLA 2GNFA 4F9AA 1ND4A 3C50A 3K54A 2BRNA 4RA4A 3BV2A 5AR7A 5CEQA 2BTSA 5IUHA 1RW8A 3FMNA 2XF0A 3R2BA 4AZTA 4C4FA 4XG7A 3RAWA 3KXNA 3EKKA 4FT9A 3DGKA 3OWPA 4FSQA 1JSTA 3P5KA 4AG8A 5HLNA 5CVGA 3PXKA 4QQTA 4EZ7A 4FGRA 3PA3A 5HBHA 2CLXA 5H3QA 4UYNA 4E5WA 1OIYA 4EOIA 3NR9A 4EHEA 4CVAA 1R0EA 5DA3A 2ZV8A 5A6OA 3UOJA 4UB7A 4IM2A 3QWJA 2BRMA 2JKQA 3QRJA 4FV1A 4QYYA 3V6RA 1WVYA 3F2AA 3KXMA 3U51A 5CEKA 5BNJA 4MKCA 4DFNA 4QNAA 5I9YA 3BU6A 4MXZA 3LM5A 4TWPA 2YAKA 4AN3A 3WOWA 5E8VA 3ZO1A 4O27B 4YHFA 2ZJWA 5IISA 3B8QA 4H05A 4NM0A 5FTOA 5CT0A 2JIIA 3U9NA 4ZTSA 2C3IB 4NZWB 3VUKA 1YXXA 2PTKA 5E9EA 5I5ZA 4NK9A 4FTNA 3FZOA 2BAQA 4XG9A 5BUIA 1ZOEA 3P86A 1U4DA 2JGZA 4ASZA 5E8YA 4F09A 3JVSA 3TZ9A 4CYIA 5G6VA 3D14A 5E90A 5H8BA 4C59A 3QD3A 2VWWA 4XRJA 5DT0A 5IEVA 2XMYA 4QP9A 2Z2WA 2R4BA 4YPDA 2XKFA 4G5PA 3BE9A 5CASA 3LXNA 4GCJA 4FIJA 5ITAA 5AAEA 3HVCA 2R0UA 4JLCA 4Q5HA 2F2UA 2V55A 4WA9A 3NEWA 3Q4CA 5L2QA 4BDFA 3AMAA 3TT0A 4ACCA 2OXYA 1TKIA 4BCIA 2UW4A 3QRUA 4D58A 4PPAA 5HORA 5BMMA 3WF8A 1OVEA 2F49A 4EOPA 1Q8YA 2VX0A 2Z02A 3NW5A 3RKBA 3IG7A 4CEGA 1UVRA 4JG8A 4KWPA 4DG0E 1NXKA 4JR7A 1YDRE 1ZY4A 4C33A 4NSTA 2RIOA 4XV9A 4HVIA 3P9JA 4E3CA 3ZZEA 3QKMA 2R9SA 3GXLA 3VRYA 4C3RA 4M13A 3DXQA 1PW2A 2GQRA 3BBWA 5CAVA 3L9LA 2RFSA 4YHJA 4DFUA 3L8VA 5HHWA 1P14A 5LQFA 4B8LA 5M06A 2VUWA 3JXWA 3NLBA 3BEAA 2YERA 3PRIA 4GMYA 5EG3A 4RX9A 2UZNA 3R9HA 4DEIA 3TG1A 3Q2JA 1XH8A 1JQHA 3IDCA 5M08A 3F3TA 4ZTQA 4BFMA 4QTBA 3EH9A 4FF8A 5I9ZA 2Y4IC 4EH9A 4C57A 5JT2A 4XJ0A 4F64A 3HMNA 4I5HA 3TV4A 3ULIA 2WU7A 4DH7A 3S00A 2YIWA 3MI9A 4NT4A 4XP2A 3TKUA 3VUHA 3DU8A 5GZ9A 2X6EA 4N0SA 2YFXA 3O71A 1IASA 4P2KA 5EOLA 1B39A 4L8MA 3PY3A 4A9TA 5CF5A 2QQ7A 3HLLA 5IDNA 4IC7A 5DVRA 3DK7A 3CKWA 2ZVAA 2UZLA 2I0VA 3HDNA 4OAVB 4FKVA 3C4ZA 3EQCA 5EM6A 4ZLOA 3CS9A 3RINA 4IJ9A 2CCIA 3HDMA 4AN9A 5LMKC 2GNIA 2O0UA 2XEYA 4FR4A 4CMTA 4FV2A 3ATSA 4FEQA 4PUZA 4XBRA 3AD6A 4ALVA 3CD3A 1GY3A 4NM7A 4DYMA 3C5UA 3H9FA 3ZZWA 2NPQA 2WD1A 2C1AA 2C6TA 2CKOA 3KCFA 4PX6A 3QQJA 4R6VA 5KMNA 1PMNA 3P23A 1XJDA 3ETAA 2YJSA 3NRMA 2V62A 2YAAA 4DEGA 5HNBA 4YSMA 3BHUA 3ORNA 4YJRA 1KWPA 3VC4A 1W84A 4ZMEA 2X81A 1SNUA 2SRCA 1QCFA 4C3FA 4J99A 3PWDA 4NIFB 4EK3A 2OBJA 4DLJA 2JKOA 3UMWA 5HG8A 2AC3A 5FP6A 2J0JA 5CS6A 4H3PA 3OW4A 3RHXA 1I44A 1PXMA 4LYNA 5DFPA 1PYEA 2G1TA 3CIKA 5CY3A 2PVFA 3RAIA 2ETMA 3NNUA 2XNEA 4U3YA 1ZLTA 1NA7A 1J7LA 1G8AA 2W7XA 2OJIA 2JFMA 2R3JA 5CVFA 2HZ0A 4GJ2A 4IW0A 4O0SA 4KNBA 4A4XA 4EKKA 3RBWA 4LFIA 5LMBA 3SA0A 3BGPA 5AP4A 1P5EA 2IG7A 3BHVA 1YI6A 3ID6C 3TZ7A 1H1WA 1Q3WA 3GVUA 2VRXA 1OL7A 3MY0A 4O84A 4D1XA 3FPQA 3LQ5A 3F61A 3D5VA 2RFEA 2W1ZA 3PXYA 4RIWB 5B2MA 5LVNA 3BIZA 4ORKA 4GIIA 3PE1A 3L9MA 2PVNA 3OTUA 4OLIA 5AUZA 4WKQA 5AUTA 