5KMMA

Trka jm-kinase with 1-(2-methyl-4-phenyl-pyrimidin-5-yl)-3-(1-naphthyl)urea
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
314
structure length
301
Chain Sequence
SGLQGHIIACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords High affinity nerve growth factor receptor
publication title Structural characterization of nonactive site, TrkA-selective kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 301
sequence length 314
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5kmmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5kmmA01
4O1OA 5DFPA 2E9NA 4U40A 4W9WA 4AOJA 2B54A 3DU8A 3GQLA 4QQ5A 4PPBA 1VYZA 3QD2B 3WYXA 4O21A 3ZMMA 3EL7A 3ZYAA 2YWPA 2P3GX 5EQYA 1ZARA 4U3ZA 2G15A 4CCUA 4BCPA 5J7HA 3UGCA 2PVKA 3NSZA 5CU0A 3IS5A 4YC8A 5LVLA 3RPYA 4JX7A 3I5ZA 2UZWE 5AP3A 4BCFA 3TTJA 4C62A 3KREA 5D1JA 5IQEA 4FK3A 3F66A 3R73A 3AXWA 2W9FB 3BLRA 4E6QA 3DKGA 4LGDA 4QP8A 4DFXE 1Y8YA 4FTLA 4RWJA 4E4LA 1J7IA 3O0GA 4AFJA 5B2MA 2BFXA 5H2UA 2IZUA 2WQNA 1OL5A 4FUYA 4L7FA 1XH9A 2R3LA 2Z8CA 1U5RA 4LG4A 1JPAA 4JXFA 2OKRA 4ZY4A 3QQLA 5BVNA 4ONAA 2Z7QA 5DYJA 5A46A 3Q5IA 4ITHA 1ZMVA 3DBFA 2Y9QA 3HX4A 4RFMA 4WO5A 1GIIA 3JY9A 4IVBA 4QMXA 3EQHA 1GOLA 4CFUA 5KKRC 4BDCA 3ZHPC 2XIXA 4U42A 2P2IA 5AP0A 3T9TA 3ODZX 3ZO4A 3R83A 3D0EA 4M3QA 2ZOQA 1UV5A 3QRIA 4F9AA 1YWRA 5KMKA 2EXCX 2VX3A 3DS6A 4KS8A 3FEGA 5IA5A 3LM0A 4BDFA 3KK8A 5ANKA 3Q4CA 3W2SA 1ZAOA 3V6RA 4JDKA 1YQJA 3QXPA 1XBCA 3QA0A 4V01A 4K33A 2W9ZB 4ACCA 4NT4A 4D2RA 3C5IA 4CMTA 3VS7A 3R7VA 3Q9YA 3AQVA 4DH8A 3PLSA 2XKCA 4I3ZA 3HP2A 4BI1A 4I5PA 2B9FA 4FKPA 4I22A 4WNOA 3LFBA 3BHYA 2QOHA 3JVSA 3MY0A 5J9YA 3RPRA 4ZZNA 3PE1A 5KNJA 5HO6A 3LLTA 3VUDA 3IOKA 4IVDA 4ZTMA 1Q97A 2QR7A 3VS0A 4C4FA 1GY3A 4PL3A 3ULZA 4FEWA 3DKOA 4I5MA 4J96A 2DYLA 2I0VA 1DAWA 5M55A 4N6ZA 4BR3A 4Z9LA 2WTVA 4CYJA 4BFMA 3QQKA 4O27B 4BCKA 3BYUA 3F5UA 2ITXA 3PJ3A 4ERWA 3G9NA 2UW9A 5EM7A 4A9UA 4O84A 3Q9XA 4RJ6A 4EHGA 2YISA 4OBOA 3IW5A 5E8SA 4O0SA 4RWKA 4LMNA 3R9DA 1MRUA 4I41A 5ACKA 4B4LA 1K2PA 4O7RA 3V8TA 4NM3A 2PE1A 5CF8A 4D28A 4LGHA 3HUCA 5I9UA 3DBEA 5TE0A 3OEZA 3ZM4A 5H8BA 5IQHA 4F9BA 4AU8A 4DG2E 1V0BA 5HX6A 3CC6A 2YIRA 4ZMEA 1KWPA 3AC2A 2PTKA 4DCEA 5TKDA 1QPJA 3Q32A 3R8UA 4E1ZA 2ZAZA 3GOKA 2XRWA 3V6SA 5K5NA 2J9MA 2ZV8A 3LCDA 3ANRA 4MXOA 3VUGA 4AFEA 4CFWA 4QD6A 2JAVA 4MBIA 4DN5A 3VHKA 4FKOA 2Y0AA 3CTHA 4XX9A 5L2TA 4QPMA 1XBAA 2UZDA 3TDVA 1PMEA 3JPVA 3NUAA 3WI6A 2VGOA 3FDNA 1XH5A 3IPHA 3NWWA 3QC4A 2Z7LA 5HHWA 5KO1A 3LCKA 2ITYA 4FV2A 4JG7A 3NIEA 4G3FA 1H08A 5JFVA 2UZVA 2X8EA 4G16A 3I0OA 5AR7A 4H3PA 2ITOA 4LYNA 3VJNA 4F0IA 3P78A 3UO4A 4NUSA 3R7OA 4P7EA 4RPVA 2X6EA 5CS6A 3U51A 3LQ8A 2IVTA 4CGAA 4FA2A 2UW5A 5CWZA 1XH8A 5D11A 4ZTSA 3RAKA 4U0IA 5CAUA 2PSQA 2ACXA 5CSWA 3RMFA 3E8EA 4NW6A 3CXWA 3F69A 1FVRA 2UVZA 5E1EA 3BRBA 4L46A 3EQGA 4TW9A 5FRIA 3RNIA 4D4VA 3IOPA 3NDMA 2C5YA 3PY0A 4H58A 1SVHA 3GBZA 3LCOA 4E93A 5K5XA 2HW7A 1SNUA 4QYEA 3HRFA 3F5XA 4ZLYA 3AD4A 2VTJA 2ZV7A 3R02A 3QKLA 3WF8A 5FQDC 4G6OA 5ANOA 3MJ1A 3KL8A 3QTIA 4G5PA 4TTHB 3PVGA 4XG4A 3C51A 3REPA 4TWNA 3UO6A 4GS6A 5G1XA 4HVDA 4YU2A 5CEKA 2CKPA 4RJ4A 3LXNA 4ANOA 3FLQA 3HV6A 3TNQB 2OJIA 4AAAA 1Y6AA 3U4UA 3FI8A 2Q0BA 3FZPA 3KULA 4MHAA 4ZSAA 5IA0A 2A0CX 4FT0A 4IM2A 4LOPA 4BDAA 4X0MA 4C37A 5CQWA 5DPVA 5GIPE 5ETFA 4CFVA 3OTUA 2R5TA 3FPMA 4RJ5A 2J5EA 2CCHA 3GXLA 3RK5A 4A9YA 4BC6A 3R30A 4QOXA 2CKOA 4O82A 5HIDA 5IA1A 5AAEA 3C9WA 2I0EA 3QRTA 3T9IA 1H27A 2ETKA 4FTRA 2FSOX 1PXKA 2QO2A 5AEPA 2PUPA 1RW8A 1F0QA 1TKIA 2Q83A 2XBAA 2B55A 3MN3A 4FKGA 3CP9A 4EHZA 3UOHA 4BZNA 2Y4PA 3COIA 3LVPA 4RGJA 3MW1A 3ANQA 3DK7A 2JDOA 5C8KA 4EC9A 4A06A 1V0OA 2E9UA 3IKAA 5CF4A 4FTJA 5L2WA 2PZPA 3WF7A 4PNIA 5BVFA 3MY5A 4C33A 1XHAA 2I0YA 4AGCA 5JKGA 1Q41A 3AC1A 3NUNA 4RX8A 3G2FA 4KBCA 3H9OA 2WMBA 2WQOA 3IW6A 4RSSA 4AOIA 1IAHA 3ZO2A 2PVHA 1ZWSA 3LJ0A 5K4IA 4DH5A 4JAJA 5HU9A 4KIPA 1GZOA 2GDOA 4ASZA 2XNEA 4JOAA 3MFRA 4S31A 4RJ8A 5HG5A 3CD8A 3QGWA 3I79A 1WBNA 2JKKA 2XJ2A 2YCSA 4TRLA 1B38A 5B2KA 3F7ZA 2QOIA 2ESMA 3VBQA 4C2WA 5J79A 5KCVA 2QLQA 3UBDA 4ZK5A 4CFMA 4EKKA 1ZY5A 4IE9A 3G9LX 3D5WA 4YBKA 3PXQA 4LMUA 3JR1A 4DHFA 1H01A 1Q8WA 4IADA 5CU3A 4DG0E 4C4GA 2BR1A 3NUYA 4H3BA 4YC3A 4E4MA 4YJUA 2R3NA 4UMTA 5JSMA 3DT1A 3IW7A 3BE2A 2W1CA 3N51A 2PVJA 3OW4A 3TL8A 4DEGA 5F95A 4XYFA 2ETRA 5AV4A 4K18A 2J5FA 3ORIA 3Q53A 4YO6A 4DA5A 1M2QA 3F7WA 4V0GA 2KTYA 2ZV9A 2BFYA 3QX2A 4GFGA 4QMPA 2OZAB 2R3MA 2YACA 3KRJA 3FQSA 4QT1A 2JC6A 4FG7A 4IZYA 2ITWA 4FTQA 3F2RA 4XCUA 3QTWA 4DAWA 3F2NA 3DB6A 2XEYA 4L45A 5DN3A 3UQCA 2J0KA 2JKOA 3VUTA 3DV3A 3LCTA 3R1NA 1U46A 1PXLA 3VUKA 4BL1A 3ACKA 4Q5HA 3QTZA 5AV3A 4U3YA 3LKMA 4QQCA 4C57A 1BX6A 2R64A 3RAIA 3P7BA 3KXXA 3S95A 1UU3A 2BIYA 2FH9A 3TACA 2W1ZA 2BZHB 3LFAA 4BDEA 3EQBA 3MESA 1W0XC 3A7GA 3E8DA 5TR6A 5H8EA 3OCTA 3DJ7A 3COMA 4QTCA 3TDWA 2FB8A 3ZM9A 3ETAA 4R7BA 4TNDA 3MB7A 5FP6A 3QZGA 2YCFA 4KBKA 4XG9A 4U97A 2QO7A 3ZLXA 2UZOA 4R3CA 4O22A 1UA2A 4QO9A 2BRNA 2GFSA 3I7CA 3E64A 3OHTA 4Q9ZA 3HVCA 5ICPA 5J7BA 5CEQA 3S3IA 1R0EA 4EWHA 3V5WA 4DFZE 4H05A 2C68A 4CTCA 3W1FA 4FR4A 4BHZA 3PRIA 2OSCA 2VTTA 4OTIA 