5KMMA

Trka jm-kinase with 1-(2-methyl-4-phenyl-pyrimidin-5-yl)-3-(1-naphthyl)urea
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
314
structure length
301
Chain Sequence
SGLQGHIIACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title Structural characterization of nonactive site, TrkA-selective kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 301
sequence length 314
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kmmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kmmA01
2GMXA 2Z7RA 1LP4A 3RM6A 4KS7A 1DAYA 3DK7A 3CR0A 5M07A 2ZV9A 2ITUA 5FBNC 3QA0A 2WTWA 3T9IA 1Y91A 1WVYA 4HCVA 4I22A 4S33A 2F7EE 3BRBA 3QA8A 4XOYA 5HLPA 2QG7A 4B8LA 3GXLA 5GHVA 3T3VA 3ZUUA 3LOKA 3GVUA 4W4XA 3IS5A 4ERKA 1FBNA 2V7AA 1ZOGA 4ANOA 5EM8A 3PJCA 1Z5MA 3FMLA 3O17A 4FG8A 3U8WA 2YM4A 4XRLA 5EKOA 3V5JA 3TDWA 3NX8A 3NR9A 3SAYA 4BZOA 3F5GA 5AV4A 5BYLA 4WNMA 4V0GA 5BMSA 1NA7A 3F5XA 3DB8A 4WD5A 4O86A 4NTSA 4C7TA 3NDMA 1XWSA 5AP6A 3SG8A 2ITPA 3EFKA 3HZTA 3W32A 4BWPA 3FMDA 4J97A 4BTFA 3F2RA 2CGWA 2EB2A 3QU0A 1ZYJA 3B2TA 1P4FA 4DEIA 2GCDA 4G16A 5J8IA 4TWCA 1PMNA 3SXSA 3PXQA 4I6BA 4C4GA 4CFWA 2CGUA 3KY2A 3U6HA 4N6ZA 4F9CA 4BIDA 1UU3A 4P2KA 4KRCA 1YXSA 4RIXB 3G6GA 4JBOA 4RLLA 5FM3A 4AACA 4JX7A 4XP0A 3KEXA 4LGDA 3QTIA 5AP2A 3RKBA 2UW0A 4C4FA 5K5NA 3OOGA 1FVVA 2OIQA 1JWHA 1IEPA 3TG1A 3UVRA 1HOWA 1Q3WA 3UYTA 3ZH8A 4LFIA 4XG7A 1XH8A 2YIWA 4PDOA 4XG9A 2PMNX 4B7TA 3MVHA 2PY3A 4AW2A 3NS9A 4UMQA 1KE9A 5CALA 2O64A 1OL1A 3C50A 4O27B 4Q2AA 2XIRA 2IW8A 3GFWA 2X9FA 3KN6A 4J8NA 2B55A 4TZRA 4W4VA 4BZNA 4L46A 5EDRA 2J0IA 2OJGA 3OFMA 4K9YA 4L53A 4ZTNA 2BR1A 1U46A 3EFLA 5F20A 4C62A 3A99A 4D2RA 4H58A 4A4OA 2A1AB 3R7YA 3EN5A 3QQJA 1KV1A 4AZEA 3D9VA 2GHMA 4I0RA 5IZFA 3LQ3A 4FGRA 3H9OA 1JSTA 3FE3A 4XYFA 4OUCA 5HG9A 1J7IA 4UZHA 1P2AA 2VU3A 2B9FA 4CTBA 4Z3VA 4XEYA 4IM0A 2JAVA 5J87A 3UP7A 1WVXA 2UW8A 3AOXA 4BI2A 1JKTA 4RFZA 5KKRC 2ZM4A 4I20A 4IB3A 4YSMA 4EYMA 4O2PA 2W99B 3Q5ZA 4R6VA 4XG2A 1Y8GA 5FTQA 3F3TA 1LUFA 2WOTA 4AGDA 3FQSA 3P7AA 5FGKA 3VUMA 2AC3A 2ZDUA 3EQFA 2J0LA 3FPMA 4FVRA 4EH3A 3BWJA 3NUAA 4F6UA 5CI7A 4FT7A 4O81A 1H28A 3NZ0A 3FKNA 4IDTA 4DEHA 2CKQA 2H34A 2DWBA 2JDRA 4RWIA 2W1DA 5CF6A 2VTJA 4YLLA 3ZUTA 2P55A 3PIYA 4IZ5A 4TKSA 5EW3A 3FL5A 4FR4A 4TYIA 2WMTA 3LFCA 3FI2A 4EH9A 3AD6A 2WTVA 3VBQA 3LFSA 4KIPA 4J52A 1O9UA 3DDQA 3KXZA 4ACCA 2QU6A 3G2FA 3BYUA 3S4QA 5BYZA 4QMMA 3KRXA 4RIYA 2SRCA 3FXXA 2UZOA 2F2CB 4AGWA 4BCIA 4TWPA 3SC1A 2UW3A 4MQ2A 2OF4A 5C1QB 3AQVA 3NNVA 1VZOA 3OHTA 4W9WA 4AN9A 2BDJA 3LM0A 2PUIA 4DT8A 3ZO1A 4F0IA 2XIKA 5JH6A 4O0XA 3DCVA 3HRCA 5HCZA 3DOGA 2LAVA 3WILA 4BCPA 4RIWB 4PDSA 4I21A 3MDYA 1IA9A 4M67A 4QMWA 3EQIA 3O23A 1SMHA 3MH3A 2QKWB 3KC3A 2JBOA 3GT8A 4LRKA 3IK3A 3G0EA 2WELA 4FVQA 4UBAA 1ZRZA 3WF9A 4RWKA 4UX9A 1S9IA 2WQMA 3UMWA 4DGLC 4KWPA 3WI6A 5JKGA 1Q8WA 4HNIA 1YHWA 5DT4A 3RP9A 4W4YA 2F2UA 3D7ZA 2C0OA 4BN1A 4EOKA 5JFWA 2UW5A 3MBLA 4KRDA 4L00A 5DEYA 1OBDA 1JSVA 3ERKA 4RPVA 2C3JA 1FGIA 5CT7A 5M44A 2C5VA 2FVDA 3G15A 4Q9ZA 5CF5A 3KULA 5AX3A 4HCTA 4E1ZA 2QOBA 2X8IA 5KBQA 3BKBA 4EQCA 3PVBA 4KD1A 5DVRA 2J4ZA 2E9UA 3V8WA 5IH5A 4YBJA 2R64A 4E3CA 4ANQA 5LVLA 3LCDA 2DYLA 3LXPA 3HRFA 4FEQA 4DE4A 2CHLA 3DTWA 3MH1A 3QYZA 4F9BA 4PX6A 3TWJA 5KO1A 4FKUA 4XV1A 3C5IA 4QQJA 4NJDA 4WKQA 3G9LX 2OSCA 4D1XA 2LGCA 4GUBA 3MH2A 5LWMA 4FTIA 5EYCA 4KUJA 5C01A 4HVIA 2PK9A 4ITJA 2QC6A 1OPKA 3NPCA 4UALA 3TV7A 5HTIA 5C4KA 1SVGA 2PMOX 4I41A 1S9JA 1ZMWA 2UVZA 3LXNA 3UODA 4EOOA 2XJ2A 2ITQA 3R8UA 4CT1A 3AT4A 5EI6A 2CJMA 1REKA 4A9RA 5IEYA 4G5PA 2F4JA 5HGIA 2QU5A 3BE9A 3KMWA 2BTRA 4QO9A 4S31A 3PIZA 3T8OA 3L8VA 3NIZA 4FTQA 2ZVAA 2XK9A 2HYYA 3FHIA 1PMVA 4FSQA 3R21A 3ZO3A 5IKWA 1JSUA 1OKWA 2VRXA 3DU8A 2PVHA 4YJNA 2ZOQA 4YPSA 2YABA 4A9SA 4IXPA 4QMXA 2R3GA 1DI8A 1BI7A 2BDWA 4DH8A 5I9UA 3DK3A 4MAOA 2XJ0A 3AC2A 3EIDA 4EOQA 3PXZA 4V0GB 3TNQB 4AOTA 4F7SA 5JSMA 4EK3A 1ZMUA 1RE8A 3PPJA 3QRTA 5T3QA 3F5UA 4Q5HA 4ERWA 5KMLA 3ZSHA 1TQIA 4DA5A 3MVJA 3HYHA 3U6JA 3FYJX 4GFOA 4X3JA 3UQFA 3TDVA 5HO6A 2O5KA 3PXRA 4LRMA 3QKLA 4FZ7A 4O2ZA 4JBVA 2UZWE 4BCFA 4FMQA 1R3CA 4APPA 4M12A 3GP0A 4F65A 5CQUA 4QTCA 3W8QA 4D1SA 4TXCA 2CN8A 4FV7A 3CC6A 3BWFA 2WQOA 3O71A 4L3JA 4HCUA 4OTPA 4YC6A 4DHFA 5A14A 4CVAA 3PSCA 3U6IA 2GQSA 4DG0E 3ZXTA 4E6AA 4JDHA 3SXFA 1SZMA 3DJ6A 2VWUA 4DCAA 2FUMA 2H6DA 4C59A 4ARKA 4PQNA 5GZAA 4C3RA 4IX5A 2CGXA 3TL8A 4O96A 4UMUA 3R8ZA 2EU9A 5AM6A 2X2KA 4JNWA 5HNBA 3FI3A 3ZBXA 1OL7A 4X3FC 3L9MA 3G51A 3R9RA 4FG7A 3EFJA 4UYAA 4D4VA 2OK1A 4ANBA 4RWJA 2BILB 3D7TA 3L1SA 4I6HA 1F0QA 4IZAA 4KIKA 3PXYA 2B4SB 4J53A 3BGPA 4YJTA 1B38A 3F7WA 3RK9A 4U97A 3GOKA 5F9EA 2CMWA 2CPKE 4ID7A 4IVAA 3QRJA 4UZDA 4ZTHA 3TI1A 1YKRA 2FH9A 4W8DA 4DTBA 3ZONA 3F5PA 4PV0A 3JY9A 4ACMA 4IAKA 2R4BA 5TT7A 2UZBA 3FI4A 1M2PA 2XH5A 1XBAA 3WZJA 2B7AA 1CSNA 1QPDA 1F3MC 2J0JA 4O84A 2CLQA 2VGOA 3HV5A 4WHZA 4K77A 2QHMA 3UYSA 4L8MA 4O1OA 5CY3A 2OIBA 4CKIA 1ZMVA 4PNIA 3GCUA 5AUWA 1OVEA 4DFLA 5HNIX 3CJFA 3I0OA 4DGMA 3POOA 2XYNA 1OPJA 4M13A 4X21A 4YU2A 3RK5A 5AUUA 1Q3DA 4FZAB 3VIDA 3UOJA 2OH4A 2OWBA 4XP3A 3PPZA 3DDPA 3R30A 4XLVA 5M4FA 2NNWB 