4DCEA 1JPAA 5A4LA 5L8KA 4V05A 3LPBA 3NPCA 4ASXA 3PYYA 2PU8A 1BMKA 1JLUE 4F63A 3Q4ZA 4QYEA 4BCMA 5EHLA 3D7TB 2W1EA 2X8DA 1U5RA 3EOCA 3ORLA 4G31A 4RPVA 1OL1A 1CKPA 5BYYA 2C1BA 4EI4A 4EL9A 2CKQA 5JFVA 5HG5A 4BWXA 3CLYA 3K5VA 4RVKA 3NYOA 1RQQA 4ZOGA 4NFNA 4PRJA 4U81A 4BGHA 4E4MA 5ETFA 1YOLA 1ZARA 3MGYA 3ACJA 1YXSA 4IX3A 2CPKE 4ANSA 3ROCA 4IWQA 2WMWA 4I0RA 3UMXA 4F7LA 4CZYB 4Y83A 3THBA 4CKIA 3U4WA 1BUHA 2Z8CA 2BUJA 5HESA 3ODZX 3OHTA 5IQCA 4R5YA 4AE6A 3VS5A 3PJCA 5GJFA 2XKDA 3AC4A 1YDTE 3OUKA 1ZZ2A 2XP2A 4HGSA 5EI2A 2XK6A 5GJDA 3UO6A 4EYMA 5EYCA 4RZWA 2B0QA 4FKPA 2XK8A 3VBVA 3VAPA 4ASEA 3P1AA 3S2PA 4DGGA 3EQBA 1H4LA 2YA9A 3ZCLA 3PIZA 4MD7E 4EH6A 4KAOA 4CTBA 5AEPA 4MVFA 5E8XA 3RGFA 1YWVA 4DFXE 4X6QC 2HW6A 3NAXA 3QA8A 1CSNA 3NYNA 4BTFA 5JGAA 4TKSA 3KVWA 2IN6A 4GU9A 3SXFA 3R28A 4XV3A 4J98A 4K6ZA 5J1VA 4UMQA 5FDXA 4FZAB 5ANOA 4BN1A 4YLJA 3U6JA 3E3PA 4RIXA 2HCKA 3ANQA 5IQHA 3AD5A 4IB5A 2QOOA 4QQJA 4DFZE 1WAKA 3MVHA 3F5XA 2UW3A 4JBQA 3KXXA 4IX5A 3G6GA 2AC5A 4FTOA 3ZO4A 2QONA 3FLSA 3Q4TA 4ZY6A 3SXSA 4EQUA 2QHNA 3EN4A 3IK3A 5KBRA 2PMIA 4KIQA 2X2MA 4MXCA 3W2QA 4EKLA 4FZ6A 4EK8A 3EB0A 3GOKA 2B9HA 4Q9SA 4LMUA 2VO3A 4IZ5A 2ITPA 3R8LA 3S95A 3F88A 5D7VA 4BCGA 3VQUA 3W10A 4PV0A 4FTIA 4FYOA 4G3FA 4HPTE 4XV1A 4FSRA 3OG7A 2O2UA 2WU6A 2W1IA 1BL7A 2YDKA 3D4QA 4CYJA 4HNIA 4E1ZA 4E20A 2C3JA 5KZIA 3R7IA 5I9VA 2ITUA 3FY0A 4FSUA 5G1XA 3POOA 4IB3A 1JKTA 5HE2A 4XNEA 3KU2A 4D0XA 3RPRA 2OXXA 2C6MA 2ITTA 3MESA 4PTGA 2VWIA 4X7QA 4JDIA 4MNEA 3RWQA 3NS9A 5DH3A 1Y6BA 4AP7A 4O83A 4JR3A 2E9VA 5C01A 2NNWB 3A7FA 4FV5A 4V0GA 4TYJA 4H3BA 5HBEA 5LJJA 4II5A 4G34A 5EFQA 3DOGA 5J8IA 4KIOA 5LCKA 3FXXA 1A9UA 4JX3A 2HOGA 3PSCA 4BYIA 4JBPA 4O0UA 1PXJA 3FMDA 3R30A 3FAAA 5BQ0A 4ZS0A 4EH5A 4H1JA 4R8QA 2R0IA 2RFDA 3W32A 4ACDA 4EH7A 3R8MA 4QP1A 2UW7A 3HGKA 4YGAA 4DA5A 3IW8A 4NTTA 3ZSGA 2JKMA 1P2AA 1MRUA 3AMYA 4EUTA 3SX9A 3VBXA 2XCKA 3V5WA 1ZAOA 5CF6A 1FINA 3TL8A 4RFZA 3TUDA 1H25A 1GZOA 3VJOA 3LLTA 3FY2A 2P2HA 5EM8A 3SLSA 1BX6A 3Q9XA 3MA6A 5E8ZA 4RLLA 4D2VA 3MV5A 4BI1A 5AR3A 3QYWA 4O7VA 4NJDA 2DQ7X 4QMYA 3PPZA 2P3GX 5D9HA 4OAUC 1M7QA 1Q8UA 2PVMA 3ZU7A 4ANBA 4DBNA 2YZLA 4AGCA 3KRLA 4D55A 3KXGA 3P78A 3E8DA 1GJOA 1PJKA 2QHMA 2DS1A 3KCKA 5BVOA 3EQDA 5IMEA 4GH2A 3MWUA 1K9AA 4MF0A 4AUAA 5M4IA 3HUCA 2WTVA 3JUHA 2XJ2A 4EC9A 3F7WA 4I1ZA 1ZY5A 3RZFA 2YM6A 5CZIA 3UNJA 4IADA 3H9OA 5CENA 1PMVA 1YKRA 4TXCA 5AV2A 2QU5A 4FUXA 4WIHA 3ANRA 4I6BA 2C47A 3KK9A 2WIPA 1SM2A 3UZTA 5IU2A 1ZMWA 4XYFA 3FZSA 3EFKA 5ANIA 2R3PA 2R3NA 2VX1A 5L6OA 3LFCA 4FTTA 2WTKB 2HXQA 2YISA 3AXWA 3FXWA 3E63A 2O3PA 3FC2A 3I81A 4YSJA 2V5QA 4MBJA 2B9JA 3CTQA 2H9VA 4EK6A 1TQMA 4PL5A 4DTBA 5AX9A 3D94A 3OXTA 3LFDA 3QLGA 3CY2A 4IX6A 3B2TA 4MH7A 3TNHA 