4AGUA 4YJSA 4DGMA 4ITIA 4PY1A 4CQGA 3ZS5A 4GW8A 4MNFA 3FL4A 4ENYA 2H9VA 4EH9A 3EJ1A 1S9IA 5JGBA 4BTKA 4L52A 2RG5A 4PP7A 2UW3A 4KB8A 5M06A 1Z9XA 4Q9SA 4OAVB 3QD0A 5H3QA 2C0TA 2X9FA 1UNGA 4BWPA 4D4YA 3NGAA 4CCBA 3TEIA 3RALA 3RCJA 3CE3A 2F7EE 4GUEA 4J95A 1ZYLA 3ULIA 4WIHA 4MBLA 5EH0A 2WXVA 3MS9A 5KZIA 4AS0A 3MJ2A 4USDA 3FXWA 4PUZA 1PYXA 1OKVA 4EH5A 4YLKA 4AGWA 4LV5A 1KV2A 3AG9A 3PRFA 5IQGA 3PIXA 4C4HA 4QQJA 1A06A 5M56A 3FQEA 4MWIA 3EQPA 4RG0A 5FTGA 3RAWA 4K8AA 3ZC5A 4FTKA 3OT3A 3PA4A 3HDMA 3SW7A 3TZ7A 3NX8A 2QLUA 5EHLA 4BB4A 3QL8A 4NM7A 4Y83A 3TZMA 3G6GA 4E5AX 3GC9A 3ZRLA 4EHEA 3S1HA 3MV5A 3AMBA 5DH3A 4BZOA 3JY0A 3FLYA 2UW6A 4ZZOA 4FTNA 1IG1A 3Q4TA 2RGPA 1KE7A 1Q3WA 2LGCA 4PTEA 5J95A 2EXMA 3U87A 3OS3A 4IB5A 3IECA 3NAXA 2QOOA 4RRVA 5HE1A 3TNIA 3HECA 3LXPA 4EQUA 4QNYA 5JH6A 5DGZA 1ZOGA 3HA8A 4JQ8A 4XV3A 3SOAA 3ZUUA 2JKMA 3TT0A 4EI4A 2YEXA 1PKGA 3GFEA 4HPUE 3UZRA 4RIWA 3JUHA 2A2AA 2ZM4A 1YXVA 3QTQA 4ZTLA 4EC8A 4IVCA 2YZAA 4JJRA 5A6OA 3PZHA 3R8PA 2W5BA 4I4EA 4C02A 2VWIA 3C4ZA 2JLDA 1H1SA 3LFCA 4RFYA 5EM6A 3MYGA 2E9OA 5HG8A 4BGHA 2YM8A 1OIYA 3O23A 4KIKA 4G3DA 2BUJA 4GYGA 4L8MA 4U44A 4JLCA 4WRSA 3V5PA 1Q24A 3EN6A 4CMOA 3FY0A 3CS9A 2XB7A 2ZMCA 4NCTC 3OWLA 2C47A 2BZIB 3HKOA 3R2YA 4KS7A 2GNHA 2X7OA 3FZOA 3R21A 3UIUA 5AUZA 1ZYSA 1SVGA 5IH4A 4K77A 5JFSA 1WBWA 4IJPA 3OG7A 5TO8A 2BMCA 3SD0A 3VUMA 3LJ2A 3LMGA 3SDJA 5L6OA 4TYHB 4R6VA 3ZFMA 3BWJA 5CT0A 3DA6A 5HBHA 1H26A 3QLGA 4C7TA 4FV5A 2B53A 2R3PA 4YSJA 1KE6A 3FLNC 4ZMFA 3SW4A 2UZEA 1EH4A 2GTMA 4KKGA 1YKRA 3R9RA 1W8CA 2GFCA 1V0PA 4MF0A 2BCJA 5DR2A 5CEPA 4YURA 5CLPA 4ACHA 3EL8A 4DLIA 4E73A 2C6TA 4EBVA 2GQRA 2GCDA 3FHRA 4CQEA 3Q6WA 2ERZE 2XK9A 4XRLA 5EDPA 4I6QA 2BZKB 3BYVA 3ELJA 4F09A 2XJ1A 4JIAA 1GAGA 3A7FA 3P23A 4XUFA 1HCLA 2P4IA 3F2AA 1PF8A 3CIKA 4J52A 2XNOA 4G3CA 5BNJA 2NO3A 3HYHA 5LCKA 3UIMA 4UX9A 5EYCA 3VBVA 1Q99A 3DBCA 3ZLSA 3DQXA 5EDRA 1OZ1A 3MB6A 4BBFA 4WSYA 3ENHA 4F64A 1Q62A 2C3JA 3MY1A 4DT9A 2PYWA 4UALA 4FSTA 5CQUA 3BWFA 4BDIA 2ZJWA 4OTWA 1STCE 4OR5A 4BIDA 3G6HA 4CT2A 4F9WA 3A7HA 3FMHA 2VWYA 2ZM1A 3TV4A 3UE4A 4RVLA 4QNAA 1K3AA 3OBGA 3SG9A 2W1IA 2OO8X 2BDFA 3P0MA 4QMWA 4DBNA 2YDJA 2XA4A 3KXNA 3ERKA 3BE9A 4EOMA 5ANDA 3BHHA 1OBDA 1VEBA 3GC8A 3NR9A 4RBLA 5CX9A 1M2PA 2R9SA 3FKLA 4FIFA 4RLKA 5IUHA 4O0XA 5JQ5A 1ZYCA 4FKQA 3P7AA 5BUJA 1O6KA 1H8FA 1H4LA 3C5UA 3RAHA 1BUHA 4KRDA 3FUPA 4YMJA 2GNGA 2GNFA 4FTIA 1G8AA 1YI3A 2W4JA 3E8CA 3R01A 1CM8A 4X6QC 3WZDA 2OGVA 2C3KA 2G2IA 2W96B 4LGGA 2CNVA 5A3XA 3O8TA 4O7WA 3PG3A 2I0HA 4W4VA 4IX3A 1YW2A 4C8BA 1JLUE 5EW9A 4C2VA 4HVSA 2J0LA 5DNRA 4LUDA 3R9NA 5K0KA 3IW8A 4TWPA 1OI9A 2OWBA 5H9BA 4UY9A 3TKUA 4FSRA 3NVMB 2J6MA 2PMOX 4FBXA 1UNHA 3D4QA 1PXIA 3DAEA 3PPZA 2HZNA 4CMUA 3EIDA 3OWPA 2VTQA 4XNEA 4QQTA 4G17A 2WIHA 4Q2AA 2WMXA 3RINA 4RC2A 2VTNA 1H07A 3W8QA 4W4WA 4GT4A 4ZS0A 4CV8A 3CY2A 2GS6A 1CKIA 4FKRA 3HA6A 5CALA 4GSBA 4EOOA 3D2KA 2HY81 3Q4UA 2WMTA 1FQ1B 1SMHA 3CPCA 3PSDA 3HMIA 5HVKA 5LQFA 4O38A 4NK9A 3F3UA 5FP5A 3DXQA 1I09A 3QYWA 3MGYA 3TWJA 4BTMA 4RIYA 2VU3A 4QPAA 3FC2A 5AR4A 3QQFA 3S00A 4N6YA 3EFLA 3IDBA 2YERA 3FSFA 5DI1A 1Q5KA 4FKWA 4LRJA 2X8DA 4ASDA 4JIKA 3U8WA 2GS2A 3JYAA 4K11A 3BHVA 1OECA 2GSFA 3K3JA 3QCXA 2C5OA 4J98A 4PPCA 3MTLA 3CKXA 2NNWB 1KV1A 1MQBA 1Q8YA 3Q4ZA 4GVAA 1REKA 4R3RA 3ZZWA 4KINA 4WG3A 5E4HA 2VV9A 3ROCA 4JBQA 4Y73A 1XH4A 5AIRA 4PF4A 1AD5A 5HG7A 3RWPA 4FSWA 4M68A 4BGGA 5LXMA 3W10A 4QMVA 1YVJA 4HCTA 4OT5A 4IAAA 2ITTA 3VNTA 3FAAA 3FI3A 5EHOA 1JNKA 4CEGA 5AV0A 4EONA 2HK5A 4AA4A 1L3RE 1CDKA 3A4OX 1ZOEA 4LL5A 5K9IA 4FL1A 1LEWA 3WF9A 4J8MA 2GNLA 3ITZA 4WUAA 3TKIA 3O71A 3O7LD 1W7HA 3ZDUA 5E1SA 3GI3A 4WG4A 5KMNA 1WBTA 5E8TA 2J7TA 3FMJA 3HRCA 4FZDB 3WBLA 3V3VA 4D0WA 3EH9A 4IZ5A 4IAKA 5IF1A 4FEXA 3PXFA 1O6YA 4GIHA 4BCOA 1YHVA 1V1KA 3E7VA 2UVYA 4R1YA 5CY3A 5HVJA 4DLJA 5IH6A 3I81A 4XH6A 5C4LA 4YHTA 2X2MA 3RK7A 2B0QA 3BPRA 5IEXA 1W83A 3GC7A 3K5VA 4C4EA 3ENMA 4FIHA 4BDHA 4D55A 2VWZA 4O2PA 4IDVA 5D12A 4HYHA 5LWNA 2OG8A 4FSNA 2OH0E 4WRGA 2HZ4A 4W4XA 2BDJA 2BRHA 3DLZA 3I6UA 4M66A 4WNKA 4JQ7A 2C6IA 3FMMA 4DTKA 3T8OA 4FODA 4AW5A 4R78A 3TTIA 2VTLA 2OI4X 1T45A 2CGVA 3AC3A 3WE8A 4HYUA 4EEVA 5A6NA 3QRJA 3V5JA 4Y5QA 5I3OA 1SM2A 2JBPA 3KRWA 3B8QA 2XNGA 3EKKA 4DT8A 2B4SB 1ZMWA 3ET7A 5EHYA 3KU2A 4BIEA 5BUIA 5FBOA 1IRKA 4DH3A 4L3PA 3UG1A 4EK6A 3UNJA 1AQ1A 1UU9A 3BKBA 4L53A 3L1SA 2XM9A 4D9UA 5HCXA 2WOUA 1T46A 2YHVA 4GK2A 4D2SA 3LHJA 3HP5A 5E8WA 5LVMA 4FSZA 4WD5A 3ZXZA 3DGKA 2NP8A 4FT5A 1WCCA 3BBWA 4EOKA 1O6LA 4CG9A 1Y57A 4NW5A 4GKIA 3EFWA 4DEBA 3EFJA 3G5DA 4LOOA 4ALUA 4PTGA 3UVQA 3FPQA 5HIEA 2PE2A 2G9XA 3AGLA 4U80A 5IU2A 1WBVA 1YOMA 5CEIA 4UN0C 4FYOA 3QLFA 4D2PA 4OTFA 2HOGA 2PVLA 2UW8A 2WGJA 4ANNA 4JVGA 4FG9A 3LZBA 3VS4A 5FDXA 2QI8A 2A4LA 4YTIA 5K4JA 1NT2A 4MCVA 4UB7A 4WT6A 4L3JA 4LV8A 2O65A 2ZDTA 2CN8A 4JDHA 4BN1A 4JG8A 5KHWA 4B99A 3NAYA 1Q61A 3RGFA 5FBNC 4MXZA 2VTHA 4G9RA 5A14A 5IA4A 2JAMA 5AP6A 1OL1A 2DUVA 4ZSGA 1B39A 4PQNA 2IW6A 4HNIA 5JRSA 4DH7A 5T3QA 4PDOA 4FOCA 4AZTA 2YIWA 5BUEA 4U5JA 3H0ZA 2E2BA 3LOKA 4G6NA 2FSLX 3U9NA 4O0YA 2CNQA 4NWMA 3CQUA 3C13A 5AA8A 5GZ8A 5JQ8A 3ATSA 