5KMMA

Trka jm-kinase with 1-(2-methyl-4-phenyl-pyrimidin-5-yl)-3-(1-naphthyl)urea
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
314
structure length
301
Chain Sequence
SGLQGHIIACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title Structural characterization of nonactive site, TrkA-selective kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 94
structure length 301
sequence length 314
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kmmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kmmA01
4KIOA 4AA4A 4NM5A 2R3RA 4L46A 2Q0NA 2BDWA 3DKGA 4QMLA 3DJ6A 4FUYA 1ERKA 3C0IA 4TT7A 3CCNA 2I7QA 4QYEA 3U6JA 3A62A 3IO7A 2YJRA 2BPMA 3SRVA 3A7IA 3ORMA 4PTGA 4UEUA 2IVSA 5EK7A 5CEOA 5C9CA 4J97A 2OH0E 4FV6A 4GYIA 3DPKA 3G6GA 3IW7A 4YZ9A 5DR9A 3WZKA 4D4SA 5KMKA 4L3JA 4ACDA 3F3TA 1H27A 4Z55A 2ZV9A 4FSZA 1P2AA 4ANSA 2UVYA 3L1SA 4FNWA 3R71A 4L42A 5TR6A 1J1BA 5D7AA 5KMIA 3PJCA 2JKKA 4L67A 4TL0A 2QO2A 2A1AB 1WMKA 3QTWA 3HDMA 3GC8A 4ACMA 5A4CA 2LAVA 5GZ9A 5F1ZA 2J0KA 4QP8A 4EKLA 4C33A 3MI9A 2XMYA 4GFOA 1Q8ZA 1KE8A 2WXVA 3P7AA 5ANKA 4QTCA 2HWOA 4FICA 4NSTA 3MFSA 3TDWA 2UZDA 3FLZA 2OW3A 3LXLA 4KBKA 3H4JA 4RZWA 5DR2A 5IA5A 2PZIA 2IVVA 4R1YA 5E91A 2ITTA 5CXHA 1Q3DA 4GT5A 4QMPA 4F1MA 2I0VA 2OF4A 1U5RA 3BZ3A 5DBXA 5TO8A 5BVWA 3RPVA 3OUNB 3MW1A 5ANEA 5IMEA 4HZSA 4XG8A 3JY9A 4RPVA 4BKJA 3SGCA 4BCNA 4H36A 3P23A 3C13A 2ITPA 2ITVA 3NYNA 5CI7A 1W83A 3PSCA 5K3YA 4BL1A 3KN6A 4OBQA 3GCQA 5CEQA 4ALWA 2IPXA 3BE9A 1PY5A 1OMWA 5AA9A 4CQGA 5L8LA 4YBJA 5FP5A 3PA5A 4PMMA 1YXVA 4IWPA 5FLFA 5FTGA 1OL1A 1CKIA 4P2KA 1Q8UA 4TWNA 4DEIA 4AQCA 4CFFA 2O63A 5HTIA 2OJJA 2DQ7X 2QO9A 4Y85A 4UWYA 4NWMA 5E8SA 3U6HA 2VX1A 2QURA 2XBAA 3LHJA 3RM7A 4IAFA 4QMOA 1M14A 3FE3A 1OB3A 2YFXA 3DQXA 4WRSA 5DOSA 4EEVA 2B9FA 5CEPA 1WZYA 3OWJA 1Q8YA 4OT5A 4R6VA 3QTRA 4F64A 3V6RA 4XV1A 4NH1A 4UMQA 1XO2B 3MVJA 3QU0A 4FV8A 3RBWA 5BMSA 2OFVA 4FKTA 1H0WA 3UO5A 4HCUA 4IXPA 4LGGA 3NUUA 5HQ0A 2JKQA 3FI4A 5C26A 4GW8A 5ANOA 5I9XA 4FMQA 2F2UA 2RFNA 4R7IA 3WIGA 4JRNA 4UYAA 4BCKA 3BLQA 3P7BA 3RMFA 2Z7LA 4F0GA 4FG8A 4DTKA 4BI1A 2OLCA 3AC8A 5IG1A 3VAPA 4CMTA 2X2KA 2JBPA 4Q9ZA 3GGFA 2YWPA 4FTIA 5ETFA 3RAHA 3H30A 3E87A 3TZMA 3BIZA 2QONA 3IDCA 5AP6A 1T46A 3BYOA 4RIWA 3TG1A 4O7VA 4L8MA 4EUTA 2B55A 5JN2A 5LVMA 3LFEA 3CE3A 2B54A 3TJCA 4EQMA 4ZZNA 5CEMA 3UNZA 5FXQA 2UW4A 4IM3A 4HVSA 4QTDA 5FBOA 1WBSA 3HV4A 4J71A 3FMMA 4WBBB 2PYWA 1L8TA 1ZZLA 2ZV2A 3QBNA 1ZY5A 4K33A 4OAUC 4FEXA 4I92A 4O0YA 3RINA 2R3MA 1CMKE 4MTAA 4E5AX 4UX9A 1YWRA 4AUAA 1R3CA 3R21A 2X1NA 3VHKA 4QD6A 5JQ5A 2XNOA 5HO8A 5AM6A 4MD8E 4M0ZA 4B6LA 3R7GA 2BIYA 3OOMA 3CJGA 2UZOA 2YAAA 3PXRA 4H1JA 4PL3A 2JAVA 3TI1A 3ZC6A 2W1IA 4RVMA 2XH5A 4NFNA 3VQHA 3OW3A 4LQMA 4WG3A 4Y46A 3OXTA 4D9TA 4EHEA 5I3RA 4F0FA 4PL4A 3RZBA 3C0HA 2VGOA 4XP0A 4HNFA 1W82A 4MXZA 3WZJA 4BDCA 2CKQA 1MQBA 4MBJA 2JBOA 2R9SA 4QPAA 4YBKA 4E20A 3ORPA 4PTEA 3NUYA 1UA2A 5BMMA 3ZDIA 1Y8YA 4D2TA 1SNXA 3C4FA 2J2IB 3QQJA 3LZBA 3KCKA 2R3KA 3KC3A 3EB0A 4FV1A 5LARA 3RAIA 3KA0A 4FKWA 4FI1A 4FZ6A 4YU2A 2WKMA 5DPVA 3AT2A 2C3IB 3NW6A 3QXOA 1OECA 4BCFA 4ZS0A 4Q9SA 3A7GA 3RCDA 3WZUA 4FSQA 2PUPA 3GOKA 2OJ9A 3V8WA 3VUDA 1OVEA 4IWOA 4NCTA 2BRGA 4S32A 2X7OA 2Z2WA 5AA8A 3ODZX 4QOXA 4APCA 2W9ZB 4KUJA 2F7ZE 4GVAA 4RJ3A 3UG1A 1YDSE 3UQCA 3O7LD 4BBFA 3LFDA 4JG6A 3HL7A 2QU6A 4RA5A 5FDPA 4ERWA 3MPAA 4FA2A 1KSWA 1GZ8A 4M68A 5E7RA 3ZOSA 4FTKA 4O83A 4NK9A 2W17A 1A9UA 5IH4A 2XYUA 3TKIA 5AADA 1FBNA 3KF7A 3ZTXA 2IW9A 3LKMA 2Y6OA 4WT6A 4YHJA 5DHJA 5KHWA 4PPAA 3OHTA 5FD2A 3EFLA 3HP5A 3BLHA 4ZTRA 5K4JA 2YHVA 3UC3A 4L00A 4KINA 3R1YA 2GS7A 2XJ2A 5AP0A 2R3FA 3MV5A 2WOUA 4PTCA 4S34A 4QP2A 3P7CA 1YXSA 4FEQA 4E6DA 3KFAA 3ZC5A 3TZ7A 4YJQA 2PHKA 3LMHA 2W5BA 1LEZA 1H1WA 3E5AA 5HCXA 2C6MA 3DNEA 5TF9A 4ZK5A 3VBVA 4BDJA 1Q8TA 5DT4A 1PXJA 2XIKA 2HZ0A 3MGYA 4BCHA 3U6IA 4MNEA 3FZOA 3QD0A 3G6HA 3UC4A 3IOKA 3UZPA 3PZEA 4C3FA 5LXMA 3KXNA 4EC8A 3ZFXA 4XV3A 1PF8A 3BQRA 5C4LA 1PXMA 2YDKA 3CQWA 3CTHA 1H08A 3W2QA 3PG3A 4U6RA 3ZSIA 4EQUA 5LJJA 1Z5MA 1TQPA 4FYNA 5HICA 1DI9A 2QOCA 3FY2A 3ZBXA 1CDKA 1F5QA 3POOA 2IJMA 5CAQA 4ZAUA 4IM0A 5HIDA 3FEGA 5HCYA 4EUUA 3PP0A 1XH6A 5DEYA 4BKYA 2BALA 4NM3A 5AIKA 1QCFA 4BB4A 5I9UA 4N6YA 4EHVA 5DYJA 1NVQA 2WTDA 4MYGA 2Z02A 4S33A 3DXQA 2QR7A 3KXXA 3CY2A 5IQCA 4RJ8A 3AMYA 4ERKA 5M57A 2P2HA 4GUBA 3QTUA 4U44A 3O2MA 2GNFA 3UIUA 3SV0A 3RPSA 3WBLA 3QUEA 5M07A 3R28A 3LFCA 3ANRA 1DI8A 3MVMA 2XCHA 2R3IA 2XB7A 2F9GA 4ZLYA 1GZKA 3AMBA 1VYZA 1B6CB 3GC7A 3KRLA 3WZDA 3T9TA 4L3PA 4O7YA 1KE6A 2RSVA 3ORXA 1IEPA 5FRIA 2XK8A 3FMLA 3O0GA 3M2WA 4LMNA 3JPVA 3NNXA 4HOKA 2ETKA 3ZHPC 2XKFA 3M1SA 3QUDA 4F9YA 3HMPA 3RJCA 3NDMA 3DOGA 3LLAA 1ZRZA 2JDTA 3TV7A 4BVUA 4YR8A 4EYMA 3U9NA 5JK3A 1RQQA 5KNJA 4CLIA 4U3ZA 3LPBA 4FODA 3AC4A 3DZOA 4KBAA 2OKRA 2FUMA 1XH4A 3MSSA 1ZYDA 5I5ZA 4IDVA 4AZTA 2X7FA 4FV4A 3FHRA 4LG4A 5CEKA 4CRSA 4G3GA 5GZAA 2PMIA 4JVGA 4WNPA 1XBAA 4V01A 3PUPA 1M2PA 4I1ZA 4AGCA 1PRYA 4OTQA 5AP3A 3PLSA 3GU7A 4GU6A 1KUTA 4NUSA 2YEXA 4ZTQA 5J5SA 3FUPA 4YNEA 1AGWA 4M97A 2R3HA 4MEDA 4F9CA 3UYTA 5L2TA 5ETIA 3ZXZA 2B4SB 2BROA 3II5A 4QP9A 