4O96A

2.60 angstrom resolution crystal structure of a protein kinase domain of type iii effector nleh2 (ecs1814) from escherichia coli o157:h7 str. sakai
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
163
Chain Sequence
KSPVPGNVIGKGGNAVVYEDMEDTTKVLKMFTISQSHEEVTSEVRCFNQYYGSGSAEKIYNDNGNVIGIRMNKINGESLLDIPSLPAQAEQAIYDMFDRLEKKGILFVDTTETNVLYDRMRNEFNPIDISSYNVSDISWSEHQVMQSYHGGKLDLISVVLSKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords type III effector protein kinase
publication title Type III Effector NleH2 from Escherichia coli O157:H7 str. Sakai Features an Atypical Protein Kinase Domain.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Hydrolase
total genus 47
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o96A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o96A01
1PHKA 3W33A 5A4QA 3SA0A 4O7ZA 4YJSA 4BI0A 4FV0A 2JKMA 4DF3A 3C13A 3RALA 2O0UA 4I0RA 5K9IA 5M08A 2BPMA 3KK9A 4FKQA 4YNOA 3QUDA 3HMPA 5I9YA 4JOAA 4DEDA 2XNPA 3D0EA 2YAKA 3DBQA 4TYEA 2W5BA 3PDTA 4XRLA 4ZTNA 4WRGA 4K0YA 1Y8YA 3MH0A 4U9AA 4ZTQA 4FTRA 1UVRA 4MD7E 3KFAA 3PG3A 2OXDA 4M97A 4PPCA 5IH4A 5J7HA 4B99A 5HBHA 1SZMA 2CKOA 3PLAE 2X6EA 3NR9A 1XH9A 4EOIA 3PY3A 4D4YA 1B39A 1VZOA 3HP5A 3AG9A 1S9IA 3SOAA 3GQIA 2EWAA 3GI3A 4G34A 2OXXA 1WCCA 2QU5A 3BYUA 1UWHA 2W1DA 3T9IA 1JBPE 1Q5KA 1W98A 5KKRB 3BBTB 1IG1A 2VWYA 4IVBA 4MXAA 3GFWA 2CN8A 4WG5A 4W8DA 4FA2A 3WBLA 5E1SA 4FSTA 4M68A 2BAKA 2OU7A 4CCBA 5IDPA 4FKPA 1AQ1A 3LW0A 4ITIA 4QRCA 2A0CX 5LWMA 3CCNA 2PE2A 3GC8A 5EM7A 5HKMA 3Q9WA 4OAVB 4I21A 3D5WA 4H3PA 3DAEA 1O6KA 4CZTA 2W4KA 2OH4A 4ZLYA 3K3JA 4QMQA 4TYIA 2C4GA 2QC6A 3A8XA 4BBMA 4CZUA 3RI1A 4CLIA 4Z3VA 3ZBFA 3NVMB 3M1SA 3IGOA 4JX3A 3LLAA 4YJOA 2BFYA 4XH6A 1LUFA 3DAKA 4O1OA 3DK6A 3WF8A 3UP7A 4MBLA 4YLKA 2R4BA 2FYSA 4MWIA 5E8XA 4KA3A 2JIIA 5E8VA 4B8MA 1DI9A 4ZP5A 4XHKB 5C03A 3FJQE 4D1SA 3C7QA 2UW0A 5A6NA 3C0IA 1XQZA 2X1NA 3BGQA 4TNDA 3CTQA 1PF8A 3D5UA 3GXLA 2JDTA 3UMWA 2BRHA 2NRYA 4JAIA 1ZMVA 3GENA 3JY0A 4N70A 1L8TA 1IA9A 4ZMFA 1KSWA 3H9RA 4U97A 3ULZA 1XBCA 4GT5A 3Q2JA 4TYHA 3F6XA 5CQWA 3H10A 4R3PA 3KULA 5EHOA 5EHYA 4E6AA 1H01A 2GHGA 3EQDA 3PJ3A 4GJ3A 3WYYA 4RWJA 4YTFA 3LQ8A 4O7SA 3AD4A 4JQEA 2JKQA 1ZWSA 3A7IA 3ACKA 2OFUA 3QAME 4FG7A 4CFVA 1QPCA 3D2KA 1GIIA 2C3KA 2Z7LA 1FOTA 5KMLA 3C4WA 1XH7A 3BX5A 3LFFA 3EQCA 5KHWA 3TDWA 4DTKA 2ITYA 4DYMA 3IOPA 2HY81 4FSYA 2WKMA 4C61A 2A27A 2QKWB 3RHKA 2V5QA 3MPAA 5IA0A 3Q60A 5J79A 4DFUA 4FSWA 4X3FB 3ZC5A 4E26A 3ORXA 4HCVA 4RIXB 5H8EA 5HU9A 4AA4A 3B8RA 3DZOA 2XJ2A 4MTAA 2PZ5A 4C4GA 2UW5A 4BCIA 3K5UA 4AZVA 3PXQA 1W7HA 1VEBA 4AZWA 4FGRA 3AC1A 3O23A 5AP3A 1MP8A 2Y7JA 5G1XA 5HIDA 5HTBA 1OL5A 2NP8A 4A06A 4O2PA 3PP0A 5HD4A 3ZDIA 3O8UA 3AOXA 3OTUA 3JYAA 4AS0A 1V0BA 4BDEA 5IQGA 3ZXTA 5DRDA 4D1ZA 3KRWA 5CZIA 3OT8A 4YR8A 3A4PA 2VWUA 5KCVA 2ITWA 4CMTA 1OVEA 1Q8UA 1Q97A 2G2IA 3WIKA 2WEVA 4UWYA 3LXPA 3Q9YA 5D7VA 3HMOA 3NAYA 5FGKA 3AD6A 5DR9A 3RNIA 3OCGA 3OHTA 2UW9A 5AR5A 3KL8A 4L46A 3JY9A 2HY0A 5IG1A 4LQMA 3QZIA 4TN6A 4AXAA 1ZZ2A 3TM0A 2QO2A 4ENYA 4DFYA 2I7QA 4TWPA 2BCJA 4E4NA 4FEXA 2RKUA 2ITVA 2B1PA 3F82A 2OK1A 3F2NA 1U54A 3DDPA 4QP6A 3I81A 4H3BA 2PE1A 5H3QA 4O1PA 3VBXA 4WG3A 3G15A 2ITZA 3MY0A 4E5WA 3PA3A 3BYMA 5LARA 5GIOE 3EN4A 2C3LA 4AOJA 3Q04A 4AZEA 2R3QA 2GCDA 1I09A 2X9FA 4IX4A 2JIUA 4QQCA 1GNGA 3UOKA 4L9IA 4UZDA 5IDNA 2BTRA 4FV1A 5DIAA 4F9BA 3H3CA 3QTIA 4GH2A 4XCUA 3TNQB 4YHFA 4AUAA 4IQ6A 3D7TB 4PDSA 5JRQA 3GC7A 1ZYSA 2Q0BA 3D9VA 5AV4A 4RJ4A 4Z7HA 3EOCA 3GCUA 4P5QA 5CEQA 5CNNA 3KKVA 2FUMA 1OIYA 4RX9A 3M2WA 3NUPA 1H1PA 4AQCA 3EN7A 5AIRA 2CHLA 1J7LA 5GNKA 3AGMA 1YOMA 2AUHA 3NEWA 4YC8A 4RFZA 3UPXA 4F1OA 5F4NA 4IAKA 5H8BA 4XX9A 1BL6A 5EH0A 4HYUA 2C69A 3V5JA 3PZEA 4G3FA 4IM2A 2WTJA 3IECA 4MD9E 5CAUA 3JR1A 5BYLA 2WOTA 2R3LA 2XVDA 3ZLWA 5A9UA 5CAPA 4L52A 4NKSA 5T68A 1KV1A 4R78A 4FVPA 3FDNA 5IH5A 4FL3A 5LVNA 4E73A 2V7AA 3QCSA 4LL5A 2WMXA 2VWZA 4JXFA 5ANOA 5L6WL 2RFSA 3Q4UA 4F63A 3PPKA 3MH2A 3UQGA 3EQGA 4PDPA 4U45A 3QRJA 3S1HA 4IZ5A 5KBRA 4M69B 4UXQA 4FTOA 4ACMA 3FLSA 4BTFA 4DG2E 5BVOA 5JFVA 3PWDA 4KS8A 5AP5A 2GS2A 4Y85A 2C6TA 4NH1A 4ANSA 3TG1A 1JAMA 3G33A 1W8CA 3EKKA 4R3CA 3ENHA 1E1VA 4ERKA 4K1BA 4S31A 4QPAA 5D10A 4TL0A 3BRBA 4LRKA 2BUJA 4D2TA 3OCTA 3ID6C 3ZOSA 4FNWA 4DH5A 2IN6A 4MNFA 4PTEA 5FQDC 1YW2A 3Q4CA 5IF1A 3EB0A 5CF5A 2IW6A 4HCTA 3P08A 3ACJA 5K0KA 4APCA 3G5DA 4LRJA 3PSCA 5ANIA 5HTCA 3PVBA 2EXEA 4RBLA 3UMXA 2VU3A 3ZONA 1Q4LA 3MN3A 2ITXA 4IANA 3H30A 5CU6A 4WBBB 4DH3A 4CFMA 4Z16A 3LM5A 1BYGA 4M7IA 3LHJA 3P4KA 4X7QA 5HCXA 5BVKA 2VTOA 3D7ZA 3L9NA 5EM8A 3G9NA 5CQUA 4AW0A 3PE1A 2J5FA 3I6WA 4DA5A 4V0GA 3LFDA 5DR2A 1YQJA 5A54A 3FXZA 5DEWA 2WMTA 4R1YA 3TKUA 2Z7QA 3PIZA 3GC0A 4GT4A 1JLUE 4RC3A 3LXKA 4ZZMA 3MTFA 3KRXA 5D7AA 1GOLA 3NSZA 3V6RA 4DFXE 5KMMA 3JVSA 3F9NA 5BMMA 2R3KA 4FF8A 1EH4A 3GT8A 1PXMA 2JDSA 3HEGA 4IWQA 3T8OA 1UU9A 2UZDA 3FL5A 3C4ZA 4U3ZA 2HW6A 3LOKA 4K2RA 5IKWA 4CRLA 3NUSA 4RIYB 3EL7A 3EN9A 3MVMA 1B6CB 1NXKA 3D83A 5E91A 2JLDA 2XMYA 4FI1A 4FV7A 4MF1A 5CAQA 4GUEA 5ICPA 2UZNA 5DH3A 3OY3A 4ZS0A 3HGKA 4DFZE 1OIRA 3BGZA 2XIKA 3MBLA 3RMFA 4ASDA 2BIYA 3KVWA 4QTBA 