4WUNA 3NCGA 4O0UA 2BAJA 4RA4A 3V8WA 4B8MA 4NYEA 5EFQA 2P55A 2E9VA 3RK9A 5HCZA 3PPKA 2WD1A 4DBXA 2Y6OA 3KCFA 2QQ7A 1LUFA 3PIYA 5DR6A 2B1PA 1ZLTA 2VAGA 3QU0A 1MRVA 1PXNA 3CQWA 4GIIA 5M4FA 3SXFA 4NKSA 1J1CA 2UVXA 3SOCA 4EZ7A 3POZA 4CSVA 2UW7A 2RSVA 3DBDA 4HYSA 2JFLA 4NFNA 3VULA 3HMOA 1R3CA 2WQMA 2VD5A 3PTGA 3QBNA 1J7UA 4YJVA 5EYKA 4CKJA 4O2ZA 2G2FA 4XHKB 3ZC6A 3A61A 3QZIA 4JBPA 4YZBA 3HDNA 3R7YA 5K0XA 2WIPA 2XZSA 4FT9A 4IX6A 3ODYX 1A9UA 1PMUA 2RG6A 3S4QA 4K9YA 3TI1A 4KSQA 4JT3A 2X6DA 3I5NA 4C3FA 5CEMA 1OPJA 4J99A 4CZUA 4M69B 4C3RA 3U6JA 5IH5A 3H10A 3U9CA 2ERKA 2ITQA 3UQFA 2UZBA 1IR3A 5AV2A 5M53A 2C6OA 3F5PA 4HOKA 5KBRA 1Q8ZA 3SXRA 5HGIA 5IQIA 4DH1A 2YZLA 3FYKX 4M15A 3KMUA 2WMVA 3WZJA 3CEKA 3NW7A 3L9NA 3QQJA 3QWJA 2I6LA 3CBLA 1YHWA 4GCJA 4NJDA 4O7SA 3OWKA 3DXPA 3NNXA 3FXXA 1JBPE 1APME 3TV7A 4AN2A 4AACA 5HTIA 1LEZA 1WBOA 4UMQA 4XG3A 4XP0A 3NW6A 4EORA 4PWNA 5C26A 3VWAA 2QU5A 2UW4A 2FUMA 3ALNA 4I92A 3L9PA 5CZIA 3RTPA 2O63A 3D15A 4RJ7A 5M51A 4D2TA 3JVRA 4FSQA 2HIWA 4A9SA 3D7TB 4EOPA 2HXQA 1Q4LA 4TWCA 4QTAA 4EK8A 3F88A 5A54A 3QUEA 4YC6A 3VIDA 3FLSA 4EOQA 5DT0A 4Z7HA 2XK8A 4AE9A 2XNNA 5CT7A 2CLXA 2C6LA 3LLAA 2OH4A 2OZAA 3HMMA 4FVPA 1A48A 4A4LA 4IMYA 3ZTXA 4MAOA 4D2WA 5KX8A 2GS7A 4FKIA 4J53A 3EB0A 4DCAA 3MH1A 4FYNA 2YM5A 4X21A 5EYDA 4AZSA 3R1SA 5CI7A 3K3IA 1J3HA 1QPDA 3FJQE 2OZOA 3W55A 3TUBA 3HAVA 2P33A 3FL5A 2W5AA 3K5UA 4OGRA 3ZDIA 2HELA 1PXOA 2JDTA 4BBMA 5L8LA 3COHA 4LQMA 2WMQA 1G3NA 3R2BA 4XP2A 3P4KA 4YZCA 3NW5A 1FOTA 3II5A 4HPTE 4RT7A 4ANSA 2YWVA 2BHHA 2JGZA 2XRUA 3NUUA 4DFUA 4HZRA 4FICA 3W33A 4KUJA 4M13A 2XKFA 4EZ5A 3W18A 3MWUA 2AYPA 4MF1A 1REJA 4FF8A 4JX3A 2QKRA 3FMNA 4BVUA 1XQZA 5GNKA 2WHBA 2QOBA 2UZNA 1UU7A 4DE4A 1MQ4A 3QAME 3PPJA 2QG7A 3LFEA 2C6KA 4EJNA 4D1XA 1HCKA 3EOCA 5HNGA 4C4IA 3PP0A 3TJDA 4MXYA 5AADA 3Q9WA 4EWQA 4FNYA 2FA2A 3L8XA 3KF4A 3B2TA 3VQUA 5IA2A 4I6HA 3NVKI 1YI4A 4I24A 4UXLA 4U79A 4IW0A 4FVQA 3E5AA 3OT8A 4YJOA 3HV4A 4QP3A 4ZJJA 4HGTA 4BDKA 4F7SA 4EZ3A 3OUKA 3PZEA 3UYTA 3PIZA 4CRLA 1XH6A 3LIJA 3HEGA 5E8UA 2GQGA 2WAJA 2QNJA 2W4OA 5FEEA 4FTMA 4BI2A 4HVGA 2ONLC 1IEPA 2A27A 3Q52A 5L8JA 1XBBA 3WE4A 4E5WA 5IDNA 1Z57A 4O6LA 3GENA 3WZKA 4F99A 1GIJA 3OXZA 5IQFA 3I6WA 3O7LB 4YJTA 3PXRA 4L68A 4RX9A 2IVSA 5EG3A 5H8GA 2X7GA 4X2GA 5AP1A 3R00A 4I23A 2FSMX 3G0EA 4D4RA 4UWYA 4FZFB 3QRUA 4OBPA 3ZH8A 1FVVA 3K2LA 4QYYA 1JKKA 4GVJA 3TZ9A 2RFSA 3U54A 2X2LA 3F6XA 3IK3A 4AF3A 2OK1A 4E6DA 3OW3A 4K0YA 5M08A 5JRQA 4WNMA 5L8KA 2C30A 4O83A 4I5CA 4RQVA 3UP7A 3WIKA 4O7NA 4DGNA 2YLFA 1FINA 3GNIB 5C03A 4PNKA 5M4UA 2CHLA 3NEWA 2R3RA 3TUCA 2C1AA 3ZEWA 2YDKA 4IB0A 3R7GA 4N70A 5D7VA 5C01A 2HAKA 4F6SA 3THBA 3GT8A 5CZHA 3MH3A 2RL5A 3H30A 3LE6A 4O86A 2YN8A 2WTWA 4KAOA 2A1AB 5CTPA 4AA5A 5IG1A 5IEYA 2UUEA 1WVXA 3MA3A 5HX8A 2OLCA 5FUTA 3ZBFA 5M4CA 5FD2A 1TQPA 3LMIA 3KF7A 1RJBA 4ACDA 4O0VA 3FLZA 1ZZLA 3NUSA 4XRJA 5EDQA 3DZQA 4GK4A 3P08A 2R3HA 4XG7A 2UV2A 3BX5A 3WF6A 4P5ZA 4NIFA 5J9LA 4RIXA 4F0FA 5AP4A 3G0FA 1R1WA 2C6EA 4FTTA 3LQ5A 4BGQA 4GEOA 4U43A 2RFNA 4CLIA 5I9VA 2QODA 4FGBA 5C9CA 5CSHA 5M44A 3M11A 4E4NA 5T6KA 5IA3A 3UZTA 3QD4A 1XO2B 4YP8A 4Y46A 4LM5A 4AZEA 2IO6A 4Y95A 3UMXA 5DE2A 3SX9A 2YDIA 3KN5A 1DAYA 3QZHA 1W82A 4YTFA 3BYMA 4MNEA 4CV9A 4R7HA 4TYGA 3VBXA 4H39A 3DBQA 4BKYA 4C3PA 3CD3A 4RZVA 4DGOA 3UPZA 5AWMA 3CSVA 1OIQA 3NYVA 2SRCA 4MXXA 3F9NA 4MYGA 2X4ZA 2YA9A 4RIOA 4YJRA 4ZS4A 5D10A 1G8SA 2JEDA 1K9AA 3TXOA 4RMZA 4FT7A 3RZFA 3VS5A 4FNZA 4FSYA 5AX9A 3QKMA 4L44A 4PMTA 2B9HA 1UU8A 2G01A 5CYIA 3LAUA 4X3FB 4W4YA 2JBOA 5AM6A 5I3RA 4ALWA 2JDVA 4FV6A 1ZZ2A 5CVHA 3WOWA 4Y8DA 3PUPA 3EZVA 4ZY6A 3F61A 3G15A 2R2PA 4DFNA 5GJGA 3O8PA 2J90A 4QP4A 1UKIA 2PWLA 3E63A 5KMOA 1H00A 3CPBA 2UZTA 3L9LA 4H3QA 2QOFA 5CF5A 5LOHA 4MKCA 3TZ8A 4NSTA 3FLWA 1OKWA 3NUPA 1LP4A 2YM3A 2OJFE 4GUBA 4MD8E 4CZYB 4OTHA 4TZRA 4Q5EA 4XLIA 2BIKB 3RKBA 5GZ9A 5FM3A 4PPAA 3KY2A 4JNWA 3ORTA 3ZCLA 4IB3A 4BWKA 5I9ZA 4JAIA 5KBQA 2RFDA 2X9EA 1GZKA 1E9HA 2IZSA 3FZSA 5HLPA 5E91A 2W99B 3PJ2A 5AR5A 5JFWA 5JGDA 4B7TA 5AUVA 3RWQA 3V04A 1PMVA 3PWYA 4HCUA 4O81A 4X6RA 2QKWB 3AT4A 4DITA 4FV7A 2WU7A 1SZMA 3GCPA 4IAIA 4L42A 4C59A 3Q2JA 5ITAA 3MBLA 3MFUA 5AUXA 2XEZA 3DK6A 3SXSA 5B7VA 3FKOA 4MXCA 3LCSA 3C0GA 3DXNA 4KABA 2AC5A 4JDIA 5AX3A 4D5HA 4I94A 2GQSA 2PU8A 1NVRA 3EMGA 5HIBA 3F5GA 2XMYA 5CXHA 4NFMA 4C38A 2G1TA 2IN6A 2JITA 1SNXA 3CTJA 4BI0A 5GJDA 2HWPA 2UW0A 3FYJX 3HV5A 1F5QA 4NCTA 3H9FA 4ZTNA 3QYZA 2PVFA 2BKKA 4MQ2A 1G5SA 4C58A 4F1MA 2YIXA 3OROA 3KMMA 4Z16A 3CY3A 3L8SA 3KVWA 3MFTA 3OFMA 2PL0A 2YAKA 4O96A 3W2RA 5LVPA 2IPXA 1F3MC 5IQCA 2JKQA 3W2OA 1ZXEA 4IX4A 4X2KA 2QVSE 5HNIX 1CMKE 4EYMA 4AOTA 1IAJA 3L8VA 1ZY4A 2WOTA 3FI2A 3BLHA 4FTUA 2XNBA 4LI5A 3T3VA 4PDSA 4PMMA 3SRVA 2W4KA 3D5UA 4WHZA 2VWXA 4XMOA 2O8YA 5TT7A 2C3LA 3F82A 5BVKA 2VTRA 2OF4A 5HU3A 3RM7A 3KB7A 2YAAA 3GOPA 1CKPA 1QPEA 2OU7A 4BCNA 5BPYA 4C34A 4ORKA 5FXSA 3D94A 2C0OA 3DKFA 4FT3A 1H0WA 3EYHA 4L00A 5CASA 1ND4A 2XBJA 3D14A 4WOVA 1J91A 1GIHA 1UKHA 3OTVA 5DBXA 3R8LA 3LPBA 4Z3VA 1E1XA 1YXUA 3BCEA 2HXLA 3KCKA 2ZMDA 2OJ9A 4V0GB 3SQQA 2ITPA 2PVYA 3NYOA 2JDRA 4KA3A 3O50A 4MVFA 