5HX8A 4QMXA 2IZRA 2QQ7A 4RJ5A 4LRMA 4ACHA 5F9EA 5GJFA 2WMXA 4BWKA 4EZ3A 4KA3A 3PG1A 4MQ2A 4W8EA 3I7BA 4FSRA 2WTKC 3DBEA 3C4WA 3UZTA 4HYSA 3R7EA 3OCSA 1OIUA 4LV8A 2A27A 4I5MA 4YZCA 2I0EA 4FTUA 3G33A 4I5CA 4O27B 3NIZA 4Z9LA 4KIPA 3ZUTA 1W84A 3CPCA 3TXOA 3QQFA 4QYYA 3R8VA 4YO6A 4U5JA 3LFQA 1H01A 4RG0A 3Q6UA 3VS6A 3NNVA 2ESMA 5HE2A 1W98A 3VS3A 4U42A 3TUCA 2P33A 4O0XA 1Y6AA 5CT0A 5A9UA 3TV4A 2CSNA 5JEBA 3RVGA 2XIXA 1CKPA 4BTJA 2CGWA 2WTKB 2ZVAA 4OUCA 3BKBA 4G5JA 3TIYA 3W18A 4BHZA 4DC2A 2QC6A 1VJYA 2J0IA 2XBJA 3V5PA 3BHTA 3DBQA 3EZVA 3RHKA 3GQLA 1WAKA 3ZLSA 5TE0A 1OZ1A 2ZDUA 5K4IA 5E8ZA 1DM2A 4XLIA 2BCJA 2OIBA 4UWBA 2B7AA 4QQ5A 3HV5A 2VNYA 3O7LB 4JQ7A 3BBWA 3F3UA 1XH7A 1R78A 2BTRA 2QOBA 2VUWA 3JS2A 2Z7QA 3TJDA 4EWQA 1ND4A 3WE4A 1Q99A 2W1FA 4GSBA 2R3LA 4JI9A 2CLXA 1JKLA 4YC6A 3F61A 3OTVA 5KX8A 5IQGA 5T68A 2F4JA 4ALUA 5A46A 3QLGA 4FNZA 4YC8A 2HWPA 3A4PA 4XCUA 3ZUUA 4DGNA 1O9UA 5ACBC 4F9WA 5J9YA 4ANQA 1A48A 1BL7A 3RPYA 4GV1A 4CTCA 3VS5A 3BEAA 4ZY5A 3C5UA 2Y4IC 4G6OA 3LM5A 4AW2A 4KABA 4JS8A 2O2UA 4IH8A 4C37A 1P4OA 4ZSGA 3R1NA 1JWHA 4QP1A 1G8SA 2X81A 4CT1A 3D5XA 3LCDA 3TIZA 2PVHA 4QMTA 1IAHA 1AD5A 2GTNA 3PY3A 4R7HA 2PSQA 3MFRA 4FR4A 4PMSA 1OL6A 1NXKA 2WMRA 3NYVA 4IZ5A 4EORA 1UVRA 2O8YA 4E7WA 1DS5A 5DRBA 2VTTA 2OWBA 4WBOA 3V8SA 5A4QA 1RE8A 1E1VA 3G0FA 1SVEA 2QI8A 2Y4IB 3OBGA 5L8JA 2GFCA 2ITWA 3PA3A 1PJKA 3K3JA 4X2GA 1OIRA 3JY0A 2C6KA 5A4EA 4D4YA 5HVKA 4XP2A 4C2WA 1Q4LA 4IVBA 3AGLA 4EKKA 2EU9A 4N6ZA 4BGQA 3A99A 4FVRA 4EONA 4Y5HA 2FA2A 2XZSA 4EOPA 2W1DA 4UV0A 3P78A 2CN5A 3H10A 4S30A 3VBQA 2BZIB 4D0WA 2GMXA 4Y95A 5JQ8A 4ZSEA 3WE8A 3AG9A 1G3NA 4IJ9A 4ZXTA 5HIEA 3QAME 5L4QA 4DH7A 5LMBA 2JDOA 2XNPA 1KE5A 4PX6A 1H1QA 3C51A 4O1OA 4JBOA 4R3PA 2VWBA 4YHFA 3W1FA 4FC0A 3QGWA 4M13A 3VBXA 3CLYA 4FIEA 3KVWA 4E73A 5CVFA 5CWZA 3SHEA 4BCIA 4D58A 1UKIA 4U81A 5E8VA 4EOLA 5IEXA 1H26A 4AZVA 4RFYA 5BVFA 4IX3A 5K5XA 2PE0A 4QP4A 4D55A 4C3RA 5GHVA 4L6QA 4FKIA 5CEIA 1H28A 4J7BA 3B2WA 5DWRA 3CTJA 4GFMA 4JOAA 5M4IA 4IB3A 4O21A 2VTJA 4QMZA 1M7QA 3I6UA 2PU8A 3DV3A 1M17A 1XKKA 4RX5A 4CD0A 5DLSA 3TKUA 4FIHA 4C38A 3DT1A 4FSMA 4AFEA 3BU6A 3QHWA 3CS9A 3VULA 2GPHA 4R3CA 5EOLA 4QMVA 5LOHA 1Y91A 2V22A 4BIDA 2J0LA 4H39A 5DEWA 4F1TA 2YLFA 3D7TA 2C6TA 4EI4A 3VWAA 2WMTA 2WQEA 4EOJA 4X2NA 4FEWA 2CKEA 3CJFA 2V62A 2FO0A 2B9IA 2BHEA 3C1XA 3IGGA 4ZIMA 3DCVA 4NIFB 4MXAA 2GSFA 3DK7A 5CSXA 1UV5A 3ZBFA 4AW1A 2ACXA 5BVEA 3K5VA 3QWKA 4FX3A 5HCZA 4C58A 4LRJA 3HP2A 2H96A 4QMUA 4USEA 4F6SA 3EN7A 5IA4A 3KGAA 1H24A 4JBPA 3F66A 4FBXA 4RLLA 4YZMA 2B1PA 5E92A 3PLAE 4WSQA 3OXZA 2J6MA 3ORLA 4WG4A 4E6AA 3QCSA 4B7TA 4B99A 2I0YA 4L9IA 5DNRA 2UVZA 2PMOX 5IF1A 4IWQA 1HCKA 4PNKA 1ZAOA 2CJMA 4FTMA 4I93A 3A61A 5CU2A 1U59A 2YM4A 3KEXA 2WHBA 4G6LA 3DAJA 3UZRA 2W99B 3F3WA 2VX0A 4WG5A 3BV2A 3I0QA 4ZTMA 3JR1A 3OEZA 2R3JA 1HCLA 1U4DA 3Q4UA 3H9OA 4FIGA 5KMLA 2YWVA 4L53A 4CCBA 2ITNA 3IGOA 3TDVA 3QQUA 5IU2A 2YIWA 4QQCA 4EH5A 3IK3A 3VRYA 4PL5A 1GIIA 4H58A 4K1BA 5HHWA 5KMOA 4CCUA 5H8BA 4B9DA 5AR2A 2GQSA 3Q9YA 4GFGA 4XMOA 4A9TA 4IADA 2QKRA 3L9MA 3EKNA 3HAMA 2E2BA 3F5PA 1YOJA 4QMNA 2BZJA 3HYHA 3RNYA 4D5KA 4YLKA 2YCSA 3V51A 1B39A 2ZM3A 4LM5A 1JLUE 2A4LA 2F49A 3FQHA 4XV2A 4AGWA 5D12A 4AZEA 4EC9A 2UZUE 3FY0A 4NL0A 3FC2A 2NO3A 4QO9A 1YHSA 3UJGA 2PWLA 4BTKA 1OUKA 2OGVA 4RWKA 3IOPA 2B0QA 4FT5A 5LVPA 4ANMA 3SW4A 5JGBA 4U45A 3Q3BA 4FV9A 1BLXA 5BYZA 3ZM9A 2E9PA 1U5QA 2UZLA 3DKCA 3PXQA 4RMZA 3O71A 4RIYB 3VUKA 3R30A 5EYCA 2IZSA 1Z9XA 3NYOA 4TWCA 3LOKA 1KOAA 1OBGA 3NYXA 5HTBA 4I5HA 3VN9A 4DH5A 5C8NA 4XNEA 1WVYA 4J1RA 5M08A 4XJ0A 4ZSLA 5JGAA 4L7FA 4M69B 4RFZA 4C61A 4FVPA 5E8YA 4WHZA 5EYDA 3GC9A 4RC3A 4L52A 2HYYA 2PZRA 3AOXA 3D2KA 2J5EA 3EN6A 4DH1A 3FMEA 4X21A 3ZM4A 3H9RA 3WILA 4J8NA 3PXYA 4M0YA 5EG3A 5HO6A 4HNIA 5IA1A 1OI9A 3E88A 5HOAA 2XS0A 1YXXA 5HGIA 3KMUA 4CG8A 4GK3A 4FIFA 3V5WA 1PKDA 2B9HA 4G3CA 4GK4A 4TYIA 4DAWA 3NSZA 5C01A 1JOWB 3D15A 3V8TA 4U3YA 3G51A 4I5PA 5IISA 3PJ3A 2HY81 4G3DA 4QMQA 1JSVA 2QHMA 2IWIA 2J51A 4MWHA 5FEDA 2GNHA 2YM7A 3QRUA 4FIJA 5CF6A 3RAKA 3H0ZA 4FTNA 5L3AA 2VWVA 5HLPA 4AXAA 3VUGA 3FI3A 4OTFA 4RC4A 3PJ1A 4XBUA 2Y9QA 2RFSA 3U87A 4BDKA 2IVTA 1FPUA 2ERKA 2R3PA 4K8AA 1YDTE 2W5AA 4ANLA 3T8OA 3PVWA 5LQFA 1JQHA 2H9VA 4BGHA 5AV4A 4FOBA 3PXFA 1ZYJA 4XOZA 5ANJA 4WUAA 3R7UA 1VYWA 4UBAA 4I23A 4L44A 5KMNA 4RBLA 4AFJA 3MTLA 4FTTA 1ZY4A 2I40A 1FGIA 5AAEA 2R3GA 4KIKB 3FV8A 5E4HA 3BYUA 4YJSA 5CSWA 3ZRKA 3BGQA 3D7ZA 3GEQA 3COHA 3RK9A 4MXOA 2WQNA 1JKTA 4HYIA 4FV2A 3ELJA 1M2QA 3LMGA 4FGRA 4GIIA 2X6DA 3QZGA 3KU2A 3FZPA 4AWIA 3F5UA 3FHIA 4CZUA 1YOLA 3WIKA 3HECA 5BNJA 2ZB0A 3UYSA 1FVTA 2CCHA 1PMVA 4GEOA 4I20A 1BX6A 1Q41A 1WVXA 3R7YA 2KULA 3NW7A 5FTOA 4NZWB 3GXLA 5KKRC 5H8EA 2VWIA 3IDBA 4MX9A 4BZOA 1LUFA 3R9RA 3R02A 3VJNA 2UZBA 4M15A 4NM7A 3E3BX 3T3VA 4BC6A 4NEUA 3LLTA 1H07A 3D0EA 3ZFMA 4AT3A 2WIHA 2R3OA 3TEIA 2PY3A 3G9LX 4LOQA 3A4OX 4ORKA 4FG9A 3K2LA 2WTIA 5F95A 3ZZWA 4ZLOA 4E4MA 4RX9A 3TACA 5B2LA 5M06A 4MNFA 3A8XA 3AD4A 4IMYA 4RJ6A 4GJ3A 3MY1A 2X8IA 3KY2A 4EHGA 5KKRB 3LMIA 3WOWA 3QRKA 3R01A 3CD3A 2C3LA 5KZ0A 2J9MA 3ZZEA 2QNJA 5J5TA 