4O96A

2.60 angstrom resolution crystal structure of a protein kinase domain of type iii effector nleh2 (ecs1814) from escherichia coli o157:h7 str. sakai
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
163
structure length
163
Chain Sequence
KSPVPGNVIGKGGNAVVYEDMEDTTKVLKMFTISQSHEEVTSEVRCFNQYYGSGSAEKIYNDNGNVIGIRMNKINGESLLDIPSLPAQAEQAIYDMFDRLEKKGILFVDTTETNVLYDRMRNEFNPIDISSYNVSDISWSEHQVMQSYHGGKLDLISVVLSKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords type III effector protein kinase
publication title Type III Effector NleH2 from Escherichia coli O157:H7 str. Sakai Features an Atypical Protein Kinase Domain.
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 47
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o96A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o96A01
5HVJA 2HW7A 2HXQA 2O3PA 3HEGA 4JX7A 4C58A 3QQGA 4XOZA 5E90A 1A9UA 1XH5A 3F3TA 4WUNA 3CJFA 3LCTA 3GT8A 2V0DA 3UOKA 4YSMA 4F4PA 5CSHA 2W17A 2WQMA 4S34A 3OCBA 4F70A 4HVIA 4NM5A 2JAMA 4OAUC 5DT4A 3TJDA 4OTRA 3P9JA 4QYFA 4WUAA 5H9BA 4D4SA 4QYEA 2ONLC 3BZ3A 2A2AA 2P55A 4C36A 4FTCA 5BUEA 2QQ7A 2PPQA 3TNIA 1XJDA 3UOLA 3QD2B 4MEDA 2GPHA 4HJOA 3PG1A 5AADA 1PYEA 4CFVA 3DBCA 4EQUA 2NNWB 3W8QA 4E6QA 5E92A 4DINA 2VX3A 4RJ8A 2I7QA 5IA3A 4U80A 2IPXA 4OTPA 3RALA 2ZV7A 4FI1A 4FKUA 3ZLYA 4J96A 4PL5A 2PYWA 1R0PA 2PZRA 3UO5A 2H8HA 3FI2A 3NGAA 1DAYA 2VX1A 2YERA 4QP8A 4OTQA 4I5MA 3WOWA 5IA2A 4ZTSA 4D58A 5AIKA 4G3CA 4B4LA 3LFFA 3EKNA 3BBTB 3H9FA 3O0GA 1KOBA 3ZCLA 2PL0A 4IVAA 3PG3A 4FSTA 3KU2A 2X8IA 4TYIA 4L00A 5D11A 3TDWA 4YTCA 3MB6A 4CMTA 5IMXA 4EC8A 4LGHA 1W84A 3KXNA 3QTWA 4XYFA 4XRJA 1H0WA 3RBWA 4O7VA 2Z7RA 4TY1A 4QQTA 5I9WA 4AW0A 5D12A 3GC0A 3CC6A 4ACDA 4FV8A 5EG3A 3LCOA 2OK1A 3Q9ZA 2XNOA 3EN4A 3EYHA 3TZ9A 4V04A 3CPCA 4QP6A 4HVDA 4CG8A 4BB4A 3NVMB 4ASDA 5GNKA 2BAQA 3VS3A 4CG9A 4XCUA 3RVGA 1OI9A 3GCVA 4JDKA 5F94A 4X7QA 3V5QA 5A54A 