5E91A 2FVDA 3CSVA 5FXSA 4B8MA 2WAJA 4FV8A 3NNWA 2PYWA 3ORKA 4IVDA 3FMLA 4MF1A 4YZDA 4DGMA 5AM6A 5KE0A 4ITIA 3DLZA 1S9IA 1XBBA 5D41A 4JG7A 4UMUA 4AGUA 2VTIA 3EFJA 4U40A 3VUIA 2H34A 4ZSEA 2X6DA 3NUYA 4RJ6A 4XG2A 5HG9A 4J95A 3OROA 4ANMA 3A4OX 3BQRA 4W4YA 1YOMA 5FXQA 2QOIA 4O7LA 1MQBA 4EEVA 3BYSA 4NL0A 1I09A 3RPOA 4QP7A 4FKGA 1YVJA 4F7SA 4QTAA 3D83A 3UODA 5TE0A 3ULZA 2OH0E 3DJ6A 2W1GA 3FL4A 3FUPA 4CFVA 4MD9E 3Q9ZA 1ZWSA 2JBOA 3LIJA 4R7BA 4L45A 1REKA 4GVJA 4R7IA 5CAOA 4MNFA 2B7AA 3FQEA 4U9AA 4MX9A 3ZXTA 1UU3A 4GYIA 3NIEA 3DFCB 2PPQA 4GRBA 4EHVA 2CJMA 5C1QB 3Q5ZA 5HD4A 3H9RA 4Z3VA 4BKYA 4AFJA 4UBAA 2ITZA 3KGAA 3LE6A 3PJ8A 3AC2A 1WZYA 4IM0A 1QMZA 3LHJA 1XQZA 3R22A 2C6EA 4LGDA 4G3CA 4Q9ZA 3D15A 3K3IA 3ZM9A 3I5NA 3QQHA 3QTZA 4JRVA 5FQDC 5BYLA 3KKVA 2X8EA 2G9XA 4BKJA 2GQGA 2HWPA 2WTJA 3O7LD 2XK3A 4DT9A 4UWBA 4CFWA 4Z16A 1RJBA 2IZSA 4RIYA 2VAGA 2IZTA 2UW8A 4RX7A 4D0WA 1OL5A 3UDBA 4BBEA 3TDWA 5EW8A 3L9PA 4I24A 4L7SA 4LQMA 5F94A 3SAYA 5GZ8A 2XRWA 4LOQA 4Y73A 5ANKA 3VWAA 2EVAA 4XG3A 4C36A 4CNHA 3NVKI 2X2KA 1YXTA 4ZTHA 3DTWA 1DM2A 3BU3A 3LFQA 3S0OA 2X9EA 3LQ8A 5E4HA 4O0TA 1SNXA 5DOSA 5J1WA 2UZUE 4CMUA 4G2FA 5KMMA 5AP0A 1OPLA 5IH5A 3OCTA 4FX3A 3O50A 3SDJA 2E9UA 2ITVA 1NVSA 2CLQA 3EN6A 4FKTA 2VN9A 5TT7A 3R83A 4ZTMA 3WZDA 5AAGA 4FTCA 3WI6A 2IVVA 4E4LA 5EI6A 3HYHA 3B8RA 4DN5A 3CTJA 2J7TA 2QI8A 3AG9A 4L42A 5HLWA 1URWA 3CPCA 3JVRA 4FTAA 5ANEA 5KO1A 3PP0A 4BZNA 3KRWA 4ERKA 2O8YA 1H0WA 3E62A 5L3AA 4RC2A 1LEZA 1IR3A 3PE2A 1OPJA 4FT5A 3A7GA 2J6MA 4IACA 5JKGA 5L2TA 3P7AA 1GZ8A 5LVOA 4MXAA 4Z7GA 5IA1A 2B4SB 4JOAA 5HNIX 5HLPA 1W83A 4EH3A 4IVBA 2WELA 3UQFA 4Y85A 1H1RA 3BWJA 4RJ4A 3CD8A 3VBQA 3GQLA 3LJ2A 1WBOA 4YBJA 3R7EA 2RFNA 3WARA 4Z55A 4MNEB 4J8MA 4CV8A 3B2WA 2YN8A 3OFMA 4LI5A 2R3IA 1YXUA 2OW3A 4V0GB 2QU6A 3F5UA 4YJOA 2C0OA 4PY1A 5JQ8A 1JWHA 3G0FA 2ZMCA 2ZMDA 3GCSA 3OVVA 3TI1A 4TT7A 2JAMA 4NW6A 2R3OA 4QMMA 4Y95A 5DIAA 5I4NA 3UGCA 3WIKA 3COHA 1J1BA 4GVAA 4K33A 1PY5A 3L9NA 3E64A 2A2AA 4WD5A 2W9FB 3FMMA 3D2KA 4FC0A 4RFYA 3RI1A 1OKYA 3EHAA 2HXLA 4YC3A 3U87A 2BR1A 3UVRA 3FI8A 1V0PA 4EUUA 1MRVA 3R8PA 4BDEA 4X2GA 1QPCA 3GB2A 3FDNA 3MH3A 2YM5A 3Q53A 4HYHA 4K77A 3GNIB 1R3CA 5AAFA 3SHEA 4QMLA 4G17A 2VTLA 4HGEA 1IAJA 3QRKA 4GKHA 2OH4A 3BV3A 3KC3A 3MDYA 5D1JA 4F9YA 2ACXA 5AUYA 4AFEA 3CE3A 4K9YA 2YACA 4FSNA 4FKIA 5IDPA 3FLZA 3A4PA 2W4KA 2ITWA 2Z7SA 3BYMA 2XB7A 2GNHA 2C6LA 4FTLA 4L9IA 3CP9A 3LMGA 3D5UA 3EWHA 5J95A 1Y91A 1CM8A 4PDPA 4RJ3A 2I7QA 3ORZA 5C8KA 3W33A 1Q8ZA 2BFXA 4FK6A 4XP3A 3AT2A 1GIHA 5JSMA 5HIDA 1WBWA 5DI1A 4X3JA 5ACKA 5JGBA 5BVKA 4WNPA 3VF9A 4B0GA 3QHWA 3A8XA 4IAFA 5A4TA 3T3UA
chains in the Genus database with same CATH superfamily