4ANNA 2WQMA 4AAAA 4E6DA 2I0VA 3E8CA 3QRTA 4I0SA 4ARKA 3MPMA 4YTHA 3U51A 2YDKA 2BZIB 4CMOA 4G2FA 4IXPA 5DOSA 4ANQA 4J98A 4RQKA 4O0YA 3O0GA 3QQFA 4KIPA 5HD7A 4S34A 4WUNA 4D28A 3EFLA 3FMLA 3A7GA 3KY2A 4KSPA 4ZY5A 2IG7A 2OO8X 4H1MA 4DN5A 1BLXA 2BAQA 2XM9A 2WQOA 4F4PA 4DE4A 5E8YA 2GSFA 3PTGA 3VW8A 2YLFA 4I0TA 4EOPA 2BDFA 4QMZA 4BI1A 1RJBA 5LWNA 3BHYA 3P78A 3PY0A 5HVYA 4OTDA 4Y46A 3LFNA 2UZTA 2RFNA 4KBAA 4U81A 3ZO2A 4NFNA 4R1VA 2HWPA 1F0QA 4W4XA 3SG9A 1OUYA 5JFXA 5CALA 3FLNC 4NWMA 4YBJA 3TI1A 4EH8A 4CG8A 3IOKA 3P0MA 2CCHA 3QKLA 5HG8A 3C4FA 3P7AA 4PL4A 3VUTA 5DEYA 4LL0A 3RWQA 1BI8A 2VTQA 2PHKA 4IB0A 4E4XA 3VS6A 2W9ZB 4BTJA 3NX8A 5BVNA 1Q62A 1V1KA 3KXXA 3ZFXA 3PJ8A 3NW7A 3QCYA 2ZM3A 2UW7A 2OG8A 2PY3A 1T46A 4JBOA 4PNKA 3UPZA 4PTGA 3GCSA 3CGOA 3CSVA 4UWBA 3R9HA 3MFUA 3EFKA 4ZJIA 3WI6A 2B7AA 5DFPA 3EIDA 1H07A 1YI6A 2IJMA 4FKOA 3V8TA 4B4LA 4WNMA 4L67A 3ZS5A 4BVUA 2JAVA 2IVVA 1Q41A 5J95A 3ORZA 5F95A 5KX8A 3ZSGA 2BILB 4FV2A 2O5KA 1REJA 2E2BA 4RRVA 5EI6A 2XRUA 5IQCA 3PA4A 4R5YA 5EFQA 3IG7A 4U7ZA 2YDJA 1DS5A 5C1QB 2YM3A 2ZM4A 1VR2A 4GFOA 3E8EA 4JJRA 5LVMA 3ZBXA 4RZVA 3F69A 1FGIA 4G3EA 4OTWA 1IEPA 5CNOA 3P79A 5HBEA 1IAHA 3LFEA 4QTEA 4PMPA 2BFXA 2F7XE 4B0GA 4GL9A 4QMNA 3OEFX 5JH6A 4AZFA 5K0XA 1OB3A 1KWPA 2X7GA 4FSMA 4L44A 4ANBA 2XUUA 4RIOA 5AP4A 4L43A 3QQLA 5HNGA 4BGQA 1FINA 5KNJA 2VX0A 4I4FA 3A4OX 3BYSA 4B7TA 3W2RA 2UUEA 2Z60A 3RTPA 3UDBA 5IPJA 4EHEA 3OY1A 5F20A 2KULA 3Q4ZA 4FKIA 4EBWA 2CKEA 1YWRA 2GFSA 2XIZA 3HA6A 5K5XA 5BMSA 2F57A 3EMGA 2B4SB 1Q61A 2C5VA 2GFCA 2ZYBA 3TUCA 3BLRA 3L8SA 3SLSA 1S9JA 3VBVA 2B0QA 3TNPC 3P7CA 3IKAA 5FG8A 2FSMX 3C4EA 4JX7A 5EW3A 5TO8A 2XZSA 4I6QA 4R7IA 4L42A 4GKHA 2QQ7A 2X9EA 4BICA 2GQSA 1YDTE 3DKOA 2R3NA 4AN2A 2C68A 1W82A 1ZYLA 4GYIA 2IZTA 2YERA 4CYJA 5L8LA 5CANA 4X2JA 4GS6A 4KSQA 3CR0A 3LE6A 4R7HA 4KIQA 2X0GA 2YN8A 5F1ZA 4A4OA 4QMTA 3O2MA 5DGZA 2W06A 2ITNA 3FMEA 3EJ1A 5JFWA 3F7WA 3PVWA 4J52A 4UMTA 4ZEGA 1URWA 2A19B 3V01A 5HTIA 1PKGA 4R8QA 4YZNA 2X8IA 3GC9A 3UP2A 2XEZA 1JSTA 5C8NA 2PMOX 5AV1A 1J91A 3BZ3A 4GCJA 4DT9A 1NVRA 3EL8A 3FQSA 2ETMA 3UO6A 3W2QA 3AQVA 3W55A 1OGUA 4QTCA 4MXCA 2YFXA 3R8ZA 4CTBA 2NNWB 3EZRA 3QC4A 3ORMA 3R73A 5BVEA 2J0MB 5DLSA 5DN3A 5DR6A 4WKQA 4BCOA 3LMHA 4IACA 3IDPA 5BPYA 4F1MA 3RNYA 2Z7SA 3BU3A 3L8PA 3QF9A 2R7IA 3IQ7A 4BDAA 4USFA 3AC3A 2WIPA 4ZXTA 3RAWA 5ANGA 5E1EA 1YXXA 3OW3A 5HG7A 5HE2A 4KS7A 4O0WA 4LOOA 3ZRLA 5D12A 3I1AA 2YWVA 2FA2A 4EOLA 4DH7A 3GOPA 2AC3A 4ZIMA 1YXTA 4AW1A 1M52A 4IDVA 2DYLA 4IFCA 3CPBA 3QKKA 4QP1A 3DXQA 3COKA 3A62A 1ZOEA 4BIBA 5LVOA 3CBLA 4RX5A 1PXLA 4D1XA 3LJ0A 4JQ7A 3VF8A 4IWOA 4BRXA 2FH9A 3QUPA 3E3PA 2PVNA 2IZSA 1RDQE 4I6HA 3RCJA 3ZSIA 1Z57A 5FBNC 3GCVA 4XV2A 4IE9A 4O84A 2QOIA 1Y57A 2XIRA 4I41A 4D2WA 4KWPA 4DEGA 4EK6A 1M7NA 2OZAB 3FMDA 4N6ZA 3Q53A 1SNUA 4J96A 1Z9XA 4MF0A 1G3NA 3HV7A 5M51A 2RG5A 3LQ3A 3MS9A 1Q8TA 4MVFA 4ZTMA 1OL2A 4HGEA 4QYGA 4XV3A 4CMUA 3TZ8A 4F64A 4D5HA 2OF2A 5M07A 3ROYA 4O0RA 2WPAA 3OUNB 4YJNA 1XHAA 4A9SA 3O50A 4U0IA 4F7JA 3K3IA 3R04A 4QNYA 4I22A 2OSCA 5KMOA 3PJ2A 2ZAZA 5CEOA 4RQVA 3QLFA 2WOUA 3DXNA 5H2UA 1OKZA 2G15A 5BUEA 3PSBA 4U80A 2XNNA 3UYSA 2YCRA 5CYIA 4IB1A 3WARA 2WU7A 2YITA 4EZ5A 4GK4A 5HE3A 2R5TA 3UOHA 4NKAA 2YZAA 4JVGA 3R7GA 2W1CA 4TNBA 3NUUA 4YJUA 3UGCA 4DEAA 1GZ8A 1IASA 4DCAA 1JWHA 2GS6A 3ULIA 1XJDA 3DPKA 3ZM4A 2HXQA 3DTWA 4FZDB 4I6FA 3RVGA 4BCJA 1FBNA 4L53A 1UKHA 2JAMA 2ZV2A 3DNDA 5AA8A 2XNBA 2NO3A 4FKTA 2OZOA 3EQIA 5CU3A 4JQ8A 2OIDA 3QTRA 3W16A 2WQEA 4PL3A 4WHZA 2R3FA 1BL7A 1KOAA 2VGPA 4IADA 4MK0A 5CT0A 3BELA 3R7OA 3A99A 4L7FA 3O17A 1UV5A 4FGBA 4ZY4A 5ITAA 3DQXA 2WXVA 3LCTA 4YHTA 5BX0A 3ALNA 3DLSA 3F3ZA 4IX3A 5HG9A 4BDDA 3VBTA 4AWIA 4PMSA 4TTHB 5BUJA 2IZRA 1H1RA 2WQNA 3PPJA 1QL6A 2E9PA 4Y72A 5K4IA 3QTXA 4YUQA 1OBGA 3KCKA 4MXZA 5EI8A 2J4ZA 3GOKA 4WRSA 4XV1A 4CLJA 4E4LA 4EWQA 4U6RA 4ENXA 5A6OA 4DGMA 4FE2A 2QNJA 4QT1A 5J87A 5HVJA 2WMBA 5HX8A 4KINA 5CY3A 1O9UA 5C26A 5GZAA 5HORA 4LRMA 4FL2A 3GBZA 5IUHA 3LFSA 3M11A 4OTRA 2CJMA 2YZLA 2VRXA 4BDFA 5AR2A 1PJKA 3LAUA 4EEVA 1ERKA 1XBBA 1VYWA 5HLNA 5FLFA 2Z7RA 2Y4IC 4UN0C 3R63A 3RK7A 2XK8A 4AZTA 3ROCA 2OGVA 4RC4A 5GZ8A 4FIFA 4QQ5A 4UXLA 2YISA 4MQ1A 4FIIA 4CKJA 2PPQA 4BDJA 2BHEA 3MPTA 4RX7A 4DHFA 5KO1A 3U87A 3I60A 4DT8A 3ZZEA 4CFFA 2HAKA 4F9AA 4ZMEA 3QA0A 4BZDA 2C6EA 5GHVA 4ZLZA 3KULB 5AUUA 2UVYA 3EHAA 2PU8A 1AGWA 2CPKE 2G01A 5J5TA 1BKXA 1FGKA 5L2QA 5TF9A 3O7LB 3LLTA 3IS5A 3COMA 3B2WA 3QCQA 4DGLC 3FAAA 4A4XA 4ASEA 4F6WA 3HVCA 5B2LA 2RF9A 2NPQA 4XV9A 4ZZNA 2CNVA 3EYHA 1GZOA 2WMUA 4C35A 5CXZA 4FL1A 4EQUA 4TT7A 2R3OA 3OC1A 4F1TA 4DC2A 1XH4A 2XRWA 2ZV8A 3LJ1A 3A8WA 4FIEA 2P2IA 4Q5HA 5FM3A 2C6KA 4YJQA 4ANOA 1H1WA 3HNGA 3FLWA 4X3JA 5LMBA 4GKIA 1KE7A 4M8TA 3FC2A 4G9CA 4AT5A 4FTJA 4YP8A 3RM6A 5M56A 1HCKA 1F3MC 1YXUA 4JS8A 4FV3A 4XYFA 1H27A 2J90A 1WAKA 3AC8A 2O2UA 4JG8A 3UQFA 3TZ7A 3LJ2A 4IDTA 4Y95A 5B2MA 5CASA 5JSMA 1W84A 1P14A 4WNKA 4RVMA 4YLJA 3W32A 3TJDA 1M2PA 5FD2A 3DA6A 5HLWA 3DKCA 4LI5A 2XK6A 2VTNA 3LVPA 4GW8A 4EOJA 2QO7A 2UVZA 4EC8A 2LGCA 5CS6A 3KN6A 3BWJA 5LQFA 4E6QA 5EG3A 3MJ2A 1OUKA 3ZCLA 5M44A 2Y6OA 4PTCA 3FHRA 4U8ZA 3L9MA 3F5GA 