4FG8A 2JDSA 2IZTA 1L8TA 4DEEA 4OTDA 5LMKA 3TIZA 4OUCA 4L43A 2J0MB 4MBJA 5HE2A 3DDQA 2C5XA 3FC1X 5HVYA 2PHKA 3VBYA 4ERKA 1PXPA 3OMVA 4RWIA 4HCVA 4DF3A 5I0BA 3DKCA 2H6DA 4UMPA 2I1MA 2BTSA 4G34A 5HLNA 3TM0A 1R78A 4QMLA 2OXDA 3EN9A 3F3VA 3KEXA 1ZRZA 1R39A 2NPQA 4IFCA 2OXYA 4V04A 3CJFA 2CPKE 4EBWA 4FEUA 2P0CA 2X7FA 4YJPA 3ROYA 4E4XA 2DS1A 1OKZA 4QMOA 1IASA 3BU6A 4S32A 1KUTA 5LMKC 4PP9A 4UZDA 3QA8A 4QTEA 4RX5A 3G33A 3UC4A 4CD0A 5LVOA 3U4WA 5A4LA 4I20A 2BALA 5ETCA 3A4PA 1Y8GA 3HUBA 1XKKA 1PRYA 5D9HA 5C8NA 3I1AA 5EW8A 4EHVA 5EYMA 3V5TA 4FZ6A 4UV0A 4FVRA 4YZMA 5EQPA 3PG1A 1KE9A 2R3JA 3C4WA 3VS2A 2F9GA 5HEZA 3S2PA 3KXHA 3V8SA 4GU6A 2ITZA 1FGIA 4GT5A 4MWHA 4C36A 2XKEA 3T3UA 2O64A 2W1EA 4ZY5A 1P4FA 3BU3A 3DFAA 3IQ7A 3RVGA 2BKZA 2W17A 3UPXA 5J5SA 4XBUA 3I4BA 5JZJA 3P86A 3MVMA 4QMTA 4PL4A 5FTOA 4RZWA 3AOXA 4BDBA 5LMAA 4YPSA 3NYNA 3ZFYA 1CTPE 4FOBA 5F20A 4YLJA 4TL0A 2R7IA 3Q9ZA 5ETIA 4W9XA 1ZYJA 2IW8A 4BZDA 3IG7A 4X7QA 4BCGA 2XUUA 2GHMA 3ZXTA 4BCJA 1WBSA 3RI1A 3MSSA 3VS1A 1DI9A 3ZOSA 4BYJA 3VW8A 2UZUE 4FV8A 3C50A 2Z7SA 5HE0A 2F2CB 1RQQA 1Z5MA 3ZSHA 1TQIA 2JFMA 3VRZA 1PXJA 1UWHA 4IAYA 5JMSA 4JQEA 3UIBA 2I40A 4FSMA 3QQGA 4L6QA 3QC9A 5CU6A 4APPA 4E6AA 4F6WA 4YJQA 4C0TA 2PUNA 4A9RA 2BZJA 4USEA 3R8MA 1GNGA 2QOCA 1URWA 4FEVA 4ALVA 1YDTE 2IVUA 2PZRA 4M8TA 4PX6A 4YZNA 5LVNA 4R77A 4F1TA 2OIDA 1YXSA 3E8NA 4RIWB 3KXMA 2H96A 3LFDA 1E1VA 4QMZA 5CVFA 1Q8UA 4O7TA 3PP1A 1WVWA 1ATPE 4XV2A 3DJ6A 1JAMA 3GCSA 2X4FA 4HGSA 5IMEA 5EOLA 5AR8A 4JRNA 4KIKB 5HCYA 4F0GA 4TN6A 1TQMA 4QRCA 5HKMA 4PMSA 3TN8A 2WFYA 4IBMA 2KULA 3IW4A 2WB8A 2Y4IB 4F70A 3ZSIA 5AUTA 3COKA 4E26A 3BYSA 4EOJA 2X1NA 3DFCB 5HLWA 1BMKA 1FGKA 3Q6UA 3PJCA 4QYHA 3PA3A 1H1QA 2WU6A 3EKNA 4ZLOA 3UNZA 4HJOA 4A4OA 5BMMA 2RF9A 3DTWA 2ZVAA 4PDPA 5EKOA 3LFFA 3ID6C 4Y85A 3U55A 4EL9A 3NLBA 4I0TA 3I7BA 1OVEA 1GZNA 5J8IA 3P9JA 1KOAA 4C35A 3VUIA 5KHXA 2R4BA 4FV4A 2GTNA 3LM5A 3UTOA 4NJ3A 2WEIA 2Y6MA 2FSTX 1PKDA 1YXTA 4FKTA 3AC8A 1ZMUA 3AMYA 3DLSA 3FKNA 5C4KA 4RQKA 4GJ3A 5HD7A 3KKVA 4AW1A 4KKEA 3MH0A 3R7EA 4G6LA 3BI6A 4FKLA 4F08A 4FNWA 5J9ZA 4BF2A 3QHRA 3GCQA 3R6XA 4HVHA 2YCQA 5E8VA 4FX3A 2VO6A 2VRXA 3UOJA 3P7CA 3VVHA 3DPKA 3QD3A 1Y6BA 2VX0A 2RKUA 4M14A 3EHAA 4DTAA 3PJ8A 4OTGA 3GCUA 5HZNA 5DRDA 4ASEA 1OUKA 2GNJA 3HLLA 3TNPC 1M17A 1PMNA 3HL7A 4FKJA 4ZSLA 3PXYA 5J87A 2I7QA 2C0IA 4IZ7A 3ZRKA 2GU8A 2NRYA 3DNDA 1W98A 2V62A 3KXGA 3O2MA 3JXWA 4NH1A 4AW0A 1Y91A 2IWIA 3BBTB 4QMQA 4NL0A 2HWOA 2EXEA 3D7TA 3MI9A 1DI8A 3QXOA 3TG1A 5EI8A 4FUXA 5KMIA 3PSBA 5FXRA 4BCIA 1NVSA 5CSVA 1UWJA 2F4JA 3DNEA 3TNWA 1M14A 2YITA 4EK4A 2WZJA 4IXPA 4IWQA 5A4CA 5L4QA 1PJKA 3PXKA 2QOLA 4UWCA 1SVEA 4TXCA 3GGFA 3WARA 2GMXA 1Q3DA 3Q04A 3QUDA 5DWRA 3VO3A 4ANBA 2Z2WA 1LPUA 3P1AA 3R71A 4FV1A 4OTPA 4DEHA 4FV3A 4P90A 3EQIA 4F9CA 1WAKA 3CTQA 5DRBA 1OMWA 3A7JA 5IMXA 5D7AA 2XNMA 4IACA 2WMWA 3FZ1A 2YM6A 4B0GA 3EQRA 4YHJA 3DB8A 3VAPA 3I60A 4GT3A 4XJ0A 4XV1A 2CJMA 4GH2A 4R3PA 3E88A 3QALE 3OC1A 4AW2A 3Q96A 5L2SA 3FQHA 3WILA 2EB3A 3V5LA 5I9WA 4CG8A 1JVPP 3SA0A 2ZB1A 2VWVA 2O0UA 4G1WA 3W16A 4YZ9A 3ZLYA 1M7QA 4EOIA 4RIYB 5BX0A 3VHEA 3N4TA 2YM7A 1BI8A 4BKZA 3O8UA 5M09A 5J1VA 3PWDA 3OZ6A 3BQRA 3MDYA 4G31A 3R22A 2REIA 3VS6A 5AUUA 5BVOA 1H0VA 1YWVA 4GV1A 2H8HA 3WYYA 1IA9A 2V5QA 5KMJA 3U6IA 4CFFA 2XIRA 5DEWA 3AT2A 3SC1A 5I5ZA 3I0QA 3FMEA 3C4CA 4CXAA 1U54B 4GG7A 1YOJA 4Z55A 4ZTHA 3TNHA 5JGAA 1UNLA 1OL6A 5BQ0A 1OPLA 2OJGA 3E3BX 4XEYA 4GYIA 4O7VA 4AQCA 2OICA 2VUWA 4LFIA 3TJCA 2XK4A 4HNFA 3W32A 4APCA 4CTBA 5E8ZA 3SVVA 1VZOA 1U59A 4IZAA 2W05A 2E9PA 2XH5A 2HY0A 2JIUA 4FL3A 3NRMA 4FI1A 4LRKA 2HCKA 2W1GA 5FEDA 5HD4A 4EH4A 3BGQA 2QU6A 3UYSA 5CSPA 4LL0A 5CU4A 4ID7A 4XS2A 2BHEA 3Q60A 4AA0A 3TUDA 5HQ0A 2IVVA 4O1PA 4A07A 4DFLA 4AGDA 5B2LA 2OIBA 5EQEA 3GFWA 4EJ7A 5AR3A 3ORLA 4D0XA 4M12A 3SG8A 2PMLX 5LCJA 5L2IA 2VN9A 1JKLA 3RPSA 2CMWA 4F1OA 2Z7RA 4FSUA 4DEAA 1JSVA 4YGAA 3G90X 4U41A 3F3TA 2EWAA 3VQHA 5AUYA 1UVRA 5ETAA 2XIZA 4D58A 5CXZA 2ZV2A 4K6ZA 5M57A 3RNYA 4MXAA 2GHLA 3MTFA 3QTSA 3AD5A 3RJCA 4L67A 1M7NA 2XYUA 5JZNA 3HNGA 3CKWA 3WZUA 5BYLA 2XCKA 4BHNA 3BHTA 4ZEGA 4L3LA 4CRSA 2WTKB 4J8NA 2Z60A 4YLLA 1BLXA 1PHKA 2VWBA 3HMNA 5ANIA 3UP2A 5DVRA 5AV1A 2IJMA 5A9UA 2PMNX 4BIBA 3ZBXA 2BROA 5CNNA 1M2RA 1U4DA 4GRBA 5AJQA 4E5BA 3UDBA 2VNWA 3BYOA 2ZM3A 3NS9A 2XYNA 1WZYA 1NVQA 1MRYA 4EK3A 3E7OA 1ZOHA 4X2FA 3RPOA 1OB3A 3E3PA 5JEBA 1B6CB 4QYFA 2BRBA 3C4FA 3GQIA 4E20A 5LJJA 2BRMA 2PVRA 3E87A 4JBOA 3DCVA 4XG8A 2P2HA 5B0XA 4CKRA 2R0IA 4EH8A 4GU9A 3UVRA 4FIJA 4GL9A 4IH8A 3W2CA 3B2WA 1YDRE 5KMMA 3M2WA 3R0TA 2CGXA 3ZO1A 2H34A 5FLFA 4Y5HA 1KE5A 4CFXA 3AMAA 4MEDA 4ZIMA 4IWPA 2XP2A 2QURA 1YRPA 1YOLA 4AX8A 4NM5A 2HENA 4S34A 3TKHA 1QL6A 4J7BA 2FVDA 3QWKA 5K3YA 3KGAA 3D2IA 4ZP5A 2R3KA 2XIKA 3EN5A 1P2AA 4EKLA 2IW9A 2BILB 4D2VA 3Q2MA 2Y8OA 3G51A 2PZ5A 5KKRB 3BZ3A 2XM8A 2YABA 2J50A 4FIIA 4QTBA 5KMLA 4FC0A 3FV8A 4AT4A 2PPQA 3H3CA 3VJOA 3E92A 4F63A 5JN2A 4F65A 3TV6A 3LW0A 2XKDA 2ONLA 3MPAA 5HO8A 4IWOA 2XK6A 5AAFA 2QCSA 3H9RA 4FTAA 4E6CA 4X3FA 3BQCA 4YSMA 4AZVA 3LMHA 2VO3A 5GHVA 4EK5A 3BV3A 3LQ3A 2ITNA 2OXXA 1O9UA 4FZ7A 3CGOA 