4A9SA 1ZYCA 3PPKA 1J7LA 4C4EA 4DEEA 2VAGA 5EKOA 3K5UA 5HORA 2F2CB 3LAUA 1J3HA 4FSTA 4JQ8A 3DAEA 1Q97A 3P1AA 4EBVA 1L3RE 4XHKB 1RJBA 2C47A 3EH9A 3R2BA 2WQOA 4IZAA 4IW0A 4P90A 4QMSA 4HVHA 5BPYA 5HO7A 2R0IA 3BELA 5JRSA 2QVSE 3NRMA 5EM6A 3HDNA 3LJ2A 4DITA 2W1ZA 2ZAZA 1SZMA 2UV2A 1MRUA 1Y57A 2Z60A 4FTQA 4GG7A 2WTJA 4A4LA 4NIFA 4ENXA 4UMPA 3ATTA 2F7EE 2JDVA 3CD8A 3HRBA 3EQFA 3O17A 3TWJA 5LMKC 3U4WA 4O7LA 4AW5A 5FP6A 2Y6MA 2JIUA 2XK9A 2P2IA 3I0OA 2GNGA 2WQBA 3DZQA 3NLBA 2J50A 2QHNA 4Z16A 3EMGA 5B2MA 3N4VA 1YQJA 4YZDA 3VUMA 4M3QA 5HD7A 5IEVA 2GNIA 3RGFA 3N4UA 5CU3A 3FLSA 4AGDA 2Q83A 2C3KA 1S9IA 4YMJA 2F7XE 4BTMA 4QTAA 5DVRA 4KD1A 5D11A 5AJQA 2WELA 4IAIA 2NRYA 4EK6A 3PSBA 1H1PA 4EYJA 4FE2A 3OD6X 3TTIA 4D5HA 4N57A 2YM3A 5IH5A 1SYKA 2GDOA 4JIAA 3SD0A 2CLQA 4C4GA 1BKXA 1IASA 1F3MC 4FKQA 4YTFA 1R0PA 1JSUA 2PVYA 5HLWA 3M42A 4I6BA 1V1KA 1R1WA 1WBVA 3NNUA 3F6XA 4YGAA 1PHKA 4QQJA 4I0SA 5HTCA 1YVJA 2CNVA 1ZMWA 2O5KA 2Y0AA 4GCJA 3S2PA 2CKPA 1VZOA 5A6NA 5CU4A 2VWZA 4QMYA 1CKJA 5K0XA 1GJOA 2C5OA 4IB1A 5AV2A 5G1XA 3RCJA 3W32A 3QCXA 3W16A 3FLYA 4O82A 4CFXA 3SOAA 2UVXA 5DN3A 1OM1A 3RKBA 3ZRMA 4IVAA 3R8LA 4TN6A 1DAYA 2DS1A 4V0GB 5H3QA 5HEZA 3EQCA 2B53A 3GB2A 3IG7A 2W4JA 4DBNA 4OTIA 5IKWA 4IFGA 4F08A 3FKOA 4O7TA 1EH4A 4H05A 1Z57A 4IDTA 3LJ1A 4JG8A 5ACKA 3C4ZA 3OCBA 2REIA 2YJSA 4JQEA 3VW6A 1BUHA 3FAAA 3FZSA 1WBWA 1APME 3SAYA 2VTNA 2HY0A 3R63A 1OGUA 4R1VA 2PUUA 3QRTA 4QTEA 2YIRA 2JC6A 4GKHA 1ZMUA 3PYYA 2WMSA 3I5NA 3Q4ZA 4OT6A 3CQEA 3KRJA 4U80A 2WU7A 2VTSA 3OMVA 4G1WA 2ITQA 1YI6A 4RIYA 2OH4A 4YLJA 4GK2A 1ZYSA 5EYKA 5LVLA 4D1XA 3P9JA 2PZYA 4OW8A 3PRIA 2JEDA 4QRCA 4QYHA 5E90A 3VQUA 3D9VA 5DI1A 3TL8A 4C8BA 3DBDA 3O23A 4J98A 4X6QC 1XJDA 2ONLC 4S2ZA 1BYGA 3E8CA 3THBA 3JUHA 4ASXA 4FZFB 3GFWA 2VN9A 2J5FA 4MH7A 3ULIA 2W5HA 4BGGA 4DEHA 2XJ1A 3OWPA 4XG7A 3ZSGA 1P14A 4BDEA 2C30A 3ORKA 3OVVA 2YIXA 2XRWA 5IA3A 3VUHA 4ZEGA 4YSMA 3GCPA 3QX4A 4NT4A 3AC2A 3EQRA 4C36A 2SRCA 1UKHA 3JYAA 2BDJA 5AR8A 3U55A 4D2PA 4ONAA 1LP4A 2P3GX 3EZRA 3SX9A 4XLVA 4C57A 2Z8CA 3D94A 3V04A 4BDHA 2VWUA 2EXCX 1ZARA 4CVAA 4I0TA 5IDPA 1OKWA 1OITA 2QKWB 2VTPA 2FH9A 2UZNA 4G31A 4OTRA 3ZXTA 5T6KA 2VO3A 4D1ZA 4GVJA 1H00A 4KRDA 3UIMA 2W1CA 1JSTA 4PMTA 4D4VA 3OFMA 2O65A 4IAYA 3MTFA 4CGAA 4EQCA 1I09A 2A19B 1OUYA 3E8DA 4O86A 5IH6A 4GU9A 3UPZA 4YURA 2B52A 4JX7A 4TWOA 4E6CA 4JDIA 3SQQA 5EW9A 4X3FB 2WMWA 4E26A 4Y72A 5C8KA 3MH2A 3MB7A 3PY1A 3DY7A 4F99A 4DLJA 1PXKA 4CKIA 4O0UA 4C62A 1O6KA 3H9FA 2EB3A 3NUPA 2YIQA 3Q96A 4U41A 5A4TA 4DCAA 4G9CA 4CG9A 5CU6A 2OXDA 2AC5A 4X0MA 4KIKA 3SC1A 3JXWA 4F0IA 3F5XA 2ZB1A 5EM7A 5AX9A 1PXIA 5FEQA 3L9LA 3KRRA 3FZ1A 3NWWA 4RA4A 2XEZA 2XM8A 3F3ZA 4X2FA 5AP1A 4CKJA 1AQ1A 3UGCA 4EOIA 1H1SA 1HOWA 2PVRA 3MH3A 3OOGA 3VIDA 4LL0A 4C4JA 4Z3VA 3QC9A 4M12A 3R7VA 3B8RA 1K2PA 5BQ0A 2BFYA 4O91A 4RSSA 3U51A 3H3CA 4I6QA 4MBIA 2RKUA 3I6WA 2WZJA 1WBTA 2VO6A 2OSCA 3HMIA 4R8QA 4H3PA 4Y8DA 4R78A 4IAKA 3ENMA 4M84A 2X2LA 3EYHA 4R5SA 5D1JA 5TT7A 5BUJA 1OPLA 5EOBA 3EQDA 4KB8A 5L2SA 4UWCA 3G0EA 4HVGA 2O0UA 1ZMVA 2YDIA 2YERA 2R2PA 4Z7GA 1ZOGA 4CFVA 2BRBA 4D2SA 4OAVB 3FDNA 2FSOX 3F3VA 3UDBA 2RG6A 5AMNA 5HESA 5JT2A 2NP8A 4DGMA 4C7TA 3SDJA 3W8LA 2FSTX 4W4XA 4C02A 5IZFA 3IS5A 3COIA 5DIAA 2QR8A 2HOGA 2XKDA 3QRJA 4CV8A 2E9NA 2XP2A 4AW0A 1U54B 5JGDA 4I4FA 3FWQA 4OLIA 1GNGA 2YN8A 4CFMA 2JAMA 3QALE 3MH0A 1QPDA 4I41A 4IIRA 1YW2A 1REKA 4YJUA 4L01A 4FTRA 3PVBA 4FKJA 3N51A 2BRMA 5CF4A 4O7WA 2UZWE 2XYNA 4GL9A 5AWMA 4UZHA 2UUEA 4WUNA 2OG8A 3OC1A 4FL3A 4AZFA 5EI8A 5A54A 3LXPA 2FB8A 3LCTA 1LPUA 4RC2A 4BTFA 5I9YA 5TKDA 2IZTA 4N70A 5AR5A 4RWJA 4E1ZA 2J90A 3F2NA 4R7BA 5FEEA 3FSFA 4EJNA 4FEVA 4W8DA 5EM5A 3Q53A 2HZIA 3MH1A 3OWKA 3CKWA 1UU8A 5BYLA 2XCKA 3KMMA 3EQBA 3RNIA 3Q2MA 4DGGA 3ANQA 4AS0A 1MQ4A 3BWJA 4U9AA 2RG5A 2W1HA 2VTHA 3QA0A 4ARKA 1M2RA 4W9WA 4EH4A 5IA2A 3FXZA 4DN5A 4LFIA 3QF9A 4G16A 5CXZA 2WEIA 3E3PA 3DBFA 4JG7A 4MXYA 4F7NA 4RQKA 3NUNA 1JBPE 2VNWA 3BU5A 4IZYA 4BI0A 4DG0E 3PSDA 2QOLA 5HG9A 5J1VA 4J53A 5AP4A 4CMOA 4BCQA 4ZTSA 4QP6A 4BIEA 2GHGA 3EQHA 4NU1A 3RWQA 4GT3A 4PRJA 4X7QA 1XQZA 3U9CA 4G9RA 5KCVA 3EKKA 3PA4A 1ZYLA 2BTSA 4GRBA 1IRKA 4IQ6A 4K2RA 3O51A 1RDQE 3O96A 4JDJA 5G6VA 5HNGA 3FPQA 4TZRA 5CQUA 5HD4A 1YDRE 5D41A 5LMKA 2X0GA 4NKSA 2V55A 3FZTA 4EZ7A 4EJ7A 3PIYA 3PE2A 3L8VA 3KN5A 3A7HA 2QOQA 4TYHB 3B2TA 3C7QA 4FKUA 3ENHA 4AOTA 2O3PA 1RW8A 4FTJA 5DE2A 3DXPA 3OUKA 3L8PA 3AT4A 5F4NA 3BQCA 4UB7A 5KHXA 2QLQA 5IUGA 3AC5A 4E4XA 4TWPA 3BRBA 5HE1A 4BBMA 1Q8WA 3GCSA 3UMWA 4DFYA 4F4PA 3NVMB 3DGKA 5M4FA 4GUEA 3GU8A 5B7VA 3BU3A 5FTQA 2VTIA 4GT4A 1TQMA 4PDPA 4YLLA 3W2CA 3FXWA 2WTWA 4IFCA 5J9LA 4HZRA 1JPAA 5K0KA 3DB8A 1UNLA 4QYFA 3DKFA 3LVPA 2C1BA 4YPDA 5BVNA 3ZU7A 4V0GA 5D9HA 4DEDA 1PKGA 4FOCA 4ITIA 2IW6A 4JJRA 5EHOA 4ASEA 4RRVA 5M44A 1X8BA 3EYGA 4AZWA 2YAKA 4AU8A 2HELA 5DGZA 4II5A 4JNWA 2UW6A 3BPRA 5FGKA 3C5IA 3PVUA 3PDTA 4UY9A 2PVJA 1OPKA 3QYWA 4C3PA 4KIQA 3Q52A 4MWIA 4BZDA 4QPMA 1R39A 1UWJA 2PTKA 4LOOA 4MVFA 3BGZA 5EQEA 2QO7A 3V5TA 2UW7A 2QOFA 4RLKA 1ZWSA 2YCRA 5HBEA 4F7JA 4O0RA 3MFTA 5EI2A 5LWNA 4FZAB 5L2WA 1ZXEA 1O6YA 4MXCA 4HGLA 