2XBJA 3F5GA 3MH2A 3VW6A 5CNNA 5M4CA 2J50A 1JNKA 4OTHA 5BYZA 5HO6A 4DF3A 2IF8A 2ETRA 4FL1A 4HZSA 3VUGA 3G0EA 3S3IA 3GC7A 4UMPA 5HX6A 4AS0A 4RC3A 1B6CB 3UJGA 2C0TA 3R2YA 4O38A 2P33A 2UZVA 3PRFA 3VVHA 4QMSA 2XCHA 4J1RA 3ZEWA 2QOBA 5HVYA 2EB3A 5J9YA 1PKGA 1ATPE 3P4KA 4OTIA 4BICA 3TCPA 1MP8A 3G9LX 4IAYA 4MTAA 4WNOA 4XRLA 2W17A 5CU3A 3CQEA 3MTFA 3R1NA 3N4VA 3U55A 3QCQA 5KUPA 1A48A 1VYZA 3HRFA 2QKRA 1R1WA 4JX7A 4NKAA 5D12A 2UW9A 5EYDA 3W2RA 3L8SA 2BVAA 4FTKA 4EOMA 2Y8OA 3FMHA 3VO3A 3QKKA 5F4NA 3FI4A 4O96A 3RM6A 2O5KA 3QTIA 4TYEA 4F65A 4QQ5A 3ZC6A 2C69A 3AGMA 1FVRA 5HI2A 4FKOA 4YNEA 4O4FA 5EYMA 4WNKA 4C2VA 4EORA 4QO9A 4S30A 5HGIA 4IC8A 2FA2A 3Q60A 1OKZA 3MBLA 4OT5A 4QOXA 2J5FA 3IGGA 3L8PA 4S2ZA 3GC9A 4C3PA 1YI3A 2CN5A 4FICA 4FZDB 5HKMA 2PVHA 3NWWA 3PUPA 3SXRA 4RMZA 3UE4A 2G2HA 1XH9A 2WQMA 3I0OA 3C4XA 1YI4A 4DITA 4ACMA 3DJ5A 2WTKC 3OOGA 3AOXA 3E5AA 5EW3A 4EH2A 4U6RA 2QLQA 4BR3A 3NUAA 1QPDA 2EXEA 3EKNA 4XOZA 2XM9A 3I4BA 5AP7A 3W2OA 2FH9A 2OF4A 4F1TA 4IBMA 3E92A 2WB8A 1FQ1B 2YIQA 3Q3BA 3QGWA 4YTHA 4ZZOA 4IH8A 1F3MC 2FB8A 3DTCA 4BVUA 2BFYA 3KMUA 3QKLA 2NRUA 3QQGA 2XUUA 4DEBA 3FYJX 1UWHA 3AKKA 5J5TA 4RIYB 2HELA 4U7ZA 4N6YA 4O7RA 4WUAA 4ZIMA 1OL6A 4DEEA 1WBTA 5A54A 3NUNA 4TYGA 1JSVA 5BVWA 4DCAA 4EOKA 1BLXA 4LOPA 4F70A 5J7BA 4QMOA 1J7UA 4O82A 1ZYDA 3CGFA 5CT7A 4E6DA 2OF2A 3DLSA 5T3QA 3TWJA 5IA0A 2J2IB 1J3HA 4QT1A 5ANDA 3QZIA 3MY5A 2WHBA 3P08A 5FP5A 5HX8A 1A06A 3TTIA 2WMSA 3VHEA 5JFSA 3KA0A 3NFGB 4NCTA 4GUBA 3F69A 2V22A 4J7BA 4M15A 3NX8A 4L68A 4EZ3A 1KE8A 4G3DA 4QTCA 1STCE 4CZTA 1DS5A 3QRIA 1XO2B 5CAPA 5A3XA 2RG6A 3LXPA 3A7JA 4E4NA 4RGJA 1XH7A 3REPA 4UMTA 4PF4A 4E6QA 5H8GA 2ZV7A 4W4WA 2B9FA 3FSKA 1BL6A 1T46A 5FBOA 3H3CA 3HL7A 5IKWA 5AP1A 3II5A 4QMUA 3LCKA 2JC6A 5IA5A 5C9CA 2OIBA 1OIQA 4KINA 4FV6A 4I3ZA 3ATTA 4M84A 4MYGA 5AA8A 5A4EA 4N70A 2RKUA 1OIUA 1OKWA 1PMEA 3VBTA 3V6SA 4D4YA 2JDRA 4FE2A 2F2CB 3KL8A 1APME 2GHGA 4PWNA 4BL1A 4EK4A 3PUFC 4EBWA 3ALNA 3U54A 3RK7A 3LZBA 3NUUA 2IZRA 5HTIA 4YTCA 3U6HA 1BKXA 2P0CA 4IE9A 1E1VA 3EQIA 4O86A 3PZHA 2HZ4A 4CFFA 2WQOA 3CKXA 2YIYA 3R7GA 5AX3A 4JJRA 3R9DA 3VULA 2QVSE 4KIPA 2ZM3A 4R3CA 2WOTA 4JRNA 3RM7A 3O17A 4JT3A 3CCNA 4YJPA 3RP9A 1OPKA 2VTQA 3OCBA 1YWRA 3PIXA 1H01A 2CDZA 2ERZE 2QOFA 3QA0A 4WBBB 3WZJA 4DH3A 2ZFYA 2YJRA 5KMJA 3OEFX 4M8TA 5E7RA 3QX2A 5B0XA 2G2IA 4BTMA 3G2FA 4AF3A 2C5OA 2ONLA 4OGRA 4BYJA 3UVPA 3GFWA 4L67A 3ZXZA 4YJUA 2IW6A 3RK5A 4QMQA 3CR0A 4L46A 5LVMA 4R1YA 2KTYA 5ANJA 5CQUA 5L2IA 1PXPA 2OU7A 3HZTA 4QMPA 5CSXA 4JIKA 4ZTRA 5HICA 3SC1A 2ETKA 3ZO2A 4EOSA 5LMKA 2BKKA 3OW3A 3RMFA 2YWVA 3AC3A 4E4XA 3GCUA 4TN6A 2BDJA 3PVBA 3U6IA 1M14A 3IW6A 3ZLSA 3R0TA 4FTQA 5DLSA 5BVFA 4WG4A 1XMMA 1Q8TA 4M3QA 2PULA 3DT1A 3EN7A 4GG5A 2QG5A 2R3HA 5JH6A 3DPKA 