2GTNA 3A7HA 4L8MA 4OTGA 5TT7A 1WVYA 1STCE 4AGUA 4QMOA 2OWBA 3E93A 4U6RA 3FZ1A 3DLSA 3NNUA 2WIHA 4TYJA 3R8VA 1G8AA 4BWPA 3QRIA 2CPKE 2IVSA 5AA9A 1ZOEA 1QPCA 3S00A 3IO7A 4ERKA 3MPAA 3IQ7A 1XQZA 4TW9A 4C4JA 1U59A 3F7ZA 5HIBA 3CTQA 5G6VA 4WG5A 4G9RA 3HLLA 3R6XA 5EOLA 3PE2A 4RIYB 3FY0A 2WMVA 3MGYA 3OWPA 1SVEA 4BKYA 4DGNA 3FI8A 5C27A 2YLEA 3PWYA 5EYDA 2QC6A 2BKZA 5L6WL 2X0GA 4XP0A 4FKVA 3QAME 3QRKA 1OGUA 3PDTA 4Y85A 2B9JA 3KMWA 3AC5A 4R6VA 3PZHA 3NAXA 2JFMA 4TKSA 3UDBA 2UW5A 4O1PA 3MV5A 5JN2A 1MRUA 3BQRA 4UMQA 3F2NA 2YDJA 4EYJA 4DTBA 2OGVA 2VWXA 5CASA 2HW6A 2WOTA 3ZHPC 3QXPA 4OBQA 2UW9A 4W4YA 2BVAA 3OD6X 4ZSJA 2Y6OA 4JXFA 5KMMA 4D4VA 4S33A 2Y4PA 3DTCA 3QD3A 4YU2A 2RG6A 3TNHA 4YO6A 3C7QA 3W18A 2W5BA 3AC3A 2YJRA 4GIIA 1QPDA 1ZYLA 2VGPA 4F7SA 4UALA 1TQPA 3UPZA 2BDWA 2ESMA 4BCQA 2C5YA 3FZOA 3GOPA 5EI8A 1JSVA 3PUPA 3EQDA 4XHKB 4C4HA 3QUPA 4RJ7A 2I0EA 4HYIA 2GHMA 2GS7A 3AGMA 3NUAA 4WBBB 2F7ZE 2PHKA 4G5PA 5J7HA 3O23A 5L2TA 4YZNA 1XHAA 2R3RA 3FY2A 4TXCA 5HOAA 4CT2A 1ZARA 3S4QA 2HWPA 1W83A 4I5PA 1U46A 2GQGA 4RFZA 3RZBA 3R8MA 3UIBA 5H8BA 1WBOA 2VNWA 3I5ZA 2KTYA 4H1JA 1HCLA 3LQ8A 4GU9A 3JR1A 3W33A 3MVHA 1OVEA 2Y4IB 3RHKA 4PNIA 3MWUA 4X2JA 3MN3A 4DLJA 4YR8A 5KHWA 1Z9XA 4USEA 1M7QA 4U5JA 4PTCA 3NNXA 3ROYA 1LUFA 4JJRA 2EXCX 4CKIA 3V8TA 3AC1A 5A4QA 3G6GA 4QD6A 1XBBA 4M68A 1PMVA 2FSMX 3VWAA 4DH3A 5J95A 3NZ0A 3TTJA 4AZVA 4FNZA 4Z7HA 1OIQA 1DM2A 2OJFE 2XIZA 4PMTA 4O96A 1YDTE 5D9HA 3ATSA 3F7WA 5FTGA 5HVKA 4XLVA 5E8YA 1OKVA 3QUEA 5M4FA 2HY0A 3EN6A 4I94A 1PMNA 3V3VA 4Z3VA 4GG7A 3QWJA 4YJUA 4D4RA 1WBTA 3LMHA 4GJ3A 4XX9A 2XK4A 3KRWA 5LVLA 3SAYA 2GQSA 1QPJA 2QU5A 3FYKX 2R4BA 5AAGA 2CNVA 3F5UA 4JBPA 2IZSA 3VS1A 4B8MA 4MK0A 1H08A 5I9ZA 4D28A 5BNJA 3FLZA 4YJQA 3R9HA 2Z7LA 2BIKB 3MPMA 1U5RA 2QURA 4QQ5A 2Y7JA 5L8JA 2FSOX 4XRLA 1CKJA 5TR6A 2WXVA 3OT3A 4LGDA 5FXQA 3HVCA 3VN9A 5D7AA 4LGGA 3EN9A 4MD8E 5ANJA 3TIZA 3R30A 5JMSA 4E5AX 1PXKA 