2C69A 2JD5A 3ORZA 4II5A 5HESA 3UOKA 5BYYA 2HZIA 4FNXA 4GFMA 1M52A 1Q8TA 5E8YA 4CFNA 3GU6A 3GC0A 4JRVA 5JFXA 3UO5A 4QMYA 4ITJA 4R5YA 5A4QA 1PXMA 4R1VA 5FTQA 5CAVA 4X3FC 5FXQA 3FZTA 3OWJA 3H4JA 5G6VA 5DIAA 4FZAB 3DY7A 3EQCA 3OEFX 4JBVA 1WMKA 3QUPA 4TPTA 5FG8A 4A4XA 4HGEA 2BDWA 1WBPA 2B52A 2F7XE 3KRXA 2BVAA 3ORNA 3PJ1A 2W06A 3MIYA 3MIAA 4GJ2A 3ATTA 5AFVA 3F3ZA 3PE2A 5HOAA 5C8MA 4D4SA 3KVXA 2VWWA 3IDCA 1P14A 4PMPA 3D7ZA 2OF2A 3PVUA 5HTBA 2G2HA 4PRJA 3W2PA 4NKAA 2YM4A 2QO9A 4BYIA 2UZLA 4FGRA 4MD7E 1X8BA 3QQHA 3ORXA 3R28A 4KIOA 1WVYA 4I93A 4KD1A 5CI6A 3O17A 1OM1A 4WG5A 4EUTA 4M97A 2EVAA 5T68A 3VW6A 4BKJA 4EH3A 5LWMA 1ZYDA 3N4VA 4GKHA 5IEVA 5IKWA 2XS0A 4YR8A 3NYXA 4LRMA 3CCNA 3R9OA 3SGCA 3OXIA 5IISA 4ZLZA 3FXZA 3QCSA 5I9YA 2J51A 4F7LA 5A4TA 5M4IA 5M07A 1XR1A 2QC6A 3R8VA 3EN7A 4OW8A 5DHJA 2W7XA 2QHNA 3RCDA 4O7LA 2PUUA 3A2CA 4ZOGA 3GEQA 3QTRA 3QHWA 4QP2A 5HI2A 3VF8A 2QG5A 4NU1A 3ZUTA 3P79A 4CNHA 4XOYA 5ANGA 4GG5A 2V55A 3NUXA 4ANLA 4UMUA 3A60A 3KRRA 3KFAA 5AMNA 4GMYA 5J1WA 3UIXA 4UMRA 3QRKA 3E93A 4O7YA 1P5EA 3EFKA 4PDYA 2VTOA 4USFA 4ZTQA 3R1YA 4KBAA 3OUNB 2OW3A 1H28A 3RPVA 3ORKA 3W8LA 2EUFB 3ORPA 2LAVA 4FEQA 5J5TA 4XV9A 4BCQA 3V5QA 2NRUA 4TYHA 4FKUA 5EM8A 4X2NA 2YJRA 2XNPA 1MP8A 4RA5A 4M67A 3W2QA 2V7AA 3PA5A 5HNBA 3VUHA 2F7ZE 1PY5A 3ZSGA 3ZZEA 1XH7A 5CANA 4WBBB 3OD6X 3PYYA 4RC4A 4N0SA 4N4SA 3HAMA 2R3OA 2QOQA 2OIQA 4O0WA 3KQ7A 3UZPA 3BIZA 4KNBA 4QP9A 2X8IA 4QYGA 4UZHA 4IM0A 3NCZA 4IVAA 4LOQA 3KMWA 4MK0A 1MUOA 4UEUA 5HBJA 4M0ZA 2WMRA 3Q3BA 3BU5A 5JT2A 4MD9E 1OPKA 4IC8A 2AUHA 3PVBA 4HYIA 1SYKA 4OT6A 4J71A 3UVPA 2B9IA 4E8AA 4O0RA 4EUUA 3DTCA 4JS8A 4AE6A 2VX1A 3QX4A 4YTCA 1URCA 4ACGA 3UC3A 2VGPA 4UWBA 3BEAA 4MH7A 1JKTA 4ZXTA 4BCMA 2ITUA 5IQAA 3ACJA 3FMKA 4RX7A 4F7NA 2JIIA 3NNUA 3OCGA 5IZFA 5KZ0A 3NPCA 2GPHA 2CGUA 4JI9A 2CLQA 3R63A 2B7AA 3JS2A 3KK9A 3EYGA 4TYJA 3F3WA 1JSUA 4RLLA 2WTCA 4AG8A 4BDGA 4EH2A 2QHMA 4IQ6A 3CJGA 3KULB 1YDSE 4G5JA 3MVJA 1KSWA 4G9CA 4IAZA 1KE8A 3CQEA 2WTIA 4I0SA 4CVAA 3QQUA 4JG6A 5EK7A 2QR8A 2QOKA 3OCBA 4IEBA 2PZYA 2VO7A 3DDPA 2ZYBA 5BVDA 4UYAA 5F9EA 3UNKA 3R1QA 4BBEA 4FKSA 2YLEA 3LXLA 3GUBA 4R8QA 4YNOA 3DZOA 4ZSEA 2IZRA 3C7QA 3RZBA 3C4EA 2YCRA 1JSTA 4HW7A 1BYGA 2OFUA 1R0PA 5LMBA 4JDJA 5TF9A 5DOSA 4D5KA 3QCQA 4CYIA 4B6LA 4HGLA 3UOLA 3AD6A 5E92A 3VRYA 4BRXA 2PK9A 1YXXA 2CN5A 2W1DA 3DAKA 3C4XA 2OBJA 3Q5ZA 4TT7A 5IUGA 2R0UA 2V22A 3M42A 1YI6A 5AP7A 4NTSA 3S0OA 2XF0A 3D5VA 4S33A 2AC3A 4HZSA 5DLSA 3EQDA 2F2UA 4DFBA 2WO6A 1BKXA 5TOZA 1VR2A 2YIQA 3DAJA 2BRGA 1YWNA 2VTSA 5I9XA 2C3IB 2J0JA 4BICA 4IHPA 4CT1A 3ZRMA 2WTDA 5C1QB 3N4UA 3VBWA 4DINA 5KE0A 4ZJVA 5EKNA 4ZAUA 1RDQE 4U9AA 4MTAA 4PV0A 3UG2A 3A62A 4AT5A 1FMOE 1GJOA 4DEDA 3KA0A 3FI4A 3UJGA 4BTFA 2J4ZA 4FK6A 3KXZA 4QP7A 3QTUA 4YUQA 5HO7A 5KUPA 4KWPA 5BYZA 4OTQA 2WMAA 3A7IA 1VYWA 3BELA 3DK3A 2O5KA 4IB1A 1OKYA 4I6BA 4QMMA 2BAKA 2R3GA 4NEUA 4U6RA 4DC2A 5I4NA 1W84A 3OY1A 2R3IA 4DEIA 3R8ZA 1OBGA 2PUIA 3WF5A 2C4GA 3SAYA 4X2JA 5HBEA 5L3AA 2RFEA 4XG6A 1OIUA 2X81A 4UXQA 3IGGA 1P4OA 3GU7A 4TYIA 4YJNA 2IG7A 2ITVA 3EN4A 4FIGA 3MVHA 3TIYA 4I1ZA 5IQDA 2W0JA 2WQEA 3C0IA 4D1ZA 3EZRA 3KRLA 4IM3A 2CKQA 4BCHA 3SV0A 3LJ1A 3EWHA 4NIFB 4RIXB 4FTCA 4EH7A 5HE3A 4ASXA 3RM6A 4D9TA 1H25A 3BHUA 1AGWA 2J0IA 3PXZA 3GU8A 4O91A 4RJ3A 5E7RA 3HV3A 4XLVA 3L9MA 4M84A 3ZFXA 4ANQA 4DFYA 2XK3A 4E3CA 2FO0A 4AXAA 3MVLA 4CLJA 4OTRA 2VTAA 2WNTA 4AN3A 2CGWA 5CENA 2QONA 1J7LA 2CKEA 2F49A 2W5HA 2WMUA 2ZDUA 3VS3A 5AAGA 1OITA 1DS5A 4NTTA 1WFCA 3BGPA 5CF6A 4OBQA 3GP0A 4XOZA 4ARKA 2VNYA 3AC5A 3QTXA 1U5QA 5DT4A 2BTRA 4K2RA 4AN9A 2Y4IC 4AP7A 4X3JA 4TKSA 4MNEB 3FSKA 3KC3A 4WSQA 5BMSA 2WPAA 3HRBA 3ZONA 2C6MA 2CNUA 1OGUA 3ORMA 5D41A 1JOWB 5AM7A 1OL7A 3BGZA 5DMZA 5F1ZA 2VTPA 5E9EA 4AZFA 4M7IA 1IA8A 2VWUA 4YO4A 4R7IA 4LUEA 4XBRA 4FL2A 2CDZA 4XG2A 5FWKK 3R9HA 5L6PA 4IC7A 4EOLA 2O3PA 4WA9A 5BVWA 3BLQA 4YPDA 3ZO3A 4KIQA 5C27A 2Q0NA 4AUAA 4YZDA 1CSNA 3OBJA 4G3GA 1ERKA 4L01A 3UODA 3LFNA 1FPUA 5GZAA 2W1HA 1TVOA 4RVMA 2X2KA 4M0YA 4MX9A 5LARA 5IUIA 3VN9A 4YTHA 3V01A 4P5QA 4QMSA 3SHEA 1DM2A 3CGFA 3H0YA 4BDDA 4QTDA 2OFVA 5FGKA 5FDPA 2HW6A 4A9TA 1QMZA 3IGOA 3IO7A 1JWHA 3VBTA 4GK3A 4F4PA 5A4EA 4O0TA 1I44A 2J2IB 3GB2A 1CKJA 3QCYA 1PYEA 4I21A 2YIYA 3HZTA 4QMUA 4YHFA 4QPSA 4S30A 3QZFA 3FBVA 5FM2A 4BWXA 4FMQA 4ENXA 4YBJA 5AA9A 5F94A 5CEOA 2WELA 2EB2A 4P2KA 3UQGA 1NW1A 5DT3A 4C4JA 4I0RA 5ANJA 3SKCA 5IPJA 3DOGA 4C61A 3D83A 4IIRA 1OIRA 5AIKA 4IJ9A 2F57A 3UMWA 5GJFA 1PW2A 4J1RA 3LFSA 4E7WA 4IWDA 4B9DA 2B9JA 5IQBA 3MA6A 3NNWA 5CSXA 3HV7A 3P5KA 1HOWA 3VC4A 1GZ8A 5JK3A 5EI2A 4BDJA 3V51A 2BAQA 2FYSA 4U8ZA 4Z7GA 5HICA 5ACBC 4H1MA 4W8DA 4EQCA 4TNBA 3DQWA 3QF9A 3L8PA 4ZTRA 2PZIA 1YHSA 3OCSA 4Y72A 3AGMA 5DA3A 3KN6A 2XCHA 3D9VA 5DG5A 3ZUVA 4U45A 5CAQA 1JQHA 3IDPA 4OAUC 1OUYA 3MPTA 4RVKA 3OP5A 4RFZA 5AUWA 2XJ0A 3M1SA 1NXKA 4QP6A 2C5NA 4U7ZA 2WEVA 2DQ7X 2RIOA 4KKHA 2ZB0A 3IONA 2OJJA 3GVUA 1QPCA 4JR3A 5L6WL 3E62A 4EYJA 4KSPA 4DGLC 2W1FA 3HMPA 1KOBA 1NY3A 4I6FA 5HG9A 2VO0A 4F6UA 3FMDA 3NNVA 4H36A 4AT3A 2R7BA 3MFSA 4OLIA 2YJSA 3NZ0A 4YNEA 1NA7A 3DJ5A 4JL9A 4ZSJA 3OY3A 4NZWB 3HGKA 