4J7BA 4L01A 3K2LA 4MVFA 4DGNA 2CNQA 2ZM1A 4WRSA 4IIRA 4EZ5A 2REIA 2X2LA 3Q32A 3RHXA 5DNRA 1R78A 1STCE 4QP6A 3UNZA 4FSMA 4QP9A 4FI1A 3PA3A 4U40A 4UEUA 4N57A 3CTHA 5HE0A 2VN9A 5ANDA 3MY0A 1G8SA 3LVPA 3ZMMA 3A7IA 4RIYB 5AR4A 3HMOA 1Q8TA 5AADA 1E1VA 4FKVA 1W82A 3QZIA 4R5YA 3ORPA 4GG5A 3RPSA 3FC1X 1PF8A 1XHAA 3R1NA 4IAAA 4HPUE 4WO5A 3ZC6A 2V7OA 3NVKI 5D7AA 3LQ5A 4XG3A 3H3CA 4IADA 2IVVA 2JGZA 2UVYA 2VWXA 2UV2A 3A62A 4A9UA 1MQ4A 2GNGA 3JXWA 2PSQA 2CGVA 2B54A 3MPMA 5F1ZA 4YR8A 5LXMA 3SOCA 2W1FA 2WD1A 3LJ0A 1L8TA 2YJSA 4M69A 3FLNC 3I0QA 1BLXA 4ZOGA 3DBCA 4FC0A 4DH5A 5CEIA 3KK9A 5GIOE 3BU5A 4M68A 4F70A 1OL6A 3ZO4A 3AC4A 4PP9A 1L3RE 3A7FA 4RA4A 4ZY6A 4N6YA 1YDSE 3OY1A 2VTTA 4KS8A 5KHWA 2PPQA 3QTRA 3E64A 3A4OX 1BL6A 3KXMA 3QTQA 1SNXA 4GG7A 2XNNA 4C37A 5LVPA 2I7QA 4EH4A 4I94A 1UKIA 4APCA 2GQGA 1YI4A 3KN5A 1OZ1A 4I0TA 2WMWA 4AU8A 1ZZ2A 2ETRA 4QYHA 2XVDA 4AS0A 3FZTA 5EM6A 3S95A 3OOMA 5K4JA 3KULB 2YITA 4P5ZA 3OEFX 4UYNA 5H8GA 3RAKA 2CNVA 4O7SA 5IUGA 4YJUA 3IW8A 1YHSA 3NUPA 3E8EA 1OL5A 2W1HA 4RG0A 4FZFB 2QOKA 1UNGA 1UNLA 2HXLA 2R3MA 5EK7A 4Z7GA 5J9LA 5CNNA 1IAJA 5CSHA 4ZJVA 2V0DA 3EZRA 3EZVA 3W16A 2QLQA 4WBOA 2X4ZA 2PZIA 4FSWA 3ZM4A 1LPUA 5DOSA 3OP5A 1GY3A 3LE6A 3EQBA 4FSUA 4FTOA 2GNHA 4RGJA 5FEEA 4YLKA 2JDVA 3E63A 1MQBA 2R5TA 4MXOA 4NCTA 2JKKA 4H36A 1OKVA 3CP9A 1IA8A 2Q0NA 3PZHA 4G2FA 3WARA 3PTGA 4BTKA 4BWXA 4DEDA 4FEWA 4FL2A 2QKRA 2RGPA 2P2IA 4IAFA 4TYEA 3NYXA 1MRYA 2UUEA 2YIYA 3M42A 4FV9A 4XS2A 3L8SA 3W2QA 5KMMA 3FL4A 5G1XA 3RBWA 5BYYA 1NVSA 1PXPA 3HV3A 3W8LA 5DYJA 2UZUE 5AV1A 4JIKA 3KRJA 3BYMA 5CAOA 1KE6A 2Y6OA 5IH4A 3FBVA 4D5HA 5F4NA 4PNKA 5CAPA 3SA0A 5CX9A 5G6VA 3EQPA 3VRZA 3ZFYA 3PRFA 3PIXA 3V01A 5HBJA 2BTSA 2KULA 3E92A 1I44A 1GIIA 4S30A 2OO8X 5M53A 3EN6A 4E5WA 5K4IA 2XK7A 3UOKA 5CEOA 3BYOA 3OW3A 3FYKX 3LHJA 3N4VA 2W17A 2OZAA 3NAXA 4NFMA 2QI8A 2PVMA 5FEDA 5HVKA 1OM1A 5AV3A 3SVVA 3DK6A 4NM7A 3TIZA 3ZDUA 5ANOA 4ZY5A 1OL2A 4A4XA 4BBFA 4LV5A 1J1BA 4CZUA 5HCYA 3FKLA 4IJ9A 3ZXZA 4C38A 5BVNA 3GC0A 2A2AA 4QTDA 3PJ8A 2AUHA 2QO2A 4YJPA 3EL8A 1PW2A 5KE0A 2PE1A 1JAMA 3W10A 4FKIA 4BKYA 2X0GA 2IO6A 4Y5QA 5A4TA 5K9IA 2RFSA 4CFVA 5CEMA 5JZNA 4O7YA 3R7EA 4DN5A 2XK4A 2XIYA 3EHAA 4LRJA 1FOTA 2PZPA 4LUDA 4NW5A 5CU6A 4FK3A 4U6RA 4WIHA 4G6LA 1SVEA 5AAGA 4AT5A 3QLGA 1KE8A 4ANLA 2PVKA 3F3WA 4LGGA 4C02A 4RJ5A 4QMYA 3II5A 4C36A 2FSLX 3KKVA 4PP7A 3PVWA 4JAJA 1CM8A 4QMZA 1BMKA 5AAEA 4QYGA 3QQLA 1YWRA 5CF4A 2NRYA 2RL5A 3PG3A 5A4EA 2VO0A 3OVVA 2R3IA 3SG9A 2IZSA 5B2MA 5F95A 2BIYA 1YQJA 5M08A 4MBJA 4HPTE 4IAYA 2NPQA 5IF1A 3PPKA 2PVRA 4U80A 1TVOA 2R3LA 5CAQA 4EK5A 3UZTA 5KNJA 4O91A 3VS4A 5J9YA 3ZBFA 1R1WA 2P0CA 3O50A 5HO8A 4P4CA 4CSVA 2R2PA 3TUCA 1PMEA 3GUBA 3NNUA 4NIFA 4K2RA 3QX2A 2VTIA 2VTRA 1ATPE 3FZOA 2OKRA 4MXAA 4DTKA 1WFCA 3DQXA 4PTGA 5ANJA 2I1MA 5E8UA 4EKKA 3R0TA 2VTNA 4NZWB 2BMCA 2C1BA 3CS9A 2G2IA 1W0XC 1YWNA 4Q5EA 5D41A 5D10A 4XV2A 5E8SA 2F49A 2JBPA 2HZ0A 2YM7A 5E7RA 5JQ5A 3TT0A 3JR1A 2VTSA 1M2QA 2FYSA 2VUWA 4HZSA 2OBJA 5EYKA 1ZY5A 3VF8A 4LOQA 3OWJA 3TKIA 4KB8A 1GZ8A 1WBPA 1LEZA 4G17A 4UXLA 3IGOA 4N4SA 3GNIB 2OJJA 3OTVA 3DFCB 4FBXA 3TJDA 4FTCA 3DLSA 1MUOA 1PMUA 2XMYA 4TWOA 2X7GA 4N0SA 4DGOA 4M8TA 2I0YA 3Q2JA 3JPVA 4MD8E 5AR8A 5FG8A 1Q97A 5D11A 4DBXA 5IQDA 5M06A 2VTLA 4R78A 3CGFA 2I6LA 3R71A 2C0IA 3CY2A 5FQDC 5JGDA 2WTDA 3NYOA 3TM0A 1NW1A 3KA0A 1FMOE 2W05A 4NU1A 4M14A 4BDGA 5HZNA 3EH9A 4JRVA 3ITZA 4G3DA 4DG3E 4DFZE 3VHEA 2VZ6A 4IDVA 4IJPA 3DAKA 3NYNA 4DLIA 1A9UA 2ZV8A 3C7QA 5CEQA 4I5CA 2GS2A 3KFAA 5I3RA 5EOLA 1FQ1B 4I93A 2QR7A 4IB1A 4PWNA 3W18A 3ZLSA 5EM5A 5IPJA 5ANEA 4O7VA 5ANKA 2Q83A 3QTSA 3VUIA 3P7BA 3MFUA 3I5ZA 1J7UA 1YXUA 2ZM3A 4BCQA 1XKKA 2HY81 4HYIA 5DBXA 4FT3A 3EKNA 4XNEA 4L42A 4RQKA 4XX9A 5EG3A 5E4HA 4O38A 4FSYA 4IFCA 3F88A 5J95A 4MXYA 5I0BA 2WB8A 4GCJA 2C6OA 1A48A 3F6XA 1K9AA 4BWKA 4D9TA 4I23A 3V5WA 2A0CX 3KCKA 4BBMA 2V62A 4RC4A 3CXWA 3ACKA 1V1KA 3ACJA 5IEVA 5A46A 4MWIA 3Q5IA 3CIKA 3ORKA 2UW4A 5ICPA 3NIEA 2W1CA 1ZYLA 2OXXA 4ZTSA 1A06A 2HXQA 3ODYX 3MB6A 2ZV2A 4GKHA 5BVFA 4FTMA 4TY1A 3E7OA 2XNBA 4AN3A 3WZDA 2XM8A 4MXXA 3PSDA 5HO7A 3M1SA 4B8MA 2BZJA 4F99A 5GJDA 4FV5A 5L3AA 3QTUA 5JK3A 3VBTA 4R8QA 3UIBA 4O21A 1FMKA 3ELJA 4CLIA 4OTHA 3QC4A 4Y73A 3HDMA 1ZOHA 3LMGA 4HYSA 4W4WA 3O0GA 1PXKA 4IH8A 3T9TA 5IUHA 4XMOA 4ALUA 2C68A 3FLSA 2XNPA 4WT6A 3ZZEA 3R7VA 2YCQA 1Q5KA 3EB0A 3PVUA 4YMJA 5IQBA 2P3GX 2W5HA 3ORXA 3ZZWA 3R1YA 3ORMA 2W1ZA 5IQFA 3KXHA 4AE6A 2ZB0A 5AAFA 2BKKA 4U7ZA 4YZBA 2J6MA 4FSTA 3HKOA 3NUXA 4RVLA 5E8TA 4CFFA 4H3PA 2DQ7X 1WBOA 3RCJA 3W1FA 4PPCA 1Q62A 2WTJA 4Q9SA 2C47A 3GQLA 5JFSA 5HTBA 4I5PA 3RMFA 3UJGA 3E5AA 4EBWA 2JAMA 2OZAB 3PLAE 2RFEA 3MS9A 4IVCA 3ODZX 2R0IA 2HZ4A 4GT4A 3HDNA 4NSTA 4GMYA 3E3BX 3ZM9A 4FZDB 3SLSA 3VVHA 1O6LA 4XUFA 5KZIA 3F82A 4RVKA 2YDIA 4ITIA 3ZOSA 4BRXA 4D2TA 1JBPE 4DCEA 2JKOA 3VO3A 3E93A 4YZMA 5CANA 3CLYA 2UZLA 3OBJA 2AC5A 4E93A 2XK6A 2E9OA 3LMIA 4GJ3A 2PL0A 5E8XA 4EHGA 3FXWA 2V55A 3RWPA 3D2KA 5AR2A 3C4XA 2XNEA 2WQNA 3LZBA 3IW7A 3I5NA 4FVPA 4CZYB 2XK8A 3V04A 3WYYA 4ANSA 4DFNA 2CKOA 4JLCA 2BRHA 1OPLA 4C4EA 3D94A 5AR5A 5HICA 3VS2A 