5J87A 4GFMA 5DR2A 3ORXA 5HE1A 4FSTA 4XBUA 3TTJA 5KNJA 3HEGA 3TKIA 4MEDA 4J96A 3RCJA 3LJ0A 4B99A 5ETCA 4LRJA 2WMXA 3QYZA 3D5WA 4FL3A 4KSQA 4KS8A 3LW0A 3UOKA 3PJ1A 4FZFB 3QTRA 4FG8A 3R21A 1ZOGA 2YWPA 2EU9A 3QAME 4PL4A 3QTQA 3HV7A 2VWUA 5HBJA 4QP4A 1H1SA 2GTNA 3RAKA 4BZDA 3O8UA 3M42A 4LG4A 3KREA 1XKKA 3C0HA 5EW9A 3PSDA 1Q24A 1XH5A 2UW0A 1YQJA 3VRZA 5GZAA 3KULA 4DFLA 2W5HA 2VWXA 5L8JA 2RGPA 4BB4A 2XRUA 4DHJA 4F4PA 4K8AA 4AU8A 2OG8A 3HP5A 2JITA 2FYSA 1XH6A 4LMNA 3ORTA 3SV0A 2VTTA 4R5SA 3UYSA 4AXEA 1F5QA 2X7GA 1Q41A 3NUSA 4BDKA 2QD9A 3TJCA 4FV0A 2J5EA 4X2JA 5C03A 1OECA 3I60A 3BBTB 4AZFA 1KE7A 3FMJA 4D1SA 4R77A 3GU7A 4IHPA 2PL0A 3V51A 5CSHA 2W1HA 3TN8A 2J0LA 4J53A 4MBLA 3CJGA 1V0OA 2CMWA 1UKHA 3ENHA 4G6NA 4MXOA 3KIOC 3F3VA 2XNOA 5IQBA 2V7AA 2WGJA 5A46A 4WOVA 3F5PA 5DT4A 4OBPA 4WSQA 2G01A 4OTGA 4WG5A 4WRGA 3VS7A 5IMXA 1IA9A 4F99A 3TIYA 3QD4A 1MRYA 3RJCA 3BX5A 2GTMA 4F0IA 4YC6A 5H9BA 3IECA 5GHVA 4CCBA 1OGUA 2W1CA 1OBDA 5EM5A 2PUPA 2ZDTA 3P79A 4JAIA 3LFAA 4TPTA 5B2LA 2WMUA 4DDGA 3EYGA 4A4OA 3OOMA 2Y4PA 3HRCA 3KXZA 3Q9YA 3VS0A 4K2RA 4RFMA 4ZSJA 4IWDA 1BI8A 1O9UA 2BAJA 4FIEA 5L8LA 2HK5A 3R1QA 2W96B 4X2FA 3ORIA 5M51A 5DE2A 4BIDA 3QHRA 2UW5A 4GS6A 4HNFA 4EC8A 4CG8A 2GNGA 4UZHA 4DT8A 2HZNA 3QCYA 3O7LB 3EL8A 4BTJA 4Y46A 2XIKA 3WZUA 4FIIA 4LL5A 4QYGA 5FEQA 4IXPA 1LR4A 4MBIA 1KOAA 4NEUA 3LFEA 2IVTA 2DUVA 1ZMUA 4FSMA 4M66A 3HA8A 2CNVA 1KOBA 1CKIA 1IA8A 4RWJA 5CI7A 5KMOA 4XMOA 1JKKA 4A4LA 3DDQA 1L3RE 2XEZA 3SRVA 5CANA 5AUXA 2O64A 4C35A 4ZMFA 5LWNA 4ACHA 4D4SA 3OY1A 2HW7A 4D5KA 2Z7RA 4FI1A 4AA0A 4DGNA 4R78A 3V3VA 2IWIA 4J52A 2OIDA 3GUBA 3H4JA 3C4CA 5F1ZA 2Q83A 5FUTA 3R02A 3G51A 3MS9A 3PJ2A 3PWYA 3CXWA 4U3ZA 5FBNC 5AUVA 5AUWA 4YP8A 4S31A 5D10A 2VGPA 4Z7HA 2WTWA 3UIBA 5E8SA 3F9NA 4FG9A 2CN8A 5CF4A 4QMWA 5DNRA 4CFUA 3QGYA 4GFGA 2YM7A 4ZLYA 2CNUA 4BDBA 4NU1A 4AE9A 1E9HA 2VTNA 4PMTA 4C58A 4KUJA 3U8WA 1KE9A 2AUHA 4FKUA 3NDMA 5DRBA 3E3BX 3UP2A 3VJNA 4CTCA 5JMSA 3IW4A 2WMBA 3DQXA 4FTJA 3QXOA 2XBAA 4YPSA 2ZB1A 4AW5A 5CEOA 5IUGA 4YHTA 4H3QA 1SMHA 2XH5A 1VEBA 3DJ7A 3OT8A 4WBOA 3OBJA 3R00A 4AXCA 3QLFA 3R8VA 3PLAE 3ZO3A 2CKPA 2I1MA 4YJNA 3FMKA 2ITXA 3F3ZA 3MY1A 4U45A 2R3QA 2BKZA 3M11A 1AGWA 3OWJA 3UQGA 2JDTA 5TKDA 4IDVA 4XG6A 4UY9A 5JFWA 1XWSA 2C3KA 3PXRA 2XNNA 2F7ZE 4YZBA 4F1OA 4UXLA 5KMIA 3BCEA 5CF8A 3KXHA 3TXOA 3FZPA 2IJMA 3UIXA 2W06A 2BZHB 2WTIA 5EHOA 2VTHA 1H07A 2I40A 3FMEA 5LMAA 5A9UA 1KE6A 5CQWA 3OCSA 2BILB 2OSCA 3HX4A 4EZ5A 3PP1A 4NYEA 3MA3A 5CU2A 3TNQB 3DB6A 3VQHA 2PZIA 3CQWA 4I94A 4OW8A 3ZSIA 4E93A 3BL7A 2X8IA 4FYNA 3GU5A 4V04A 4WSYA 4G3EA 2CCHA 2X4FA 4I93A 5DMZA 1BYGA 3IW7A 4QYFA 3R7OA 3ZUTA 3JR1A 1H08A 4EJNA 3I6UA 5JN2A 3A8WA 3RNYA 3ROYA 3UDSA 2C4GA 3KRXA 4TTHB 