4WNPA 5EI6A 3SRVB 2JIVA 5L2QA 4MQ1A 2A19B 3AC4A 5EW3A 5F4NA 3MPMA 4AWIA 2V7OA 5ANEA 3TCPA 2EU9A 1XWSA 3MH2A 1LR4A 3WZEA 4FIEA 3O96A 2O2UA 1QCFA 3PFQA 4QMNA 5CAPA 4N57A 3D5XA 3LFQA 4J97A 4DTBA 4AZWA 5GINE 5BVEA 3OVVA 2R3FA 3AT3A 4U81A 4H1JA 1U54A 3PY3A 1FMKA 2WMSA 2YFXA 5AP5A 2XVDA 4CKIA 3NMUF 1S9JA 3PY1A 2C6DA 4ACMA 4JR7A 4BTJA 3CLYA 3A8XA 4FTOA 4FV0A 1XJDA 4G3EA 1BL7A 4TY1A 2X0GA 3QKKA 4F9YA 2V0DA 2DWBA 2PE0A 4ZZMA 3WIGA 4S2ZA 1H1WA 3OOGA 4XP3A 4ANMA 2CSNA 4TYEA 4UYNA 5DEYA 4F7JA 2QD9A 3EQFA 4RWLA 3GU4A 3RHXA 1FBNA 4W8EA 4K1BA 3R7UA 2R3QA 2PULA 5E8XA 4O7ZA 4L9IA 2WTJA 3ZEPA 4M69A 4RC3A 3PSCA 3RHKA 1OL2A 2ETMA 3BEGA 4A7CA 4QP1A 3PDTA 2CCIA 1JKSA 3B8RA 3A8WA 4R5SA 2FGIA 3N9XA 5FEQA 2GHGA 3FE3A 3GU5A 4FE2A 5IDPA 2GNIA 5AP2A 4NM0A 3ALOA 3R7IA 2HZ0A 3SLSA 3FZRA 5CNOA 5HORA 1BI7A 4GFOA 4PTCA 4FKVA 3QFVA 5EOBA 3GCVA 4O6EA 2PMIA 3FWQA 3OXTA 1H1PA 1H1RA 2PY3A 3FHIA 4I5HA 4BY9E 3O51A 3ZLWA 3A99A 3FY2A 2VZ6A 2XIYA 4G2FA 3C0HA 1RE8A 4IFGA 5EM5A 4UBAA 4I4FA 2XK7A 5GIOE 2Z02A 1FVTA 2C5VA 2WKMA 3VF9A 2C1BA 4P4CA 3PLAE 2BPMA 4IX5A 2WQBA 3R04A 4IDTA 4EQMA 3K54A 3OF0A 3CR0A 4KRCA 5CU2A 4DG3E 1BL6A 3QGYA 2PVNA 2Y7JA 3FMLA 3PVWA 4FV9A 4IAFA 4WKQA 4RVTA 3OOMA 4PL5A 4TWOA 4D1SA 4HVIA 4IANA 1VJYA 2X39A 3POOA 4WBOA 4L7SA 5E90A 1H24A 2VTMA 3ZU7A 4DGGA 3C1XA 4V05A 4EOSA 5HTCA 4B8LA 3BV2A 5DR9A 3NIZA 2HYYA 2PVMA 3RP9A 2WTKC 4DYMA 4EH6A 4ZJIA 5AR2A 3LXKA 1J1BA 4CZTA 5CAOA 5CVGA 3U6HA 2VTIA 3RBWA
chains in the Genus database with same CATH superfamily
4O1OA 5DFPA 2E9NA 4U40A 4W9WA 4AOJA 2B54A 3DU8A 3GQLA 4QQ5A 4PPBA 1VYZA 3QD2B 3WYXA 4O21A 3ZMMA 3EL7A 3ZYAA 2YWPA 2P3GX 5EQYA 1ZARA 4U3ZA 2G15A 4CCUA 4BCPA 5J7HA 3UGCA 2PVKA 3NSZA 5CU0A 3W0QA 3IS5A 4YC8A 5LVLA 3RPYA 4JX7A 3I5ZA 2UZWE 5AP3A 4BCFA 3TTJA 4C62A 3KREA 5D1JA 5IQEA 4FK3A 3F66A 3R73A 3AXWA 2W9FB 3BLRA 4E6QA 3DKGA 4LGDA 1W2FA 4QP8A 1Y8YA 4DFXE 4FTLA 4RWJA 4E4LA 1J7IA 3O0GA 4AFJA 5B2MA 2BFXA 5H2UA 2IZUA 2WQNA 1OL5A 4FUYA 4L7FA 1XH9A 2R3LA 2Z8CA 1U5RA 4LG4A 1JPAA 4JXFA 2OKRA 4ZY4A 3QQLA 5BVNA 4ONAA 2Z7QA 5DYJA 5A46A 3Q5IA 4ITHA 1ZMVA 3DBFA 2Y9QA 3HX4A 4RFMA 4AXDA 4WO5A 1GIIA 3JY9A 4IVBA 4QMXA 3EQHA 1GOLA 4CFUA 5KKRC 4BDCA 3ZHPC 2XIXA 4U42A 2P2IA 5AP0A 3T9TA 3ODZX 3ZO4A 3R83A 3D0EA 4M3QA 2ZOQA 1G8KA 1UV5A 3QRIA 4F9AA 4QDEA 1YWRA 5KMKA 2EXCX 2VX3A 3DS6A 4KS8A 3FEGA 5IA5A 3LM0A 4BDFA 3KK8A 5ANKA 3Q4CA 3W2SA 1ZAOA 3V6RA 4JDKA 1YQJA 3QXPA 1XBCA 3QA0A 4V01A 4K33A 2W9ZB 4ACCA 4NT4A 4D2RA 3C5IA 4CMTA 3VS7A 3R7VA 3Q9YA 3AQVA 4DH8A 3PLSA 2XKCA 4I3ZA 3HP2A 4BI1A 4I5PA 2B9FA 4FKPA 4I22A 4WNOA 3LFBA 3BHYA 2QOHA 3JVSA 3MY0A 5J9YA 3RPRA 4ZZNA 3PE1A 5KNJA 5HO6A 3LLTA 3VUDA 3IOKA 4IVDA 4ZTMA 1Q97A 2QR7A 3VS0A 4C4FA 1GY3A 4PL3A 3ULZA 4FEWA 3DKOA 4I5MA 4J96A 2DYLA 2I0VA 1DAWA 5M55A 4N6ZA 4BR3A 4Z9LA 2WTVA 4CYJA 4BFMA 3QQKA 4O27B 4BCKA 3BYUA 3F5UA 2ITXA 3PJ3A 4ERWA 3G9NA 2UW9A 5EM7A 4A9UA 4O84A 3Q9XA 4RJ6A 4EHGA 2YISA 4OBOA 3IW5A 5E8SA 4O0SA 4RWKA 4LMNA 3R9DA 1MRUA 4I41A 5ACKA 4B4LA 1K2PA 4O7RA 3V8TA 4NM3A 2PE1A 5CF8A 4D28A 4LGHA 3HUCA 5I9UA 3DBEA 5TE0A 3OEZA 3ZM4A 5H8BA 5IQHA 4F9BA 4AU8A 4DG2E 1V0BA 5HX6A 3CC6A 2YIRA 4ZMEA 1KWPA 3AC2A 2PTKA 4DCEA 5TKDA 1QPJA 3Q32A 3R8UA 3W0SA 4E1ZA 2ZAZA 3GOKA 2XRWA 3V6SA 4DHJA 5K5NA 2J9MA 2ZV8A 3LCDA 3ANRA 4MXOA 3VUGA 4AFEA 4CFWA 4QD6A 2JAVA 4MBIA 4DN5A 3VHKA 4FKOA 2Y0AA 3CTHA 4XX9A 5L2TA 4QPMA 1XBAA 2UZDA 3TDVA 1PMEA 3JPVA 3NUAA 3WI6A 2VGOA 4DDIA 3FDNA 1XH5A 3IPHA 3NWWA 3QC4A 2Z7LA 5HHWA 5KO1A 3LCKA 2ITYA 4FV2A 4JG7A 3NIEA 4G3FA 4AAYA 1H08A 5JFVA 2UZVA 2X8EA 4G16A 3I0OA 5AR7A 4H3PA 2ITOA 4LYNA 3VJNA 4F0IA 3P78A 3UO4A 4NUSA 3R7OA 4P7EA 4RPVA 2X6EA 5CS6A 3U51A 3LQ8A 2IVTA 4CGAA 4FA2A 2UW5A 5CWZA 1XH8A 5D11A 4ZTSA 3RAKA 4U0IA 5CAUA 2PSQA 2ACXA 5CSWA 3RMFA 3E8EA 4NW6A 3CXWA 3F69A 1FVRA 2UVZA 5E1EA 3BRBA 4L46A 3EQGA 4TW9A 5FRIA 3RNIA 4D4VA 3IOPA 3NDMA 2C5YA 3PY0A 4H58A 1SVHA 3GBZA 3LCOA 4E93A 5K5XA 2HW7A 1SNUA 4QYEA 3HRFA 3F5XA 4ZLYA 3AD4A 2VTJA 2ZV7A 3R02A 3QKLA 3WF8A 5FQDC 4G6OA 5ANOA 3MJ1A 3KL8A 3QTIA 4G5PA 4TTHB 3PVGA 4XG4A 3C51A 1W2DA 4TWNA 3REPA 4GS6A 5G1XA 3UO6A 4HVDA 4YU2A 2CKPA 4RJ4A 3LXNA 4ANOA 3FLQA 3HV6A 3TNQB 2OJIA 4AAAA 1Y6AA 3U4UA 5CEKA 2Q0BA 3FZPA 3FI8A 3KULA 4MHAA 4ZSAA 5IA0A 2A0CX 4FT0A 4IM2A 4LOPA 4BDAA 4X0MA 4C37A 5CQWA 5DPVA 5GIPE 5ETFA 4CFVA 3OTUA 2R5TA 3FPMA 4RJ5A 2J5EA 2CCHA 3GXLA 3RK5A 4A9YA 4BC6A 3R30A 4QOXA 2CKOA 4O82A 5HIDA 5IA1A 5AAEA 3C9WA 2I0EA 3QRTA 3T9IA 1H27A 2ETKA 4FTRA 2FSOX 1PXKA 2QO2A 5AEPA 2PUPA 1RW8A 1F0QA 1TKIA 2Q83A 2XBAA 2B55A 3MN3A 4FKGA 3CP9A 4EHZA 3UOHA 4BZNA 2Y4PA 3COIA 3LVPA 4RGJA 3MW1A 3ANQA 3DK7A 2JDOA 5C8KA 4EC9A 4A06A 1V0OA 2E9UA 3IKAA 5CF4A 4FTJA 5L2WA 2PZPA 3WF7A 4PNIA 5BVFA 3MY5A 2XARA 4C33A 1XHAA 2I0YA 4AGCA 5JKGA 1Q41A 3AC1A 3NUNA 4RX8A 3G2FA 4KBCA 3H9OA 2WMBA 2WQOA 3IW6A 4RSSA 4AOIA 1IAHA 3ZO2A 2PVHA 1ZWSA 3LJ0A 5K4IA 4DH5A 4JAJA 5HU9A 4KIPA 1GZOA 2GDOA 4ASZA 2XNEA 4JOAA 3MFRA 4S31A 4RJ8A 5HG5A 3CD8A 3QGWA 3I79A 1WBNA 2JKKA 2XJ2A 2YCSA 4TRLA 1B38A 5B2KA 3F7ZA 2QOIA 2ESMA 3VBQA 4C2WA 5J79A 5KCVA 2QLQA 3UBDA 4ZK5A 4CFMA 4EKKA 1ZY5A 4IE9A 3G9LX 