2WTKC 2WIPA 5M57A 5CF8A 4BICA 2X9EA 3DPKA 3C4FA 2YA9A 4QYYA 5HTCA 3DAJA 2IVTA 4CNHA 4Y5HA 1ZZLA 2BROA 3BLHA 4Z9LA 2Z7QA 1YVJA 4UMTA 3BGZA 3QTXA 5J7HA 4EUUA 3HV6A 2XA4A 5LOHA 2R3OA 4A06A 4FYOA 3R2YA 3QRKA 3DKOA 4KIOA 3R9HA 3LMHA 2BRGA 4MX9A 1FVRA 4O7RA 3D5UA 4G6OA 4F0GA 5AUTA 4D2SA 4UWCA 4RC2A 3MIAA 5AA9A 5IA2A 5AMNA 2PE2A 4AFEA 4X0MA 3DQWA 3EQDA 3E7VA 3NUSA 4EI4A 3SQQA 4O7ZA 3TV4A 4DEAA 2C69A 4GJ2A 5GJFA 5DHJA 3VF9A 3UE4A 4CFNA 2C4GA 4ANNA 3SHEA 2E9PA 5AUZA 4GYGA 4J71A 4RFMA 4NIFB 3WF7A 1NVRA 5KBRA 2PTKA 3AT2A 5BVDA 4R7BA 3WZUA 2YM8A 4ALWA 4FKWA 4BFMA 1UNHA 1UWHA 3F3VA 2VV9A 4BBEA 5C27A 2PU8A 2WNTA 3DAEA 4G31A 3SRVA 4AZFA 5CXZA 2YACA 4IQ6A 4BYJA 4QMNA 2R9SA 3AC5A 3ZSGA 5AR7A 2Y8OA 1KOAA 4HGLA 4P7EA 3TEIA 3UNJA 3HMIA 4BTMA 4RA5A 3BEAA 2XB7A 4IZ7A 4XLIA 2XIZA 4QOXA 4E4XA 3RPVA 5DRDA 1PKGA 4RJ6A 2EXEA 2XUUA 4TYGA 4AP7A 2Y4IC 2IWIA 2NRUA 4LYNA 4DINA 5BQ0A 2QOFA 3KRLA 3FZPA 4TWNA 1CKPA 1BUHA 1OMWA 2CCHA 5TO8A 3KF7A 3MIYA 3PWDA 4C4HA 3B8QA 4EOSA 4MBLA 2PZRA 3QL8A 5IA1A 5IA0A 5IU2A 4IMYA 4O0TA 5DR6A 1OITA 1OUYA 1ZY4A 4QD6A 5B7VA 2ZV7A 3FLQA 2YISA 3DXPA 2X8DA 5L4QA 3DJ7A 4J95A 4BR3A 5JEBA 5CXHA 4QTEA 4FT0A 2OJIA 4ZJJA 1RW8A 3MPTA 4ALVA 4PMPA 4O7LA 3FMEA 4FV1A 4CV9A 2HELA 3MYGA 5AV2A 2XNGA 2J0MB 3E88A 4RBLA 4IE9A 3H0ZA 3AC1A 4TL0A 3OTUA 1DS5A 1WBSA 2ZAZA 4ZSAA 2GDOA 3GCSA 3CPCA 2PMIA 5A3XA 1UWJA 4USEA 3R6XA 1OIRA 2UW7A 1W84A 3BGQA 4NKSA 5HBEA 4A7CA 5HX8A 3ZEWA 1YWVA 4JDJA 2OG8A 3R7OA 3LCOA 4OAVB 4QT1A 2ITTA 5IG1A 5GZ9A 3ROYA 2W1GA 5KMKA 5B2KA 1P14A 4FIJA 4QPAA 3I60A 2VTMA 4B99A 3SV0A 1GZNA 1J7LA 2W4OA 4KBCA 4RZVA 3QZHA 2IW9A 3CTJA 4R5SA 1M7QA 2QOIA 3D0EA 5M4UA 4WG4A 2YEXA 3GQIA 1G8AA 4FV8A 3MWUA 4YLJA 4ZS0A 4CG9A 2FO0A 1DM2A 3QQGA 3Q4UA 4OTWA 4H1JA 3I1AA 3W2SA 3LJ1A 3WZEA 1CDKA 5A4QA 2YZLA 3U55A 3W2RA 4JR7A 5CU4A 2G15A 5CAUA 3R73A 4MXCA 4QP4A 3IOKA 4WNKA 3DBDA 3HEGA 3NW6A 2YN8A 3BHUA 4QMTA 3ID6C 3TZ9A 3IGGA 4PY1A 3ENHA 4FIFA 4EOMA 2BIKB 2PVYA 5AP1A 3FDNA 3RCDA 3WYXA 1ZYDA 3I6WA 4PL4A 4BDKA 4ZMEA 5AR3A 5JQ8A 2J0KA 1NT2A 2XKEA 4M0ZA 1SVHA 3CSVA 4FV4A 3D83A 4PPAA 2J50A 2R3QA 2YIXA 3ANQA 4KA3A 2WMUA 3GC8A 2RSVA 5BX0A 1BKXA 1ZLTA 3A61A 5CVGA 5EI8A 4HOKA 1RJBA 2W06A 3PE1A 4UXQA 2OXDA 4L45A 4WRGA 3EQGA 2ZMDA 4NM0A 5AFVA 3K3IA 4ZTLA 5M4CA 1G5SA 3LM5A 2VTHA 2O65A 4CYJA 1LR4A 1IR3A 2EUFB 3EQCA 5DI1A 4HVDA 1WZYA 5EQYA 2XKCA 3W55A 1H1SA 5C4LA 3TN8A 5AP0A 3R9OA 3BYVA 4XH6A 2WQEA 3FEGA 2BUJA 1GNGA 2R3KA 2C5YA 3NCGA 4IBMA 4YJRA 4O7WA 4NK9A 3TZ7A 4TRLA 3SD0A 4B9DA 3DNDA 2IVUA 4EBVA 5LMAA 3PA4A 4XG6A 4V01A 4EQMA 4E5AX 4V05A 4ENYA 2W96B 3HECA 4AE9A 2CCIA 5AV0A 1FINA 1PXJA 3PFQA 4F08A 4I5MA 3MA6A 2VWVA 4FNXA 3HP5A 3V51A 3EFWA 3COKA 3R63A 3UQCA 3MN3A 3KCFA 2VWIA 1W7HA 3IONA 4RMZA 3OZ6A 5FXSA 5HIBA 3VBVA 4ZJIA 1JOWB 3BCEA 4H1MA 2WIHA 1WBNA 2Z02A 3P86A 2IVSA 2ERKA 4DYMA 4HGTA 2F9GA 3R02A 4RFYA 3RZFA 4FKSA 4PRJA 1PYEA 4ZZNA 1SNUA 1ZYSA 3ROCA 3KREA 4ZLZA 4OTFA 4FIHA 3EQHA 3AD4A 4DFXE 1TQPA 2C5OA 3VAPA 4BIBA 2R3NA 4MQ1A 4DLJA 3D5XA 4X2NA 3TTJA 4FZ6A 2EB3A 2FSTX 3PY3A 3QD3A 2B9HA 4PPBA 1WAKA 4O0VA 5HU3A 4QMUA 5DIAA 3AXWA 4FF8A 4Z55A 5I5ZA 3I7BA 3DNEA 3ATSA 4H05A 2WOUA 1UV5A 3V5QA 2A4LA 4EH2A 2PWLA 5EQEA 4IVDA 2HY0A 3KF4A 3FQEA 3MFTA 3NUUA 2PUPA 4IW0A 5D12A 3RI1A 5EDPA 5BPYA 3A7HA 3IOPA 4QQ5A 5DWRA 1B6CB 2XP2A 4BI1A 4R77A 4E4LA 3U51A 4BC6A 3HUCA 3V8SA 3EWHA 3FZ1A 1CTPE 3OUNB 4FTTA 4CD0A 2QOHA 5C26A 4NUSA 4JIAA 5HQ0A 4AT3A 4ASDA 3KMMA 5AEPA 4Y83A 3MA3A 5EHYA 5FTGA 3NLBA 3A4PA 4JDKA 1Y6AA 4LOOA 4PTCA 3R22A 3UVQA 3R8VA 3GI3A 1B39A 1KOBA 3C1XA 3NWWA 4QYFA 4RJ7A 3DKFA 4QMOA 2PE0A 3GCVA 4X3FA 4ACGA 3ORIA 1GZKA 4BDIA 2Y0AA 3HAMA 3I4BA 5I9YA 3F7ZA 3ET7A 2WPAA 3QCSA 2YM6A 4XV9A 4FTRA 3FHRA 3VWAA 2NO3A 3D15A 3Q96A 4QNAA 4LM5A 1IAHA 2C5NA 3UDBA 3HUBA 4B6LA 3L9PA 3SW4A 4BDBA 3VW6A 3RWQA 3QX4A 5EW8A 3CJGA 3QAME 1RQQA 5FXRA 3BBWA 2BCJA 5DFPA 4WUAA 5LVOA 2WGJA 1CKJA 3V5LA 4ANMA 4CQEA 5K5XA 3M11A 3ZDIA 4F1MA 3GCQA 4GS6A 4R1VA 5KUPA 4PL3A 5LCKA 4D2VA 5D7VA 5IEXA 1YW2A 5CYIA 5KKRB 3DLZA 4FEXA 2IZRA 2YERA 1H0VA 2YM3A 3H9FA 4FIIA 3MW1A 4OR5A 3ATTA 5LQFA 4AGCA 4L68A 3MH0A 4BCOA 3HX4A 3OXIA 4TTHB 4J96A 4WBBB 4XOZA 3ZO2A 5FBOA 5TE0A 2JDSA 3NNWA 2GSFA 3CE3A 3HV4A 5CT0A 3UO6A 3ZYAA 1M52A 3QKMA 4EWHA 4BHNA 4EHVA 3F2NA 4GV1A 4UWBA 4G5JA 4QP1A 2GS6A 3FZSA 1YXTA 3UO4A 3LLTA 4EH5A 2C1AA 5HI2A 4G3CA 2WMAA 3HNGA 4M0YA 3CKXA 2WMQA 2BZIB 3CQUA 3P0MA 4GH2A 4X2KA 3HP2A 3DBEA 4BL1A 3N4UA 4IWQA 2GNLA 5DE2A 5C9CA 4M7IA 4EH6A 3TTIA 1UU8A 1OUKA 3Q04A 3Q6WA 3VC4A 4BDEA 5IDNA 3LCKA 3QWKA 4QTAA 3KRWA 4IC8A 4RX7A 4MTAA 4AWIA 2ERZE 5CS6A 1J1CA 1H0WA 4BY9E 2VD5A 5E8WA 4YGAA 3DA6A 3QGYA 3FZRA 4DEGA 1YRPA 3CBLA 3BU3A 5LJJA 3BX5A 1JVPP 2YFXA 4DH3A 1H4LA 3A7GA 3GB2A 3F3ZA 5JGBA 3LFBA 4MNEA 4ZAUA 3U87A 4FOCA 1Y57A 5DPVA 3LPBA 4Y72A 2CLXA 4YZ9A 5A9UA 1JLUE 5HD7A 1H25A 5A54A 3O8TA 2Y9QA 3UC3A 2IG7A 3JVRA 1ERKA 4CEGA 2R0UA 1SM2A 4F6WA 1V0OA 4ZSJA 5L8KA 4AW1A 1KE7A 3G90X 3FWQA 3GU4A 4MNFA 5LVMA 4FKJA 1YI6A 2PUNA 1Q61A 3FLZA 4KNBA 4FTKA 1VR2A 4UY9A 4AOJA 3RAHA 3WE8A 4XRJA 4YNEA 5EYDA 4EH8A 5IH6A 5CWZA 3LW0A 4I1ZA 1XQZA 