2XVDA 1YRPA 3DS6A 3FQSA 3PE1A 3R6XA 4FL2A 4EHZA 1ZLTA 5CF5A 3A8WA 2VTLA 2OFUA 3DB6A 2XK7A 5AX3A 4DEGA 4ZLZA 2XNGA 1UU7A 4O6LA 4TTHB 5KMJA 2C6OA 2R5TA 5AFVA 5M56A 1JKSA 2CCIA 4I24A 2BKZA 1NA7A 3WF5A 5A4LA 3R9OA 3AD6A 3DU8A 3GP0A 2W4OA 3AXWA 2C3JA 3LM0A 4JDKA 4RWIA 1U46A 3F2RA 3TTJA 4L68A 3EN5A 5HX6A 2ONLA 3VUTA 1OL7A 3FC1X 3WF8A 1PXLA 5AAGA 5M09A 3EFKA 2GQRA 2B9JA 2PPQA 1IR3A 2I1MA 4HPUE 3POZA 2YA9A 1KE9A 1YOMA 4EH9A 4D1SA 4U0IA 1M52A 1O6LA 3AC3A 4PPCA 3W2PA 3C0GA 1JKKA 2ITUA 4BYJA 3QC4A 5DMZA 5AUVA 2WMVA 3QKMA 4BDFA 3OT3A 5EQYA 1V0PA 2C0OA 3PJ2A 3ZYAA 3P0MA 3UVPA 4PUZA 1Q61A 3ORTA 2CGVA 5IQIA 3FMKA 3TN8A 3UOJA 4FL1A 4UMRA 4W4YA 2PE1A 2UZVA 5BVDA 3HA8A 4O81A 5AR4A 4CRLA 2WGJA 3R22A 5E8TA 3RAWA 1WCCA 2BFXA 1YI4A 5EDPA 4CZTA 5KBRA 5CS6A 4U7ZA 4O96A 4DFLA 2PE2A 5GZ8A 3DQWA 2C6IA 4CSVA 1IA9A 3HV7A 5DR6A 4F70A 4DLIA 4F7SA 5IQDA 2XF0A 4YZNA 3ORNA 4NKAA 4OTPA 4MCVA 4LRKA 4LUEA 4XV9A 3A7FA 4NJ3A 5EYMA 1JVPP 5HBJA 2WNTA 2H34A 4IEBA 1NW1A 2DYLA 1GY3A 5FQDC 4AN9A 1R0EA 5HNBA 5CI6A 5AUUA 4IX5A 5F94A 5I3OA 3QL8A 1FMOE 3OROA 4IC7A 5IPJA 3JVRA 3ZSHA 3FPMA 3MESA 2VO7A 3MFUA 4G17A 4DGLC 3R00A 5EH0A 2IVUA 3RALA 3IW4A 3BX5A 1MRVA 4YO4A 1UU3A 4HVDA 4FV5A 5EKNA 3EN9A 4V04A 4OTWA 4NFMA 1FQ1B 3QTSA 4Y73A 3LFSA 1Y6BA 2OZOA 4PP7A 1I44A 3QQHA 1OKZA 4U79A 3AT3A 4I22A 4WNKA 3ULZA 4PDYA 1K9AA 2VO0A 3Q32A 3QKLA 3MIYA 5M4UA 4IJPA 4O0TA 5CAOA 4HGTA 2YM6A 4D2WA 1U54A 3NX8A 2WOTA 4CMUA 2DUVA 4O2ZA 3HMNA 4ZMEA 2JFMA 4YP8A 2R4BA 2JGZA 3IW5A 3E7OA 3AGMA 3Q9XA 4YPSA 3ZS5A 4RWLA 5M4CA 3M11A 2BRNA 2VU3A 3L9PA 4RGJA 3R8UA 4CZYB 5C4KA 3E7VA 3LW0A 3UO6A 3A7JA 4RIOA 5CX9A 4K11A 5HG7A 5E8UA 4D28A 4EH2A 1UU9A 3I81A 2P55A 4ZTNA 2UW9A 4QMWA 1MP8A 4L45A 3P5KA 3R73A 3PIZA 2AUHA 4FSNA 4JL9A 1BI7A 4DG3E 5J7HA 3TNPC 5HU9A 3TM0A 4ZY6A 2OXXA 1ZOEA 4MF0A 2C0IA 3DDPA 4NTTA 3RWPA 4HJOA 3BCEA 5HU3A 3FYKX 4ANBA 3F82A 4AF3A 1YHWA 3I7CA 4AN2A 5CENA 2X4FA 2CNUA 3TNWA 4XBRA 4XG6A 3VO3A 5ANDA 2WMUA 5IUIA 5IMXA 4WNMA 3EHAA 4BF2A 3QTZA 4FKOA 2E9VA 3HMOA 4LI5A 2PVFA 3N4TA 4O84A 4AN3A 4AACA 3PP1A 4BDGA 2PZ5A 2YZAA 3NR9A 4X6RA 3ZEWA 1YHVA 3R0TA 1XR1A 3RK5A 1XH5A 3MIAA 4YJVA 2J0JA 5CSVA 4HW7A 5EM8A 2BIKB 3R8MA 3R1SA 4EK8A 5J87A 3MJ1A 3EQPA 5TOZA 2IW8A 2HZ4A 3ZMMA 5M55A 4AA0A 3LE6A 1XH8A 4RJ4A 3T3UA 5FG8A 4RVTA 4AP7A 3KXHA 4C0TA 3VF8A 2BHHA 2CGUA 4JBQA 4O7ZA 4FF8A 2VWXA 4I94A 4IAAA 4TYHA 2C68A 3FLWA 4GH2A 4FV3A 3UIBA 4H1MA 2V7OA 3EQIA 3DDQA 2YCQA 4BFMA 4AG8A 5GIPE 3K54A 3DBCA 2VD5A 5AR7A 4YJNA 3BV3A 4BRXA 5D10A 1OBDA 4Q5HA 3D14A 3NS9A 4QQTA 4UMUA 3DTWA 1FVVA 4IB5A 4ACGA 4GKIA 4ITJA 5CVGA 4ASDA 4DEAA 3S0OA 2C4GA 3IDPA 2XA4A 2X39A 2BVAA 5JMSA 3QCYA 4WD5A 4BHNA 3OTUA 2Y7JA 5L6PA 4BDBA 5L2QA 4FTCA 4CV9A 3EWHA 3FXXA 5IQHA 3CGFA 4D2RA 2ITZA 2W1GA 4HGEA 4LGDA 3R8ZA 4YSJA 2OJGA 3PIXA 4EOMA 4DINA 4A7CA 2XEYA 1MRYA 2BRHA 5LCJA 2EXMA 3BYSA 3EFJA 3UVQA 3UNJA 4A06A 3W2SA 3KULB 2OK1A 3DNDA 3FJQE 4MNEB 4TNDA 2R64A 1WFCA 4GG5A 3HLLA 3UG2A 4YTIA 4BIBA 4LOPA 2GU8A 4F6WA 2JDSA 4FTAA 4O7RA 4E5WA 4JXFA 4YC3A 5M51A 3ROYA 1PXOA 2IO6A 4U40A 3TNQB 4MQ1A 2OI4X 3FQEA 3L8SA 5KUPA 2RFEA 4AX8A 2J0MB 4YUQA 5ITAA 2W0JA 1FOTA 3KXZA 5HG5A 1QPEA 3VNTA 4JAJA 2JKMA 2UW0A 3CQUA 2XIRA 2OIDA 5I9ZA 4XRJA 5D7VA 4HYHA 4CQEA 3ZLXA 3MDYA 3ZO3A 2VRXA 1OL5A 2CNQA 2ITYA 4N0SA 4YHTA 5A14A 4MHAA 4TKSA 4DFZE 3OZ6A 3VHEA 4C35A 4FNXA 3EOCA 5H8GA 4JR3A 1QPCA 3NUSA 2CPKE 2IN6A 4ZOGA 3ZUVA 4BZNA 4DHFA 3PY0A 4FKSA 4W4VA 2HIWA 3MPTA 4YNOA 4EBWA 3E93A 4EL9A 4QNAA 3GT8A 5JKGA 4PWNA 2OU7A 2XNMA 3F7WA 4YJPA 1VEBA 2Q0BA 3WF9A 1OKVA 1GZOA 4KAOA 1OKYA 2Z7SA 3OS3A 4WSYA 3TNIA 3H0YA 2J4ZA 2BZHB 4G3EA 2WEVA 2BUJA 5B0XA 3KXMA 3BI6A 4L3LA 3WI6A 5JH6A 2G2FA 3KVXA 3LQ8A 4BDIA 5JFSA 1J7IA 5CT7A 4KS7A 1IG1A 3NMUF 2ITXA 2XNNA 4AOIA 3F2AA 3HVCA 4QP7A 3LCKA 4PP9A 4X3JA 4XYFA 2NNWB 3GU6A 3P4KA 5DT0A 4W4WA 4DE4A 5LWMA 3R9NA 3TUDA 4DCEA 1REJA 3QLFA 4FVQA 4GYGA 3D5UA 5IEYA 2G9XA 3HV3A 5LVOA 4BY9E 3IQ7A 4BDAA 5E8WA 2VTQA 3QFVA 3QZIA 1UWHA 4RQVA 4NYEA 5IA0A 5J95A 5HZNA 3RM6A 3WF7A 3OCTA 4K6ZA 5F20A 2R3NA 3I4BA 4ID7A 2WD1A 4IM2A 4RIXB 4OTDA 3SXRA 3PXZA 3NZ0A 5AUTA 5H9BA 2QD9A 5HVYA 3VVHA 4KNBA 3ETAA 2BAQA 3W8QA 4F6UA 5JRQA 3RPOA 4ACCA 3PWYA 4E3CA 3ROCA 3CEKA 5AP2A 4CFWA 3ZEPA 1JAMA 4JAIA 4AE9A 2HCKA 1B38A 4JBVA 2BAKA 4BBEA 5IDNA 2CKOA 2WMBA 5E9EA 3FLNC 1H4LA 2QLUA 4AT4A 3KRXA 1ZZ2A 4EH7A 2E9OA 5BX0A 1QL6A 4LYNA 5J8IA 4KRCA 1T45A 4OBPA 2R7IA 5CVHA 5HNIX 2G1TA 2ZJWA 3QTXA 3RPRA 3AD5A 3LIJA 2JLDA 4ALVA 4DEBA 3GUBA 3NUAA 3D2IA 2XUUA 4IZ7A 3NIEA 2JDRA 2HW7A 2OJFE 4C4IA 4OTHA 5CAVA 3UO4A 1JNKA 5AIRA 4K9YA 4M14A 1TQIA 4JT3A 3BWFA 3DFCB 4KS8A 3WZEA 2R3QA 3KREA 1P5EA 3MJ2A 4DFUA 3RTPA 5KO1A 4CNHA 3KKVA 5CNNA 3IKAA 3ZH8A 5ETAA 3R1QA 2OICA 4BCPA 5KMMA 4DBXA 3DLSA 4FK6A 4ZP5A 2C5XA 3PRFA 3PFQA 1E9HA 4KSQA 2Z7RA 3CPBA 5C27A 2WAJA 3MA3A 3GQIA 2ZMDA 5T3QA 2VX3A 4PY1A 5AUWA 1YWNA 3ATSA 4BDDA 5GJGA 3SG8A 3VF9A 4BR3A 2G15A 4R5YA 3P86A 3QD2B 4Y5QA 4WKQA 2CGXA 3DA6A 3O8TA 4DG2E 2ZV8A 2YABA 4PDSA 3FZRA 4O7NA 4CT2A 2HZNA 3Q9ZA 4ZTHA 5J9ZA 4A07A 3O8PA 3REPA 3MS9A 4FZ7A 1XWSA 4B4LA 2JITA 4ZZOA 3SG9A 4X2KA 4DYMA 