5CVHA 4I24A 4E1ZA 2I0YA 3E64A 5IEYA 5A3XA 5ACBC 4XLIA 4ORKA 2WTDA 3FUPA 4UZHA 5L3AA 2R0IA 4MBIA 4I5HA 5E8WA 2DWBA 4FT9A 4KKGA 5CSHA 2QCSA 4QMOA 3H9FA 4CFWA 2EB3A 2O8YA 3DK7A 3FXWA 4QMXA 5ACKA 2WU6A 5AR8A 3VUIA 3SXFA 3B8QA 3EN5A 3RAIA 4H58A 5DE2A 2QD9A 3DBFA 2X4ZA 3OFMA 3MJ1A 2PMIA 4GYGA 3MFSA 4KIKB 4ITJA 4Q9SA 5IUIA 3QRIA 5JKGA 3RPRA 4QYEA 5FXQA 5KMJA 4FKWA 2YWPA 2HZ4A 1OI9A 2P0CA 1U54B 5ANDA 3CTJA 4U41A 5CF8A 4DEIA 5JT2A 5IA4A 4A4LA 2CNUA 3R1YA 3BLHA 3BWFA 4NM7A 2R7BA 4QYFA 5BVFA 2ZB1A 1OM1A 2HOGA 2PK9A 3N4UA 4FV6A 1G8AA 3FY2A 3AT4A 4L6QA 3NUAA 3JS2A 4S33A 3R8PA 4RVTA 4PMMA 4O91A 2C1BA 3G9LX 2W17A 3QQGA 1ZYJA 1URCA 3HRFA 3DK3A 2V7OA 3Q5ZA 1YKRA 4CZYB 5JEBA 3Q2MA 5M4CA 4P90A 4Q5EA 2VTMA 2ETRA 3ZFYA 1Y91A 3P23A 5C4LA 4FG9A 1GZNA 3PG1A 5EYMA 3QHWA 3BU6A 4DEBA 2UZWE 1KUTA 3G0EA 4GG5A 4MBJA 5JRSA 1QPEA 1UNLA 3E93A 1UNGA 2OF4A 3QALE 4ANMA 4IC7A 4QTAA 4BF2A 3NAXA 3MH1A 4NCTA 2O63A 4CRSA 3UZPA 3P7BA 4L68A 3ETAA 4RGJA 2ZV7A 1ZZLA 4EHGA 2BALA 4RJ3A 4TPTA 4QQJA 4TWOA 1A9UA 1U5RA 3NYNA 4G31A 1PMEA 5JMSA 3VQHA 1IR3A 2PWLA 2C3IB 2WNTA 5EQPA 4X21A 5E8UA 4DTAA 4NYEA 3B2TA 3VUHA 2CKQA 3ORTA 4FSRA 5IA3A 5BYYA 2OJFE 4GIHA 5HI2A 2PE0A 3LCOA 3I4BA 4C38A 1Q8YA 3ZLYA 5B7VA 2PUNA 2B9HA 2QG7A 4AACA 4DFBA 1T45A 5KUPA 3RHXA 4R7BA 3U9CA 2SRCA 4NL0A 3POZA 3S2PA 1ZLTA 3NYXA 4FG8A 3PY1A 5HHWA 3F3VA 3HRCA 5EKOA 4IBMA 3QYWA 2XK9A 3DBEA 4BDCA 4FTMA 4C58A 4OBOA 1SMHA 4F6SA 4MEDA 4JRNA 4XP2A 5FRIA 5KMKA 3OT3A 4WD5A 2X7OA 4DGOA 4W4YA 4XBUA 2RG6A 4HVSA 4N6YA 4JIKA 5B0XA 4DLJA 2FSLX 2XKDA 3HX4A 3LXNA 4EONA 3U6IA 4F7SA 4M0YA 3ALOA 3E92A 4BKZA 3C0GA 3LZBA 4TZRA 4BYIA 4D4RA 2PVHA 2P55A 3IW7A 2X8EA 3LMGA 1YHWA 4FT3A 3E7VA 3TN8A 3QUEA 2XS0A 4FICA 4AOIA 4BHZA 4C3PA 3TL8A 3S4QA 5IMEA 3NIZA 5DA3A 1B38A 1XH6A 4H3QA 2LAVA 2FB8A 4J8NA 3WILA 3ITZA 3V5QA 2VWIA 4WO5A 1ZAOA 5M57A 1R0PA 1G5SA 4QYYA 2WAJA 4V0GB 3PVUA 3R83A 5EW9A 3W1FA 2C47A 3CS9A 4IH8A 3PWYA 1R39A 3UOJA 2CGWA 3BV2A 2HYYA 2ZJWA 2W4OA 5I3RA 2GTNA 1KE8A 3FPMA 2FSOX 4QO9A 4FKVA 2C30A 2IVSA 4LUEA 4HGSA 4AFJA 4BWXA 5AUYA 4UMPA 5AR7A 2I40A 3OXTA 5A4LA 2PVLA 2XNOA 4K6ZA 2P3GX 2VV9A 3RPVA 4I4EA 3ET7A 4OT5A 3FI4A 2Y6MA 3FSFA 3KF4A 4FV9A 3UVQA 4BTKA 4CKIA 4FZAB 4F99A 3C4XA 4O6EA 4QQTA 4M66A 1NVSA 1WBTA 4X3FA 1LPUA 4EYMA 2B54A 4XEYA 3QKMA 5DG5A 3WZUA 3O8PA 3SW7A 2YIWA 3LFBA 4EK3A 4RIXA 5D1JA 3ORKA 2C6IA 1OBDA 4BZNA 3HECA 4M67A 1WBPA 3NUXA 1WBWA 1YDSE 2UW4A 3O71A 2VWVA 4PNIA 4UYNA 5DHJA 4F6UA 5HVKA 5A4EA 3MVJA 2QOBA 2YHVA 3Q3BA 3TACA 5CWZA 2ERZE 1OL7A 3SHEA 3ZHPC 4BGGA 4HVHA 1U46A 4CCUA 4I94A 3KMWA 4LM5A 4MCVA 3ODYX 4J95A 4XG3A 4C2VA 5AAGA 2EU9A 3DNEA 4QMLA 3BHUA 2BHHA 3NUNA 4YMJA 2QOHA 3D14A 2F7EE 4IWDA 3NNUA 2ZVAA 5JN2A 2IWIA 1PYXA 3RPYA 1Q8WA 4F70A 3UQCA 2C6MA 4BCQA 4FIGA 2R3GA 3R7EA 3ZZWA 5EK7A 3TNHA 4IFGA 4QPSA 4R5SA 4KBKA 4GG7A 4BZOA 2UZBA 3TTIA 1LP4A 3NCGA 3PRIA 5FDPA 4X2FA 5E4HA 3S3IA 2X8DA 4FNZA 5F94A 1PXIA 2XCKA 4IB5A 3QQKA 3MSSA 4QMPA 4C8BA 2GNIA 1A48A 4RA4A 4EOQA 3KRRA 1M17A 2ZM1A 2ZV9A 4DINA 5J5SA 3NNVA 2VTAA 2WTKC 3KMUA 4RWKA 5HLPA 4YZ9A 4NT4A 3R8UA 1JVPP 3QD4A 4FTKA 3SC1A 2ESMA 3A2CA 3F2AA 4ALWA 3I0QA 4NU1A 1XH5A 3BBWA 4Z9LA 3SKCA 2PVMA 4O7RA 2ETKA 3OOGA 3RINA 1DAWA 4BGHA 2WD1A 3DFCB 2XBAA 4QP2A 1SM2A 4I5MA 3CKWA 3R7VA 3COHA 4GFMA 4FYOA 4CNHA 3AMYA 5BQ0A 2OICA 1I44A 3VF9A 2W1EA 4O96A 2WELA 2QVSE 3QWKA 4Y8DA 4UEUA 2VTPA 2ZOQA 5GINE 4OT6A 3VNTA 3F3TA 2PZRA 4E7WA 3ORIA 3FLQA 4MNEA 3LIJA 3PUPA 3SAYA 5IQBA 3LQ5A 2UV2A 4L3PA 4EH9A 4ERWA 1GJOA 2XF0A 2JFMA 4F08A 4YC6A 4YSJA 2BDWA 2XK3A 3ZO3A 3MB6A 4XUFA 5JQ5A 2ONLC 4E20A 2GPHA 2VO6A 3HV3A 2BRMA 3PIXA 1UU7A 2C6DA 4BHNA 4I5CA 3RCDA 2WMVA 5AMNA 2VN9A 4IAAA 5JGDA 1K2PA 4XJ0A 3MVLA 3QTZA 5HOAA 4BDHA 4DAWA 3HV5A 5EYDA 3WF7A 4AGUA 4BKJA 3DKGA 1RQQA 4KKEA 2F4JA 4IZ7A 5IUGA 3VQUA 1HOWA 3T9TA 3PXYA 2B9IA 1RE8A 2A4LA 3GU7A 5DVRA 4R77A 3M42A 5K4JA 3DJ6A 4JI9A 4TXCA 5KE0A 4AA0A 4C0TA 3R2YA 4FTNA 2HELA 4K8AA 2Y4PA 3BQRA 3MH3A 3NZ0A 3I0OA 1P4OA 2XP2A 4F0IA 4D55A 3P1AA 4ZY6A 2X7FA 2CKPA 3TUBA 1J1BA 3PYYA 2J2IB 5DT3A 5KMIA 4HVGA 1H25A 5HX6A 4GFGA 2VWWA 3BGPA 3MY1A 4PPBA 3WF5A 4C3FA 4O2ZA 4ZSLA 4BKYA 5D9HA 1H8FA 3MA6A 2BAJA 3TV7A 2HK5A 1KE9A 4H36A 2UW6A 3RZBA 1XKKA 1Q3DA 5A46A 4ALVA 4O0UA 5AV2A 2XYNA 5E8TA 5TOZA 4B8LA 5CU2A 1ZARA 4IZAA 3TKHA 4JG6A 3ANQA 3VUKA 4JLCA 4C57A 4E93A 2BZHB 3AMBA 1GZKA 1R1WA 3FSKA 4II5A 4YC3A 1XO2B 3SOCA 3EQBA 5AAEA 3UJGA 2PVFA 4NW6A 3K54A 3IW5A 4IVAA 3F61A 3Q6UA 5D41A 2VGOA 1JSUA 2R3HA 3RWPA 4CEGA 4J99A 4DG0E 4CGAA 2X2LA 3ZUVA 3ORNA 5HE0A 5JZJA 3WYXA 3VO3A 3MFRA 3F5PA 3ZYAA 5J1WA 4HYHA 1OKWA 3MW1A 1VJYA 2WTVA 3FZPA 4ACGA 3L8XA 4K33A 4WUAA 3NNXA 5AV0A 4BB4A 2OFVA 3DB8A 3FQEA 4PRJA 4UB7A 3F7ZA 1W0XC 5L2TA 3N4TA 3LPBA 4PY1A 3PVGA 5H9BA 3W2OA 3QYZA 3V8WA 3II5A 3UE4A 3VW6A 3GU8A 4XOYA 5JZNA 3U4WA 5C8KA 1ZOGA 4IC8A 3FMJA 4YBKA 4IAIA 5K3YA 4IJ9A 2XCHA 4CQGA 1PXPA 3D4QA 3PXFA 1PYEA 2YIRA 3EFJA 3PE2A 4FTIA 3SVVA 3QHRA 1WFCA 3VUGA 3FZTA 3I7CA 3L1SA 4FIJA 5L2WA 2JDOA 2YJSA 2A2AA 2KTYA 3KEXA 3LFQA 2OJIA 3C5UA 4NTTA 5HG5A 4B6LA 4HZSA 3G90X 3RZFA 4MKCA 2DUVA 4IHPA 5HCYA 4DH8A 3KK8A 2QLUA 4IAYA 2YM7A 2C0OA 3CPCA 