3C9WA 2PULA 3R9NA 5FD2A 4YO4A 2W9FB 3ZRMA 3ALNA 1Z57A 2RKUA 3O8UA 3R7IA 3W2OA 3NVMB 2WAJA 4WOVA 5L2SA 1YHVA 1Q4LA 4RSSA 3BQCA 2C0TA 2XK3A 3D4QA 4X2GA 2VWZA 2OU7A 4FGBA 3EKKA 5AIKA 3UZRA 4H39A 2PZ5A 4BGGA 4I92A 3OY3A 3QD4A 4GT3A 2H96A 4IANA 4ZY4A 4OBPA 2XZSA 3O7LD 3U9CA 3R8PA 1KE5A 2VWYA 2W5BA 4HVGA 1W83A 5LCJA 3IPHA 1H01A 4YBKA 3UOHA 3ZU7A 3C4EA 2ITZA 4OT5A 4FKOA 4OTRA 3A8XA 3B8RA 3CKWA 3FV8A 2HAKA 1VJYA 1I09A 2VO3A 4BDCA 3UQGA 5JFXA 2Z2WA 2HZIA 3LJ2A 2X6DA 2YIQA 2ITXA 3SW7A 3R2BA 5L6WL 1F5QA 4C2WA 3OF0A 3MESA 3Q3BA 4Y46A 4KBAA 5HE2A 4KKHA 2B0QA 4G9CA 5FM2A 2F57A 2VTOA 3HV7A 4GEOA 2FSMX 4XP2A 1H8FA 1XH5A 2VX1A 4ZMFA 4YTCA 1WVWA 1WBTA 3TZ8A 1M2RA 4EHEA 5GIPE 1ZAOA 4X7QA 3D14A 3P78A 4MBIA 5EHLA 4ZTRA 1T46A 5BVWA 5JRSA 3TNPC 3ZLYA 2PVNA 4E6DA 4JG6A 4EWQA 3D7TB 2YCSA 3GCPA 4CG8A 2WFYA 2W0JA 3OC1A 4KIKB 4M66A 4YURA 4ZLYA 2Y7JA 4YPDA 3P7CA 2Z60A 3NUNA 2P4IA 3LFEA 5BUIA 5HE3A 4EC8A 2C6LA 3VS1A 2H8HA 4BVUA 4F7JA 2G2HA 4Y85A 3FY2A 4UMRA 5E91A 4TYHA 3FLYA 5HNGA 2ZJWA 2GFCA 2R7IA 4AFJA 1YDTE 1TKIA 3E8DA 3FAAA 3QCQA 4MCVA 4BI0A 5IDPA 4IC7A 3WOWA 4FKTA 3N9XA 2IW6A 4ASZA 5HIDA 5J9ZA 2CN5A 4X2JA 2FSOX 3BQRA 4FKRA 4JQEA 3KQ7A 5TF9A 3FC2A 2VO6A 2ZB1A 1DAWA 1YXXA 2VTAA 5CZHA 2GQRA 2GS7A 4FODA 1M17A 2HWOA 2ONLC 5CZIA 3AGLA 2JD5A 4MD9E 4O6LA 3CTQA 5DT3A 4MF1A 4MH7A 3VJOA 4CYIA 3PJ1A 5E1EA 4RVMA 2C3KA 1KSWA 4CCUA 2UZTA 4HJOA 3V5PA 4X3FB 1GZOA 2EXCX 3L8XA 2QVSE 1UA2A 2ESMA 4TPTA 4EK6A 3PSBA 3L9NA 3ZSIA 4CLJA 5A6OA 5GINE 2YM5A 4X6RA 4YHTA 4M97A 2BZHB 4GW8A 5CQWA 4L52A 5TKDA 2G9XA 2QO7A 3I7CA 3TZMA 2QOOA 4DFUA 4IVBA 4FSNA 4FT9A 2WQBA 3BE2A 2YWPA 4IAIA 4JDIA 4O7TA 3RNYA 3BV2A 3NNXA 4HGEA 3FMKA 3P08A 3A60A 3WF8A 3OS3A 4EL9A 5L6OA 5L2QA 3LAUA 3VS7A 5K3YA 3OD6X 2WTIA 4M84A 4RLKA 4E20A 4BKJA 5LMKC 2J90A 2Z7LA 3R1SA 4RJ4A 3KRRA 3F61A 1WMKA 2HIWA 3KL8A 4FX3A 3VS5A 4USDA 3PA5A 4IX4A 5HU9A 2XRUA 3BIZA 5E8VA 2O3PA 3P23A 4BDJA 1PXIA 1W98A 3GENA 1HCLA 4M69B 3TNHA 2WKMA 3LFDA 4O7NA 5AP4A 2CSNA 1M14A 2FGIA 4PL5A 4E73A 5DEWA 4J8MA 4AUAA 4UB7A 3AC8A 5LARA 2C3IB 4DH1A 4PMSA 4MEDA 4RIWA 4AGUA 4C2VA 2VX3A 4KSQA 4EOLA 2WXVA 4JQ7A 4AW0A 4DEEA 4EH7A 2BHEA 4NKAA 5A4LA 3PUPA 2QURA 4WNOA 3TKHA 4QMVA 3RALA 4D2PA 2O0UA 1XH7A 4IWPA 5FEQA 4M15A 5ETIA 4BDFA 3W2CA 4EKLA 4C3FA 3REPA 3DXQA 3C4WA 4NFNA 3QCXA 4IX3A 1Q8ZA 3MY1A 3PJ3A 5AP3A 5H8EA 4OBQA 3NW5A 4F1OA 2BRMA 1YOMA 5HOAA 5IA4A 4YJSA 2XCHA 5EFQA 3FPQA 2R3RA 4P90A 2WZJA 3PXFA 4FTLA 1OIYA 1CMKE 2OIDA 3M2WA 3OROA 4FL1A 4GT5A 4S32A 5CI6A 3UMXA 4X6QC 5CVFA 4FEVA 3BI6A 3I6UA 4AAAA 2B52A 4FL3A 3FJQE 5IQIA 4LQMA 4FNYA 4MNEB 3IDCA 3S1HA 4GIIA 1U54A 2CDZA 4ZEGA 3VW8A 4C35A 4LUEA 2YWVA 2X7OA 3QCYA 2ZDTA 3PJ2A 1AGWA 4F0FA 3DJ5A 3IDBA 1NY3A 3MTLA 3HL7A 3O96A 3R83A 5GJGA 3E8CA 1CKIA 1R39A 2GTNA 5H9BA 4YSJA 4P5QA 5AA8A 2C6KA 3QXOA 2HK5A 2YCRA 4BF2A 3ORZA 3Q4ZA 4JQ8A 4LI5A 2BFXA 5M4IA 3AG9A 1PKDA 3VS3A 2DUVA 3EYHA 4X2FA 5T68A 1QMZA 4EC9A 3CY3A 4FICA 3LKMA 4U3ZA 3PYYA 1OGUA 3NAYA 3NW7A 3C4CA 4A9YA 4F63A 3HMPA 4I0SA 4ZTMA 2VTQA 5CU0A 1ZOEA 5AX9A 2GNFA 3OCTA 3PP0A 3RVGA 3UPXA 5KMNA 5CTPA 2ITOA 4GU6A 4H3BA 4MYGA 4D4RA 3UZPA 4NW6A 1K2PA 3NGAA 4I6FA 4F1TA 4ASXA 3P79A 4KABA 5AWMA 1BL7A 3VNTA 1ZYCA 1OIUA 1OKYA 2JIUA 1NXKA 4AW5A 3SDJA 4E4MA 5CLPA 5HE1A 3UG2A 3LCTA 5DRBA 1JQHA 2CKPA 3FI8A 1P4OA 4JJRA 4RWLA 4C61A 5CEPA 5JRQA 4AT4A 3FMHA 4R7HA 4D5KA 3COMA 1XR1A 4K18A 4NM5A 3CQWA 3PXKA 2WMVA 4YZDA 4CXAA 4K0YA 3COHA 5IISA 4BDAA 5HCXA 2XYUA 5ACKA 4BYIA 3F69A 4ZSLA 3CD8A 3GFEA 2XNOA 3VBYA 4BCKA 4YUQA 4B0GA 1XBCA 1MRUA 5HORA 5K0XA 4CKJA 4Y95A 2XM9A 4XHKB 2O8YA 4OTIA 5DT0A 1J3HA 3WZKA 4QTBA 3P9JA 5HHWA 3WIKA 4FV2A 1OI9A 2ETMA 5F94A 4CFXA 2BAKA 2WU7A 3HA8A 1UU9A 4JRNA 1AD5A 4IACA 5ETFA 2JKMA 3Q2MA 3RPRA 2C3LA 3CD3A 3OWPA 5J1VA 3ZHPC 4ORKA 4NEUA 4WG5A 4D2WA 3MJ1A 5K0KA 3Q9ZA 3QLFA 3P1AA 5DR9A 2YJRA 3ULZA 2XF0A 3TACA 3TUBA 3VS0A 2RIOA 3KXXA 2B53A 2P33A 5E8ZA 3MTFA 5HVJA 1BYGA 3CPBA 4D9UA 5I4NA 4TYHB 4K1BA 4MF0A 1OIQA 4KIQA 3N4TA 4GKIA 1VEBA 4K8AA 4JS8A 1UVRA 2UZNA 4BTJA 4FKPA 5HG7A 4D28A 3R1QA 2CKEA 3HGKA 2Q0BA 4RQVA 3A2CA 3UOLA 2X6EA 3K5UA 3Q53A 5JN2A 2IJMA 4NT4A 3G0FA 3P5KA 4GRBA 3BELA 1IG1A 1R0EA 3GOPA 4C3PA 1OKZA 3O51A 5JGAA 3QZFA 3DGKA 1U5QA 4AN2A 3AD5A 3RINA 3EYGA 2QOCA 4RRVA 3QHWA 3R7GA 4PDPA 2IZTA 4II5A 5KMIA 3HAVA 1BI8A 4GIHA 3CEKA 3P4KA 4IEBA 4MWHA 2BAQA 4OT6A 3U4UA 4A4LA 2B9JA 3OWKA 3KK8A 2WEIA 4BGHA 2BPMA 3G33A 4C4JA 5IMXA 4DF3A 4YTHA 2RFNA 5J7BA 1V0BA 2J5FA 3H0YA 2XEYA 3EL7A 2KTYA 1OECA 2UVXA 3HLLA 3DTCA 4D4YA 1Y8YA 3AT3A 2HOGA 1XO2B 4U43A 4NWMA 4YO6A 5KHXA 2QODA 3I81A 5HLNA 4ZZOA 2QHNA 1E1XA 2RF9A 4J1RA 1PXLA 3R04A 4EUTA 3CCNA 5BVOA 5EYMA 3PY1A 3IW5A 3NSZA 4ZSEA 5HKMA 5FLFA 4RX8A 2ZYBA 3KVWA 4F7LA 2JEDA 4A9TA 4LGHA 3QXPA 5AUXA 4PDYA 2IN6A 2Z7SA 4D0XA 4ACHA 3IO7A 4F9WA 2C6DA 3WBLA 4RVTA 3LFAA 5AUYA 1PHKA 2BFYA 4KAOA 4FUXA 1Z9XA 5KMOA 2ITYA 4GK2A 4U9AA 4NJ3A 3WF5A 5J5SA 3V3VA 3BBTB 5CASA 4AF3A 3C0GA 2UW6A 3F2AA 3IKAA 3LXLA 4QP3A 2BZKB 3AMBA 4GK4A 4QP7A 4NL0A 4CGAA 2W1IA 3OBGA 4W8EA 5IQAA 3D5VA 4FSRA 4WSYA 5IA5A 5C03A 3BHTA 4O0UA 3IECA 3TCPA 4QRCA 4DGGA 5ANGA 