3D5WA 4YBKA 3PXQA 4LMUA 3JR1A 4DHFA 4QDVA 1H01A 1Q8WA 4IADA 5CU3A 4DG0E 4C4GA 2BR1A 3NUYA 4H3BA 4YC3A 4E4MA 4YJUA 2R3NA 4UMTA 5JSMA 3DT1A 3IW7A 3BE2A 2W1CA 3N51A 2PVJA 3OW4A 3TL8A 4DEGA 5F95A 4XYFA 2ETRA 5AV4A 4K18A 2J5FA 3ORIA 3Q53A 4YO6A 4DA5A 1M2QA 3F7WA 4V0GA 2KTYA 2ZV9A 2BFYA 3QX2A 4GFGA 4QMPA 2OZAB 2R3MA 2AEGA 2YACA 3KRJA 3FQSA 4QT1A 2JC6A 4FG7A 4IZYA 2ITWA 4FTQA 3F2RA 4XCUA 3QTWA 4DAWA 3F2NA 3DB6A 2XEYA 4L45A 5DN3A 3UQCA 2J0KA 2JKOA 3VUTA 3DV3A 3LCTA 3R1NA 1U46A 1PXLA 3VUKA 4BL1A 3ACKA 4Q5HA 3QTZA 5AV3A 4U3YA 3LKMA 4QQCA 4LDTA 4C57A 1BX6A 2R64A 3RAIA 3P7BA 3KXXA 3S95A 1UU3A 2BIYA 2FH9A 3TACA 2W1ZA 2BZHB 3LFAA 4BDEA 3EQBA 3MESA 1W0XC 3A7GA 3E8DA 5TR6A 5H8EA 3OCTA 3DJ7A 3COMA 4QTCA 3TDWA 2FB8A 2IF8A 3ETAA 3ZM9A 4R7BA 4TNDA 3MB7A 5FP6A 3QZGA 2YCFA 4KBKA 4XG9A 4U97A 2QO7A 3ZLXA 2UZOA 4R3CA 4O22A 1UA2A 4QO9A 2BRNA 2GFSA 3I7CA 3E64A 3OHTA 4Q9ZA 3HVCA 3W0RA 5ICPA 5J7BA 5CEQA 3S3IA 1R0EA 4EWHA 3V5WA 4DFZE 4H05A 2C68A 4CTCA 3W1FA 4FR4A 4BHZA 3PRIA 2OSCA 2VTTA 4OTIA 4AGUA 4YJSA 4DGMA 4ITIA 4PY1A 4CQGA 3ZS5A 4GW8A 4MNFA 3FL4A 4ENYA 2H9VA 4EH9A 3EJ1A 1S9IA 5JGBA 4BTKA 4L52A 2RG5A 4PP7A 2UW3A 4KB8A 5M06A 1Z9XA 4Q9SA 4OAVB 3QD0A 5H3QA 2C0TA 2X9FA 1UNGA 4BWPA 4D4YA 3NGAA 4CCBA 3TEIA 3RALA 3RCJA 3CE3A 2F7EE 4GUEA 4J95A 1ZYLA 3ULIA 4WIHA 4MBLA 5EH0A 2WXVA 3MS9A 5KZIA 4AS0A 3MJ2A 4USDA 3FXWA 4PUZA 1PYXA 1OKVA 4EH5A 4YLKA 4AGWA 4LV5A 1KV2A 3AG9A 3PRFA 5IQGA 3PIXA 4C4HA 4QQJA 1A06A 5M56A 3BL7A 3FQEA 4MWIA 3EQPA 4RG0A 5FTGA 3RAWA 4K8AA 3ZC5A 4FTKA 3OT3A 3PA4A 3HDMA 3SW7A 3TZ7A 3NX8A 2QLUA 5EHLA 4BB4A 3QL8A 4NM7A 4Y83A 3TZMA 3G6GA 4E5AX 3GC9A 3ZRLA 4EHEA 3S1HA 3MV5A 3AMBA 5DH3A 4BZOA 3JY0A 3FLYA 2UW6A 4ZZOA 4AXEA 4FTNA 1IG1A 3Q4TA 2RGPA 1KE7A 1Q3WA 2LGCA 4PTEA 5J95A 2EXMA 3U87A 3OS3A 4IB5A 3IECA 3NAXA 2QOOA 4RRVA 5HE1A 3TNIA 3HECA 3LXPA 3W0PA 4EQUA 4QNYA 5JH6A 5DGZA 1ZOGA 3HA8A 4JQ8A 4XV3A 3SOAA 3ZUUA 2JKMA 3TT0A 4EI4A 2YEXA 1PKGA 3GFEA 4HPUE 3UZRA 4RIWA 3JUHA 2A2AA 2ZM4A 1YXVA 3QTQA 4ZTLA 4EC8A 4IVCA 2YZAA 4JJRA 5A6OA 3PZHA 3R8PA 2W5BA 4I4EA 4C02A 2VWIA 3C4ZA 2JLDA 1H1SA 3LFCA 4RFYA 5EM6A 3MYGA 2E9OA 5HG8A 4BGHA 2YM8A 1OIYA 3O23A 4KIKA 4G3DA 2BUJA 4GYGA 4L8MA 4U44A 4JLCA 4WRSA 3V5PA 1Q24A 3EN6A 4CMOA 3FY0A 3CS9A 2XB7A 2ZMCA 4NCTC 3OWLA 2C47A 2BZIB 3HKOA 3R2YA 4KS7A 2GNHA 2X7OA 3FZOA 3R21A 3UIUA 5AUZA 1ZYSA 1SVGA 5IH4A 4K77A 5JFSA 1WBWA 4IJPA 3OG7A 5TO8A 2BMCA 3SD0A 3VUMA 3LJ2A 3LMGA 3SDJA 5L6OA 4TYHB 4R6VA 3ZFMA 3BWJA 5CT0A 3DA6A 5HBHA 1H26A 3QLGA 4C7TA 4FV5A 2B53A 2R3PA 4YSJA 1KE6A 3FLNC 4ZMFA 3SW4A 2UZEA 1EH4A 2GTMA 4KKGA 1YKRA 3R9RA 1W8CA 2GFCA 1V0PA 4MF0A 2BCJA 5DR2A 5CEPA 4YURA 5CLPA 4ACHA 3EL8A 4DLIA 4E73A 2C6TA 4EBVA 2GQRA 2GCDA 3FHRA 4CQEA 3Q6WA 2ERZE 2XK9A 4XRLA 5EDPA 4I6QA 2BZKB 3BYVA 3ELJA 4F09A 2XJ1A 4JIAA 1GAGA 3A7FA 3P23A 4XUFA 1HCLA 2P4IA 3F2AA 1PF8A 3CIKA 4J52A 2XNOA 4G3CA 4O4FA 5BNJA 2NO3A 3HYHA 5LCKA 3UIMA 4UX9A 5EYCA 3VBVA 1Q99A 3DBCA 3ZLSA 3DQXA 5EDRA 1OZ1A 3MB6A 4BBFA 4WSYA 3ENHA 4F64A 1Q62A 2C3JA 3MY1A 4DT9A 2PYWA 4UALA 4FSTA 5CQUA 3BWFA 4BDIA 2ZJWA 4OTWA 1STCE 4OR5A 4BIDA 3G6HA 4CT2A 4F9WA 3A7HA 3FMHA 2VWYA 2ZM1A 3TV4A 3UE4A 4RVLA 4QNAA 1K3AA 3OBGA 3SG9A 2W1IA 2OO8X 2BDFA 3P0MA 4QMWA 4DBNA 2YDJA 2XA4A 3KXNA 3ERKA 3BE9A 4EOMA 5ANDA 3BHHA 1OBDA 1VEBA 3GC8A 3NR9A 4RBLA 5CX9A 1M2PA 2R9SA 3FKLA 4FIFA 4RLKA 5IUHA 4O0XA 5JQ5A 1ZYCA 4FKQA 3P7AA 5BUJA 1O6KA 1H8FA 1H4LA 3C5UA 3RAHA 1BUHA 4KRDA 3FUPA 4YMJA 2GNGA 2GNFA 4FTIA 1G8AA 1YI3A 2W4JA 3E8CA 3R01A 1CM8A 4X6QC 3WZDA 2OGVA 2C3KA 2G2IA 2W96B 4LGGA 2CNVA 5A3XA 3O8TA 4O7WA 3PG3A 2I0HA 4W4VA 4IX3A 1YW2A 4C8BA 1JLUE 5EW9A 4C2VA 4HVSA 2J0LA 5DNRA 4LUDA 3R9NA 5K0KA 3IW8A 4TWPA 1OI9A 2OWBA 5H9BA 4UY9A 3TKUA 4FSRA 3NVMB 2J6MA 2PMOX 4FBXA 1UNHA 3D4QA 1PXIA 3DAEA 3PPZA 2HZNA 4CMUA 3EIDA 3OWPA 2VTQA 4XNEA 4QQTA 4G17A 2WIHA 4Q2AA 2WMXA 3RINA 4RC2A 2VTNA 1H07A 3W8QA 4W4WA 4GT4A 4ZS0A 4BJJA 4CV8A 3CY2A 2GS6A 1CKIA 4FKRA 3HA6A 5CALA 4GSBA 4EOOA 3D2KA 2HY81 3Q4UA 2WMTA 1FQ1B 1SMHA 3CPCA 3PSDA 3HMIA 5HVKA 5LQFA 4O38A 4NK9A 3F3UA 5FP5A 3DXQA 1I09A 3QYWA 3MGYA 3TWJA 4BTMA 4RIYA 2VU3A 4QPAA 3FC2A 5AR4A 3QQFA 3S00A 4N6YA 3EFLA 3IDBA 2YERA 3FSFA 5DI1A 1Q5KA 4FKWA 4LRJA 2X8DA 4ASDA 4JIKA 3U8WA 2GS2A 3JYAA 4K11A 3BHVA 1OECA 2GSFA 3K3JA 3QCXA 2C5OA 4J98A 4PPCA 3MTLA 3CKXA 2NNWB 1KV1A 1MQBA 1Q8YA 3Q4ZA 4GVAA 1REKA 4R3RA 3ZZWA 4KINA 4WG3A 5E4HA 2VV9A 3ROCA 4JBQA 4Y73A 3AKJA 1XH4A 5AIRA 4PF4A 1AD5A 5HG7A 3RWPA 4FSWA 4M68A 4BGGA 5LXMA 3W10A 4QMVA 1YVJA 4HCTA 4OT5A 4IAAA 2ITTA 3VNTA 3FAAA 3FI3A 5EHOA 1JNKA 4CEGA 5AV0A 4EONA 2HK5A 4AA4A 1L3RE 1CDKA 3A4OX 1ZOEA 4LL5A 5K9IA 4FL1A 1LEWA 3WF9A 4J8MA 2GNLA 3ITZA 4WUAA 3TKIA 3O71A 3O7LD 1W7HA 3ZDUA 5E1SA 3GI3A 4WG4A 5KMNA 1WBTA 5E8TA 2J7TA 3FMJA 3HRCA 4FZDB 3WBLA 3V3VA 4D0WA 3EH9A 4IZ5A 4IAKA 5IF1A 4FEXA 3PXFA 1O6YA 1ST0A 4GIHA 4BCOA 1YHVA 1V1KA 3E7VA 2UVYA 4R1YA 5CY3A 5HVJA 4DLJA 5IH6A 3I81A 4XH6A 4LV7A 4YHTA 2X2MA 3RK7A 2B0QA 3BPRA 5IEXA 3TYKA 1W83A 3GC7A 3K5VA 4C4EA 3ENMA 4FIHA 4BDHA 4D55A 2VWZA 3ML1A 4O2PA 4IDVA 5D12A 4HYHA 5LWNA 2OG8A 4FSNA 2OH0E 4WRGA 2HZ4A 4W4XA 2BDJA 