5FEEA 3VBWA 4E3CA 4EUUA 3S0OA 4G6NA 3KGAA 1JQHA 4RJ8A 4RLLA 3HZTA 3OF0A 4O81A 1JOWB 2UZLA 3GU4A 4JDJA 3TCPA 2GQRA 2H34A 3CQUA 2QOLA 3OS3A 3OROA 4FSZA 4G17A 5JK3A 2R9SA 3OUKA 4LV5A 3DBCA 2E9VA 4O0XA 4XP3A 4I6BA 3TWJA 5IA1A 4FKLA 5CAVA 2YAAA 3R7YA 3ZFMA 4AN3A 2DS1A 5CF6A 4YU2A 4D0XA 2WFYA 3UODA 4GV1A 2X2KA 2QHMA 2YCFA 4ZSGA 2Y0AA 2IVUA 4D2PA 2HCKA 2QI8A 2X39A 4M14A 5AM6A 4AT4A 4EKKA 4DCEA 1OIUA 4HPUE 3FHIA 4MYGA 5DT0A 1NA7A 1OMWA 3DZQA 3E87A 4O0SA 3V51A 3VBQA 3DKFA 5E90A 1WBNA 5FXSA 4G16A 3ZC6A 3U4UA 4NCTC 1H1SA 3A60A 1WVWA 4IMYA 1F5QA 3F3UA 2OI4X 1TQMA 3AT2A 3QRUA 3LM0A 4YHJA 2FSTX 5CVFA 5HESA 3WF9A 1ZY5A 1P4FA 2XIXA 3FLZA 3WE8A 1V0OA 1YRPA 5DWRA 2WTCA 4AFEA 4NW5A 2XIYA 2WQBA 3DCVA 2O64A 3DTCA 3O96A 3DLZA 1BI7A 2VD5A 2X81A 3PJ1A 3DJ5A 4RVLA 5JGBA 1MRYA 5KKRC 4TYGA 4X2GA 5JQ8A 1NT2A 5BVDA 4S30A 3W10A 3ZUTA 2B9JA 4A9YA 4I92A 3PP1A 3SG8A 4I3ZA 4BDKA 2EVAA 3BEGA 3O7LD 4MXYA 3VRZA 4AOTA 2XKCA 4EL9A 3R9DA 3UNJA 3R71A 2YLEA 4GUBA 5K5NA 5I0BA 2VTLA 2QR8A 2YEXA 3CE3A 1OL1A 4RIWA 3UVPA 4FOCA 2BRBA 1NVQA 4BCHA 4JR3A 4CG9A 4JDIA 3A7HA 1ZMUA 4I5PA 2A1AB 4JT3A 4V01A 4PV0A 4D4SA 3CQWA 3UG1A 4HVDA 2BIKB 4OTFA 3KC3A 3IGGA 4PQNA 4J53A 3MESA 4J1RA 4TYJA 4AF3A 4FBXA 3DFAA 3RKBA 3ZRMA 3TT0A 1XBAA 4OTPA 1ND4A 2BDJA 3VC4A 4NIFB 2JKKA 3ERKA 2C5NA 2C0TA 2WB8A 3QZFA 4GJ2A 1XWSA 3MIAA 3QWJA 3BYOA 3QRKA 5EDRA 5C9CA 5GZ9A 3SW4A 4C36A 5AV3A 1YHSA 5CU0A 5AJQA 3RBWA 3TKIA 2PVKA 5I9ZA 3EQPA 5CEIA 4FR4A 1JKSA 4M12A 4AGCA 4XRJA 3EH9A 4XOZA 3KREA 1OKYA 3P9JA 2VTTA 1U59A 5AUWA 2WMSA 3RAKA 3GQLA 4O7TA 3MFTA 5EDPA 5C4KA 4UALA 2ZDTA 3ZXZA 1YHVA 3TNWA 2GHLA 5AP2A 3NDMA 3SQQA 4EOOA 1LEZA 2BZJA 3FXXA 4FT7A 1CSNA 5HO8A 1YOLA 2VTHA 1M14A 4K18A 5AA9A 2I1MA 3UIMA 1ZXEA 3QTSA 4U42A 3FV8A 3NUYA 2EXCX 3NW6A 5AUXA 4FEQA 4QP8A 2IPXA 3QD0A 4OAUC 4ZTLA 2HW7A 3QQJA 4QTDA 2R3JA 3F2RA 2WMAA 4EH2A 4F9YA 3U6HA 1WVXA 3R22A 4PX6A 4XG6A 3E3BX 2F2UA 2XK7A 5CEKA 2B52A 4RZWA 2OJJA 5EHLA 1UKIA 3ELJA 4MD8E 4X3FC 4WG4A 3FE3A 3O8TA 2R2PA 2IZUA 4EK5A 1PKDA 3R8LA 4HYSA 2WHBA 2QHNA 3O51A 5HEZA 4BBFA 3R00A 2QOCA 3RPSA 1CTPE 1H08A 5AAFA 4OBPA 3R8MA 4RX8A 5ANJA 4EHZA 4C4FA 3HA8A 4O86A 4DBXA 4XP0A 5EQYA 2PMNX 2UVXA 1H28A 2J9MA 2XEYA 1E9HA 2BZKB 2JKOA 3BHTA 3Q52A 4BFMA 4BDIA 4G1WA 4QMUA 2GNHA 2PL0A 3G51A 3WZEA 2XNGA 1SVHA 2J5EA 4FZFB 3BLQA 4FZ6A 3V5WA 3V04A 4ACCA 2GQGA 4AT3A 4K77A 2QO9A 2EXMA 4GRBA 3DXPA 4WNPA 5HCZA 3V6SA 4W8EA 4EH6A 3KU2A 3S95A 5ANEA 3U55A 2W1FA 5IA5A 4EQCA 3KRJA 2XH5A 1YXVA 3Q6WA 1ZYCA 4QMSA 1Y8GA 1SNXA 2XKEA 2ONLA 1MQBA 3C5IA 4BCPA 5CI6A 1UA2A 4F0FA 4IB3A 5LVLA 3NCZA 3AMAA 3EFWA 2Q83A 2G2FA 2OKRA 5LMKA 3GNIB 3MIYA 4HNFA 3UIBA 4P7EA 2J6MA 5FTQA 5J1VA 2PVYA 1H4LA 3VJOA 1JKLA 4OW8A 3TZ9A 1Z5MA 5HICA 2R3RA 4O7NA 4LGGA 3RP9A 3HMMA 5BUIA 4W9WA 4ZSEA 5M09A 3E88A 4K11A 4LG4A 4YZDA 3W2SA 3VS5A 4TYHB 2HZNA 3IONA 3IPHA 4Q2AA 4AN9A 4CT1A 4BBEA 2Y9QA 5DYJA 4OBQA 5IEXA 3VRYA 2JFLA 5C8MA 1TQPA 1YOJA 5DRBA 4Z55A 5L2SA 5CU4A 2VO0A 4ASXA 1O6YA 3DS6A 5LXMA 3BCEA 3WIGA 3QZHA 3A7FA 2OW3A 4XG2A 4YJVA 4LUDA 3UOLA 4AG8A 3VWAA 4ASZA 2UZVA 3RJCA 4AA5A 1NY3A 3H4JA 1MRUA 4EJNA 4QMVA 4RFMA 5ANKA 3HAMA 4CT2A 4FEVA 4D4VA 2RFEA 3R28A 5CZHA 1J7UA 5FP5A 4C37A 3CTHA 2VZ6A 4E4MA 2C0IA 3PRFA 4BDGA 3SRVA 3OCSA 4LYNA 2I6LA 2W4JA 4BWPA 4L01A 5HZNA 3IO7A 3NVKI 5F9EA 4CYIA 2BR1A 2YIXA 4GU9A 4GU6A 3VHKA 4EC9A 2CDZA 3MWUA 5IQHA 1XR1A 4HGLA 4XG9A 5CI7A 4BL1A 4OLIA 1MUOA 2GDOA 2W05A 3R9OA 4OUCA 3VIDA 4BR3A 3KXZA 2JC6A 3SD0A 3JXWA 4ZLOA 1R0EA 4I1ZA 3UTOA 4XG8A 1YI3A 1PXKA 4AE9A 1O6LA 2J0LA 3K2LA 2J0IA 1WMKA 3CJFA 3OBJA 4P5ZA 4YPDA 5LCKA 4JDHA 3T3VA 2OIQA 3NMUF 2H9VA 1PMVA 3BE2A 5GJGA 3FYJX 4GMYA 3VBYA 4A9RA 3TXOA 2JIVA 3OP5A 5CF4A 5J8IA 5M4UA 2XNEA 1BX6A 1JKTA 5AR4A 4EUTA 3FPQA 4C59A 2P2HA 3QQHA 4CTCA 4IJPA 4RLKA 4JAJA 3U8WA 4DFLA 3CD8A 4O7YA 3FKLA 5M4IA 4J97A 3HYHA 4FUYA 4X6RA 4E6CA 4RA5A 3R7UA 2PMLX 3BE9A 4EK8A 2E9UA 4OTGA 4ZJJA 2OH0E 3FL4A 2CGVA 5CXHA 5HBJA 3ZO1A 2PZIA 5AUTA 4WOVA 1H0VA 4H39A 2YM5A 2W1HA 3DJ7A 3TZMA 5ETCA 2HENA 1YI4A 1U4DA 3Q32A 2JBOA 3UIUA 5HIEA 3KXGA 3Q4TA 3LFAA 2O3PA 1Y6AA 3V8SA 1R3CA 1Q3WA 3F66A 5JFSA 1STCE 5FWKK 3SXSA 4QMWA 4FV5A 5HO7A 2YM8A 1GAGA 2QU6A 2EUFB 2OBJA 3F88A 5AP1A 3TDVA 4FTLA 4TWCA 4ZOGA 4F7LA 5FXRA 2JEDA 3JUHA 2GMXA 2J0JA 2AYPA 2IO6A 3OXZA 3IK3A 3QD2B 4HJOA 5FTOA 4M84A 4KRDA 2ITQA 2PZYA 1Q24A 3R8VA 4C02A 5CSWA 4CV9A 3OBGA 3ORLA 3OWLA 2JDVA 4QMMA 5FM2A 3FI2A 2IW8A 5M06A 5E7RA 2CMWA 5GJFA 3VUDA 4ACHA 3NYVA 3R0TA 1DI8A 1CM8A 4HYIA 4BIEA 3FZOA 3FMMA 3UNZA 4C33A 4C2WA 4MHAA 4CKRA 3L9PA 4X6QC 2GU8A 2JD5A 5A4TA 3HAVA 4EI4A 4YZBA 3QZGA 4W4VA 1QPDA 4ZS4A 3UVRA 4C62A 5EQEA 3AT3A 2I0HA 3KVXA 3EZVA 3KRLA 3FMNA 1J1CA 4UYAA 3DY7A 4U43A 4AGWA 5HO6A 4GT3A 3CLYA 2YCSA 3VAPA 2ZB0A 5L6PA 3FKNA 4FTTA 3W8QA 3DB6A 3NWWA 2W99B 1JSVA 3P86A 4M0ZA 3L8VA 4NFMA 4AGDA 2HZIA 2O65A 4R3RA 1WBVA 1AD5A 3VS7A 2QOKA 3CP9A 3PSDA 1P5EA 5EYKA 1QMZA 2WMWA 2GS7A 2XJ0A 3KCFA 3KXMA 4LOPA 5HNIX 2C6OA 4BDBA 4ZSJA 1E1XA 5L8KA 4BC6A 4KBCA 4IVCA 4FK6A 5DPVA 3GCPA 3OG7A 5L8JA 2J51A 4KKHA 4C34A 4ZAUA 4YZCA 3DU8A 3MB7A 5H8GA 4TRLA 4WBOA 3W18A 4CSVA 2GHMA 3COIA 2YIQA 3IW8A 