1PYXA 3C13A 4HYHA 4U41A 1P5EA 2B9IA 4YZNA 4QQTA 2W4KA 1OBGA 2A19B 1Y6BA 4K11A 2VX0A 3IW6A 1MP8A 1XH4A 1YOLA 3GU6A 4I4FA 4OW8A 2ETKA 4FK6A 4NH1A 3LIJA 5IUIA 5FUTA 5DLSA 4FNWA 4J99A 5CU3A 4AA5A 4IHPA 4AZSA 4QQCA 5HLWA 2PUUA 2YZAA 3FKOA 2X1NA 3T3UA 2XKDA 4CRLA 1YXVA 3HRBA 5E92A 4I24A 4EOIA 4ENXA 3S2PA 1LEWA 4MD7E 3VUHA 2GFSA 1FPUA 2J9MA 4RX5A 3EN9A 3OUKA 5FDPA 4TN6A 1U54B 3R7UA 4IM2A 4WSQA 3U9NA 1URCA 3VN9A 3JYAA 4AOIA 4L9IA 1GAGA 4TT7A 4RC3A 3B2WA 3QRIA 4FA2A 4DFBA 2QNJA 4U0IA 3VULA 5HVYA 3OT8A 4OGRA 5CEKA 2I0HA 4RX9A 2XBAA 3QYWA 4Y8DA 5AP5A 3R8LA 3QRUA 1ZARA 4C0TA 1M7NA 2Z8CA 4MHAA 4U81A 2UW9A 2UZDA 4MXZA 3TJCA 4MKCA 4YJVA 4L3LA 3UIUA 3WIGA 4EOPA 2GHLA 2YDJA 4TW9A 4G1WA 1UKHA 4FV0A 4UWYA 3MJ2A 4BDHA 2C6MA 3GBZA 1R0PA 3MPAA 3QD2B 4KKEA 3RJCA 2JKQA 4CRSA 2VNWA 2XJ1A 4AZVA 1H27A 1JPAA 3F66A 3FSFA 5EW9A 3OWLA 2YDKA 5JFVA 1O6KA 5HESA 3GU5A 1VYZA 3E3PA 4G3FA 3UNKA 2OFVA 2I0VA 2PVJA 4ZIMA 4D4SA 5L2TA 3FSKA 4F9AA 5M09A 2GNJA 4HNFA 2P2HA 2HZNA 3OW4A 4YHJA 5CVHA 2E2BA 3CQEA 5J5TA 4FUYA 2BVAA 3UVPA 2W9ZB 3O2MA 4GL9A 3MSSA 1NVQA 2V22A 4ZTQA 4ZXTA 2IZUA 4S2ZA 2JC6A 3RPYA 4PMMA 3E8NA 5I9VA 2PMLX 2VAGA 5FDXA 1H1PA 4ACDA 1E9HA 3N51A 1RDQE 4GFGA 2QG5A 4KINA 3RK7A 3QTZA 3K3JA 4A07A 4WA9A 4I4EA 3GC7A 4E8AA 2ACXA 4CZTA 3QUEA 3LLAA 3BPRA 4EORA 3OEZA 3Q52A 2XEZA 4AZTA 1KWPA 4G9RA 2WHBA 5JT2A 4EHZA 3IG7A 3FUPA 5FRIA 3QALE 5J79A 5AJQA 4C4IA 3EJ1A 2X4FA 4FTJA 2RG5A 4D55A 4EQUA 4IB5A 4G6NA 2JITA 3IW4A 2OH0E 3MB7A 3ZTXA 2VWBA 3A8WA 2NP8A 2QR8A 4NTTA 2G2FA 4R3RA 5BVEA 3RAWA 4AQCA 4O82A 1U5RA 3HVCA 3DFAA 4MK0A 4IM3A 2BRBA 2ITVA 3QUDA 4CCBA 4DTAA 3VS6A 4O0SA 5M55A 3ZCLA 4FIEA 4ZLOA 5DN3A 5LVNA 1U59A 3E87A 2ITNA 2QOLA 2OFUA 4AA0A 2R7BA 2G1TA 3NMUF 3QZGA 4L43A 5FP6A 2VTPA 4GFMA 1QL6A 2EVAA 4ZS4A 3DKGA 2PVLA 2PVFA 3K54A 2B1PA 4U5JA 4XV3A 5BUJA 2W4JA 4AA4A 1O6YA 4QP8A 3G5DA 2Y4PA 4BCMA 4D58A 4ZK5A 4FTNA 4CMTA 3LFFA 3UO5A 3TIYA 1GIHA 1SYKA 4R3PA 4LMUA 3U54A 4UMPA 2R3JA 1AQ1A 3ANRA 1XBBA 1PJKA 4K33A 3SRVB 5EOBA 3DBFA 4GUEA 1DI9A 4BIEA 4BCJA 1TQMA 3EMGA 3JUHA 3ZFXA 4IFGA 2JFMA 4QPSA 4O83A 3UIMA 4EK4A 2WTKB 3F3UA 5L8JA 5EH0A 4IAZA 2GU8A 3R28A 4JOAA 1YOJA 4UV0A 2XCKA 4YC3A 1H07A 3QFVA 3BLRA 3QGWA 5BNJA 2W7XA 2AYPA 3MGYA 4BHZA 4IX6A 4EK8A 4XJ0A 2OW3A 2VNYA 2IPXA 4E5BA 3GU8A 3PLSA 4O0YA 5L2WA 3KU2A 4J98A 4RJ8A 3E62A 4EJ7A 1W8CA 3Q4TA 2JIVA 4M3QA 4R7IA 4NYEA 3UC4A 5AM7A 2VO7A 3QHRA 3ZUVA 3BV3A 4BB4A 1H1RA 2QQ7A 4QYEA 2ZMCA 4U8ZA 4BGQA 2HW6A 3L9LA 4CTCA 4NM3A 5DGZA 5JMSA 3Q6UA 4O22A 3C51A 2VGPA 4HW7A 4E7WA 3QKKA 4ZZMA 3I79A 5B0XA 4N70A 5DMZA 1QCFA 4RZWA 1ZXEA 4O0RA 4KBKA 3EN4A 2YAKA 4L7SA 2FB8A 4L67A 3ZLXA 3QQKA 1ND4A 1Q8YA 2RFDA 2HCKA 5DR2A 4QMPA 3ZRKA 5EKNA 2E9VA 3Q9YA 4GYIA 4DG2E 1VYWA 3NYVA 2QD9A 5M56A 3KVXA 4G34A 4JI9A 5M51A 2HWPA 3VUTA 5BUEA 4FV3A 4XG8A 3GGFA 4F09A 2PHKA 5HBHA 1GJOA 3SOAA 4FTAA 2W5AA 4NCTC 4DBNA 5AUVA 5TOZA 2WO6A 3V6RA 2Y4IB 2XBJA 3TXOA 5EM7A 3LCSA 3S00A 5EQPA 4C58A 2J51A 4EJNA 2F7XE 4BZDA 2JDTA 3RZBA 1JKSA 4OBOA 4I3ZA 2XNMA 3G9NA 4DITA 2OGVA 5ETAA 2C6EA 1WBWA 3ORTA 4EYJA 2G01A 3QF9A 5EI2A 4JBPA 4F9YA 4U3YA 3FY0A 4GU9A 4RJ3A 2X2MA 3ULIA 3C4ZA 3KB7A 2BRNA 3NEWA 3OXTA 4ITHA 4JR3A 4XCUA 3R8MA 4B4LA 3HMNA 4QNYA 4C8BA 3SGCA 2VWWA 1T45A 5HG8A 1YDRE 5DG5A 2PZYA 4RIOA 4YP8A 3H10A 2JFLA 2I40A 5H3QA 4YTIA 1K3AA 4K6ZA 5DA3A 3BHHA 3A7JA 5HD4A 3DXNA 1QPJA 5CU2A 1JNKA 4IWOA 4D1ZA 4L3PA 4OTQA 1V0PA 5ANIA 3QQFA 4LMNA 3PP1A 3D2IA 2UZVA 5E9EA 2X39A 3DY7A 4C33A 2XKFA 4EZ3A 2X7FA 3TUDA 2BAJA 3TNIA 4F4PA 5IQGA 2C5XA 4OTGA 3DZQA 4F7NA 5DH3A 2C6TA 2WU6A 2XIXA 5IA3A 5A4CA 3OXZA 3FQHA 1G3NA 1UU7A 4PMTA 5FWKK 2XRWA 3TNWA 4HZRA 3QWJA 1YI3A 3MVMA 3PE2A 4G3GA 4JG7A 4C34A 1H1QA 4PTEA 3VBWA 3ENMA 3TKUA 2GNIA 4FV6A 4BCHA 1U4DA 4YJQA 3BEGA 3RHKA 4EOJA 3VRYA 3MVLA 1X8BA 5JZJA 4HGSA 3D5WA 3JY0A 4XG4A 4DFYA 4FIGA 2W1EA 4LV8A 1WCCA 2OXYA 3Q9XA 3LQ8A 1OB3A 2WMXA 4ZSGA 3POZA 3ZS5A 4DH7A 5LMBA 3OG7A 4IWDA 3ETAA 4EEVA 1KUTA 1PXOA 3PZEA 4BKZA 5IQEA 3R01A 2V5QA 2A27A 3CGOA 1URWA 3GU7A 1JKKA 2J7TA 4KSPA 3VHKA 3O8PA 2WEVA 3PY0A 4D0WA 4L7FA 3Q60A 4DEBA 4TYJA 4RIXA 2JDOA 5AIRA 3WE4A 4PUZA 1KV2A 3ALOA 2C6IA 3UG1A 4DT9A 5IQCA 5IQHA 3FLWA 5ITAA 3DKCA 2GTMA 3HMMA 3BU6A 3PDTA 3BHYA 3C0HA 2QLUA 4OAUC 3BZ3A 3PRIA 2J2IB 4GVAA 4OLIA 3V6SA 2RG6A 4FG9A 3ZRLA 2YHVA 4UN0C 4CKRA 5C8MA 2BHHA 2Y6MA 3DBQA 3ZC5A 3FMNA 2FA2A 3Q4CA 3GC9A 2O2UA 2ITWA 3W2PA 3SX9A 1GIJA 3V8TA 5KCVA 4R3CA 3G6HA 3ZEPA 1APME 1H1WA 5EHOA 3O7LB 5A6NA 3NCZA 5CSWA 4YJOA 4FTUA 2F7ZE 4LOPA 4OTDA 4FKLA 4YNOA 5L6PA 2OF2A 4CV8A 4XBRA 3RTPA 4TNBA 4Z16A 3C0IA 3V5TA 5I9ZA 4AXAA 2BKZA 5I9WA 4JXFA 4FKGA 4WNPA 4EZ7A 3COIA 3KMUA 4CMOA 1JKLA 3EN7A 4W9XA 2XS0A 4YTFA 4U42A 4JBQA 4QMQA 5FTOA 5B2LA 4GK3A 2R3FA 5L2IA 2C30A 4O6EA 2WTCA 1Q41A 2QOQA 4IB0A 3OCGA 4JL9A 5KZ0A 2UZEA 2OICA 3ORNA 3PWYA 2HENA 4JG8A 4QP2A 4QPMA 4RT7A 5HEZA 3PVGA 1QPCA 3U4WA 2I0EA 1IASA 2BDFA 2JLDA 4YC8A 4KKGA 4JAIA 4Z7HA 4E6CA 5D1JA 3TV6A 3QC9A 4CFUA 5CAVA 2E9NA 4HVHA 3H9RA 3OCSA 3L8PA 3RAIA 3FXZA 4FT5A 5HX6A 1MRVA 3EQRA 4CQGA 1IRKA 3AGMA 1H08A 3AC3A 3Q9WA 4JVGA 1H26A 3GEQA 4XBUA 4EONA 