2BRHA 3DLZA 3I6UA 4M66A 4WNKA 4JQ7A 2C6IA 3FMMA 4DTKA 3T8OA 4FODA 4AW5A 4R78A 3TTIA 2VTLA 2OI4X 1T45A 2CGVA 3AC3A 3WE8A 4HYUA 4EEVA 5A6NA 3QRJA 4FRFA 4Y5QA 5I3OA 3V5JA 1SM2A 2JBPA 3KRWA 3B8QA 2XNGA 3EKKA 4DT8A 2B4SB 1ZMWA 3ET7A 5EHYA 3KU2A 4BIEA 5BUIA 5FBOA 1IRKA 4DH3A 4L3PA 3UG1A 4EK6A 3UNJA 1AQ1A 1UU9A 3BKBA 4L53A 3L1SA 2XM9A 4D9UA 5HCXA 2WOUA 1T46A 2YHVA 4GK2A 4D2SA 3LHJA 3HP5A 5E8WA 5LVMA 4FSZA 4WD5A 3ZXZA 3DGKA 2NP8A 4FT5A 1WCCA 3BBWA 4EOKA 1O6LA 4CG9A 1Y57A 4NW5A 4GKIA 3EFWA 4DEBA 3EFJA 3G5DA 4LOOA 4ALUA 4PTGA 3UVQA 3FPQA 5HIEA 2PE2A 2G9XA 3AGLA 4U80A 5IU2A 1WBVA 1YOMA 5CEIA 4UN0C 4FYOA 3QLFA 4D2PA 4OTFA 2HOGA 2PVLA 2UW8A 2WGJA 4ANNA 4JVGA 4FG9A 3LZBA 3VS4A 5FDXA 2QI8A 2A4LA 4YTIA 5K4JA 1NT2A 4MCVA 4UB7A 4WT6A 4L3JA 4LV8A 2O65A 2ZDTA 2CN8A 4JDHA 4BN1A 4JG8A 5KHWA 4B99A 3NAYA 1Q61A 3RGFA 5FBNC 4MXZA 2VTHA 4G9RA 5A14A 5IA4A 2JAMA 5AP6A 1OL1A 2DUVA 4ZSGA 1B39A 4PQNA 2IW6A 4HNIA 5JRSA 4DH7A 5T3QA 4PDOA 4FOCA 4AZTA 2YIWA 5BUEA 4U5JA 3H0ZA 2E2BA 3LOKA 4G6NA 2FSLX 3U9NA 4O0YA 2CNQA 4NWMA 3CQUA 3C13A 5AA8A 5GZ8A 5JQ8A 3ATSA 4WUNA 3NCGA 4O0UA 2BAJA 4RA4A 3V8WA 4B8MA 4NYEA 5EFQA 2P55A 2E9VA 3RK9A 5HCZA 3PPKA 2WD1A 4DBXA 2Y6OA 3KCFA 2QQ7A 1LUFA 3PIYA 5DR6A 2B1PA 1ZLTA 2VAGA 3QU0A 1MRVA 1PXNA 3CQWA 4GIIA 5M4FA 3SXFA 4NKSA 1J1CA 2UVXA 3SOCA 4EZ7A 3POZA 4CSVA 2UW7A 2RSVA 3DBDA 4HYSA 2JFLA 4NFNA 3VULA 3HMOA 1R3CA 2WQMA 2VD5A 3PTGA 3QBNA 1J7UA 4YJVA 5EYKA 4CKJA 4O2ZA 2G2FA 4XHKB 3ZC6A 3A61A 3QZIA 4JBPA 4YZBA 3HDNA 3R7YA 5K0XA 2WIPA 2XZSA 4FT9A 4IX6A 3ODYX 1A9UA 1PMUA 3NFFB 2RG6A 3S4QA 4K9YA 3TI1A 4KSQA 4JT3A 2X6DA 3I5NA 4C3FA 5CEMA 1OPJA 4J99A 4CZUA 4AXCA 4M69B 4C3RA 3U6JA 5IH5A 3H10A 3U9CA 2ERKA 2ITQA 3UQFA 2UZBA 1IR3A 5AV2A 5M53A 2C6OA 3F5PA 4HOKA 5KBRA 1Q8ZA 3SXRA 5HGIA 5IQIA 4DH1A 2YZLA 3FYKX 4M15A 3KMUA 2WMVA 3WZJA 3CEKA 3NW7A 3L9NA 3QQJA 3QWJA 2I6LA 3CBLA 1YHWA 4GCJA 4NJDA 4O7SA 3OWKA 3DXPA 3NNXA 3FXXA 1JBPE 1APME 3TV7A 4AN2A 4AACA 5HTIA 1LEZA 1WBOA 4UMQA 4XG3A 4XP0A 3NW6A 4EORA 4PWNA 5C26A 3VWAA 2QU5A 2UW4A 2FUMA 3ALNA 4I92A 3AKKA 3L9PA 5CZIA 3RTPA 2O63A 3D15A 4RJ7A 5M51A 4D2TA 3JVRA 4MUQA 4FSQA 2HIWA 4A9SA 3D7TB 4EOPA 2HXQA 1Q4LA 3BL9A 4TWCA 4QTAA 4EK8A 3F88A 5A54A 3QUEA 4YC6A 3VIDA 3FLSA 4EOQA 5DT0A 4Z7HA 2XK8A 4AE9A 2XNNA 5CT7A 2CLXA 2C6LA 3LLAA 2OH4A 2OZAA 3HMMA 4FVPA 1A48A 4A4LA 4IMYA 3ZTXA 4MAOA 4D2WA 5KX8A 2GS7A 4FKIA 4J53A 3EB0A 4DCAA 3MH1A 4FYNA 2YM5A 4X21A 5EYDA 4AZSA 4AQKA 3R1SA 5CI7A 3K3IA 1J3HA 1QPDA 3FJQE 2OZOA 3W55A 3TUBA 3HAVA 2P33A 3FL5A 2W5AA 3K5UA 4O4BB 4OGRA 3ZDIA 2HELA 1PXOA 2JDTA 4BBMA 5L8LA 3COHA 4LQMA 2WMQA 1G3NA 3R2BA 4XP2A 3P4KA 4YZCA 3NW5A 1FOTA 3II5A 4HPTE 4RT7A 4ANSA 2YWVA 2BHHA 2JGZA 2XRUA 3NUUA 4DFUA 4HZRA 4FICA 3W33A 4KUJA 4M13A 2XKFA 4EZ5A 3W18A 3MWUA 2AYPA 4MF1A 1REJA 4FF8A 4JX3A 2QKRA 3FMNA 4BVUA 1XQZA 5GNKA 2WHBA 2QOBA 2UZNA 1UU7A 4DE4A 1MQ4A 3QAME 3PPJA 2QG7A 3LFEA 2C6KA 4EJNA 4D1XA 1HCKA 3EOCA 5HNGA 4C4IA 3PP0A 3TJDA 4MXYA 5AADA 3Q9WA 4EWQA 4FNYA 2FA2A 3L8XA 3KF4A 3B2TA 3VQUA 5IA2A 4I6HA 3NVKI 1YI4A 4I24A 4UXLA 4U79A 4IW0A 4FVQA 3E5AA 3OT8A 4YJOA 3HV4A 4QP3A 4ZJJA 4HGTA 4BDKA 4F7SA 4EZ3A 3OUKA 3PZEA 3UYTA 3PIZA 4CRLA 1XH6A 3LIJA 3HEGA 5E8UA 2GQGA 2WAJA 3TMOA 2QNJA 2W4OA 5FEEA 4FTMA 4BI2A 4HVGA 2ONLC 1IEPA 2A27A 3Q52A 5L8JA 1XBBA 3WE4A 4E5WA 5IDNA 1Z57A 4O6LA 3GENA 3WZKA 4F99A 1GIJA 3OXZA 5IQFA 3I6WA 3O7LB 4YJTA 3PXRA 4L68A 4RX9A 2IVSA 5EG3A 5H8GA 2X7GA 4X2GA 5AP1A 3R00A 4I23A 2FSMX 3G0EA 4D4RA 4UWYA 4FZFB 3QRUA 4OBPA 3ZH8A 1FVVA 3K2LA 4QYYA 1JKKA 4GVJA 3TZ9A 2RFSA 1XMMA 2X2LA 3U54A 3F6XA 3IK3A 4AF3A 2OK1A 4E6DA 3OW3A 4K0YA 5M08A 5JRQA 4WNMA 5L8KA 3VONA 2C30A 4O83A 4I5CA 4RQVA 3UP7A 3WIKA 4O7NA 4DGNA 2YLFA 1FINA 3GNIB 5C03A 4PNKA 5M4UA 2CHLA 3NEWA 2R3RA 3TUCA 2C1AA 3ZEWA 2YDKA 4IB0A 3R7GA 4N70A 5D7VA 5C01A 2HAKA 4F6SA 3THBA 3GT8A 5CZHA 3MH3A 2RL5A 3H30A 3LE6A 4O86A 2YN8A 2WTWA 4KAOA 2A1AB 5CTPA 4AA5A 5IG1A 5IEYA 2UUEA 1WVXA 3MA3A 5HX8A 2OLCA 5FUTA 3ZBFA 5M4CA 5FD2A 1TQPA 3LMIA 3KF7A 1RJBA 4ACDA 4O0VA 3FLZA 1ZZLA 3NUSA 4XRJA 5EDQA 3DZQA 4GK4A 3P08A 4O4DA 2R3HA 4XG7A 2UV2A 3BX5A 3WF6A 4P5ZA 4NIFA 5J9LA 4RIXA 4F0FA 5AP4A 3G0FA 1R1WA 2C6EA 4FTTA 1TZDA 3LQ5A 4BGQA 4GEOA 4U43A 2RFNA 4CLIA 5I9VA 2QODA 4FGBA 5C9CA 5CSHA 2ZFYA 5M44A 3M11A 4E4NA 5T6KA 5IA3A 3UZTA 3QD4A 3W0MA 1XO2B 4YP8A 4Y46A 4LM5A 4AZEA 2IO6A 4Y95A 3UMXA 5DE2A 3SX9A 2YDIA 3KN5A 1DAYA 3QZHA 3O5AA 1W82A 4YTFA 3BYMA 4MNEA 4CV9A 4R7HA 4TYGA 3VBXA 4H39A 3DBQA 4BKYA 4C3PA 3CD3A 4RZVA 4DGOA 3UPZA 5AWMA 3CSVA 1OIQA 3NYVA 2SRCA 4MXXA 3F9NA 4MYGA 2X4ZA 2YA9A 4RIOA 4YJRA 4ZS4A 5D10A 1G8SA 2JEDA 1K9AA 3TXOA 4RMZA 4FT7A 3RZFA 3VS5A 4FNZA 4FSYA 5AX9A 3QKMA 4L44A 4PMTA 2B9HA 1UU8A 2G01A 5CYIA 3LAUA 4X3FB 4W4YA 2JBOA 5AM6A 5I3RA 4ALWA 2JDVA 4FV6A 1ZZ2A 5CVHA 3WOWA 4Y8DA 3PUPA 3EZVA 4ZY6A 3F61A 3G15A 2R2PA 4DFNA 5GJGA 3O8PA 2J90A 4QP4A 1UKIA 2PWLA 3E63A 5KMOA 1H00A 3CPBA 2UZTA 3L9LA 4H3QA 2QOFA 5CF5A 5LOHA 4MKCA 3TZ8A 4NSTA 3FLWA 1OKWA 3NUPA 1LP4A 2YM3A 2OJFE 4GUBA 4MD8E 4CZYB 4OTHA 4TZRA 4Q5EA 4XLIA 2BIKB 3RKBA 5GZ9A 5FM3A 4PPAA 3KY2A 4JNWA 1TFFA 3ORTA 3ZCLA 4IB3A