5AX3A 4BCNA 3VULA 4EOSA 5TT7A 3ZLSA 4IZYA 4MX9A 5A4CA 4MXXA 5L2IA 3NYOA 3DGKA 3VUMA 4EK4A 1UWJA 2RGPA 3BPRA 1VYZA 4APPA 2YM4A 5AM7A 1L3RE 3F5UA 5C27A 4L3JA 3TTJA 3Q5IA 2WMRA 2VTRA 1ZY4A 3JVRA 2G9XA 3A7JA 3L9LA 4KABA 4DFNA 4G6OA 3C0HA 4RWLA 2Q0NA 3R2BA 5EI2A 2Y4IB 3E63A 3LFCA 4KIKA 3CEKA 4JIAA 4NTSA 4U5JA 3DQWA 3WZJA 2V0DA 4GEOA 3FQHA 5ETIA 2FVDA 2QURA 3VS2A 2QONA 4PDYA 2R64A 5EOLA 4QNAA 4MAOA 4EH5A 2OXYA 3C4CA 3V5TA 4UV0A 4EH7A 4QMYA 2VO3A 4WIHA 4IEBA 3KB7A 4YGAA 3QTUA 4NM5A 5M53A 5LOHA 2OWBA 2P4IA 2BRNA 1HCLA 3EKNA 3FBVA 2RFDA 4JRVA 2C5YA 4Y5HA 4EBVA 1GIJA 2PZPA 4YJPA 4EOMA 2XNMA 1ATPE 2REIA 3SXRA 4G5JA 3HDMA 4CFUA 4X0MA 1KV2A 2CGXA 3HV4A 3OEZA 4QP7A 4BWKA 4RSSA 4RJ6A 4MNEB 4D5KA 4ZJVA 4DBNA 3NGAA 1KE6A 2W9FB 3G2FA 2W7XA 3ZU7A 4D9TA 3E62A 4E5AX 2VTSA 4F7NA 2C1AA 1OPJA 5IEVA 4ANLA 3CJGA 3N4VA 4N0SA 2J50A 3AC5A 3HMIA 4NUSA 4YO4A 3ZEWA 5ETFA 4J71A 4DEHA 4IM3A 3HLLA 3Q96A 4GVJA 5LCJA 4DGNA 4GK2A 2C3JA 2WTWA 4S32A 3SV0A 3IDCA 3QTWA 3QGWA 4ITHA 3G6GA 4HNIA 5EKNA 4DLIA 1OKVA 4FOBA 1J3HA 5HU3A 5FTGA 4FYNA 1LR4A 4CFNA 2CN5A 4RJ5A 4K9YA 3OVVA 4O83A 4M15A 3ENMA 5KMNA 1SVGA 3F5XA 3ZDUA 1UU3A 2B9FA 5J9YA 4U79A 3QXPA 5T3QA 2OLCA 1CKJA 4C4JA 3AC4A 4IVDA 4O7LA 3UBDA 2YABA 4FVRA 2V55A 4D58A 4F9WA 4XG7A 4AZSA 4NJ3A 5IA2A 2UZEA 2VO7A 2QOOA 3ZH8A 1M2QA 2ZMDA 4L00A 2F2CB 3UNKA 4YPSA 4UBAA 5EM5A 3PJCA 5CEPA 3UC3A 2PULA 2ITOA 4YJTA 2W96B 4MXOA 1FVRA 2VNYA 3W8LA 3TV6A 4D2RA 3VN9A 3EQHA 4X2KA 3RM7A 2GNFA 3ZM9A 5FUTA 2YCQA 2VUWA 5GJDA 4IWPA 4WA9A 5FEDA 2Z2WA 5J7BA 3KMMA 3KN5A 3GFEA 3QX4A 4AX8A 3D7TA 4G3DA 3CIKA 4I20A 4XS2A 1KE5A 4E5BA 3FI8A 2P33A 4R6VA 3MV5A 3VS0A 5E9EA 2X6DA 4YLLA 4D2VA 4AW5A 1XH8A 5AX9A 3R7IA 1QPJA 2GTMA 4TKSA 3OW4A 3GU5A 4YNEA 4A9UA 5HNBA 3MVHA 3HUCA 5C01A 2QLQA 2VX3A 2QODA 5FP6A 4FIHA 3QGYA 3BQCA 3ODZX 2DQ7X 1TKIA 4BI2A 4HGTA 1PXJA 2F7ZE 3HP2A 2X4FA 3QXOA 5EDQA 3LMIA 5FBOA 4QYHA 3C1XA 2VTJA 2WIHA 4RPVA 3FI3A 1ZMWA 4UMUA 4QOXA 4KIOA 1CMKE 4D9UA 5GIPE 4YTCA 3KQ7A 2YDIA 1IA8A 5TE0A 4EQMA 2FGIA 4KNBA 3CY2A 4KUJA 3SGCA 4FSQA 3R1SA 1Y6BA 4JBVA 1RW8A 3D15A 5IMXA 1OZ1A 5LMKC 4ZSAA 3QL8A 1YDRE 3OCBA 5AIKA 1H1QA 2AC5A 2B53A 3LXLA 3OOMA 4JDKA 4NM3A 4O6LA 3PZHA 3GU6A 4IW0A 3WZKA 3DT1A 4WSQA 5I9VA 4L45A 4M69A 1U5QA 5J9ZA 4BTMA 2YJRA 3BKBA 5L6OA 1PMUA 3FYKX 5IZFA 4HPTE 5I5ZA 1KOBA 4RC2A 2YM6A 3WF6A 3I5ZA 2G1TA 1J7IA 5HGIA 4D2SA 3BV3A 1OITA 1YWVA 2ITTA 3R30A 3RK9A 4PPAA 2YIYA 3IW4A 2ACXA 3FLYA 4V04A 4JNWA 3PXZA 1H0WA 4ACDA 3G6HA 3EYGA 4HOKA 1UNHA 3FY0A 2GNJA 4LV8A 5AP0A 3ZO4A 4FNYA 4IIRA 4JBQA 4O7WA 3VS4A 5EOBA 3D5XA 4JBPA 1CKIA 1R78A 2XJ1A 5IISA 3THBA 3H0ZA 4FZ7A 1JPAA 4TY1A 3V5LA 2H8HA 1CDKA 2RSVA 3VS1A 2CCIA 5HE1A 4CFXA 3R9NA 4DITA 3FC1X 2HZ0A 4USDA 2F49A 4BIDA 5LJJA 3PPZA 2VX1A 4JG7A 4EZ7A 5BVWA 1X8BA 4BCKA 4FEUA 3GP0A 5EYCA 3R1QA 5J9LA 1TVOA 4V05A 4UX9A 4O21A 4PP7A 3QTQA 4J7BA 4XBRA 3TIYA 3UO5A 4DTBA 5B2KA 5I4NA 2UZUE 4XNEA 4N4SA 3BI6A 4FVQA 3D2IA 2PSQA 3E8DA 5HIBA 5LVPA 4ZTHA 3OMVA 5IQFA 2HIWA 3QCXA 2XKFA 3R01A 2BKZA 5E8ZA 3WZDA 4NSTA 1NW1A 4BN1A 5E8SA 3GB2A 4PUZA 3SX9A 3POOA 4FKSA 4RIYA 3U9NA 4FK3A 4RG0A 4YURA 3QFVA 5DI1A 4DGGA 2ITUA 3HDNA 1GY3A 3I6UA 4EH4A 4RVKA 2W5AA 4FKRA 4C4IA 3CXWA 2Y8OA 3PIYA 3E8NA 4J8MA 4MQ2A 2J7TA 4UY9A 4IX6A 3LKMA 3ZUUA 4KRCA 2XBJA 3TEIA 3FZ1A 1OL6A 1FMOE 2CGUA 1H24A 3QBNA 4MH7A 4P4CA 4RIWB 5KZIA 3VJNA 3BYVA 5IQEA 4ZTSA 2QG5A 3ZEPA 4A07A 1WVYA 2VNWA 4HW7A 1SYKA 2GNLA 3DV3A 4FMQA 4HVIA 4IM0A 4M13A 5BNJA 2PVRA 2RL5A 4XMOA 4Y5QA 3PA5A 4IX5A 4P2KA 3R21A 1W83A 3OD6X 3Q9ZA 3QC9A 4OTHA 4W4WA 1DAYA 5ETAA 4EH3A 1PMNA 3UO4A 3W2PA 4FX3A 3D94A 4G6LA 5CX9A 3FWQA 5KHXA 4A7CA 4QPMA 1FVTA 5CSPA 4LGHA 4YJRA 4YSMA 4BCFA 4C4HA 3GEQA 3W2CA 4F0GA 3UZTA 5AUVA 1QCFA 1LEWA 3PXKA 2CLQA 3IW6A 4FTCA 3K5VA 4W9XA 4AU8A 2UW3A 4EWHA 2R3IA 3PFQA 3I5NA 1M7QA 4AW2A 4L3LA 3LCDA 4BCGA 4KB8A 4BYJA 5AR3A 3PLSA 2Z8CA 4OGRA 4F09A 2NRUA 4O38A 4UWCA 5DMZA 1K3AA 5DBXA 4DEEA 4EJ7A 4O7VA 2BMCA 3FMHA 4NJDA 4HZRA 3FKOA 3DBDA 5HQ0A 1MRVA 3NRMA 1WBSA 3AD5A 4FSNA 4PP9A 4H05A 3KF7A 1M2RA 3KXNA 3WOWA 2XA4A 3E7OA 2YA9A 2R0UA 3HUBA 3JPVA 2JGZA 4UMQA 3ZMMA 5EW8A 4EORA 5I9WA 4QD6A 4RJ7A 5M55A 4AP7A 4CVAA 1A06A 3R02A 4G9RA 4D0WA 5TKDA 5AWMA 5L4QA 5FEQA 4A9TA 3P5KA 1K9AA 3OTVA 3T3UA 4C3RA 4NK9A 3LCSA 4B9DA 4RT7A 4OTIA 4FT5A 5A14A 3V3VA 3ZSHA 2WZJA 4IAZA 2R3PA 3F3WA 3GCQA 4FKJA 2WTKB 4LGDA 4XG4A 5CLPA 5CTPA 4O82A 4XLVA 4TWNA 3EWHA 4RMZA 4E8AA 2W5HA 4Q9ZA 3AXWA 2X2MA 5KZ0A 3UIXA 2OJ9A 2V22A 1DM2A 3C50A 3BHHA 3CKXA 3R1NA 4FTQA 5CT7A 4Z7GA 5KBQA 3BHVA 2PYWA 4U40A 5G6VA 1PRYA 4PF4A 4BY9E 4OTQA 5EM6A 3ZTXA 4F9CA 2BTSA 3KXHA 2BVAA 4GIIA 1REKA 3AC2A 5AEPA 3Q9XA 3QU0A 2PUPA 2W1IA 1PXOA 4YO6A 4FTUA 4M3QA 2G2HA 2I0EA 3HL7A 4GSBA 4JR7A 2V62A 4PDOA 5CVGA 3CGFA 3EQFA 2IW9A 3VHEA 3S00A 3RK5A 3UZRA 1PY5A 4YTIA 1ZYDA 4USEA 2WMQA 1SVEA 3FMKA 3ANRA 2QOFA 4TW9A 3VS3A 2UW8A 3C9WA 2E9OA 3REPA 4ID7A 3G0FA 3MGYA 5I9XA 3NLBA 4U44A 4QP4A 3MTLA 2EB2A 4EYJA 4NM0A 4WNOA 2WTIA 4PWNA 4WSYA 3GVUA 5CSVA 4CV8A 2VAGA 3TIZA 3U54A 3UYTA 1OECA 2ZMCA 1H00A 1WZYA 4O0VA 3QQUA 4DG3E 2JDRA 4DH1A 2YACA 1YVJA 3OXIA 3QD3A 4C4EA 3CD3A 3MI9A 4FNXA 4MWHA 