3QTWA 4LG4A 1Q99A 5LWNA 1PRYA 4DAWA 2OI4X 3MFSA 3KXGA 5FP5A 4BCGA 2R3PA 5E90A 4TNDA 5KX8A 1XH6A 3DZOA 3PG1A 3VUDA 5T6KA 4WUNA 4YZCA 1J91A 2OJFE 3W33A 4V04A 3RNIA 5HG5A 3S3IA 4BCNA 5E1SA 4I5HA 5H8BA 3FMMA 2H9VA 5I3OA 3ZLWA 5KMJA 3NUYA 3UBDA 5I9XA 4U79A 1Q24A 3JVSA 4IZYA 2QO9A 5AP7A 2WMRA 3VBXA 4L6QA 4E6QA 3QQUA 4BDDA 2OLCA 4O1PA 4AZWA 3VJNA 3SKCA 1FVTA 4C57A 3UTOA 4R1YA 3VUGA 3C5UA 2ONLA 5CNOA 3BYSA 4E4NA 5GZ8A 1H24A 2J5EA 3H4JA 3KXNA 4FNZA 3R00A 3VQHA 4GSBA 4CT2A 2YLEA 3UP2A 4ONAA 3HA6A 1FGKA 2QCSA 5L8LA 3DT1A 5FXQA 3QD0A 2CNUA 3NRMA 2QONA 2PYWA 2WMBA 3BLQA 1HCKA 3QBNA 4LL0A 4LL5A 4USFA 1QPEA 4ZP5A 3RGFA 2YLFA 3MFRA 4U45A 2YCFA 4U44A 1BX6A 4FKQA 5BMMA 3MI9A 4L44A 3R9DA 5J1WA 3WF6A 3UIXA 1XJDA 2BALA 2X81A 3F9NA 2X8EA 3DV3A 5GNKA 3LFNA 3QUPA 2GHGA 3DB6A 2O63A 3ORLA 5ETCA 3RPOA 1H00A 3ZFMA 4DC2A 5LMKA 5E8YA 3H30A 4QMSA 1GOLA 4ASEA 2HW7A 4QMLA 3FMJA 4HVSA 2YAAA 4FSZA 4I6QA 2DS1A 2OZOA 3DS6A 3LFQA 4PF4A 5BVKA 3VQUA 4HYUA 4CMUA 1EH4A 2WMSA 3QQHA 3AMYA 4FEUA 2JIIA 5CENA 1ZWSA 4GVJA 5TR6A 1PXMA 5IMEA 4FE2A 1REJA 4AX8A 2EXMA 3S0OA 1Q8UA 3BHVA 1WBVA 1PY5A 5C8NA 5CSVA 2GPHA 5EDQA 5C8KA 4AG8A 3UGCA 5CSPA 3OMVA 3KGAA 3MY5A 5HIEA 5D9HA 4WG3A 4F64A 4FOBA 4E26A 3UPZA 3EOCA 4JT3A 3LXKA 2EWAA 3OT3A 5H2UA 4JX3A 3RM7A 4CFMA 1XH9A 3JS2A 3OCBA 4FYNA 4S34A 3THBA 2OJ9A 2R3HA 3IDPA 3MV5A 4YHFA 3SXRA 4O0WA 5CSXA 3IQ7A 4H3QA 2YIRA 4G3EA 3K5VA 5ACBC 3AMAA 1PXNA 4F6SA 3VUKA
chains in the Genus database with same CATH superfamily
2GMXA 2Z7RA 1LP4A 3RM6A 4KS7A 1DAYA 2ZFYA 3DK7A 3CR0A 5M07A 2ZV9A 2ITUA 5FBNC 3QA0A 2WTWA 3T9IA 1Y91A 1WVYA 4HCVA 4I22A 4S33A 2F7EE 3BRBA 3QA8A 4XOYA 5HLPA 2QG7A 4B8LA 3GXLA 5GHVA 3T3VA 3ZUUA 3LOKA 3GVUA 4W4XA 1VLRA 3IS5A 4ERKA 1FBNA 2V7AA 1ZOGA 4ANOA 5EM8A 3PJCA 1Z5MA 3FMLA 3O17A 4FG8A 3U8WA 2YM4A 4XRLA 5EKOA 3V5JA 3TDWA 3NX8A 3NR9A 3SAYA 4BZOA 3F5GA 5AV4A 5BYLA 4WNMA 4V0GA 5BMSA 1NA7A 3F5XA 3DB8A 4WD5A 4O86A 4NTSA 4C7TA 3NDMA 1XWSA 5AP6A 3SG8A 2ITPA 3EFKA 3HZTA 3W32A 4BWPA 3FMDA 4J97A 4BTFA 2XAOA 3F2RA 2CGWA 2EB2A 3QU0A 1ZYJA 3B2TA 1P4FA 4DEIA 2GCDA 4G16A 5J8IA 4TWCA 1PMNA 3SXSA 3PXQA 4I6BA 4C4GA 4CFWA 2CGUA 3KY2A 3U6HA 4N6ZA 4F9CA 4BIDA 1UU3A 4P2KA 4KRCA 1YXSA 4RIXB 3G6GA 4JBOA 4RLLA 5FM3A 4AACA 4JX7A 4XP0A 3KEXA 4LGDA 3QTIA 5AP2A 3RKBA 3UDZA 2UW0A 4C4FA 5K5NA 3OOGA 1FVVA 2OIQA 1JWHA 1IEPA 3TG1A 3UVRA 1HOWA 1Q3WA 3UYTA 3ZH8A 4LFIA 4XG7A 1XH8A 2YIWA 4PDOA 4XG9A 2PMNX 4B7TA 3MVHA 2PY3A 4AW2A 3NS9A 4UMQA 1KE9A 5CALA 2O64A 1OL1A 3C50A 4O27B 4Q2AA 2XIRA 2IW8A 3GFWA 2X9FA 3KN6A 4J8NA 2B55A 4TZRA 4W4VA 4BZNA 4L46A 5EDRA 2J0IA 2OJGA 3OFMA 4K9YA 4L53A 4ZTNA 2BR1A 1U46A 3EFLA 5F20A 4C62A 3A99A 4D2RA 4H58A 4A4OA 2A1AB 3R7YA 3EN5A 3QQJA 1KV1A 4AZEA 3D9VA 2GHMA 4I0RA 5IZFA 3LQ3A 4FGRA 3H9OA 1JSTA 3FE3A 4XYFA 4OUCA 5HG9A 1J7IA 4UZHA 1P2AA 2VU3A 2B9FA 4CTBA 4Z3VA 4XEYA 4IM0A 2JAVA 5J87A 3UP7A 1WVXA 3W0PA 2UW8A 3AOXA 4BI2A 1JKTA 4RFZA 5KKRC 4MUQA 2ZM4A 4I20A 4IB3A 4YSMA 4EYMA 4O2PA 2W99B 3Q5ZA 4R6VA 4XG2A 1Y8GA 5FTQA 3F3TA 1LUFA 2WOTA 4AGDA 3FQSA 3P7AA 5FGKA 3VUMA 2AC3A 2ZDUA 3EQFA 2J0LA 3FPMA 4FVRA 4EH3A 3BWJA 3NUAA 4F6UA 5CI7A 4FT7A 4O81A 1H28A 3NZ0A 3FKNA 4IDTA 4DEHA 2CKQA 2H34A 2DWBA 2JDRA 4RWIA 2W1DA 5CF6A 2VTJA 4YLLA 3ZUTA 2P55A 3PIYA 4IZ5A 4TKSA 5EW3A 3FL5A 4FR4A 4TYIA 2WMTA 3LFCA 3FI2A 4EH9A 3AD6A 2WTVA 3VBQA 3LFSA 4KIPA 4J52A 1O9UA 3DDQA 3KXZA 4ACCA 2QU6A 3G2FA 3BYUA 3S4QA 5BYZA 4QMMA 3KRXA 4RIYA 2SRCA 3FXXA 2UZOA 2F2CB 4AGWA 4BCIA 4TWPA 3SC1A 2UW3A 4MQ2A 2OF4A 5C1QB 3AQVA 3NNVA 3PFYA 1VZOA 3OHTA 4W9WA 4AN9A 2BDJA 3LM0A 2PUIA 4DDIA 4DT8A 3ZO1A 4F0IA 2XIKA 5JH6A 4O0XA 3DCVA 3HRCA 5HCZA 3DOGA 2LAVA 3WILA 4BCPA 4RIWB 4PDSA 4I21A 3MDYA 1IA9A 4M67A 4QMWA 3EQIA 3O23A 1SMHA 3MH3A 2QKWB 3KC3A 2JBOA 3GT8A 4LRKA 3IK3A 3G0EA 2WELA 4FVQA 4UBAA 1ZRZA 3WF9A 4RWKA 4UX9A 1S9IA 2WQMA 3UMWA 4DGLC 4KWPA 3WI6A 5JKGA 1Q8WA 4HNIA 1YHWA 5DT4A 3RP9A 4W4YA 2F2UA 3D7ZA 2C0OA 4BN1A 4EOKA 5JFWA 2UW5A 3MBLA 4KRDA 4L00A 5DEYA 1OBDA 1JSVA 3ERKA 4RPVA 2C3JA 1FGIA 5CT7A 5M44A 2C5VA 2FVDA 3G15A 4Q9ZA 5CF5A 3KULA 5AX3A 4HCTA 4E1ZA 2QOBA 2X8IA 5KBQA 3BKBA 4EQCA 3KIOC 3PVBA 4KD1A 5DVRA 2J4ZA 2E9UA 3V8WA 5IH5A 4YBJA 2R64A 4E3CA 4ANQA 5LVLA 3LCDA 2DYLA 3LXPA 3HRFA 4FEQA 4DE4A 2CHLA 3DTWA 3MH1A 3QYZA 4F9BA 4PX6A 3TWJA 5KO1A 4FKUA 4XV1A 3C5IA 4QQJA 4NJDA 4WKQA 3G9LX 2OSCA 4D1XA 2LGCA 4GUBA 3MH2A 5LWMA 4FTIA 5EYCA 4KUJA 5C01A 4HVIA 2PK9A 4ITJA 2QC6A 1OPKA 3NPCA 4UALA 3TV7A 5HTIA 5C4KA 1SVGA 2PMOX 4I41A 1S9JA 1ZMWA 2UVZA 3LXNA 3UODA 4EOOA 2XJ2A 2ITQA 3R8UA 4CT1A 3AT4A 5EI6A 2CJMA 1REKA 4A9RA 5IEYA 4G5PA 2F4JA 5HGIA 2QU5A 3BE9A 3KMWA 2BTRA 4QO9A 4S31A 3PIZA 3T8OA 3L8VA 3NIZA 4FTQA 2ZVAA 2XK9A 2HYYA 3FHIA 3NFFB 1PMVA 2IF8A 4FSQA 3R21A 3ZO3A 5IKWA 1JSUA 1OKWA 2VRXA 3DU8A 2PVHA 4YJNA 2ZOQA 4YPSA 2YABA 4A9SA 4IXPA 4QMXA 2R3GA 1DI8A 1BI7A 2BDWA 4DH8A 5I9UA 3DK3A 4BJJA 4MAOA 2XJ0A 3AC2A 3EIDA 4EOQA 3PXZA 4V0GB 3TNQB 4AOTA 4F7SA 5JSMA 4EK3A 1ZMUA 1RE8A 3PPJA 3QRTA 5T3QA 3F5UA 4Q5HA 4ERWA 5KMLA 3ZSHA 4F78A 1TQIA 4DA5A 3MVJA 3HYHA 3U6JA 3FYJX 4GFOA 4X3JA 3UQFA 3TDVA 5HO6A 2O5KA 3PXRA 4LRMA 