2PZ5A 5AX3A 5IQGA 3F6XA 1W7HA 3LQ5A 3VHKA 3LXPA 5A46A 2OW3A 2VTSA 4YJVA 3MH3A 3VBQA 4E5WA 2ZB0A 2X7GA 5ANDA 1ZMUA 4ZSAA 5JK3A 4NCTC 3N4VA 1R3CA 1JLUE 4L42A 2BHHA 3ODYX 5CU3A 3NW5A 5IDNA 3IDCA 3P7AA 5IQIA 3F9NA 2XM9A 3QKKA 4BCHA 4CFFA 4C4GA 2O8YA 3EJ1A 4QP2A 1FVVA 2XKEA 1YKRA 3OWJA 4QPSA 1Q62A 2QHMA 1FINA 3CEKA 3EL8A 5BVEA 4AT3A 2CN8A 3BCEA 3KF7A 4AUAA 4XP3A 3HAVA 2FYSA 2O2UA 4E8AA 4U79A 4RX8A 2VTRA 5E91A 4DCEA 4JAIA 4FE2A 3C0IA 3BHTA 3FKNA 3QZFA 1H4LA 3F61A 2BAKA 3BE2A 3R1SA 4FKPA 4KINA 5FM3A 1CSNA 4LV8A 4PDSA 5JT2A 1BL7A 2J51A 3QYWA 5D7VA 3W1FA 4YNEA 4L3LA 3KCFA 5FBNC 3AT2A 4UXLA 3UTOA 2C0OA 3P78A 4U41A 4D0WA 2X9EA 3UODA 4DH1A 5LWNA 4EH3A 2OBJA 4FKRA 2FH9A 3FSKA 3SD0A 4Y5QA 4EQMA 4O7SA 3PXRA 2UZWE 2Y6MA 5AEPA 3S1HA 3OS3A 4J7BA 3DBEA 3GVUA 4EOIA 3ROCA 3TZ8A 2DWBA 4B8LA 1OBGA 4FIEA 3BYVA 1IA8A 5CF8A 2PUPA 1UWHA 1F0QA 3DAEA 4IJ9A 2H96A 1LEWA 1CM8A 3HMMA 3QUDA 2I6LA 3GCQA 3MB7A 4G31A 4KSQA 4NUSA 4XBRA 4PDPA 2IG7A 4O82A 5FUTA 4K1BA 3AD5A 4IHPA 2C0IA 3QQKA 4M7IA 2OIDA 3EB0A 1G8SA 5I9VA 4DA5A 3T8OA 1NVRA 2OJIA 4FF8A 4X0MA 2ITWA 5IISA 2RSVA 2QG7A 5GJGA 5M07A 3II5A 2UZDA 3LQ3A 3KXXA 3C4FA 2ONLA 5K0XA 1OL2A 3DDQA 3V6SA 4FGRA 4L67A 3CS9A 2ITYA 1SNUA 3EFJA 4GFGA 3V5JA 3VNTA 5IG1A 4XV2A 1YVJA 3O8UA 4IAFA 1O6KA 3BLRA 1MRYA 4G5JA 4EUUA 3OOGA 3L9MA 4ASEA 4KD1A 3NS9A 4CFMA 4F0IA 3NEWA 1TKIA 5LVMA 3BLQA 2BRBA 2HELA 4MWIA 1AQ1A 4PL3A 3LOKA 5HICA 3H0YA 2VWWA 2ETKA 4RC2A 4ACGA 2PE0A 4F64A 1W0XC 4W8DA 2ITXA 4C02A 4FT5A 4J8MA 5CI6A 4F1MA 2CKEA 4ANOA 5HZNA 3PRIA 4G9CA 2QOIA 3VBWA 4FX3A 3R83A 5TOZA 1S9JA 4OGRA 5AMNA 4D2SA 3FHRA 4RQVA 3PVWA 3IECA 3LFAA 1RDQE 4FSYA 4JIAA 4BYIA 1M2PA 5EYMA 4FA2A 5DVRA 5M4CA 1PKDA 5DR2A 3PSDA 2QOCA 3MH2A 4I6FA 3LFEA 3NAYA 3MH0A 4Y95A 3QC4A 4C3PA 3PE1A 5HE1A 1DI8A 3F5GA 2YABA 4C4IA 5J79A 1WBVA 1X8BA 5GZ8A 5EW3A 5ETIA 3U87A 5HO7A 5EW8A 3FZRA 1OKWA 5L8KA 2JBPA 4FV5A 4AGCA 3FMNA 4JBQA 3BHHA 1OL6A 