3ZLXA 4FC0A 1Q8ZA 5IU2A 2UZOA 4KD1A 4QP9A 4ZZOA 2B55A 1PW2A 3GUBA 3SDJA 1IRKA 3DAJA 4PMTA 2R3MA 3CQEA 5T6KA 4UMRA 4L7SA 3MY5A 4PL5A 4AE6A 1ZRZA 4C7TA 3ATSA 4N57A 1WBOA 3R9RA 3E5AA 2ZDUA 4GVAA 1V0PA 1JNKA 2VWXA 1BUHA 4FT0A 4FEWA 3TV4A 2OIBA 3BIZA 4GK3A 3WE4A 2CNQA 2Z02A 2ITPA 4EHVA 2W0JA 3BEAA 4FV8A 1GIHA 3C51A 2W1GA 4LOQA 4Y73A 4ALUA 4G3CA 1MQ4A 3MA3A 5CEMA 3BU5A 3N9XA 4NEUA 3HKOA 4FKUA 2XK4A 5JGAA 2ERKA 2PTKA 2QR7A 3OWJA 4S2ZA 2OJGA 4LMUA 3I79A 3NS9A 4CD0A 1FQ1B 2IVTA 5IQIA 4Y83A 4FTAA 2C5OA 3RAHA 5CENA 4EOKA 3HRBA 4FUXA 5I3OA 5I9UA 3A61A 5IH6A 3GGFA 4L8MA 3ATTA 2CSNA 3H0YA 2W1ZA 3KA0A 5CSXA 3OZ6A 4YZMA 3RPOA 2JITA 1CKPA 3FEGA 4I23A 3RGFA 3ZRKA 3OWKA 2PUIA 4X2NA 3TUDA 3EN6A 3EQRA 4ZK5A 2H6DA 3SRVB 2PVJA 3R6XA 2XM8A 3D5VA 2H96A 2C5XA 3OWPA 2RIOA 2WGJA 3I7BA 3DDQA 1YXSA 5LMAA 1P2AA 4OR5A 4O22A 1ZOHA 4U3YA 4JL9A 1FVVA 3NPCA 4FODA 4FV4A 4I93A 5AP7A 5AFVA 2HXLA 2WO6A 2CLXA 4EZ3A 5CAOA 3UC4A 3AGLA 4F65A 1BMKA 2BKKA 2E9NA 4G3GA 2BROA 5AUZA 3H9OA 3FZRA 2C6LA 2WEIA 4WT6A 3LCKA 4LMNA 3U6JA 5BYZA 4CXAA 1FPUA 4H1JA 4O27B 1H26A 4ONAA 5FDXA 2FO0A 3NW5A 4NZWB 5DNRA 1IAJA 3DOGA 5D11A 4QP3A 1OIQA 2XB7A 3CC6A 3TJCA 3HMNA 3V5PA 4CQEA 2QKRA 2BRGA 5M4FA 3QLGA 3UG2A 5IQAA 2XYUA 2PUUA 4NIFA 3VVHA 1Q99A 2OZAA 4O0TA 2VTIA 1OPLA 1TQIA 2F9GA 3QX2A 1JKKA 2GNGA 4HCUA 3TNIA 2JBPA 3PXRA 3HV6A 5IQDA 1YWNA 2J0KA 1G8SA 1APME 1FMKA 3FZSA 3NNWA 2VWBA 4KAOA 5TR6A 3N51A 3NIEA 5E92A 4IAFA 4LFIA 4EKLA 4FKGA 1PXNA 1UU8A 3CY3A 3MYGA 4RFYA 5AP6A 3MDYA 1OPKA 3QA8A 3IDBA 4BCMA 2QOQA 5AADA 2HWOA 4FSUA 4RWIA 4G5PA 4ZTRA 3ORPA 5DT4A
chains in the Genus database with same CATH superfamily
1PHKA 3W33A 5A4QA 3SA0A 4O7ZA 4YJSA 4BI0A 4FV0A 2JKMA 4DF3A 3C13A 3RALA 2O0UA 4I0RA 5K9IA 5M08A 2BPMA 3KK9A 4FKQA 4YNOA 3QUDA 3HMPA 5I9YA 4JOAA 4DEDA 2XNPA 3D0EA 2YAKA 3DBQA 4TYEA 3W0QA 1OGYA 2W5BA 3PDTA 4XRLA 4ZTNA 4WRGA 4K0YA 1Y8YA 3MH0A 4U9AA 4ZTQA 4FTRA 1UVRA 4MD7E 3KFAA 3PG3A 2OXDA 4M97A 4PPCA 5IH4A 5J7HA 4B99A 5HBHA 1SZMA 2CKOA 3PLAE 2X6EA 3NR9A 1XH9A 4EOIA 1ST0A 3PY3A 4D4YA 1B39A 1VZOA 3HP5A 3AG9A 1S9IA 3SOAA 3GQIA 3TMOA 2EWAA 3GI3A 4G34A 2OXXA 1WCCA 2QU5A 3BYUA 1UWHA 2W1DA 3T9IA 1JBPE 1Q5KA 1W98A 5KKRB 3BBTB 1IG1A 2VWYA 4IVBA 4MXAA 3GFWA 2CN8A 4WG5A 4W8DA 4FA2A 3WBLA 1VLRA 5E1SA 4FSTA 4AXCA 4M68A 2BAKA 2OU7A 4CCBA 3VONA 5IDPA 4FKPA 1AQ1A 3LW0A 4ITIA 4QRCA 2A0CX 5LWMA 3CCNA 2PE2A 3GC8A 5EM7A 5HKMA 3Q9WA 4OAVB 4I21A 3D5WA 4H3PA 3DAEA 1O6KA 4CZTA 2W4KA 2OH4A 4ZLYA 3K3JA 4QMQA 4TYIA 2C4GA 2QC6A 3A8XA 4BBMA 4CZUA 3RI1A 4CLIA 4Z3VA 3ZBFA 3NVMB 3M1SA 3IGOA 4JX3A 3LLAA 4YJOA 2BFYA 4XH6A 1LUFA 3DAKA 4O1OA 3DK6A 2XALA 3WF8A 3UP7A 4MBLA 4YLKA 2R4BA 2FYSA 4MWIA 5E8XA 4KA3A 2JIIA 5E8VA 4B8MA 1DI9A 4ZP5A 4XHKB 5C03A 3FJQE 4D1SA 3C7QA 2UW0A 5A6NA 3C0IA 1XQZA 2X1NA 3BGQA 4TNDA 3CTQA 1PF8A 3D5UA 3GXLA 2JDTA 3UMWA 2BRHA 2NRYA 4JAIA 1ZMVA 3GENA 3JY0A 4N70A 1L8TA 1IA9A 4ZMFA 1KSWA 3H9RA 4U97A 3ULZA 1XBCA 4MUQA 4GT5A 3Q2JA 4TYHA 3F6XA 5CQWA 3H10A 4R3PA 3KULA 5EHOA 5EHYA 4E6AA 1H01A 2GHGA 3EQDA 3PJ3A 4GJ3A 3WYYA 4RWJA 4YTFA 3LQ8A 4O7SA 3AD4A 4JQEA 2JKQA 1ZWSA 3A7IA 3ACKA 2OFUA 3QAME 4FG7A 4CFVA 1QPCA 3D2KA 1GIIA 2C3KA 2Z7LA 1FOTA 5KMLA 3C4WA 1XH7A 3BX5A 3LFFA 3EQCA 5KHWA 3BLAA 3TDWA 4DTKA 2ITYA 4DYMA 3IOPA 2HY81 4FSYA 2WKMA 4C61A 2A27A 2QKWB 3RHKA 2V5QA 3MPAA 5IA0A 3Q60A 5J79A 4DFUA 4FSWA 4X3FB 3ZC5A 4E26A 3ORXA 4HCVA 4RIXB 5H8EA 5HU9A 4AA4A 3B8RA 3DZOA 2XJ2A 4MTAA 2PZ5A 4C4GA 2UW5A 4BCIA 3K5UA 4AZVA 3PXQA 1W7HA 1VEBA 4AZWA 4FGRA 3AC1A 3O23A 5AP3A 1MP8A 2Y7JA 5G1XA 5HIDA 5HTBA 1OL5A 2NP8A 4A06A 4O2PA 3PP0A 5HD4A 3ZDIA 3O8UA 3AOXA 3OTUA 4AXEA 3JYAA 4AS0A 1V0BA 4BDEA 5IQGA 3ZXTA 5DRDA 3BL9A 4D1ZA 3KRWA 5CZIA 3OT8A 4YR8A 3A4PA 2VWUA 5KCVA 2ITWA 4CMTA 1OVEA 1Q8UA 1Q97A 2G2IA 3WIKA 2WEVA 4UWYA 3LXPA 3Q9YA 5D7VA 3HMOA 3NAYA 5FGKA 3AD6A 5DR9A 3RNIA 3OCGA 3OHTA 2UW9A 5AR5A 3NFFB 3KL8A 4L46A 3JY9A 2HY0A 5IG1A 4LQMA 3QZIA 4TN6A 4AXAA 1ZZ2A 3TM0A 2QO2A 4ENYA 4DFYA 2I7QA 4TWPA 4AAYA 2BCJA 4E4NA 4FEXA 2RKUA 2ITVA 2B1PA 3F82A 2OK1A 3F2NA 1U54A 3DDPA 4QP6A 3I81A 1XMMA 4H3BA 2PE1A 5H3QA 4O1PA 3VBXA 4WG3A 3G15A 2ITZA 3MY0A 4E5WA 3PA3A 3BYMA 5LARA 5GIOE 3EN4A 2C3LA 4AOJA 3Q04A 4AZEA 2R3QA 2GCDA 1I09A 2X9FA 4IX4A 2JIUA 4QQCA 1GNGA 3UOKA 4L9IA 4UZDA 5IDNA 2BTRA 4FV1A 5DIAA 4F9BA 3H3CA 3QTIA 4GH2A 4XCUA 3TNQB 4YHFA 4AUAA 4IQ6A 3D7TB 4PDSA 5JRQA 3GC7A 1ZYSA 2Q0BA 3D9VA 5AV4A 4RJ4A 4Z7HA 3PFYA 3EOCA 3GCUA 4P5QA 5CEQA 5CNNA 3KKVA 2FUMA 1OIYA 4RX9A 3M2WA 3NUPA 1H1PA 4AQCA 3EN7A 4DHZA 5AIRA 2CHLA 1J7LA 5GNKA 3AGMA 1YOMA 2AUHA 3NEWA 4YC8A 4RFZA 3UPXA 4F1OA 5F4NA 4IAKA 5H8BA 4XX9A 1BL6A 5EH0A 4HYUA 2C69A 3V5JA 3PZEA 4G3FA 4IM2A 2WTJA 3IECA 4MD9E 5CAUA 3JR1A 5BYLA 2WOTA 2R3LA 2XVDA 3ZLWA 5A9UA 5CAPA 4L52A 4NKSA 5T68A 1KV1A 4R78A 4FVPA 3FDNA 5IH5A 4FL3A 5LVNA 4E73A 2V7AA 3QCSA 4LL5A 2WMXA 2VWZA 4JXFA 5ANOA 5L6WL 2RFSA 3Q4UA 4F63A 3PPKA 3MH2A 3UQGA 3EQGA 4PDPA 4U45A 3QRJA 3S1HA 4IZ5A 5KBRA 4M69B 4UXQA 4FTOA 4ACMA 3FLSA 4BTFA 4DG2E 5BVOA 5JFVA 3PWDA 4KS8A 5AP5A 2GS2A 4Y85A 2C6TA 4NH1A 4ANSA 3TG1A 1JAMA 3G33A 1W8CA 3EKKA 4R3CA 3ENHA 1E1VA 4ERKA 4K1BA 4S31A 4QPAA 5D10A 