4F63A 4BCOA 2HAKA 5LCKA 1NVSA 4PV0A 4C2VA 3FMNA 3RHXA 4R77A 2XNBA 2XK4A 2YDJA 4P5ZA 4DTAA 3DLZA 3HX4A 1QMZA 3BGPA 4EZ5A 1SNUA 5A6OA 2YM5A 4I21A 5AP5A 5I4NA 2XKEA 4M69A 3QQGA 3MVLA 4KKHA 4EOKA 1H1RA 2XKCA 3HA6A 3KCFA 3OY1A 2GQGA 4OBOA 3L8XA 4APPA 4B0GA 3E92A 3DTCA 3LFFA 3SOCA 2GFSA 2GNLA 2LGCA 2AC3A 3FMDA 3G9NA 4GIHA 4UXQA 3Q04A 2WFYA 4E93A 3EFWA 1FINA 4ZSJA 4DT9A 3FBVA 4GS6A 3DJ7A 3ZLYA 2V0DA 4QYGA 4RVLA 1VR2A 1NT2A 3VS1A 5EW8A 3UOKA 2X7GA 4LL5A 4X3FC 3OP5A 2YM8A 4RJ7A 2W4KA 2Y8OA 4I4EA 3S00A 1PMUA 3ZRLA 3AMAA 4FG7A 2EWAA 3HGKA 3MYGA 3WYXA 4UYNA 4UMTA 2FYSA 2G01A 5BYYA 3W2OA 1P4FA 4L7SA 2HENA 4QMMA 2FVDA 1S9JA 3OT8A 4XX9A 3TUBA 2X2MA 1OPJA 3P08A 5J7BA 5DG5A 3BHHA 3QQLA 4P5QA 5AV0A 5HBHA 3VW8A 1Y8GA 5EHLA 5ANGA 4JLCA 3Q2JA 3EN4A 1XHAA 2PULA 2WIPA 1Q24A 1URWA 2JFLA 5CAUA 2IG7A 2OO8X 4IVDA 3HKOA 3OCGA 3GC0A 1OL2A 2E9UA 2PMLX 3KULA 4MD9E 1NVRA 3LQ5A 3MA6A 5C8MA 1FGKA 1SMHA 3UP2A 3QX2A 2XNEA 4P4CA 2W06A 3QCQA 4FK3A 2WMQA 2QG7A 3SA0A 4EH8A 2PMNX 4LV5A 4DA5A 4D4RA 3D7TB 3PZHA 3LCSA 4E4LA 3UIXA 5E1SA 4QT1A 2V7AA 4R3RA 3S95A 3VRZA 4DT8A 5HIBA 4FT9A 1WBOA 4Q5EA 1W7HA 3E64A 3NPCA 5CZIA 2DWBA 3BYMA 4PNIA 3UQGA 2W05A 3PPJA 2EXEA 2XIYA 4MKCA 3R83A 1PMEA 2VWYA 4EK3A 3LQ3A 4ZSAA 3VS4A 4CKRA 2QCSA 5J1WA 5DRDA 2X8EA 1SVHA 3PTGA 1GAGA 5AR3A 3QWJA 3R8PA 4OR5A 2C5VA 3HV6A 3NGAA 4XG2A 4E5BA 3D83A 3MWUA 2YCFA 3DK3A 4GMYA 3B8QA 3DXNA 4XG4A 1NY3A 5FM3A 3VUIA 2W7XA 2GNJA 2X4ZA 3Q4TA 4BCGA 3QTIA 4CLJA 4U97A 1OIQA 4EOQA 2FSMX 4K77A 4RFMA 2C5YA 3TV6A 3V5QA 5M53A 4YZBA 4FZDB 5ANIA 3UE4A 3FSKA 3Q60A 2R7BA 4I0RA 5FXSA 3NW5A 2EVAA 3GCUA 3ORIA 3ALOA 3W33A 4C34A 4PQNA 3SVVA 5IQEA 3NCZA 4Q2AA 3PXKA 2YITA 4CYIA 3DK6A 4YJTA 3FMJA 3MN3A 4FT0A 1M7NA 2OIQA 2WTVA 3KB7A 2YACA 4CYJA 3BYVA 2HXQA 4DGOA 3HMMA 3SXFA 4EWHA 3DJ5A 2QOOA 4AAAA 4F7LA 2QOHA 2X6EA 1TVOA 3MBLA 5CQWA 3ET7A 2WTCA 4IAZA 4ZS4A 1LR4A 4BYIA 4BWPA 1KE7A 4BCJA 3ZDUA 5LMAA 4F1OA 3QRIA 5HE0A 3QZHA 3A60A 4XP3A 4G2FA 4FSWA 3IW8A 1WVWA 3DAKA 3P79A 4JRVA 3GOPA 2PL0A 2WPAA 3E62A 3AC1A 1URCA 4HVIA 5BVOA 3OBJA 5L8KA 3OWLA 4FTOA 4AOJA 5K9IA 4RZVA 5AUXA 4FGBA 3GNIB 4LGHA 2QOKA 4FSUA 4EOSA 2QOIA 2H8HA 2YISA 2X9EA 2XM9A 4RIXA 5JZNA 5EQPA 2PVLA 2BR1A 3HRFA 4A9YA 3G2FA 3FLQA 4FKLA 1QPJA 5BUEA 2KTYA 5LVNA 3ZO2A 1KV2A 4J96A 4CTBA 5EHYA 4NJDA 4O38A 4C4HA 5HI2A 4FT7A 5KZIA 5J79A 4W9XA 4BCMA 2ZDTA 4MK0A 4DTBA 5HG8A 3MPMA 5IQFA 4IVCA 2J7TA 3EJ1A 2ITOA 4NW5A 3EL7A 4AA5A 5FWKK 2P4IA 5CSHA 4EK4A 4M66A 3VS7A 2GTMA 4S31A 2FGIA 5EDQA 1PYXA 2BDFA 4NW6A 4D2VA 2UW5A 3G15A 4IE9A 5CU0A 3QD3A 2ETMA 3KQ7A 4CFUA 4XRLA 2RGPA 2PZPA 3QKKA 2OZAB 4G3FA 4HPTE 4WA9A 4I6FA 4DH3A 3UQFA 2I0HA 1IAJA 2GHMA 4IB0A 2VZ6A 4I6HA 4RVKA 3F88A 5JSMA 2UW8A 2PUNA 3OEFX 4PMPA 3VBTA 4FNYA 4TNBA 3SW7A 4UXLA 3G90X 3F9NA 3OW4A 1Q3WA 5EFQA 5L2IA 5L6OA 3HEGA 4E4NA 1G5SA 1E1XA 3FL5A 5DA3A 1TKIA 3CIKA 4USFA 5FUTA 4IX6A 3R7IA 3ZCLA 3PWDA 2QU5A 2C69A 4TYJA 4HYUA 3HUBA 4HCTA 3BBTB 4XG3A 5L6WL 5CASA 3ACJA 4UZDA 2QG5A 4Y83A 5AUZA 4WOVA 4F09A 3RI1A 3L9NA 3ORZA 3S4QA 5KBQA 4QPSA 2C5NA 3EIDA 1CSNA 4O7SA 5K5NA 3UNKA 1PMNA 3KXGA 3NCGA 4B8LA 4BN1A 3HAVA 2NRUA 2Y4PA 4J8MA 3ITZA 4FV7A 1BI8A 4DFBA 2BMCA 3V5LA 1YWVA 4LMUA 2XK6A 3AQVA 5C03A 3HUCA 2OJIA 2YLEA 2JIIA 1YI3A 4MF1A 3SRVB 4FT3A 3IW6A 4FKVA 3CY3A 5ICPA 5CANA 4X2JA 2EB2A 4IHPA 3VC4A 3QA8A 1XH9A 3UBDA 3ZONA 3TCPA 3CTQA 2GS2A 3UODA 2A0CX 3NEWA 3KL8A 3O50A 3KRWA 5FM2A 2C0TA 1OIYA 1GIHA 1PW2A 1CM8A 2ZV7A 3C4XA 4U8ZA 3C4EA 4QTBA 1XBCA 4YJOA 2C1AA 2RIOA 3FKLA 3FL4A 2IZUA 3A2CA 3LFBA 3W2RA 5GJDA 3I5ZA 3UOHA 3BEGA 3CBLA 4EOOA 2C6DA 3TKHA 3QGYA 5HE3A 5DT3A 4FTLA 3FI8A 3WF6A 1WBNA 2VWWA 4A9RA 2WB8A 3FKNA 4QNYA 3KK8A 2HXLA 3MY0A 3OG7A 3GFEA 3NVKI 2I6LA 1FMKA 4USDA 4XS2A 1KWPA 2BZKB 2HK5A 5BVKA 3ODYX 4ZTLA 4XH6A 2PVKA 3MVHA 2ZYBA 4IX4A 5EI6A 3HNGA 1BL6A 5JFWA 3R9HA 2GS6A 5GNKA 4ZJVA 3QZFA 3LCOA 3PPZA 3COMA 2UZEA 3S3IA 3GI3A 3Q6WA 2NPQA 3CXWA 1ATPE 1IA8A 4FV0A 2VTRA 1GZNA 4H3BA 1J91A 3R9DA 4UN0C 3OY3A 3DKOA 4BI2A 2W1EA 3TNHA 4RT7A 4EH3A 3OXIA 4K18A 5HLNA 3Q5ZA 3QHRA 3QTQA 4QP3A 5JZJA 3VS0A 5H2UA 3CGOA 3U8WA 2UZTA 5CNOA 4A4XA 4JDHA 2A2AA 4AGUA 5I9VA 4XG9A 2OXYA 3ID6C 2GHLA 3SLSA 4JR7A 2BAJA 3RZFA 4O6EA 1H8FA 2X8DA 4HCVA 5AV1A 3BE2A 2RL5A 4MAOA 5E8XA 2OBJA 2C6LA 4LUDA 4X3FA 2CN8A 3R7OA 4ITHA 4ZY4A 3GU5A 3EQGA 4MBLA 4MD7E 1K3AA 5AUYA 4UALA 3FYJX 2RFDA 3NAYA 4HGSA 4DFXE 3IECA 2G2HA 3C50A 3UOLA 1J7UA 1Q62A 5CZHA 4D9UA 4H3QA 4RX7A 5FXRA 2ETRA 3D5WA 4L43A 1J1CA 4AE6A 2EUFB 1YXUA 3W10A 4XOYA 3GENA 3I1AA 4M7IA 4V05A 4TRLA 1A06A 1PYEA 4KKGA 4ANOA 2YZLA 5FBNC 4WRGA 2O64A 3I60A 4D0XA 4YTCA 3V3VA 4M67A 1XBBA 4DFNA 3HRCA 3LFNA 3PJ8A 4FYOA 4TYGA 3MY5A 2FSLX 3V6SA 1GOLA 4FEUA 2X9FA 1GIJA 1LEWA 2XK3A 3OF0A 5EW3A 5ETCA 4E6QA 5JFXA 1MUOA 3CR0A 4IANA 4J95A 3E63A 4G34A 4XEYA 4KBCA 4GJ2A 2RF9A 3GU4A 2PVNA 3LJ0A 1FVRA 4TPTA 3SXSA 5DH3A 2JIVA 4F65A 4J99A 4K0YA 5CYIA 5C1QB 2VV9A 3D5VA 3E8EA 4NTSA 3W55A 3QYZA 4JX3A 4U43A 4F9AA 5IQBA 2PK9A 2WU6A 2HW6A 4KKEA 5AAFA 4KSPA 1YKRA 3IPHA 4KWPA 3V5JA 4TXCA 4ASZA 3ACKA 2P0CA 4RIWB 3C9WA 1G8AA 4IC8A 3ZO1A 2XJ0A 3Q4CA 4PDOA 3E8NA 5GINE 