1Q8UA 4EZ3A 4R3CA 1KE8A 4DEBA 3VS7A 3ZFYA 3NNVA 5A4CA 3LFQA 4O7ZA 4FSWA 3I6WA 4RWLA 5HCYA 3BX5A 4AZFA 4LL0A 3GUBA 4BF2A 4EH7A 1F5QA 4D1XA 4NW5A 2DYLA 3IW8A 3BHVA 1EH4A 1H1RA 2XJ0A 5AUTA 1ZMVA 2G01A 2WTCA 4FTOA 1BL6A 4RLLA 3QD4A 3ORTA 5BUIA 4IZ5A 3ZFXA 2P2IA 4FC0A 4FKJA 3CP9A 4KBAA 4O0RA 5AR8A 4UB7A 4WD5A 5FEQA 3O17A 3R21A 5L2IA 3GBZA 3CQEA 2QOOA 3VAPA 3DK7A 3NWWA 4FTMA 2J0IA 2P33A 2PVNA 4IAYA 5F95A 4C59A 3QL8A 4IWOA 3R8LA 1H07A 3FKOA 3UP2A 5L2WA 5EW9A 3UVPA 3PVGA 3V8WA 1GY3A 3V5LA 3JXWA 4AFEA 4CCBA 3Q6UA 5M55A 5DRDA 3W2SA 3KA0A 4TYHB 4ZLYA 3B8RA 1FVRA 3CQUA 4UX9A 1H1PA 4FUYA 4KIPA 4ZIMA 3LZBA 1YOMA 2ZM3A 4O0XA 3AMBA 4QNYA 2CKPA 2Y9QA 3PA4A 3DB6A 4ZTNA 3KGAA 3CBLA 1OL5A 4MD7E 5HU3A 4V05A 3DBFA 3UYTA 3NVKI 3TNQB 3AD6A 4OTHA 4IVDA 3R9NA 1B39A 2XM8A 1H00A 1B6CB 4FZ6A 3TTIA 4BR3A 4PP7A 1XH8A 4FEUA 5EQEA 4GYGA 2V7AA 3EZRA 3DB8A 3QALE 4EHGA 4YPDA 3UGCA 1IAHA 2QD9A 1V0OA 2W5HA 3IS5A 4BZNA 3FLQA 4FTRA 2R9SA 4D2WA 2I1MA 4IANA 4M67A 4KA3A 3COIA 2BFYA 2C4GA 3QTIA 5ETAA 4X2GA 3MVMA 5GINE 3KULB 5BUJA 3RAHA 5AP4A 1XH7A 4M3QA 5EHYA 3ETAA 4GU6A 4ZJVA 3ZSGA 4FTLA 2XB7A 5CU4A 4L7SA 3TZMA 1GZOA 2PVHA 4U3YA 4G2FA 3KRJA 3MA3A 3ZOSA 2R7IA 3K5UA 3LXLA 4YLLA 3TV6A 2PUIA 5CAVA 3PRFA 2XK7A 1MQBA 2G15A 4APPA 4ZP5A 2FSTX 4E4XA 4E73A 4BDKA 1SYKA 3JUHA 2X81A 3D7TB 4IMYA 3ZSHA 5AR7A 2G2FA 2GMXA 4L46A 1OPJA 5GJDA 4EH4A 4ZSGA 3ZH8A 3M2WA 3IW5A 3W8LA 2JBOA 4ANSA 5M51A 3F2RA 3VJNA 4C62A 4EOPA 3R22A 4WSYA 4PNKA 4TT7A 2UW4A 2UVZA 4JS8A 5CANA 2JDOA 3BV2A 3GP0A 4I5CA 3EIDA 4MH7A 4ACHA 4BWXA 5CF6A 5A14A 2IVUA 4IX3A 3ZZEA 5FBOA 3R28A 5EDRA 5HNGA 2J50A 3TG1A 2G1TA 4E93A 4DFLA 2PZPA 4O0SA 2Q83A 1ND4A 2C68A 1IG1A 2IVVA 2IZUA 4I21A 4DG2E 3QGYA 3EWHA 3CGOA 4FIIA 3DJ5A 4FV4A 2CNUA 4C38A 4TWPA 2WMWA 3TWJA 4GVJA 1H1WA 3FHIA 3NSZA 3M11A 4GKIA 2JKOA 5H8EA 2BRMA 3N4UA 4MYGA 3OHTA 1XWSA 4O38A 4AW2A 4F9BA 4O7WA 2PY3A 4NIFB 1PXPA 4I24A 2QO7A 5KZIA 3RGFA 