2GFSA 4R3PA 2BDWA 2GNJA 5B7VA 4QD6A 4I0TA 3HKOA 2GNLA 2FSOX 4NW5A 3FL5A 4QP6A 4QYHA 4UWYA 4FVPA 5CSWA 3UOLA 5DEWA 2YITA 5HNGA 3W0OA 4O0VA 3UG1A 3KFAA 5AR5A 5AV4A 3LFSA 4QMTA 2VWZA 3TZMA 3FZ1A 3ACKA 2XKCA 1V1KA 3MFRA 5TOZA 3PIYA 3ODYX 3WF9A 3MH1A 1XBAA 2WXVA 5CU0A 4KIKA 3R7UA 2VO7A 4FV9A 2CKEA 2WTCA 2BHHA 5AR2A 4Y72A 3QTSA 4OTRA 2XIYA 4BHZA 3ZRLA 4C61A 3WYXA 1TQIA 2BTRA 3TV7A 3O0GA 4RC4A 4UEUA 4WHZA 1OKVA 4I5MA 4HJOA 3TEIA 4FUYA 3C9WA 2BRGA 2B9IA 1H00A 3GEQA 4RZVA 3ZS5A 1UU7A 3KULB 4DAWA 2DYLA 4TZRA 1G3NA 2PK9A 4ITHA 3KK8A 1PXKA 4IAAA 2JEDA 2G2FA 3UG2A 2AEGA 3RAHA 4CMOA 4OTQA 2GFCA 4ANLA 4XX9A 2QC6A 4U97A 5C26A 3E87A 4IZYA 4I6LA 3ZEPA 4F1MA 3PA5A 5T68A 4MAOA 1W7HA 3IONA 4D2WA 3OD6X 2WMVA 1GIIA 1UWJA 5HZNA 5CU6A 1H1QA 4DTKA 3V8TA 3GI3A 4X0MA 4O7SA 2HYYA 2NO3A 1LUFA 1Q99A 3SG8A 5D7AA 4DBXA 3WZKA 3LCDA 2GU8A 4BBFA 3ITZA 2PZYA 3UZPA 2IW9A 3SW4A 3IO7A 4WO5A 4U43A 4FKQA 3TM0A 2GS6A 5JZJA 1OMWA 2QO9A 1GZNA 4HZRA 2UVYA 4D2TA 3TJDA 2X2LA 5KCVA 2GHLA 4L44A 1O6YA 3Q6WA 4GJ3A 3DY7A 5CVHA 4KKGA 2VTAA 4KS7A 4GEOA 5IH6A 3W0PA 2OJFE 1XR1A 3P0MA 4ONAA 2BDFA 4Y5HA 5EM7A 3V01A 4FVRA 2W99B 3UC4A 5HIEA 1DAYA 4P5QA 2VD5A 4A9SA 3IPHA 3H10A 4G5JA 2X0QA 4GK4A 4A9RA 4PNKA 3QU0A 4N57A 1JOWB 4O4CA 4H36A 3RZBA 3FLWA 4GK3A 2IO6A 2ZM1A 2WMAA 3MFUA 4L6QA 5K4IA 5K9IA 2V7OA 4RSSA 4AQCA 2W05A 4EQMA 4WT6A 4O2ZA 1VYWA 4C7TA 1OI9A 1Y57A 4RJ5A 4AXAA 4P90A 4X6RA 2FO0A 3E7VA 5IQEA 2XM8A 3RCDA 3NNVA 3SW7A 3MFSA 3FI3A 4I6FA 2P55A 4AOTA 3BPRA 2B52A 2OGVA 4FSWA 4CRSA 3HAMA 2YLEA 4D9TA 4BJJA 4L00A 3S1HA 1ZYCA 3GCPA 3ELJA 3R9OA 4DEDA 1Y8GA 5E92A 4DEHA 2XYUA 3AMBA 3C7QA 1DAWA 1YDSE 5GIPE 2X0OA 3DV3A 5E8WA 5B2KA 5A14A 5I9XA 3ZYAA 3L1SA 3HRBA 4F7JA 4JBOA 4ZTNA 3SRVB 4HYIA 3UOHA 2CGUA 3IW5A 3O51A 5K0XA 4UXQA 3V5QA 2C6DA 1O6KA 4O1PA 4RVLA 4LDTA 4BY9E 4ZZMA 3JYAA 4FNXA 3KRJA 4G16A 2VZ6A 5FM3A 2J0IA 3BHYA 3PFYA 2R3FA 5GNKA 4YNOA 4IZAA 3WE4A 1WBSA 4I4FA 2HY0A 2H96A 4RIXB 2OFVA 5DPVA 3V8SA 3QCXA 4FEUA 4BGQA 4QPAA 4FVQA 4L7FA 4YLKA 3W1FA 3OCGA 4B9DA 2B1PA 4TYIA 4UMRA 4USEA 2XYNA 3BQCA 3EL7A 4DGLC 5HTBA 4DFBA 3RWPA 3NYVA 4RVTA 4QEBA 1PXLA 3I0QA 2WMTA 5IQFA 4RWKA 3I7BA 2C5VA 4FODA 5AUUA 2BCJA 3CTHA 2IZUA 5C8MA 5CU4A 5CEPA 2JIVA 1CTPE 4RBLA 4ANNA 4IB0A 5KHWA 5EDRA 3CEKA 3PSBA 3C0IA 4ALUA 4NH1A 5AV3A 3POZA 3QUPA 2I0EA 5K0KA 5EQEA 5EQYA 1H26A 2Q0NA 1WVXA 4UWCA 5JK3A 3Q52A 3DKCA 3PDTA 2Z7LA 4QRCA 3MPMA 4QTDA 4HCTA 4I20A 2X7OA 3G90X 3PVGA 4D2PA 4BC6A 2J51A 3F2RA 3A61A 4NCTC 3QXPA 3ZTXA 3RTPA 4FKSA 4S32A 1H24A 4O7NA 4WRSA 4USDA 3Q2MA 4JS8A 4QMNA 3MTLA 4B4LA 5FTGA 1M2QA 4JQEA 1WMKA 3Q9WA 3AT3A 3HV4A 4O22A 3JY0A 4DG3E 3MYGA 3QTUA 4ALWA 4DDIA 3HV5A 1OL2A 4NWMA 2YIXA 4JDKA 3ZFXA 2OIQA 2HAKA 2OZAA 4E5BA 4W9XA 