3I79A 4CFNA 3F5GA 4Z7HA 3CSVA 2XRUA 3WARA 2PUIA 5AV3A 3KF4A 3Q5IA 1V0OA 3QD4A 4O22A 4ZMFA 4AZSA 4FKGA 1WBPA 5HVJA 3QQKA 1H25A 1W0XC 4TYEA 4ZJIA 3ALNA 3TZ8A 4M8TA 4G5PA 2F57A 2R0UA 5CLPA 4G6NA 4AT5A 2ZOQA 4FSYA 5IUHA 4O2PA 3UPXA 2W96B 4YJRA 4J52A 4BICA 3CC6A 2ZM1A 4P7EA 1SVGA 4OGRA 5EDRA 1UNGA 4FUXA 4YTHA 2CDZA 4I3ZA 3DFAA 1UNHA 3VJOA 1KV1A 1H0VA 3NAXA 4BKZA 5CSPA 4IBMA 5E1EA 3LXKA 4PF4A 5FDXA 3C4CA 3UP7A 3JVSA 3TT0A 3ZO4A 2VTOA 3QXPA 4PPBA 3ZFYA 4EH6A 3MB6A 3LXNA 4WIHA 3VBWA 2VTMA 1ZOHA 2H6DA 4NCTC 2CMWA 3GVUA 3KK9A 4TY1A 3U4UA 4DH8A 5JFVA 3BHVA 4FKRA 5GIOE 3G5DA 3BHYA 3RK7A 3NUXA 2C6EA 4F9BA 1PXPA 2QODA 4E8AA 2ZMCA 3VBYA 1STCE 2WO6A 2GCDA 4FKPA 4WO5A 4ZJJA 2JKOA 5AEPA 1SM2A 3QUPA 3LFAA 3VS2A 4A9UA 4CXAA 1CTPE 4EK5A 5IQAA 4IWDA 5CAPA 3PVGA 1KOBA 1BMKA 3BLRA 1W8CA 5I0BA 5AM7A 2VTAA 5HKMA 4ANNA 3U54A 4O1PA 3TZ9A 2XIZA 3UVRA 1V0BA 2ZM4A 5DFPA 2BILB 2UW3A 3O8UA 5I9WA 3KMWA 4IACA 4OTGA 3ERKA 3CP9A 3V01A 4NM0A 3GCVA 3SKCA 3K3IA 2OZAA 4TW9A 5CTPA 4DF3A 4JIKA 2V5QA 3T9IA 4BWXA 3FMHA 3EL8A 3Q9WA 4O0SA 4RX8A 3RP9A 3D4QA 4FIIA 4B8MA 2W9FB 1F0QA 1Q5KA 2VGPA 2OF2A 2AYPA 5KE0A 3BHUA 3NNWA 5AP7A 3R2YA 3HZTA 3IONA 5A3XA 3F69A 3F7ZA 4ENYA 3CKXA 2G2IA 3FI2A 4CEGA 3COKA 2BKKA 4ZZMA 4O0WA 1DAWA 3R04A 2ERZE 4MXXA 5CF8A 5BUIA 3GBZA 2WMAA 5B2KA 4O0VA 3WYYA 2JD5A 3UMXA 3ZLWA 1PXNA 4C4FA 3S1HA 4A4OA 4WNOA 4C59A 2WQMA 5CALA 2PVMA 4N4SA 3UTOA 5CY3A 4XUFA 2CHLA 1YXTA 2YIYA 3N9XA
chains in the Genus database with same CATH superfamily
4KIOA 4AA4A 4NM5A 2R3RA 4L46A 2Q0NA 2BDWA 3DKGA 4QMLA 3DJ6A 4FUYA 1ERKA 3C0IA 4TT7A 3CCNA 2I7QA 4QYEA 3U6JA 3A62A 3IO7A 2YJRA 2BPMA 3SRVA 3A7IA 3ORMA 4PTGA 4UEUA 2IVSA 5EK7A 5CEOA 5C9CA 4J97A 2OH0E 4FV6A 4GYIA 3DPKA 3G6GA 3IW7A 4YZ9A 5DR9A 3WZKA 4D4SA 5KMKA 4L3JA 4ACDA 3F3TA 1H27A 4Z55A 2ZV9A 4FSZA 1P2AA 4ANSA 2UVYA 3L1SA 4FNWA 3R71A 4L42A 5TR6A 1J1BA 5D7AA 5KMIA 3PJCA 2JKKA 4L67A 4TL0A 2QO2A 2A1AB 1WMKA 3QTWA 3HDMA 3GC8A 4ACMA 5A4CA 2LAVA 5GZ9A 5F1ZA 2J0KA 4QP8A 4EKLA 4C33A 3MI9A 2XMYA 4GFOA 1Q8ZA 1KE8A 2WXVA 3P7AA 5ANKA 4QTCA 2HWOA 4FICA 4NSTA 3MFSA 3TDWA 2UZDA 3FLZA 2OW3A 3LXLA 4KBKA 3H4JA 4RZWA 5DR2A 5IA5A 2PZIA 2IVVA 4R1YA 5E91A 2ITTA 5CXHA 1Q3DA 4GT5A 4QMPA 4F1MA 2I0VA 2OF4A 1U5RA 3BZ3A 5DBXA 5TO8A 5BVWA 3RPVA 3OUNB 3MW1A 5ANEA 5IMEA 4HZSA 4XG8A 3JY9A 4RPVA 4BKJA 3SGCA 4BCNA 4H36A 3P23A 3C13A 2ITPA 2ITVA 3NYNA 5CI7A 1W83A 3PSCA 5K3YA 4BL1A 3KN6A 4OBQA 3GCQA 5CEQA 4ALWA 2IPXA 3BE9A 1PY5A 1OMWA 5AA9A 4CQGA 5L8LA 4YBJA 5FP5A 3PA5A 4PMMA 1YXVA 4IWPA 5FLFA 5FTGA 1OL1A 1CKIA 4P2KA 1Q8UA 4TWNA 4DEIA 4AQCA 4CFFA 2O63A 5HTIA 2OJJA 2DQ7X 2QO9A 4Y85A 4UWYA 4NWMA 5E8SA 3U6HA 2VX1A 2QURA 2XBAA 3LHJA 3RM7A 4IAFA 4QMOA 1M14A 3FE3A 1OB3A 2YFXA 3DQXA 4WRSA 5DOSA 4EEVA 2B9FA 5CEPA 4O4FA 1WZYA 3OWJA 1Q8YA 4OT5A 4R6VA 3QTRA 4F64A 1TZDA 3V6RA 4XV1A 4NH1A 4UMQA 1XO2B 3MVJA 3QU0A 4FV8A 3RBWA 5BMSA 2OFVA 4FKTA 1H0WA 3UO5A 4HCUA 4IXPA 4LGGA 3NUUA 5HQ0A 2JKQA 3FI4A 5C26A 4GW8A 5ANOA 5I9XA 4FMQA 2F2UA 2RFNA 4R7IA 3WIGA 4JRNA 4UYAA 4BCKA 3BLQA 4DDIA 3P7BA 3RMFA 2Z7LA 4F0GA 4FG8A 4DTKA 4BI1A 2OLCA 3AC8A 5IG1A 3VAPA 4CMTA 2X2KA 2JBPA 4Q9ZA 3GGFA 2YWPA 4FTIA 5ETFA 3RAHA 3H30A 3E87A 3TZMA 3BIZA 2QONA 3IDCA 5AP6A 1T46A 3BYOA 4RIWA 3TG1A 4O7VA 4L8MA 4EUTA 2B55A 5JN2A 5LVMA 3LFEA 3CE3A 2B54A 3TJCA 4EQMA 4ZZNA 5CEMA 3UNZA 5FXQA 2UW4A 4IM3A 4HVSA 4QTDA 5FBOA 1WBSA 3HV4A 4J71A 3FMMA 4WBBB 2PYWA 1L8TA 1ZZLA 2ZV2A 3QBNA 1ZY5A 4K33A 4OAUC 4FEXA 4I92A 4O0YA 3RINA 2R3MA 1CMKE 4MTAA 4E5AX 4UX9A 1YWRA 4AUAA 1R3CA 3R21A 2X1NA 3VHKA 4QD6A 5JQ5A 2XNOA 5HO8A 5AM6A 4MD8E 4M0ZA 4B6LA 3R7GA 3BL7A 2XAMA 2BIYA 3OOMA 3CJGA 2UZOA 2YAAA 3PXRA 4H1JA 4PL3A 2JAVA 3TI1A 3ZC6A 2W1IA 4RVMA 2XH5A 4NFNA 3VQHA 3OW3A 4LQMA 4WG3A 4Y46A 3OXTA 4D9TA 4EHEA 5I3RA 4F0FA 4PL4A 3RZBA 3C0HA 2VGOA 4XP0A 4HNFA 1W82A 4MXZA 3WZJA 4BDCA 2CKQA 1MQBA 4MBJA 2JBOA 2R9SA 4QPAA 4YBKA 4E20A 3ORPA 4PTEA 3NUYA 1UA2A 5BMMA 3ZDIA 1Y8YA 4D2TA 1SNXA 3C4FA 1W2FA 2J2IB 3QQJA 3LZBA 3KCKA 2R3KA 3KC3A 3EB0A 4FV1A 5LARA 3RAIA 3KA0A 4FKWA 4FI1A 4FZ6A 4YU2A 2WKMA 5DPVA 3AT2A 2C3IB 3NW6A 3QXOA 1OECA 4BCFA 4ZS0A 4Q9SA 3A7GA 3RCDA 3WZUA 4FSQA 2PUPA 3GOKA 2OJ9A 3V8WA 3VUDA 1OVEA 4IWOA 4NCTA 2BRGA 4S32A 2X7OA 2Z2WA 5AA8A 3ODZX 4QOXA 4APCA 2W9ZB 4KUJA 2F7ZE 4GVAA 4RJ3A 3UG1A 1YDSE 3UQCA 3O7LD 4BBFA 3LFDA 4JG6A 3HL7A 2QU6A 4RA5A 5FDPA 4ERWA 3MPAA 4FA2A 1KSWA 1GZ8A 4M68A 5E7RA 3ZOSA 4FTKA 4O83A 4NK9A 2W17A 1A9UA 5IH4A 3VONA 2XYUA 3TKIA 5AADA 1FBNA 3KF7A 3ZTXA 2IW9A 3LKMA 2Y6OA 4WT6A 4YHJA 5DHJA 5KHWA 4PPAA 3KIOC 3OHTA 5FD2A 3EFLA 3HP5A 3AKJA 3BLHA 4ZTRA 5K4JA 2YHVA 3UC3A 4L00A 4KINA 3R1YA 2GS7A 2XJ2A 5AP0A 2R3FA 3MV5A 2WOUA 4PTCA 4S34A 4QP2A 3P7CA 1YXSA 4FEQA 4E6DA 3KFAA 3ZC5A 3TZ7A 4YJQA 2PHKA 3LMHA 2W5BA 1LEZA 1H1WA 3E5AA 5HCXA 2C6MA 3DNEA 5TF9A 4ZK5A 3VBVA 4BDJA 1Q8TA 5DT4A 1PXJA 2XIKA 2HZ0A 3MGYA 4BCHA 3U6IA 4MNEA 3FZOA 3QD0A 3G6HA 3UC4A 3IOKA 3UZPA 3UDTA 3PZEA 4C3FA 5LXMA 3KXNA 4EC8A 3ZFXA 4XV3A 1PF8A 3BQRA 5C4LA 1PXMA 2YDKA 3CQWA 3CTHA 1H08A 3W2QA 3PG3A 4U6RA 3ZSIA 4EQUA 5LJJA 1Z5MA 1TQPA 4FYNA 5HICA 1DI9A 2QOCA 3FY2A 3ZBXA 