1H27A 5AP6A 4CV9A 2Y0AA 4DFBA 2CCIA 3LCDA 4OUCA 4YLJA 4YTFA 2YM7A 1UKHA 5M53A 4CFXA 4Y5HA 4PDYA 1H01A 4EL9A 3DS6A 3ULZA 3G90X 3O7LB 3P1AA 5HTCA 5M56A 1KE9A 3OZ6A 4F6UA 1KUTA 5E8ZA 4UXQA 4BGQA 1UVRA 3EN7A 4V0GB 4WRGA 4ZEGA 5GIOE 2ZMCA 3ZSIA 4KKEA 2WQEA 3HV6A 3ZBFA 2VWYA 5K5XA 4O0YA 3FMJA 4MAOA 4TRLA 3WILA 4EK5A 4ALUA 3PLSA 3OWKA 4J95A 3KCKA 3PP1A 3C4XA 4KS7A 2YZAA 4RVLA 5EHLA 1ZAOA 4GSBA 3FC1X 4EJNA 3AMYA 5M44A 4ZJJA 1T46A 3P7BA 4G34A 2PVFA 3MS9A 2UZVA 1PXNA 1KE5A 2JDSA 3I0QA 3ALOA 3MSSA 5JRQA 2DUVA 3PXQA 5CVFA 1YI6A 5DMZA 3C9WA 1BI8A 3NNWA 2R3IA 3GI3A 3O8PA 4MX9A 4NCTA 2XK9A 4GH2A 4DEHA 3DKCA 4G3GA 5HTBA 1JAMA 2HZIA 4L52A 2WQOA 4NJDA 3GQIA 5EYCA 2Q0BA 4I0TA 2QOKA 4O7YA 4X21A 3V8SA 4X3JA 5DWRA 3FXWA 3E7OA 4IEBA 4LMUA 2GTMA 4M14A 2RFEA 3C5UA 4YLKA 3OXIA 3ATTA 1OKZA 1YQJA 1Q97A 3UOHA 3FL4A 2YIRA 4EOMA 1ZOHA 3A8WA 3MIYA 3HRBA 4K11A 1L3RE 2AUHA 3A61A 4KIOA 4Y46A 5JZNA 4XOYA 3QTUA 1P5EA 1JQHA 2HY81 3FPMA 3FMLA 5IDPA 4IDVA 4JDIA 4Q9ZA 3DBQA 3OROA 3EQRA 3MFSA 5M09A 3DJ6A 2WOUA 2F9GA 2QI8A 4RJ3A 4GMYA 2VTAA 2CNQA 2PVKA 3FC2A 4HZRA 5CNNA 1OL7A 3RP9A 4CGAA 5BX0A 4MXZA 2B54A 4FKIA 3A4OX 4QP4A 2UZUE 4KSPA 2WTKC 1FPUA 3AGLA 1MRVA 3U4UA 2Y4IC 3BGZA 4RMZA 4ASZA 2RIOA 2A19B 2C30A 4E20A 4EK8A 4FSQA 3R9DA 1KV1A 4YZCA 3U9CA 2BRHA 4AA5A 3FSFA 3ZEPA 3OEZA 3LW0A 2HZ4A 2R3OA 4QTBA 3FMHA 3I5NA 4F9AA 3BU6A 3UVRA 3ORKA 2QVSE 1FMOE 5DR6A 2OF2A 3KC3A 2XH5A 3QHRA 4O2ZA 2G2HA 3F3VA 3OXZA 1OM1A 1BX6A 3ANQA 3DXQA 4JL9A 5DOSA 1WBNA 4E6CA 2FSLX 3IGOA 5JFXA 3JPVA 5DGZA 3COKA 2B52A 4D0XA 3L8SA 3OW3A 1Q8WA 5DT0A 2YZLA 2R3MA 5CZHA 1OUKA 1RJBA 3R00A 3BYMA 5GJFA 4C3FA 1YXUA 3TN8A 4KUJA 5H2UA 4WKQA 4M66A 4C34A 5DA3A 2R5TA 5HEZA 2NO3A 4A7CA 4PUZA 2CGWA 3G2FA 3H3CA 1KE6A 4E3CA 4J99A 4FG9A 4DEGA 5DEYA 5HG7A 3MW1A 4CMOA 1JKSA 2BTRA 2VO6A 5AV3A 4DH8A 3QQHA 2YDKA 2XKCA 4RG0A 3R7GA 2OF4A 4L53A 4CFUA 3KXHA 2O65A 1ERKA 3QZGA 4ZY5A 4FGBA 4UEUA 