5IQAA 2GCDA 4AGWA 2PUNA 2I0YA 3KY2A 2XK9A 4HPUE 4L3PA 5FWKK 4CKJA 4A07A 3QL8A 3GENA 3PPJA 5HIBA 3RALA 4OTDA 3L8XA 2OK1A 1Q5KA 4PMSA 4CG9A 2OFUA 3PXFA 4D4RA 2Z60A 4I0SA 3QCSA 1JVPP 4ZS4A 3GGFA 3MVJA 4M14A 4FNWA 3BHTA 3O8TA 3V5LA 3NUPA 1AD5A 4U79A 2E9NA 5JQ5A 3V04A 1PXOA 4RRVA 2BAKA 4BDHA 5KMKA 1J1CA 3LCOA 4YZMA 4M0ZA 4KIKB 4X3FA 5ETAA 5J79A 4XHKB 3F2NA 1YHWA 4MWIA 5K5XA 4MCVA 2PY3A 4AAAA 1JAMA 5D11A 5LVLA 1R39A 5DR9A 3I1AA 1CMKE 1WBPA 1Q97A 4K11A 2HZIA 2VV9A 4IAIA 4RJ7A 1W0XC 3D5XA 4F08A 5IQGA 4CSVA 4ZAUA 2VTMA 4BHNA 4PPBA 2VGOA 4ID7A 2FSTX 4RT7A 2ONLC 3MJ2A 4PMPA 3W55A 3F82A 3GP0A 1ZYLA 4G6OA 5CNOA 5EDQA 4XV2A 2C6OA 2PZPA 2UVZA 5L2SA 3G15A 2XNGA 3T3VA 3NAYA 3WE8A 5CAQA 2I6LA 4DLIA 3AGLA 4JDJA 5M53A 3O2MA 2QLUA 4EWHA 4CRLA 3OBGA 4I41A 3ZFYA 5H2UA 2A19B 3ZHPC 4HGTA 4TL0A 2PUIA 3UZRA 3QX4A 4FSYA 1E1XA 1KE5A 3MW1A 5AM7A 1MUOA 3WF7A 5DWRA 1FVTA 3RPVA 2UW6A 1HCKA 4AW0A 3Q4UA 4D28A 3TUCA 2PMLX 4KB8A 4ZZNA 2CNQA 2XA4A 3OY3A 3M2WA 4AXDA 3C4WA 3MPTA 2UZBA 3F66A 4EHZA 3QQLA 5FM2A 4RWLA 2GS2A 4F6SA 4GT3A 3QZFA 3UVQA 3COIA 3GOPA 3NGAA 2Y6MA 3LCSA 1M52A 4CLJA 5K3YA 5ANGA 3TIZA 3LFFA 3UBDA 5EOBA 4L52A 3ZRMA 4AXFA 5IEXA 5EKOA 3PVWA 1Q4LA 2VWYA 2GPHA 4E7WA 1NT2A 4FT0A 2WIHA 1G8KA 2A27A 3V5JA 4C4HA 5GIOE 4JQ7A 3EZRA 4W8DA 3WBLA 1PKDA 4FTMA 4G3GA 5CWZA 5JRQA 4ZSLA 2YDJA 3C0GA 5HOAA 3TKHA 4I22A 3BEGA 3QC9A 1EH4A 2QOLA 4BCHA 4U41A 2UZDA 4O2PA 3EQPA 1YRPA 2RL5A 4H1MA 1PYXA 4K1BA 4PPCA 3F3WA 1TQPA 4I4EA 2OJGA 4CCUA 4R3RA 3DNDA 4JL9A 3SKCA 4O91A 3PPKA 1U46A 2W5AA 4BJJB 2AYPA 3FI2A 2CHLA 4FMQA 3T9TA 3W8QA 3SOCA 4R7HA 5BPYA 3R63A 4PP9A 3FEGA 5GJGA 4MK0A 1W82A 2B54A 4RIOA 5LVPA 4AQKA 4HGLA 4IB1A 1TVOA 3O96A 2YZAA 4C37A 5CZHA 1K3AA 3FLQA 5JZNA 5M4UA 4C02A 3FWQA 4BDJA 4EOOA 4F78A 3VS6A 3QZGA 3NIZA 3DAEA 4HYUA 2IPXA 1GZKA 1REJA 5L4QA 3WF5A 3O23A 1W98A 2Y9QA 2QCSA 3ZLXA 4H39A 4BCFA 2ITOA 2ERKA 5CEIA 2UZEA 4AN2A 4BI2A 5E8UA 2ZDUA 1O6LA 2QODA 4AWIA 3W2SA 4M97A 4MQ2A 3UNKA 4NM5A 4GKIA 3BKBA 3HP2A 3PFQA 4W4VA 4ASDA 4BWPA 2OWBA 5CYIA 5CEMA 3PY0A 2PZ5A 3LMHA 2OKRA 4AGDA 3CPBA 2F7EE 4L01A 3TDVA 3JY9A 4WNMA 4DHFA 2QOQA 4ZEGA 4PTEA 5KKRB 4QPSA 5LCJA 2PE1A 3IQ7A 4IX4A 5AV0A 4ACGA 3SG9A 2A98A 1OM1A 4XOYA 2ITYA 4DG2E 3QUDA 2UZOA 1CKJA 4O0YA 4FNZA 4HCUA 5IG1A 4IM3A 5KBQA 5L6PA 4YZNA 4IQ6A 5CAUA 5AADA 5J5SA 1W8CA 2E2BA 2WKMA 2WMQA 3LVPA 1SVGA 3EZVA 5FTQA 1NVRA 5TR6A 3P5JC 4IJPA 4D5HA 2JDVA 4AACA 3VS2A 2PE0A 2BIKB 4F9BA 4GSBA 3M1SA 5DG5A 4YO4A 3EQHA 3OWKA 3DFAA 4BDIA 5GINE 3BHHA 3LJ1A 3C4EA 4DINA 2XIRA 3DAJA 3BLRA 2WOUA 2XKEA 3R01A 2FGIA 1KUTA 3BLQA 3H0YA 2J90A 4I5PA 1UV5A 3DXNA 3ENMA 4P7EA 4PNIA 4TW9A 2JDSA 4FZ7A 4GT5A 4BRXA 4D9UA 4DH1A 3QD0A 3V8WA 4C8BA 1NVQA 3PZEA 4RWIA 3UC3A 3MH0A 