1CDKA 1F5QA 3POOA 2IJMA 5CAQA 4ZAUA 4IM0A 5HIDA 3FEGA 5HCYA 4EUUA 3PP0A 1XH6A 5DEYA 4BKYA 2BALA 4NM3A 5AIKA 1QCFA 4BB4A 5I9UA 4N6YA 4EHVA 5DYJA 1NVQA 2WTDA 4MYGA 2Z02A 4S33A 3DXQA 2QR7A 3KXXA 3CY2A 5IQCA 4RJ8A 3AMYA 4ERKA 5M57A 2P2HA 4GUBA 3QTUA 4U44A 3O2MA 2GNFA 3UIUA 3SV0A 3RPSA 3WBLA 3QUEA 5M07A 3R28A 3LFCA 3ANRA 1DI8A 3MVMA 2XCHA 2R3IA 2XB7A 2F9GA 4ZLYA 1GZKA 3AMBA 1VYZA 1B6CB 3GC7A 3KRLA 3WZDA 3T9TA 4L3PA 4O7YA 1KE6A 2RSVA 3ORXA 1IEPA 5FRIA 2XK8A 3FMLA 3O0GA 3M2WA 4LMNA 3JPVA 3NNXA 4HOKA 2ETKA 3ZHPC 2XKFA 3M1SA 3QUDA 4F9YA 3HMPA 3RJCA 3NDMA 3DOGA 3LLAA 1ZRZA 2JDTA 3TV7A 4BVUA 4YR8A 4EYMA 3U9NA 5JK3A 1RQQA 5KNJA 4CLIA 4U3ZA 3LPBA 4FODA 3AC4A 3DZOA 4KBAA 2OKRA 2FUMA 1XH4A 3MSSA 1ZYDA 5I5ZA 4IDVA 4AZTA 2X7FA 4FV4A 3FHRA 4LG4A 5CEKA 4CRSA 4G3GA 5GZAA 2PMIA 4JVGA 4WNPA 1XBAA 4V01A 3PUPA 1M2PA 4I1ZA 4AGCA 1PRYA 4OTQA 5AP3A 3PLSA 3GU7A 4GU6A 1KUTA 4NUSA 2AEGA 2YEXA 4ZTQA 5J5SA 3FUPA 4YNEA 1AGWA 4M97A 2R3HA 4MEDA 4F9CA 3UYTA 5L2TA 5ETIA 3ZXZA 2B4SB 2BROA 3II5A 4QP9A 5HX8A 3P5JC 4QMXA 2IZRA 2QQ7A 4RJ5A 4LRMA 4ACHA 5F9EA 5GJFA 2WMXA 4BWKA 4EZ3A 2IEWA 4KA3A 3PG1A 4MQ2A 4W8EA 3I7BA 4FSRA 2WTKC 3DBEA 3C4WA 3UZTA 4HYSA 3R7EA 3OCSA 1OIUA 4LV8A 2A27A 4I5MA 4YZCA 2I0EA 4FTUA 3G33A 4I5CA 4O27B 3NIZA 4Z9LA 4KIPA 3ZUTA 1W84A 3CPCA 3TXOA 3QQFA 4QYYA 3R8VA 4YO6A 4U5JA 3LFQA 1H01A 4RG0A 3Q6UA 3VS6A 3NNVA 2ESMA 5HE2A 1W98A 3VS3A 4U42A 3TUCA 2P33A 4O0XA 1Y6AA 5CT0A 5A9UA 3TV4A 2CSNA 5JEBA 3RVGA 2XIXA 1CKPA 4BTJA 2CGWA 2WTKB 2ZVAA 4OUCA 3BKBA 4G5JA 3TIYA 3W18A 4BHZA 4DC2A 2QC6A 1VJYA 2J0IA 2XBJA 3V5PA 3BHTA 3DBQA 3EZVA 3RHKA 3GQLA 1WAKA 3ZLSA 5TE0A 1OZ1A 2ZDUA 5K4IA 5E8ZA 1DM2A 4XLIA 2BCJA 2OIBA 4UWBA 2B7AA 4QQ5A 3HV5A 2VNYA 3O7LB 4JQ7A 3BBWA 3F3UA 2X0QA 1XH7A 1R78A 2BTRA 2QOBA 2VUWA 3JS2A 2Z7QA 3TJDA 4EWQA 1ND4A 3WE4A 1Q99A 2W1FA 4GSBA 2R3LA 4JI9A 2CLXA 1JKLA 4YC6A 3F61A 3OTVA 5KX8A 5IQGA 5T68A 2F4JA 4ALUA 5A46A 3QLGA 4FNZA 4YC8A 2HWPA 3A4PA 4XCUA 3ZUUA 4DGNA 1O9UA 5ACBC 4F9WA 5J9YA 4ANQA 1A48A 1BL7A 3RPYA 4GV1A 4CTCA 3VS5A 3BEAA 4ZY5A 3C5UA 2Y4IC 4G6OA 3LM5A 4AW2A 4KABA 3TMOA 4JS8A 2O2UA 4IH8A 4C37A 1P4OA 4ZSGA 3R1NA 1JWHA 4QP1A 1G8SA 2X81A 4CT1A 3D5XA 3LCDA 3TIZA 2PVHA 4QMTA 1IAHA 1AD5A 2GTNA 3PY3A 4R7HA 2PSQA 3MFRA 4FR4A 4PMSA 1OL6A 1NXKA 2WMRA 3NYVA 4IZ5A 4EORA 1UVRA 2O8YA 4E7WA 1DS5A 5DRBA 2VTTA 2OWBA 4WBOA 3V8SA 5A4QA 1RE8A 1E1VA 3G0FA 1SVEA 2QI8A 2Y4IB 3OBGA 5L8JA 2GFCA 2ITWA 3PA3A 1PJKA 3K3JA 4X2GA 1OIRA 3JY0A 2C6KA 5A4EA 4D4YA 5HVKA 4XP2A 4C2WA 1Q4LA 4IVBA 3AGLA 4EKKA 2EU9A 4N6ZA 4BGQA 4AXFA 3A99A 4DHIB 4FVRA 4EONA 4Y5HA 2FA2A 2XZSA 4DHJA 4EOPA 2W1DA 4UV0A 3P78A 2CN5A 3H10A 4S30A 3VBQA 2BZIB 4D0WA 2GMXA 4Y95A 5JQ8A 4ZSEA 3WE8A 3AG9A 1G3NA 4IJ9A 4ZXTA 5HIEA 3QAME 5L4QA 4DH7A 5LMBA 2JDOA 2XNPA 3W0MA 1KE5A 4PX6A 1H1QA 3C51A 4O1OA 4JBOA 4R3PA 2VWBA 4YHFA 3W1FA 4FC0A 3QGWA 4M13A 3VBXA 3CLYA 4FIEA 3KVWA 4O4BB 4E73A 5CVFA 5CWZA 3SHEA 4BCIA 4D58A 1UKIA 4U81A 5E8VA 4EOLA 5IEXA 1H26A 4AZVA 3W0PA 4RFYA 5BVFA 4IX3A 5K5XA 2PE0A 4QP4A 4D55A 4C3RA 5GHVA 4L6QA 4FKIA 5CEIA 1H28A 4J7BA 3B2WA 5DWRA 3CTJA 4GFMA 4JOAA 5M4IA 4IB3A 4O21A 2VTJA 4QMZA 1M7QA 3I6UA 2PU8A 3DV3A 1M17A 1XKKA 4RX5A 4CD0A 5DLSA 3TKUA 4FIHA 4C38A 3DT1A 4FSMA 4AFEA 3BU6A 3QHWA 3CS9A 3VULA 2GPHA 4R3CA 5EOLA 4QMVA 5LOHA 1Y91A 2V22A 4BIDA 2J0LA 4H39A 5DEWA 4F1TA 2YLFA 3D7TA 2C6TA 4EI4A 3VWAA 2WMTA 2WQEA 4EOJA 4X2NA 4FEWA 2CKEA 3CJFA 2V62A 2FO0A 2B9IA 2BHEA 3C1XA 3IGGA 4ZIMA 3DCVA 1G8KA 4NIFB 4MXAA 2GSFA 3DK7A 5CSXA 1UV5A 3ZBFA 4AW1A 2ACXA 5BVEA 3K5VA 3QWKA 4FX3A 5HCZA 4C58A 4LRJA 3HP2A 2H96A 4QMUA 4USEA 4F6SA 3EN7A 5IA4A 3KGAA 1H24A 4JBPA 3F66A 4FBXA 4RLLA 4YZMA 2B1PA 5E92A 3PLAE 4WSQA 3OXZA 1W2DA 2J6MA 3ORLA 4WG4A 4E6AA 3QCSA 4B7TA 4B99A 2I0YA 4L9IA 5DNRA 2UVZA 2PMOX 5IF1A 4IWQA 1HCKA 4PNKA 1ZAOA 3BL9A 2CJMA 4FTMA 4I93A 3A61A 5CU2A 1U59A 2YM4A 3KEXA 2WHBA 4G6LA 3DAJA 3UZRA 2W99B 3F3WA 2VX0A 4WG5A 3BV2A 3I0QA 4ZTMA 3JR1A 3OEZA 2R3JA 1HCLA 1U4DA 3Q4UA 4QDVA 3H9OA 4FIGA 5KMLA 2YWVA 4L53A 4CCBA 2ITNA 3IGOA 3TDVA 3QQUA 5IU2A 2YIWA 4QQCA 4EH5A 3IK3A 3VRYA 4PL5A 1GIIA 4H58A 4K1BA 5HHWA 5KMOA 4CCUA 5H8BA 4B9DA 5AR2A 2GQSA 3Q9YA 4GFGA 4XMOA 4A9TA 4IADA 2QKRA 3L9MA 3EKNA 3HAMA 2E2BA 3F5PA 1YOJA 4QMNA 2BZJA 3HYHA 3RNYA 4D5KA 4YLKA 2YCSA 3V51A 1B39A 2ZM3A 4LM5A 1JLUE 2A4LA 2F49A 3FQHA 4XV2A 4AGWA 5D12A 4AZEA 4EC9A 2UZUE 3FY0A 4NL0A 3FC2A 2NO3A 4QO9A 1YHSA 3UJGA 2PWLA 4BTKA 1OUKA 2OGVA 4RWKA 3IOPA 2B0QA 4FT5A 5LVPA 4ANMA 3SW4A 5JGBA 4U45A 3Q3BA 4FV9A 1BLXA 5BYZA 3ZM9A 2E9PA 1U5QA 2UZLA 3DKCA 3PXQA 3W0OA 4RMZA 3O71A 4RIYB 3VUKA 3R30A 5EYCA 2IZSA 1Z9XA 3NYOA 4TWCA 3LOKA 1KOAA 1OBGA 3NYXA 5HTBA 4I5HA 3VN9A 4DH5A 5C8NA 4XNEA 1WVYA 4J1RA 2X0PA 5M08A 4XJ0A 4ZSLA 5JGAA 4L7FA 4M69B 4RFZA 4C61A 4FVPA 5E8YA 4WHZA 5EYDA 3GC9A 4RC3A 4L52A 2HYYA 2PZRA 3AOXA 3D2KA 2J5EA 3EN6A 4DH1A 3FMEA 4X21A 3ZM4A 3H9RA 3WILA 4J8NA 3PXYA 4M0YA 5EG3A 5HO6A 4HNIA 5IA1A 1OI9A 3E88A 5HOAA 2XS0A 1YXXA 5HGIA 3KMUA 4CG8A 4GK3A 4FIFA 3V5WA 1PKDA 2B9HA 4G3CA 4GK4A 4TYIA 4DAWA 3NSZA 5C01A 1JOWB 3D15A 3V8TA 4U3YA 3G51A 4I5PA 5IISA 3PJ3A 2HY81 4G3DA 