4TL0A 3BRBA 4LRKA 2BUJA 4D2TA 3OCTA 3ID6C 3ZOSA 4FNWA 4DH5A 2IN6A 4MNFA 4PTEA 5FQDC 1YW2A 3Q4CA 5IF1A 3EB0A 5CF5A 2IW6A 4HCTA 3P08A 3ACJA 5K0KA 4APCA 3G5DA 4LRJA 3PSCA 5ANIA 5HTCA 3PVBA 2EXEA 4RBLA 3UMXA 2VU3A 3ZONA 1Q4LA 3MN3A 2ITXA 4IANA 3H30A 5CU6A 4WBBB 4DH3A 4CFMA 4Z16A 3LM5A 1BYGA 4M7IA 3LHJA 3P4KA 4X7QA 5HCXA 4QDEA 5BVKA 2VTOA 3D7ZA 3L9NA 5EM8A 3G9NA 5CQUA 4AW0A 3PE1A 2J5FA 3I6WA 4DA5A 4V0GA 3LFDA 5DR2A 1YQJA 5A54A 3FXZA 5DEWA 2WMTA 4R1YA 3TKUA 2Z7QA 3PIZA 3GC0A 4GT4A 1JLUE 4RC3A 3LXKA 4ZZMA 3MTFA 3KRXA 5D7AA 1GOLA 3NSZA 3V6RA 4DFXE 5KMMA 3JVSA 3F9NA 5BMMA 2R3KA 4FF8A 1EH4A 3GT8A 1PXMA 2JDSA 3HEGA 4IWQA 3T8OA 1UU9A 2UZDA 3FL5A 3C4ZA 4U3ZA 2HW6A 3LOKA 4K2RA 5IKWA 4CRLA 3NUSA 4RIYB 3EL7A 3EN9A 3MVMA 1B6CB 1NXKA 3D83A 5E91A 2JLDA 2XMYA 4FI1A 4FV7A 4MF1A 5CAQA 4GUEA 5ICPA 2UZNA 5DH3A 3OY3A 4ZS0A 3HGKA 4DFZE 1OIRA 3BGZA 2XIKA 3MBLA 3RMFA 4ASDA 4DHIB 2BIYA 3KVWA 4QTBA 4ANNA 1ST4A 2WQMA 4AAAA 4E6DA 2I0VA 3E8CA 3QRTA 4I0SA 4ARKA 3MPMA 4YTHA 3U51A 2YDKA 2BZIB 4CMOA 4G2FA 4IXPA 5DOSA 4ANQA 4J98A 4RQKA 4O0YA 3O0GA 3QQFA 4KIPA 5HD7A 4S34A 4WUNA 4D28A 3EFLA 3FMLA 3A7GA 3KY2A 4KSPA 4ZY5A 2IG7A 2OO8X 4H1MA 4DN5A 1BLXA 2BAQA 2XM9A 2WQOA 4F4PA 4DE4A 5E8YA 2GSFA 3PTGA 3VW8A 2YLFA 4I0TA 4EOPA 2BDFA 4QMZA 4BI1A 1RJBA 5LWNA 3BHYA 3P78A 3PY0A 5HVYA 4OTDA 4Y46A 3LFNA 2UZTA 2RFNA 4KBAA 4U81A 3ZO2A 4NFNA 4R1VA 2HWPA 1F0QA 4W4XA 3SG9A 1OUYA 2X0QA 5JFXA 5CALA 3FLNC 4NWMA 4YBJA 3TI1A 4EH8A 4CG8A 3IOKA 3P0MA 3W0SA 2CCHA 3QKLA 5HG8A 3C4FA 3P7AA 4PL4A 3VUTA 5DEYA 4DHJA 4LL0A 3RWQA 1BI8A 2VTQA 2PHKA 4IB0A 4E4XA 3VS6A 2W9ZB 4BTJA 3NX8A 5BVNA 1Q62A 1V1KA 3KXXA 3ZFXA 3PJ8A 3NW7A 3QCYA 2ZM3A 4JMQA 2UW7A 2OG8A 2PY3A 1T46A 4JBOA 4PNKA 3UPZA 4PTGA 3GCSA 3CGOA 3CSVA 4UWBA 3R9HA 3MFUA 3EFKA 4ZJIA 3WI6A 2B7AA 5DFPA 3EIDA 1H07A 1YI6A 2IJMA 4FKOA 3V8TA 4B4LA 3W0NA 4WNMA 4L67A 3ZS5A 4BVUA 2JAVA 2IVVA 1Q41A 5J95A 3ORZA 5F95A 5KX8A 3ZSGA 2BILB 4FV2A 2O5KA 1REJA 2E2BA 4RRVA 5EI6A 2XRUA 5IQCA 3PA4A 4R5YA 5EFQA 3IG7A 4U7ZA 2YDJA 1DS5A 5C1QB 2YM3A 2ZM4A 1VR2A 4GFOA 3E8EA 4JJRA 5LVMA 3ZBXA 4RZVA 3F69A 1FGIA 4G3EA 4OTWA 1IEPA 5CNOA 3P79A 5HBEA 1IAHA 3LFEA 4QTEA 4PMPA 2BFXA 2F7XE 4B0GA 4GL9A 4AXFA 4QMNA 3OEFX 5JH6A 4AZFA 5K0XA 1OB3A 1KWPA 2X7GA 4FSMA 4L44A 4ANBA 2XUUA 4RIOA 5AP4A 4L43A 3QQLA 5HNGA 4BGQA 1FINA 5KNJA 2VX0A 4I4FA 3A4OX 3BYSA 4B7TA 3W2RA 2UUEA 2Z60A 3RTPA 3UDBA 5IPJA 4EHEA 3OY1A 5F20A 2KULA 3Q4ZA 4FKIA 4EBWA 2CKEA 1YWRA 2GFSA 2XIZA 3HA6A 5K5XA 5BMSA 2F57A 3EMGA 3UDZA 2B4SB 1Q61A 2C5VA 2GFCA 2ZYBA 3TUCA 3BLRA 3L8SA 3SLSA 1S9JA 3VBVA 1XMLA 2B0QA 3TNPC 3P7CA 3IKAA 5FG8A 2FSMX 3C4EA 4JX7A 5EW3A 5TO8A 2XZSA 4I6QA 4R7IA 4L42A 4GKHA 2QQ7A 2X9EA 4BICA 2GQSA 1YDTE 3DKOA 2R3NA 4AN2A 2C68A 1W82A 1ZYLA 4GYIA 2IZTA 2YERA 4CYJA 5L8LA 5CANA 4X2JA 4GS6A 4KSQA 3CR0A 3LE6A 4R7HA 4KIQA 2X0GA 2YN8A 5F1ZA 4A4OA 4QMTA 3O2MA 5DGZA 2W06A 2ITNA 3FMEA 3EJ1A 5JFWA 3F7WA 3PVWA 4J52A 4UMTA 4ZEGA 1URWA 2A19B 3V01A 5HTIA 1PKGA 4R8QA 4YZNA 2X8IA 3GC9A 3UP2A 4DDGA 4AXDA 2XEZA 1JSTA 5C8NA 2PMOX 4O4FA 5AV1A 1J91A 3BZ3A 4GCJA 4DT9A 1NVRA 3EL8A 3FQSA 2ETMA 3UO6A 3W2QA 3AQVA 3W55A 1OGUA 4QTCA 4MXCA 2YFXA 3R8ZA 4CTBA 2NNWB 3EZRA 3QC4A 3ORMA 3R73A 5BVEA 3TYKA 2J0MB 5DLSA 5DN3A 5DR6A 4WKQA 4BCOA 3LMHA 4IACA 3IDPA 5BPYA 4F1MA 3RNYA 2Z7SA 3BU3A 3L8PA 3QF9A 2R7IA 3IQ7A 4BDAA 4USFA 3AC3A 4O4BB 2WIPA 4ZXTA 3RAWA 5ANGA 5E1EA 1YXXA 3OW3A 5HG7A 5HE2A 4KS7A 4O0WA 4LOOA 3ZRLA 5D12A 3I1AA 2YWVA 2FA2A 4EOLA 4DH7A 3GOPA 2AC3A 4ZIMA 1YXTA 4AW1A 1M52A 4IDVA 2DYLA 4IFCA 3CPBA 3QKKA 4QP1A 3DXQA 3COKA 3A62A 1ZOEA 4BIBA 5LVOA 3CBLA 4RX5A 1PXLA 4D1XA 3LJ0A 4JQ7A 3VF8A 4IWOA 4BRXA 2FH9A 3QUPA 3E3PA 2PVNA 2IZSA 1RDQE 4I6HA 3RCJA 3ZSIA 1Z57A 5FBNC 3GCVA 4XV2A 4IE9A 4O84A 2QOIA 1Y57A 2XIRA 4I41A 4D2WA 4KWPA 4DEGA 4EK6A 1M7NA 2OZAB 3FMDA 4LDTA 4N6ZA 3Q53A 1SNUA 4J96A 1Z9XA 4MF0A 1G3NA 3HV7A 5M51A 2RG5A 3LQ3A 3MS9A 1Q8TA 4MVFA 4ZTMA 1OL2A 4HGEA 4QYGA 4XV3A 4CMUA 3TZ8A 4F64A 4D5HA 2OF2A 5M07A 3ROYA 4O0RA 2WPAA 3OUNB 4YJNA 1XHAA 4A9SA 3O50A 4U0IA 4F7JA 3K3IA 3R04A 4QNYA 4I22A 2OSCA 5KMOA 3PJ2A 2ZAZA 5CEOA 4RQVA 3QLFA 2WOUA 3DXNA 5H2UA 1OKZA 2G15A 5BUEA 3PSBA 4U80A 2XNNA 3UYSA 2YCRA 5CYIA 4IB1A 3WARA 2WU7A 2YITA 4EZ5A 4GK4A 5HE3A 2R5TA 3UOHA 4NKAA 2YZAA 4JVGA 3R7GA 2W1CA 4TNBA 3NUUA 4YJUA 3UGCA 4DEAA 1GZ8A 1IASA 4DCAA 1JWHA 2GS6A 3ULIA 1XJDA 3DPKA 3ZM4A 2HXQA 3DTWA 4FZDB 4I6FA 3RVGA 4BCJA 1FBNA 4L53A 1UKHA 2JAMA 2ZV2A 3DNDA 5AA8A 2XNBA 2NO3A 4FKTA 2OZOA 3EQIA 5CU3A 4JQ8A 2OIDA 3QTRA 3W16A 2WQEA 4PL3A 4WHZA 2R3FA 1BL7A 1KOAA 2VGPA 4IADA 4MK0A 5CT0A 3BELA 3R7OA 3A99A 4L7FA 3O17A 1UV5A 4FGBA 4ZY4A 5ITAA 3DQXA 2WXVA 3LCTA 4YHTA 5BX0A 3ALNA 3DLSA 3F3ZA 4IX3A 5HG9A 4BDDA 3VBTA 4AWIA 4PMSA 4TTHB 5BUJA 2IZRA 1H1RA 2WQNA 3PPJA 1QL6A 2E9PA 4Y72A 5K4IA 3QTXA 4YUQA 1OBGA 3KCKA 4MXZA 5EI8A 2J4ZA 3GOKA 4WRSA 4XV1A 4CLJA 4E4LA 4EWQA 4U6RA 4ENXA 5A6OA 4DGMA 4FE2A 2QNJA 4QT1A 5J87A 5HVJA 2WMBA 5HX8A 4KINA 5CY3A 1O9UA 5C26A 5GZAA 5HORA 4LRMA 4FL2A 3GBZA 5IUHA 3LFSA 3M11A 4OTRA 2CJMA 2YZLA 2VRXA 4BDFA 5AR2A 1PJKA 3LAUA 4EEVA 1ERKA 1XBBA 1VYWA 5HLNA 5FLFA 2Z7RA 2Y4IC 4UN0C 3R63A 