3QKLA 4FZ7A 4O2ZA 4JBVA 2UZWE 4BCFA 1G8KA 4FMQA 1R3CA 4APPA 4M12A 3GP0A 4F65A 5CQUA 3AKJA 4QTCA 3O5AA 3W8QA 4D1SA 4TXCA 2CN8A 4FV7A 3CC6A 3BWFA 2WQOA 3O71A 4L3JA 4HCUA 4OTPA 4YC6A 4DHFA 5A14A 4CVAA 3PSCA 3U6IA 2GQSA 4DG0E 3ZXTA 4E6AA 4JDHA 3SXFA 1SZMA 3DJ6A 2VWUA 4DCAA 2FUMA 2H6DA 4C59A 4ARKA 4PQNA 5GZAA 4C3RA 4IX5A 2CGXA 3TL8A 4O96A 4UMUA 3R8ZA 2EU9A 5AM6A 2X2KA 4JNWA 5HNBA 3FI3A 3ZBXA 1OL7A 4X3FC 3L9MA 3G51A 3R9RA 4FG7A 3EFJA 4UYAA 4D4VA 2OK1A 4ANBA 4RWJA 2BILB 3D7TA 3L1SA 4I6HA 1F0QA 4IZAA 4KIKA 3PXYA 2B4SB 4J53A 3BGPA 4YJTA 1ST0A 1B38A 3F7WA 3RK9A 4U97A 3GOKA 5F9EA 2CMWA 2CPKE 4ID7A 4IVAA 3QRJA 4UZDA 4ZTHA 3TI1A 1YKRA 2FH9A 4W8DA 4DTBA 3ZONA 3F5PA 4PV0A 3JY9A 4ACMA 4IAKA 2R4BA 5TT7A 2UZBA 3FI4A 1M2PA 2XH5A 1XBAA 3WZJA 2B7AA 1CSNA 1QPDA 1F3MC 2J0JA 4O84A 2CLQA 2VGOA 3HV5A 4WHZA 4K77A 2QHMA 3UYSA 4L8MA 4O1OA 5CY3A 2OIBA 4CKIA 1ZMVA 4PNIA 3GCUA 5AUWA 1OVEA 4DFLA 5HNIX 3CJFA 3I0OA 4DGMA 3POOA 2XYNA 1OPJA 4M13A 4X21A 4YU2A 3RK5A 5AUUA 1Q3DA 4FZAB 3VIDA 3UOJA 2OH4A 2OWBA 4XP3A 3PPZA 3DDPA 3R30A 4XLVA 5M4FA 2NNWB 4J7BA 4L01A 3K2LA 4MVFA 4DGNA 2CNQA 2ZM1A 4WRSA 4IIRA 4EZ5A 2REIA 2X2LA 3Q32A 3RHXA 5DNRA 1R78A 1STCE 4QP6A 3UNZA 4FSMA 4QP9A 4FI1A 3PA3A 4U40A 4UEUA 4N57A 3CTHA 5HE0A 2VN9A 5ANDA 3MY0A 1G8SA 3LVPA 3ZMMA 3A7IA 4RIYB 5AR4A 3HMOA 1Q8TA 5AADA 1E1VA 4FKVA 1W82A 3QZIA 4R5YA 3ORPA 4GG5A 3RPSA 3FC1X 1PF8A 1XHAA 3R1NA 4IAAA 4HPUE 4WO5A 3ZC6A 2V7OA 3NVKI 5D7AA 3LQ5A 4XG3A 3H3CA 4IADA 2IVVA 2JGZA 2UVYA 2VWXA 2UV2A 3A62A 4A9UA 1MQ4A 2GNGA 3JXWA 2PSQA 2CGVA 2B54A 3MPMA 5F1ZA 2XARA 4YR8A 5LXMA 3SOCA 2W1FA 2WD1A 3LJ0A 4O4DA 1L8TA 2YJSA 4M69A 3FLNC 3I0QA 1BLXA 4ZOGA 3DBCA 4FC0A 4DH5A 5CEIA 3KK9A 5GIOE 3BU5A 4M68A 4F70A 1OL6A 3ZO4A 3AC4A 4PP9A 1L3RE 3A7FA 4RA4A 4ZY6A 4N6YA 1YDSE 3OY1A 2VTTA 4KS8A 5KHWA 2PPQA 3QTRA 3E64A 3A4OX 1BL6A 3KXMA 3QTQA 1SNXA 4GG7A 2XNNA 4C37A 5LVPA 2I7QA 4EH4A 4I94A 1UKIA 4APCA 2GQGA 1YI4A 3KN5A 1OZ1A 4I0TA 2WMWA 4AU8A 1ZZ2A 2ETRA 4QYHA 2XVDA 4AS0A 3FZTA 5EM6A 3S95A 3OOMA 5K4JA 3KULB 2YITA 4P5ZA 3OEFX 4UYNA 5H8GA 3RAKA 2CNVA 3AKLA 5IUGA 4O7SA 4YJUA 3IW8A 1YHSA 3NUPA 3E8EA 1OL5A 2W1HA 4RG0A 4FZFB 2QOKA 1UNGA 1UNLA 2HXLA 2R3MA 5EK7A 4Z7GA 5J9LA 5CNNA 1IAJA 5CSHA 4ZJVA 2V0DA 3EZRA 3EZVA 3W16A 2QLQA 4WBOA 2X4ZA 2PZIA 4FSWA 3ZM4A 1LPUA 5DOSA 3OP5A 1GY3A 3LE6A 3EQBA 4FSUA 4FTOA 2GNHA 4RGJA 5FEEA 3UDSA 4YLKA 2JDVA 3E63A 1MQBA 2R5TA 4MXOA 4NCTA 2JKKA 4H36A 1OKVA 3CP9A 1IA8A 2Q0NA 3PZHA 4G2FA 3WARA 3PTGA 4BTKA 4BWXA 4DEDA 4FEWA 4FL2A 2QKRA 2RGPA 2P2IA 4IAFA 4TYEA 3NYXA 1MRYA 2UUEA 2YIYA 3M42A 4FV9A 4XS2A 3L8SA 3W2QA 5KMMA 3FL4A 4O4EA 5G1XA 3RBWA 5BYYA 1NVSA 1PXPA 3HV3A 3W8LA 5DYJA 2UZUE 5AV1A 4JIKA 3KRJA 3BYMA 5CAOA 1KE6A 2Y6OA 5IH4A 3FBVA 4D5HA 5F4NA 4PNKA 5CAPA 3SA0A 5CX9A 5G6VA 3EQPA 3VRZA 3ZFYA 3PRFA 3PIXA 3P5JC 3V01A 5HBJA 2BTSA 2KULA 3E92A 1I44A 1GIIA 4S30A 2OO8X 5M53A 3EN6A 4E5WA 5K4IA 2XK7A 3UOKA 5CEOA 4BJJB 3BYOA 3OW3A 3FYKX 3LHJA 3N4VA 2W17A 2OZAA 3NAXA 4NFMA 2QI8A 2PVMA 5FEDA 5HVKA 1OM1A 5AV3A 3SVVA 3DK6A 4NM7A 3TIZA 3ZDUA 5ANOA 4ZY5A 1OL2A 4A4XA 4BBFA 4LV5A 1J1BA 4CZUA 5HCYA 3FKLA 4IJ9A 3ZXZA 4C38A 5BVNA 3GC0A 2A2AA 4QTDA 3PJ8A 2AUHA 2QO2A 4YJPA 3EL8A 1PW2A 5KE0A 2PE1A 1JAMA 3W10A 4FKIA 4BKYA 2X0GA 2IO6A 4Y5QA 5A4TA 5K9IA 2RFSA 4CFVA 5CEMA 5JZNA 4O7YA 3R7EA 4DN5A 2XK4A 2XIYA 3EHAA 4LRJA 1FOTA 2PZPA 4LUDA 4NW5A 5CU6A 4FK3A 4U6RA 4WIHA 4G6LA 1SVEA 5AAGA 4AT5A 3QLGA 1KE8A 4ANLA 2PVKA 3F3WA 4LGGA 4C02A 4RJ5A 4QMYA 3II5A 4C36A 2FSLX 3KKVA 4PP7A 3PVWA 4JAJA 1CM8A 4QMZA 1BMKA 5AAEA 4QYGA 3QQLA 1YWRA 5CF4A 2NRYA 2RL5A 3PG3A 5A4EA 2VO0A 3OVVA 2R3IA 3SG9A 2IZSA 5B2MA 5F95A 2BIYA 1YQJA 5M08A 4MBJA 4HPTE 4IAYA 2NPQA 5IF1A 3PPKA 2PVRA 4U80A 1TVOA 2R3LA 5CAQA 4EK5A 3UZTA 5KNJA 4O91A 3VS4A 5J9YA 3ZBFA 1R1WA 2P0CA 3O50A 5HO8A 4P4CA 4CSVA 2R2PA 3TUCA 1PMEA 3GUBA 3NNUA 4NIFA 4K2RA 3QX2A 2VTIA 2VTRA 1ATPE 3FZOA 2OKRA 4MXAA 4DTKA 1WFCA 3DQXA 4PTGA 5ANJA 2I1MA 5E8UA 4EKKA 3R0TA 2VTNA 4NZWB 2BMCA 2C1BA 3CS9A 2G2IA 1W0XC 1YWNA 4Q5EA 5D41A 5D10A 4XV2A 5E8SA 2F49A 2JBPA 2HZ0A 2YM7A 5E7RA 5JQ5A 3TT0A 3JR1A 2VTSA 1M2QA 2FYSA 2VUWA 4HZSA 2OBJA 5EYKA 1ZY5A 3VF8A 4LOQA 3OWJA 3TKIA 4KB8A 1GZ8A 1WBPA 1LEZA 4G17A 4UXLA 3IGOA 4N4SA 3GNIB 2OJJA 3OTVA 3DFCB 4FBXA 3TJDA 3ML1A 4FTCA 3DLSA 1MUOA 1PMUA 2XMYA 4TWOA 2X7GA 4N0SA 4DGOA 4M8TA 2I0YA 3Q2JA 3JPVA 4MD8E 5AR8A 5FG8A 1Q97A 5D11A 4DBXA 5IQDA 5M06A 2VTLA 4R78A 3CGFA 2I6LA 3R71A 2C0IA 2XANA 3CY2A 5FQDC 5JGDA 2WTDA 3NYOA 3TM0A 1NW1A 3KA0A 1FMOE 2W05A 4NU1A 4M14A 4BDGA 5HZNA 3EH9A 4JRVA 3ITZA 4G3DA 4DG3E 4DFZE 4DHJA 3VHEA 2VZ6A 4IDVA 4IJPA 3DAKA 3NYNA 4DLIA 1A9UA 2ZV8A 3C7QA 5CEQA 4I5CA 2GS2A 3KFAA 5I3RA 1TZDA 5EOLA 1FQ1B 4I93A 2QR7A 4IB1A 4PWNA 3W18A 3ZLSA 5EM5A 5IPJA 5ANEA 4O7VA 5ANKA 2Q83A 3QTSA 3VUIA 3P7BA 3MFUA 3I5ZA 1J7UA 1YXUA 2ZM3A 4BCQA 1XKKA 2HY81 4HYIA 5DBXA 4QEBA 4FT3A 3EKNA 4XNEA 4L42A 4RQKA 4XX9A 5EG3A 5E4HA 4O38A 4FSYA 4IFCA 3F88A 5J95A 4MXYA 5I0BA 2WB8A 4GCJA 2C6OA 1A48A 3F6XA 1K9AA 4BWKA 4D9TA 4I23A 3V5WA 2A0CX 3KCKA 4BBMA 2V62A 4RC4A 3CXWA 3ACKA 1V1KA 3ACJA 4DHZA 5IEVA 5A46A 4MWIA 