5FRIA 3IW7A 3VUTA 3F5PA 4IQ6A 2E2BA 4W9WA 2C5NA 3GENA 2RFDA 4XG2A 4HYSA 3UC4A 5HD4A 4CRLA 5GIPE 4FEXA 4XG3A 4FYOA 3C51A 3WZDA 4BIEA 2A27A 4GK3A 3UMXA 4FEVA 5BYLA 3FQHA 2JC6A 3DLZA 3R8ZA 3DK3A 1UKIA 3W16A 2H6DA 5AP5A 5IZFA 1A48A 4U0IA 4F63A 1I09A 4DH7A 4QO9A 4EBVA 3GC7A 4RA4A 3R04A 2UVXA 1U54A 2EU9A 2PMLX 3VC4A 3TUBA 4D5HA 2WD1A 4ZZMA 1V1KA 3BYOA 5D10A 5BMMA 2JKMA 4DFXE 2OJGA 3E7VA 5J8IA 4GFOA 5BMSA 5AX9A 3ZMMA 1LEZA 2XBAA 4IW0A 4YBJA 5CAOA 1P14A 2JAVA 2YM8A 3KRRA 3Q04A 3R7VA 3ZUUA 3H10A 2FGIA 3FZTA 5KMOA 4QNAA 4G3EA 4FL2A 2VO7A 4U44A 5B0XA 3NPCA 3TCPA 1MP8A 2ZM1A 3UJGA 4BFMA 1NVQA 3ORPA 5AR3A 3SKCA 3L1SA 2W1ZA 4FKQA 4RJ4A 2J6MA 3G51A 3FKLA 3KEXA 5ICPA 5KBRA 3EN5A 2OSCA 4AN2A 3SRVA 4TZRA 2C1AA 2EUFB 4K9YA 5E7RA 3FQEA 4BWKA 5M08A 4OTWA 4ANMA 1PXMA 2XP2A 4RX9A 3W2RA 4BIBA 3K3IA 4EOJA 5DR9A 4ZTHA 3OBJA 3TV4A 2WMQA 3BPRA 3DFCB 5IMEA 4I6HA 3I60A 1YW2A 3OVVA 5CQUA 1OPKA 3PA3A 5ANGA 5AV0A 1FGKA 4MQ1A 4CSVA 3F88A 3R71A 3N9XA 3OCTA 2X2KA 3WBLA 4W4WA 4BZOA 3A7JA 4IBMA 3E8NA 2FO0A 3C5IA 2ITZA 5L2QA 2VTIA 4AZEA 4O7TA 3PIZA 1BKXA 3RPRA 3E3PA 3RM6A 2CKOA 4FL1A 4RIWB 4BCFA 4IWPA 1YDSE 2YIYA 3R02A 4IWDA 4MF0A 4AZWA 3UQCA 2HAKA 2EWAA 1PXLA 3BI6A 2X8DA 5J9ZA 2KULA 1ZXEA 2YFXA 2X6DA 4TWNA 4YHFA 3DOGA 3UQFA 3O50A 4ZOGA 3TNWA 4KNBA 3JY9A 4FICA 4L9IA 3D2IA 3PVUA 1VZOA 4PMMA 3MY5A 4QOXA 4IAZA 2YM5A 3W2OA 2B53A 4YJOA 3Q2JA 4OBOA 2GNFA 4U40A 5B2MA 4DEDA 4B0GA 5E9EA 2OFVA 5LQFA 4IC7A 4ARKA 3RKBA 4IADA 2WU6A 3F2AA 1JPAA 4GK2A 4IM0A 4WNOA 3HV4A 4A07A 3TUDA 4HNFA 5CVHA 4FTTA 3GC9A 2EB3A 4I93A 3CQWA 4IB3A 2BIYA 3FYJX 3RPYA 1TQMA 3GCUA 2WELA 4LRJA 3R7OA 3EHAA 3GXLA 5BQ0A 4FIGA 1PY5A 4GT3A 4FVRA 3NCZA 3BQCA 3LHJA 2R3FA 3ORMA 3BHUA 5IEXA 2JDRA 4FT0A 3RNYA 4AOIA 4OTIA 4YC6A 4CEGA 4IIRA 3LFCA 4OT5A 4Y83A 4II5A 4RVMA 2BZKB 2OZAB 3C0HA 3RNIA 2QKRA 3ZLWA 1XKKA 4NFMA 5IEYA 3DA6A 4IX4A 1WMKA 3DTWA 3Q52A 3HRCA 4WA9A 3SOCA 5I9XA 5KMLA 3V5WA 