3RK7A 2XK8A 4AZTA 3ROCA 2OGVA 4RC4A 5GZ8A 4FIFA 4QQ5A 4UXLA 2YISA 4MQ1A 4FIIA 4CKJA 2PPQA 4BDJA 2BHEA 3MPTA 4RX7A 4DHFA 5KO1A 3U87A 3I60A 4DT8A 3ZZEA 2IEWA 4CFFA 4BJJA 2HAKA 4F9AA 4ZMEA 3QA0A 4BZDA 2C6EA 5GHVA 4ZLZA 3KULB 5AUUA 2UVYA 3EHAA 2PU8A 1AGWA 2CPKE 2G01A 5J5TA 1BKXA 1FGKA 5L2QA 5TF9A 3O7LB 3LLTA 3IS5A 3COMA 3B2WA 3QCQA 4DGLC 3FAAA 4A4XA 4ASEA 4F6WA 3HVCA 5B2LA 2RF9A 2NPQA 4XV9A 4ZZNA 2CNVA 3EYHA 1GZOA 2WMUA 4C35A 5CXZA 4FL1A 4EQUA 4TT7A 2R3OA 3OC1A 4F1TA 4DC2A 1XH4A 2XRWA 2ZV8A 3LJ1A 3A8WA 4FIEA 2P2IA 4Q5HA 5FM3A 2C6KA 4YJQA 4ANOA 1H1WA 3HNGA 3FLWA 4X3JA 5LMBA 4GKIA 1KE7A 4M8TA 3FC2A 4G9CA 4AT5A 4FTJA 4YP8A 3RM6A 5M56A 1HCKA 1F3MC 1YXUA 4JS8A 4FV3A 4XYFA 1H27A 2J90A 1WAKA 3AC8A 2O2UA 4JG8A 3UQFA 3TZ7A 3LJ2A 4IDTA 4Y95A 5B2MA 5CASA 3W0OA 5JSMA 1W84A 1P14A 4WNKA 4RVMA 4YLJA 3W32A 2NYAA 3TJDA 1M2PA 5FD2A 3DA6A 5HLWA 3DKCA 4LI5A 2IF8A 2XK6A 2VTNA 3LVPA 2X0PA 4GW8A 4EOJA 2QO7A 2UVZA 4EC8A 2LGCA 5CS6A 3KN6A 3BWJA 5LQFA 4E6QA 5EG3A 3MJ2A 1OUKA 3ZCLA 5M44A 2Y6OA 4PTCA 3FHRA 4U8ZA 3L9MA 3F5GA 5CVHA 4I24A 4E1ZA 2I0YA 3E64A 5IEYA 5A3XA 5ACBC 4XLIA 4ORKA 2A98A 2WTDA 3FUPA 4UZHA 5L3AA 2R0IA 4MBIA 4I5HA 5E8WA 2DWBA 4FT9A 4KKGA 5CSHA 1G8KA 2QCSA 4QMOA 3H9FA 4CFWA 2EB3A 2O8YA 3DK7A 3FXWA 4QMXA 5ACKA 2WU6A 5AR8A 3VUIA 3SXFA 3B8QA 3EN5A 3RAIA 4O4CA 4H58A 5DE2A 2QD9A 3DBFA 2X4ZA 3OFMA 3MJ1A 2PMIA 4GYGA 3MFSA 4KIKB 4ITJA 4Q9SA 5IUIA 3QRIA 5JKGA 3RPRA 4QYEA 5FXQA 5KMJA 4FKWA 2YWPA 2HZ4A 1OI9A 2P0CA 1U54B 5ANDA 3CTJA 4U41A 5CF8A 4DEIA 5JT2A 5IA4A 4A4LA 2CNUA 3R1YA 3BLHA 3BWFA 4NM7A 2R7BA 4QYFA 5BVFA 2ZB1A 1OM1A 2HOGA 2PK9A 3N4UA 4FV6A 1G8AA 3FY2A 3AT4A 4L6QA 3NUAA 3JS2A 4S33A 3R8PA 4RVTA 4PMMA 4O91A 2C1BA 3G9LX 2W17A 3QQGA 1ZYJA 1URCA 3HRFA 3DK3A 2V7OA 3Q5ZA 1YKRA 4CZYB 5JEBA 3Q2MA 5M4CA 4P90A 4Q5EA 2VTMA 2ETRA 3ZFYA 1Y91A 3P23A 5C4LA 4FG9A 1GZNA 3PG1A 5EYMA 3QHWA 3BU6A 4DEBA 2UZWE 1KUTA 3G0EA 4GG5A 4MBJA 5JRSA 1QPEA 1UNLA 3E93A 1UNGA 2OF4A 3QALE 4ANMA 4IC7A 4QTAA 4BF2A 3NAXA 3MH1A 4NCTA 2O63A 4CRSA 3UZPA 3P7BA 4L68A 3ETAA 4RGJA 2ZV7A 1ZZLA 4EHGA 2BALA 4RJ3A 4TPTA 4QQJA 4TWOA 1A9UA 1U5RA 3NYNA 4G31A 1PMEA 5JMSA 3VQHA 1IR3A 2PWLA 2C3IB 2WNTA 5EQPA 4X21A 5E8UA 4DTAA 4NYEA 3B2TA 3VUHA 2CKQA 3ORTA 4FSRA 5IA3A 5BYYA 2OJFE 4GIHA 5HI2A 2PE0A 3LCOA 3I4BA 4C38A 1Q8YA 3ZLYA 5B7VA 2PUNA 2B9HA 2QG7A 4AACA 4DFBA 1T45A 5KUPA 3RHXA 4R7BA 3U9CA 2SRCA 4NL0A 3POZA 3S2PA 1ZLTA 3NYXA 4FG8A 3PY1A 5HHWA 3F3VA 3HRCA 5EKOA 4IBMA 3QYWA 2XK9A 3DBEA 4BDCA 4FTMA 4C58A 4OBOA 1SMHA 4F6SA 4MEDA 4JRNA 4XP2A 5FRIA 5KMKA 3OT3A 4WD5A 2X7OA 4DGOA 4W4YA 4XBUA 2RG6A 4HVSA 4N6YA 4JIKA 5B0XA 4DLJA 2FSLX 2XKDA 3HX4A 3LXNA 4EONA 3U6IA 4F7SA 4M0YA 3ALOA 3E92A 4BKZA 3C0GA 3LZBA 4TZRA 4BYIA 4D4RA 2PVHA 2P55A 3IW7A 2X8EA 3LMGA 1YHWA 4FT3A 3E7VA 3TN8A 3QUEA 2XS0A 4FICA 4AOIA 4BHZA 4C3PA 3TL8A 3S4QA 5IMEA 3NIZA 5DA3A 1B38A 1XH6A 4H3QA 2LAVA 2FB8A 4J8NA 3WILA 3ITZA 3V5QA 2VWIA 4WO5A 1ZAOA 5M57A 1R0PA 4LV7A 1G5SA 4QYYA 2WAJA 4V0GB 3PVUA 3R83A 5EW9A 3W1FA 2C47A 3CS9A 4IH8A 3PWYA 1R39A 3UOJA 2CGWA 3BV2A 2HYYA 2ZJWA 2W4OA 5I3RA 2GTNA 1KE8A 3FPMA 2FSOX 4QO9A 4FKVA 2C30A 2IVSA 4LUEA 4HGSA 4AFJA 4BWXA 5AUYA 4UMPA 5AR7A 2I40A 3OXTA 5A4LA 2PVLA 2XNOA 4K6ZA 2P3GX 2VV9A 3RPVA 4I4EA 3ET7A 4OT5A 3FI4A 2Y6MA 3FSFA 3KF4A 4FV9A 3UVQA 4BTKA 4CKIA 4FZAB 4F99A 3C4XA 4O6EA 4QQTA 4M66A 1NVSA 1WBTA 4X3FA 1LPUA 4EYMA 2B54A 4XEYA 3QKMA 5DG5A 3WZUA 3O8PA 3SW7A 2YIWA 3LFBA 4EK3A 4RIXA 5D1JA 3ORKA 2C6IA 1OBDA 4BZNA 3HECA 4M67A 1WBPA 3NUXA 1WBWA 1YDSE 2UW4A 3O71A 2VWVA 4PNIA 4UYNA 5DHJA 4F6UA 5HVKA 5A4EA 3MVJA 2QOBA 2YHVA 3Q3BA 3TACA 5CWZA 2ERZE 1OL7A 3SHEA 3ZHPC 4BGGA 4HVHA 1U46A 4CCUA 4I94A 3KMWA 4LM5A 4MCVA 3ODYX 4FJVA 4J95A 4XG3A 4C2VA 5AAGA 2EU9A 3DNEA 2XAOA 4QMLA 3BHUA 2BHHA 3NUNA 4YMJA 2QOHA 3D14A 2F7EE 4IWDA 3NNUA 2ZVAA 5JN2A 2IWIA 1PYXA 3RPYA 1Q8WA 4F70A 3UQCA 2C6MA 4BCQA 4FIGA 2R3GA 3R7EA 3ZZWA 5EK7A 3TNHA 4IFGA 4QPSA 4R5SA 4KBKA 4GG7A 4BZOA 2UZBA 3TTIA 1LP4A 3NCGA 3PRIA 5FDPA 4X2FA 5E4HA 3S3IA 2X8DA 4FNZA 5F94A 1PXIA 2XCKA 4IB5A 3QQKA 3MSSA 4QMPA 4C8BA 2GNIA 1A48A 4RA4A 4EOQA 3KRRA 1M17A 2ZM1A 2ZV9A 4DINA 5J5SA 3NNVA 2VTAA 2WTKC 3KMUA 4RWKA 5HLPA 4YZ9A 4NT4A 3R8UA 1JVPP 3QD4A 4FTKA 3SC1A 2ESMA 3A2CA 3F2AA 4ALWA 3I0QA 4NU1A 1XH5A 3BBWA 4Z9LA 3SKCA 2PVMA 4O7RA 2ETKA 3OOGA 3RINA 1DAWA 4BGHA 2WD1A 3DFCB 2XBAA 4QP2A 1SM2A 4I5MA 3CKWA 3R7VA 3COHA 4GFMA 4FYOA 4CNHA 3AMYA 5BQ0A 2OICA 1I44A 3VF9A 2W1EA 4O96A 2WELA 2QVSE 3QWKA 4Y8DA 4UEUA 2VTPA 2ZOQA 5GINE 4OT6A 3VNTA 3F3TA 2PZRA 4E7WA 3ORIA 3FLQA 4MNEA 3LIJA 3PUPA 3SAYA 5IQBA 3LQ5A 2UV2A 4L3PA 4EH9A 4ERWA 1GJOA 2XF0A 2JFMA 4F08A 4YC6A 4YSJA 2BDWA 2XK3A 3ZO3A 3MB6A 4XUFA 5JQ5A 2ONLC 4E20A 2GPHA 2VO6A 3HV3A 2BRMA 3PIXA 1UU7A 2C6DA 4BHNA 4I5CA 3RCDA 2WMVA 5AMNA 2VN9A 4IAAA 5JGDA 1K2PA 4XJ0A 3MVLA 3QTZA 5HOAA 4BDHA 4DAWA 3HV5A 5EYDA 3WF7A 4AGUA 4BKJA 3DKGA 1RQQA 4KKEA 2F4JA 4IZ7A 5IUGA 3VQUA 1HOWA 3T9TA 3PXYA 2B9IA 1RE8A 2A4LA 3GU7A 5DVRA 4R77A 3M42A 5K4JA 3DJ6A 4JI9A 4TXCA 5KE0A 4AA0A 4C0TA 3R2YA 4FTNA 2HELA 4K8AA 2Y4PA 3BQRA 3MH3A 3NZ0A 3I0OA 1P4OA 2XP2A 4F0IA 4D55A 3P1AA 4ZY6A 2X7FA 2CKPA 3TUBA 1J1BA