3Q5IA 3CIKA 3ORKA 2UW4A 5ICPA 3NIEA 2W1CA 1ZYLA 2OXXA 4ZTSA 1A06A 2HXQA 3ODYX 3MB6A 2ZV2A 4GKHA 5BVFA 4FTMA 4AXFA 4TY1A 3E7OA 2XNBA 4AN3A 3WZDA 2XM8A 4MXXA 3PSDA 4O4FA 5HO7A 3M1SA 4B8MA 2BZJA 4F99A 5GJDA 4FV5A 5L3AA 3QTUA 5JK3A 3VBTA 4R8QA 3UIBA 4O21A 1FMKA 3ELJA 4CLIA 4OTHA 3QC4A 4Y73A 3HDMA 1ZOHA 3LMGA 4HYSA 4W4WA 3O0GA 1PXKA 4IH8A 3T9TA 5IUHA 4XMOA 4ALUA 2C68A 3FLSA 2XNPA 4WT6A 3ZZEA 3R7VA 2YCQA 1Q5KA 3EB0A 3PVUA 4YMJA 5IQBA 2P3GX 2W5HA 3ORXA 3ZZWA 3R1YA 3ORMA 2W1ZA 5IQFA 3KXHA 4AE6A 2ZB0A 5AAFA 2BKKA 4U7ZA 4YZBA 2J6MA 4FSTA 3HKOA 3NUXA 4RVLA 5E8TA 4CFFA 4H3PA 2DQ7X 1WBOA 3RCJA 3W1FA 4PPCA 1Q62A 2WTJA 4Q9SA 2C47A 3GQLA 5JFSA 5HTBA 4I5PA 3RMFA 3UJGA 3E5AA 4EBWA 2JAMA 2OZAB 3PLAE 2RFEA 3MS9A 4IVCA 3ODZX 2R0IA 2HZ4A 4GT4A 3HDNA 4NSTA 4GMYA 3E3BX 3ZM9A 4FZDB 3SLSA 3VVHA 1O6LA 4XUFA 5KZIA 3F82A 4RVKA 2YDIA 4ITIA 3ZOSA 4BRXA 4D2TA 1JBPE 4DCEA 2JKOA 3VO3A 3E93A 4YZMA 5CANA 3CLYA 2UZLA 3OBJA 2AC5A 4E93A 2XK6A 2E9OA 3LMIA 4GJ3A 2PL0A 5E8XA 4EHGA 3FXWA 2V55A 3RWPA 3D2KA 5AR2A 3C4XA 2XNEA 2WQNA 3LZBA 3IW7A 3I5NA 4FVPA 4CZYB 2XK8A 3V04A 3WYYA 4ANSA 4DFNA 2CKOA 4JLCA 2NYAA 2BRHA 1OPLA 4C4EA 3D94A 5AR5A 5HICA 3VS2A 2WTKC 2WIPA 5M57A 5CF8A 4BICA 2X9EA 3DPKA 3C4FA 2YA9A 4QYYA 5HTCA 3DAJA 2IVTA 4CNHA 2X0PA 4Y5HA 1ZZLA 2BROA 3BLHA 4Z9LA 2Z7QA 1YVJA 4UMTA 3BGZA 3QTXA 5J7HA 4EUUA 3HV6A 2XA4A 5LOHA 2R3OA 4A06A 4FYOA 3R2YA 3QRKA 3DKOA 4KIOA 3R9HA 3LMHA 3TMOA 2BRGA 4MX9A 1FVRA 4O7RA 3D5UA 4G6OA 4F0GA 5AUTA 4D2SA 4UWCA 4RC2A 3MIAA 5AA9A 5IA2A 5AMNA 2PE2A 4AFEA 4X0MA 3DQWA 3EQDA 3E7VA 3NUSA 4EI4A 3SQQA 4O7ZA 3TV4A 4DEAA 2C69A 4GJ2A 5GJFA 5DHJA 3VF9A 3UE4A 4CFNA 2C4GA 4ANNA 3SHEA 2E9PA 5AUZA 4GYGA 4J71A 4RFMA 4NIFB 3WF7A 4QDVA 1NVRA 5KBRA 2PTKA 3AT2A 5BVDA 4R7BA 3WZUA 2YM8A 4ALWA 4FKWA 4BFMA 1UNHA 1UWHA 3F3VA 2VV9A 4BBEA 5C27A 2PU8A 2WNTA 3DAEA 4G31A 3SRVA 4AZFA 5CXZA 2YACA 4IQ6A 4BYJA 4QMNA 2R9SA 3AC5A 3ZSGA 5AR7A 2Y8OA 1KOAA 4HGLA 4P7EA 3TEIA 3UNJA 3HMIA 4BTMA 4RA5A 3BEAA 2XB7A 4IZ7A 4XLIA 2XIZA 4QOXA 4E4XA 3RPVA 5DRDA 1PKGA 4RJ6A 2EXEA 2XUUA 4TYGA 4AP7A 2Y4IC 2IWIA 2NRUA 4LYNA 4DINA 5BQ0A 2QOFA 3KRLA 3FZPA 4TWNA 1CKPA 1BUHA 1OMWA 2CCHA 5TO8A 3KF7A 3MIYA 3PWDA 4C4HA 3B8QA 4EOSA 4MBLA 2PZRA 3QL8A 5IA1A 5IA0A 5IU2A 4IMYA 4O0TA 5DR6A 1OITA 1OUYA 1ZY4A 4QD6A 5B7VA 2ZV7A 3FLQA 2YISA 3DXPA 2X8DA 5L4QA 3DJ7A 4J95A 4BR3A 5JEBA 5CXHA 4QTEA 4FT0A 2OJIA 4ZJJA 1RW8A 3MPTA 4ALVA 4PMPA 4O7LA 3FMEA 4FV1A 4CV9A 2HELA 3MYGA 5AV2A 2XNGA 2J0MB 3E88A 4RBLA 4IE9A 3H0ZA 3AC1A 4TL0A 3OTUA 1DS5A 1WBSA 2ZAZA 4ZSAA 2GDOA 3GCSA 3CPCA 2PMIA 5A3XA 1UWJA 4USEA 3R6XA 1OIRA 2UW7A 1W84A 3BGQA 4NKSA 5HBEA 4A7CA 5HX8A 3ZEWA 1YWVA 4JDJA 2OG8A 3R7OA 3LCOA 4OAVB 4QT1A 2ITTA 2IEWA 5IG1A 5GZ9A 3ROYA 2W1GA 5KMKA 5B2KA 1P14A 4FIJA 4QPAA 3I60A 2VTMA 4B99A 3SV0A 1GZNA 1J7LA 2W4OA 4KBCA 4RZVA 3QZHA 2IW9A 3CTJA 4R5SA 1M7QA 2QOIA 3D0EA 5M4UA 4WG4A 2YEXA 3GQIA 1G8AA 4FV8A 3MWUA 4YLJA 4ZS0A 4CG9A 2FO0A 1DM2A 3QQGA 3Q4UA 4OTWA 4H1JA 3I1AA 3W2SA 3LJ1A 3WZEA 1CDKA 5A4QA 2YZLA 3U55A 3W2RA 4JR7A 5CU4A 2G15A 5CAUA 3R73A 4MXCA 4QP4A 3IOKA 4WNKA 3DBDA 3HEGA 3NW6A 2YN8A 3BHUA 4QMTA 3ID6C 3TZ9A 3IGGA 4PY1A 4AXDA 3ENHA 4FIFA 4EOMA 2BIKB 2PVYA 5AP1A 3FDNA 3RCDA 3WYXA 1ZYDA 3I6WA 4PL4A 4BDKA 4ZMEA 5AR3A 5JQ8A 2J0KA 1NT2A 2XKEA 4M0ZA 1SVHA 3CSVA 4FV4A 3D83A 4PPAA 2J50A 2R3QA 2YIXA 3ANQA 4KA3A 2WMUA 3GC8A 2RSVA 5BX0A 1BKXA 1ZLTA 3A61A 5CVGA 5EI8A 4HOKA 1RJBA 2W06A 3PE1A 4UXQA 2OXDA 4L45A 4WRGA 3EQGA 2ZMDA 4NM0A 5AFVA 3K3IA 4ZTLA 5M4CA 1G5SA 3LM5A 2VTHA 2O65A 4CYJA 1LR4A 1IR3A 2EUFB 3EQCA 5DI1A 4HVDA 1WZYA 5EQYA 2XKCA 3W55A 1H1SA 5C4LA 3TN8A 5AP0A 3R9OA 3BYVA 4XH6A 2WQEA 3FEGA 2BUJA 1GNGA 2R3KA 2C5YA 3NCGA 4IBMA 4YJRA 4O7WA 4NK9A 3TZ7A 4TRLA 3SD0A 4B9DA 3DNDA 2IVUA 4EBVA 5LMAA 3PA4A 4XG6A 4V01A 4EQMA 4E5AX 4V05A 4ENYA 2W96B 3HECA 4AE9A 2CCIA 5AV0A 1FINA 1PXJA 3PFQA 4F08A 4I5MA 3MA6A 2VWVA 4FNXA 3HP5A 3V51A 3EFWA 3COKA 3R63A 3UQCA 3MN3A 3KCFA 2VWIA 1W7HA 3IONA 4RMZA 3OZ6A 5FXSA 5HIBA 3VBVA 4ZJIA 1JOWB 3BCEA 4H1MA 2WIHA 1WBNA 2Z02A 3P86A 2IVSA 2ERKA 4DYMA 4HGTA 2F9GA 3R02A 4RFYA 3RZFA 4FKSA 4PRJA 1PYEA 4ZZNA 1SNUA 1ZYSA 3ROCA 3KREA 4ZLZA 4OTFA 4FIHA 3EQHA 3AD4A 4DFXE 1TQPA 2C5OA 3VAPA 4BIBA 2R3NA 4MQ1A 4DLJA 3D5XA 4X2NA 3TTJA 5BV3A 4FZ6A 2AQXA 2EB3A 2FSTX 3PY3A 2B9HA 3QD3A 1WAKA 4O0VA 4PPBA 5HU3A 4QMUA 5DIAA 3AXWA 4FF8A 4Z55A 5I5ZA 3I7BA 3DNEA 3ATSA 4H05A 2WOUA 1UV5A 3V5QA 2A4LA 4EH2A 4DDGA 2PWLA 5EQEA 4IVDA 2HY0A 3KF4A 3FQEA 3MFTA 3NUUA 2PUPA 4IW0A 5D12A 3RI1A 5EDPA 5BPYA 3A7HA 3IOPA 4QQ5A 5DWRA 1B6CB 2XP2A 4BI1A 4R77A 4E4LA 3U51A 4BC6A 3HUCA 3V8SA 3NFGB 3EWHA 3FZ1A 1CTPE 3OUNB 4FTTA 4CD0A 2QOHA 5C26A 4NUSA 4JIAA 5HQ0A 4AT3A 4ASDA 3KMMA 5AEPA 4Y83A 3MA3A 5EHYA 5FTGA 3NLBA 3A4PA 4JDKA 1Y6AA 4LOOA 4PTCA 3R22A 3UVQA 3R8VA 3GI3A 1B39A 1KOBA 3C1XA 3NWWA 4QYFA 4RJ7A 3DKFA 4QMOA 2PE0A 3GCVA 4X3FA 4ACGA 3ORIA 1GZKA 4BDIA 2Y0AA 3HAMA 3I4BA 5I9YA 3F7ZA 3ET7A 2WPAA 3QCSA 2YM6A 4XV9A 3BL9A 4FTRA 3FHRA 3VWAA 2NO3A 3D15A 3Q96A 4QNAA 4LM5A 1IAHA 2C5NA 3UDBA 3HUBA 4B6LA 3L9PA 3SW4A 4BDBA 3VW6A 3RWQA 3QX4A 5EW8A 3CJGA 3QAME 1RQQA 5FXRA