4QMQA 1JSVA 2QHMA 2IWIA 2J51A 4MWHA 5FEDA 2GNHA 2YM7A 3QRUA 4FIJA 5CF6A 3RAKA 3H0ZA 4FTNA 5L3AA 2VWVA 5HLPA 4AXAA 3VUGA 3FI3A 4OTFA 4AQKA 4RC4A 3PJ1A 4XBUA 2Y9QA 2RFSA 3U87A 4BDKA 2IVTA 1FPUA 2ERKA 2R3PA 4K8AA 1YDTE 2W5AA 4ANLA 3T8OA 3PVWA 5LQFA 1JQHA 2H9VA 4BGHA 5AV4A 4FOBA 3PXFA 1ZYJA 4XOZA 5ANJA 4WUAA 3R7UA 1VYWA 4UBAA 4I23A 4L44A 5KMNA 4RBLA 4AFJA 3MTLA 4FTTA 1ZY4A 2I40A 1FGIA 5AAEA 2R3GA 4KIKB 3FV8A 5E4HA 3BYUA 4YJSA 5CSWA 3ZRKA 3BGQA 3D7ZA 3GEQA 3COHA 3RK9A 4MXOA 2WQNA 1JKTA 4HYIA 4FV2A 3ELJA 1M2QA 3LMGA 4FGRA 4GIIA 2IF8A 2X6DA 3QZGA 3KU2A 3FZPA 4AWIA 3F5UA 3FHIA 4CZUA 1YOLA 3WIKA 3HECA 5BNJA 2ZB0A 3UYSA 1FVTA 2CCHA 1PMVA 4GEOA 4I20A 1BX6A 1Q41A 1WVXA 3R7YA 2KULA 3NW7A 5FTOA 4NZWB 3GXLA 5KKRC 5H8EA 2VWIA 3IDBA 4MX9A 4BZOA 1LUFA 3R9RA 3R02A 3VJNA 2UZBA 4M15A 4NM7A 3E3BX 3T3VA 4BC6A 4NEUA 3LLTA 1H07A 3D0EA 3ZFMA 4AT3A 2WIHA 2R3OA 3TEIA 2PY3A 3G9LX 4LOQA 3A4OX 1XMLA 4ORKA 4FG9A 3K2LA 2WTIA 5F95A 3ZZWA 4ZLOA 4E4MA 4RX9A 3TACA 5B2LA 5M06A 4MNFA 3A8XA 3AD4A 4IMYA 4RJ6A 4GJ3A 3MY1A 2X8IA 3KY2A 4EHGA 5KKRB 3LMIA 3WOWA 3QRKA 3R01A 3CD3A 2C3LA 5KZ0A 2J9MA 3ZZEA 2QNJA 5J5TA 4A9SA 1ZYCA 3PPKA 1J7LA 4C4EA 4DEEA 2VAGA 4DDGA 5EKOA 3K5UA 5HORA 2F2CB 2XARA 3LAUA 1J3HA 4FSTA 4JQ8A 3DAEA 1Q97A 3P1AA 4EBVA 1L3RE 4XHKB 1RJBA 2C47A 3EH9A 3R2BA 2WQOA 4IZAA 4IW0A 4P90A 4QMSA 4HVHA 5BPYA 5HO7A 2R0IA 3BELA 3W0SA 5JRSA 2QVSE 3NRMA 5EM6A 3HDNA 3LJ2A 4DITA 2W1ZA 2ZAZA 1SZMA 2UV2A 1MRUA 1Y57A 2Z60A 4FTQA 4GG7A 2WTJA 4A4LA 4NIFA 4ENXA 4UMPA 3ATTA 2F7EE 2JDVA 3CD8A 3HRBA 3EQFA 3O17A 3TWJA 5LMKC 3U4WA 4O7LA 4AW5A 5FP6A 2Y6MA 2JIUA 2XK9A 2P2IA 3I0OA 2GNGA 2WQBA 3DZQA 3NLBA 2J50A 2QHNA 4Z16A 3EMGA 5B2MA 3N4VA 1YQJA 4YZDA 3VUMA 4M3QA 5HD7A 5IEVA 2GNIA 3RGFA 3N4UA 5CU3A 3FLSA 4AGDA 2Q83A 2C3KA 1S9IA 4YMJA 2F7XE 4BTMA 4QTAA 5DVRA 4KD1A 5D11A 5AJQA 2WELA 4IAIA 2NRYA 4EK6A 3PSBA 1H1PA 4EYJA 4FE2A 3OD6X 3TTIA 4D5HA 4N57A 2YM3A 5IH5A 1SYKA 2GDOA 4JIAA 3SD0A 2CLQA 4C4GA 1BKXA 1IASA 1F3MC 4FKQA 4YTFA 1R0PA 1JSUA 2PVYA 5HLWA 3M42A 4I6BA 1V1KA 1R1WA 1WBVA 3NNUA 3F6XA 4YGAA 1PHKA 4QQJA 4I0SA 5HTCA 1YVJA 2CNVA 1ZMWA 2O5KA 2Y0AA 4GCJA 3S2PA 2CKPA 1VZOA 5A6NA 5CU4A 2VWZA 4QMYA 1CKJA 5K0XA 1GJOA 2C5OA 4IB1A 5AV2A 5G1XA 3RCJA 3W32A 3QCXA 3W16A 1G8JA 3FLYA 4O82A 4CFXA 3SOAA 2UVXA 5DN3A 1OM1A 3RKBA 3ZRMA 4IVAA 3R8LA 4TN6A 1DAYA 2DS1A 4V0GB 5H3QA 5HEZA 3EQCA 2B53A 3GB2A 3IG7A 2W4JA 4DBNA 4OTIA 5IKWA 1VLRA 4IFGA 4F08A 3FKOA 4O7TA 1EH4A 4H05A 1Z57A 4IDTA 3LJ1A 4JG8A 5ACKA 3C4ZA 3OCBA 2REIA 2YJSA 4JQEA 3VW6A 1BUHA 3FAAA 3FZSA 1WBWA 1APME 3SAYA 2VTNA 2HY0A 3R63A 1OGUA 4R1VA 2PUUA 3QRTA 4QTEA 2YIRA 2JC6A 4GKHA 1ZMUA 3PYYA 2WMSA 3I5NA 3Q4ZA 4OT6A 3CQEA 3KRJA 4U80A 2WU7A 2VTSA 3OMVA 4G1WA 2ITQA 1YI6A 4RIYA 2OH4A 4YLJA 4GK2A 1ZYSA 5EYKA 5LVLA 4D1XA 3P9JA 2PZYA 4OW8A 3PRIA 2JEDA 4QRCA 4QYHA 5E90A 3VQUA 3D9VA 5DI1A 3TL8A 4C8BA 3PFYA 3DBDA 3O23A 4J98A 4X6QC 1XJDA 2ONLC 4S2ZA 1BYGA 3E8CA 3THBA 3JUHA 4ASXA 4FZFB 3GFWA 2VN9A 2J5FA 4MH7A 3ULIA 2W5HA 4BGGA 4DEHA 2XJ1A 3OWPA 4XG7A 3ZSGA 1P14A 4BDEA 2C30A 3ORKA 3ML1A 3OVVA 2YIXA 3O5AA 2XRWA 5IA3A 3VUHA 4ZEGA 4YSMA 3GCPA 3QX4A 4NT4A 3AC2A 3EQRA 4C36A 2SRCA 1UKHA 3JYAA 2BDJA 5AR8A 3U55A 4D2PA 4ONAA 4LDTA 1LP4A 2P3GX 3EZRA 3SX9A 4XLVA 4C57A 2Z8CA 3D94A 3V04A 4BDHA 2VWUA 2EXCX 1ZARA 4CVAA 4I0TA 5IDPA 1OKWA 1OITA 2QKWB 2VTPA 2FH9A 2UZNA 4G31A 4OTRA 3ZXTA 5T6KA 2VO3A 4D1ZA 4GVJA 1H00A 4KRDA 3UIMA 2W1CA 1JSTA 4PMTA 4D4VA 3OFMA 2O65A 4IAYA 3MTFA 4CGAA 4EQCA 1I09A 2A19B 1OUYA 3E8DA 4O86A 5IH6A 4GU9A 3UPZA 4YURA 2B52A 4JX7A 4TWOA 4E6CA 4JDIA 3SQQA 5EW9A 4X3FB 2WMWA 4E26A 4Y72A 5C8KA 3MH2A 3MB7A 3PY1A 3DY7A 4F99A 4DLJA 1PXKA 4CKIA 4O0UA 4C62A 1O6KA 3H9FA 2EB3A 3NUPA 2YIQA 3Q96A 4U41A 5A4TA 4DCAA 4G9CA 4CG9A 5CU6A 2OXDA 2AC5A 4X0MA 4KIKA 3SC1A 3JXWA 4F0IA 3F5XA 2ZB1A 5EM7A 5AX9A 1PXIA 5FEQA 3L9LA 3KRRA 3FZ1A 3NWWA 4RA4A 2XEZA 2XM8A 3F3ZA 4X2FA 5AP1A 4CKJA 1AQ1A 3UGCA 4EOIA 1H1SA 1HOWA 2PVRA 3MH3A 3OOGA 3VIDA 4LL0A 4C4JA 4Z3VA 3QC9A 4M12A 3R7VA 3B8RA 1K2PA 5BQ0A 2BFYA 4O91A 4RSSA 3U51A 2NYAA 3H3CA 4I6QA 4MBIA 2RKUA 3I6WA 2WZJA 1WBTA 2VO6A 2OSCA 3HMIA 4R8QA 4H3PA 4Y8DA 4R78A 4IAKA 3ENMA 4M84A 2X2LA 3EYHA 4R5SA 5D1JA 5TT7A 5BUJA 1OPLA 5EOBA 3EQDA 4KB8A 5L2SA 4UWCA 3G0EA 4HVGA 2O0UA 1ZMVA 2YDIA 2YERA 2R2PA 4Z7GA 1ZOGA 4CFVA 2BRBA 4D2SA 4OAVB 3FDNA 2FSOX 3F3VA 3UDBA 2RG6A 5AMNA 5HESA 5JT2A 2NP8A 4DGMA 4C7TA 3SDJA 3W8LA 2FSTX 4W4XA 4C02A 5IZFA 3IS5A 3COIA 5DIAA 2QR8A 2HOGA 2XKDA 3QRJA 4CV8A 2E9NA 2XP2A 4AW0A 1U54B 5JGDA 4I4FA 3FWQA 4OLIA 1GNGA 2YN8A 4CFMA 2JAMA 3QALE 3MH0A 1QPDA 4I41A 4IIRA 1YW2A 1REKA 4YJUA 4L01A 4FTRA 3PVBA 4FKJA 3N51A 2BRMA 5CF4A 4O7WA 2UZWE 2XYNA 4GL9A 5AWMA 4UZHA 2UUEA 4WUNA 2OG8A 3OC1A 4FL3A 4AZFA 5EI8A 5A54A 3LXPA 2FB8A 3LCTA 1LPUA 4RC2A 4BTFA 5I9YA 5TKDA 2IZTA 4N70A 5AR5A 4RWJA 4E1ZA 2J90A 3F2NA 4R7BA 5FEEA 3FSFA 4EJNA 4FEVA 4W8DA 5EM5A 3Q53A 2HZIA 3MH1A 3OWKA 3CKWA 1UU8A 5BYLA 2XCKA 3KMMA 3EQBA 3RNIA 3Q2MA 4DGGA 3ANQA 4AS0A 1MQ4A 3BWJA 4U9AA 2RG5A 2W1HA 2VTHA 3QA0A 4ARKA 1M2RA 4W9WA 4EH4A 5IA2A 3FXZA 4DN5A 4LFIA 3QF9A 4G16A 5CXZA 2WEIA 3E3PA