3NZ0A 5CX9A 2RG5A 4AZEA 3ZUVA 4UV0A 3DKGA 2OZAB 2LAVA 4OUCA 3BYUA 3BGZA 3BE2A 3VUDA 1OGYA 2ZV2A 3E93A 1OIRA 3MIAA 5KHXA 3TNPC 5DRDA 1SZMA 2WPAA 2R3KA 3TUBA 4BCPA 4EH4A 1M7NA 4MD8E 3NUXA 2A1AB 3O8PA 5IZFA 2JDOA 3FV8A 4DH8A 5FXRA 4PDSA 3QZHA 2PSQA 1FOTA 4EYJA 4TYHA 1JSUA 5L2WA 5CSPA 5EHYA 5AWMA 2GQSA 1U59A 2YCFA 5CXHA 3P7CA 1JBPE 3BWFA 5I3RA 4DHIB 4RQVA 4ITJA 3MIYA 4X3FB 3TACA 4K0YA 4KRCA 3U4UA 3QQFA 4XCUA 2XNMA 1OB3A 1PRYA 3ZLYA 3R73A 1XBCA 4YMJA 1ZXEA 3C13A 4FRFA 2Q0BA 1DI9A 2J4ZA 2RSVA 4M7IA 4QP3A 2YLFA 3OT3A 2J0KA 2X39A 3EFWA 3SVVA 1HCLA 3DXPA 3TNIA 4D2RA 4BCKA 5BUEA 1FGKA 1QL6A 4DHZA 4HOKA 4EONA 4F7NA 1ST0A 4GFOA 3HNGA 4IANA 3S4QA 3ZMMA 4ENXA 3N4TA 3N51A 5C4KA 3MN3A 3CQUA 2EUFB 3PXQA 4LV8A 2YIRA 4ZY4A 3R04A 5IUIA 1OUKA 3O5AA 3OF0A 1VZOA 1VJYA 4N6ZA 4LL0A 4BDGA 3EFLA 3QRTA 4BDAA 4KSPA 4U0IA 1Y8YA 1ERKA 2PWLA 3PXZA 3VBWA 2X0GA 3VUMA 2Z7QA 3EYHA 4BI0A 2VNYA 3A2CA 4LGHA 1FMOE 2UVXA 3OMVA 4XLVA 5IF1A 3BZ3A 3E7OA 3AC1A 4C2WA 1URCA 3QWKA 4FJVA 3DNEA 4FK3A 4L53A 4G6LA 4U42A 4AT4A 2IVUA 4UALA 3MB7A 4F9WA 3NW6A 1J91A 4CT1A 2VTOA 4BZOA 3W2CA 4FIGA 2C0IA 2Y0AA 4CV9A 2BMCA 4AT3A 5CTPA 5TF9A 4CQGA 3QUEA 2ESMA 3T8OA 4RJ8A 5A4QA 4GU6A 3AT4A 5IA4A 4EJ7A 2YCRA 1Z9XA 3QQKA 3UP7A 1IG1A 4F6WA 1M2RA 3MSSA 5J7HA 1AQ1A 5FRIA 3UIMA 4ERWA 4PDYA 1QPEA 4Y5QA 3A62A 4A9UA 2W9ZB 3GC8A 5KZ0A 2JAVA 1P4FA 3BLHA 3KEXA 1G5SA 1PF8A 2F7XE 4O0RA 5EKNA 2VTJA 3GU4A 4K18A 3BGQA 1KV2A 2QO7A 4JBVA 4HVDA 1H0VA 3IGOA 2WMRA 3FYKX 2R7IA 3HMIA 4NM3A 4I21A 4W9WA 2XJ0A 3PA4A 4C4IA 2YCSA 5I3OA 3BI6A 5BVDA 2R3RA 4M68A 3NCGA 5AP3A 4C38A 4X2NA 3C4FA 4RVMA 2KULA 3OZ6A 3JS2A 2OICA 4E73A 3UNZA 1Q61A 4YR8A 4MXXA 4USFA 3VW8A 1U54A 2F57A 3QALE 4DFYA 4GV1A 4GIHA 1YOJA 1ZRZA 2JFLA 5LOHA 4NKSA 5M57A 5LXMA 3HMMA 3A60A 3CGOA 4EWQA 3OEZA 3GC0A 4FTUA 5T6KA 2WNTA 4EK5A 3AD4A 1R78A 3ORMA 3FXZA 1GIJA 1SYKA 2VTSA 3RPSA 1ZOHA 4GK2A 2J9MA 4BIEA 1H27A 2V0DA 4LOOA 4P5ZA 1GOLA 3FQHA 2WFYA 3QQUA 4RX8A 2HENA 4ENYA 4U5JA 3IOKA 5LWMA 3TNWA 4CGAA 2BROA 2YM8A 2FUMA 5AP5A 2H8HA 3W0RA 3K2LA 4KD1A 4GT4A 5HG7A 2OXDA 4OBQA 1PXIA 1CDKA 3GQIA 1J7IA 3A7IA 3DCVA 2X1NA 2WO6A 4E6AA 4C4GA 3QD2B 5DBXA 4CLIA 4O7ZA 1VLRA 4W4XA 2BHEA 4IAZA 5FEDA 2F9GA 1Q8WA 2NRYA 3A99A 3E8CA 2GDOA 2PVKA 4FIHA 3V5TA 3VF8A 4DTAA 4QDVA 3HV6A 1S9JA 3EJ1A 4PQNA 2BZIB 2OJJA 4BDDA 5HU9A 5E1EA 3UIUA 2WTDA 5KMLA 4CFNA 2Y6OA 3ZRKA 1UU8A 4E6CA 1F0QA 1FBNA 4TWNA 3HAVA 2CGWA 5CALA 2GMXA 4TNBA 5IEYA 3FKNA 4M67A 4P4CA 5AP6A 1G8SA 3W18A 4IFGA 4KKHA 4BWKA 4F0GA 3HV3A 4RA5A 3GU6A 4XG4A 1RE8A 2BRBA 4GW8A 3LM0A 1WBVA 3NSZA 2BZKB 2R7BA 3R8UA 2QG7A 2A4LA 3G5DA 3SD0A 5AR8A 4YZ9A 5DR6A 5EI8A 4UX9A 5HQ0A 2NYAA 4W8EA 3ZBXA 4XEYA 3E8EA 5DN3A 3F7ZA 3MPAA 2QOKA 4DE4A 4YC8A 1GNGA