2PULA 5HLPA 4ZZNA 3UNJA 5HIDA 3E8CA 3VUMA 4RT7A 3CPBA 4CLIA 1W82A 2UZEA 2Z7QA 3DGKA 1M7NA 5IH6A 5CF4A 3VW8A 4E4NA 2HK5A 2C5OA 5I9YA 3MY0A 4EHVA 3FLWA 4BL1A 5IQHA 3LAUA 3BLHA 4BDEA 1JKTA 2A0CX 5AM6A 5KX8A 3A2CA 2ZV8A 4BCGA 3GOKA 4QQCA 1Q8TA 3E8DA 1K3AA 4I23A 4R8QA 2R3PA 3Q60A 2UUEA 4RIYA 1JKKA 3ZDIA 2W9FB 1L8TA 3JY0A 2RKUA 4YZ9A 2PMOX 5CALA 3OWLA 5AWMA 2YN8A 3LFBA 4ONAA 4DFZE 5CXZA 4H36A 5T3QA 2ITTA 3RINA 5BVNA 3AG9A 3EOCA 4I6BA 4P90A 4XBUA 1JOWB 3QTSA 3DZQA 5HCXA 4HPUE 4FV9A 3ZUTA 4QMVA 3ZDUA 3HMIA 3VS6A 2QOFA 3KREA 2WTKB 2C6TA 4WIHA 4BZDA 1H26A 5IEVA 4IZYA 4BDBA 4K18A 2WZJA 5EYKA 4PPCA 1YDRE 3CKWA 4WRSA 2OZAA 3SA0A 4YNOA 4UN0C 5AV1A 4QMTA 2Z8CA 4BKJA 1JKLA 2W1IA 3G9NA 3V6RA 3V51A 4ACCA 3DK6A 2GNJA 1KE7A 2UW3A 4DCAA 2JIIA 5HI2A 1V0BA 4BDFA 1HCKA 5A4TA 1YWNA 2XKFA 5BVKA 4G1WA 5F1ZA 4CMUA 2B1PA 3L9LA 4JOAA 3OG7A 2PE1A 2HCKA 4UMPA 4OTFA 3KXZA 1B38A 4XJ0A 5ANKA 2VTNA 3EQBA 4U42A 5HNBA 3UNZA 4EI4A 5J1WA 4L6QA 3OUNB 2AYPA 3A7FA 4QP3A 5KUPA 2QOQA 4UWCA 5C9CA 5HQ0A 3R9OA 2VWZA 2BALA 4I20A 4GVAA 1W8CA 3OY1A 3QYZA 5FQDC 1SZMA 4DF3A 3VUDA 2NP8A 3POZA 2XKDA 4CYIA 4PQNA 1FVTA 2IW6A 4M13A 4MNEB 4G6NA 3GB2A 4BI1A 5AP7A 4D2RA 1YXSA 2GQRA 3H0ZA 4JBOA 5DNRA 4BCKA 4KRDA 2OIQA 2XNBA 5HCZA 4E7WA 3CKXA 4BBFA 3DAKA 3EFKA 3NYOA 3WZUA 4FKSA 4TPTA 3QFVA 5CTPA 4F08A 4UY9A 1UU3A 2XRUA 1YHWA 2YDIA 3NIEA 5CQWA 4H3QA 4QYGA 1O6LA 2GDOA 3WI6A 2GSFA 5BVDA 3VQUA 4FYNA 4IFGA 2GS2A 5CXHA 4L44A 3VS0A 4EH6A 4ZTMA 4ENXA 1PRYA 1S9IA 4FL3A 2C5XA 4L45A 3COHA 4DC2A 4WHZA 4TL0A 3C0GA 3KB7A 1ZMWA 5L3AA 4E6AA 4RWIA 3C4CA 3KXGA 4DFUA 5F20A 3QWKA 3SGCA 3MVJA 2XCHA 3G9LX 5ETFA 2UZNA 5D1JA 4FBXA 3ORZA 2YITA 3BKBA 3BIZA 5FEDA 3RCJA 2R7BA 4H58A 2C3LA 3WE8A 2Z02A 4D9UA 3HUCA 3F3ZA 4YGAA 3ANRA 2IW8A 3VVHA 3TL8A 5IH5A 5JGDA 3G15A 4MBLA 3ENMA 2B9IA 4IM2A 2OI4X 4ZJIA 4DGOA 3KRLA 3OXTA 1OMWA 4MNEA 4AGWA 5AJQA 2J0LA 2WMXA 4NT4A 4DAWA 2X1NA 4UZHA 2F57A 4P2KA 2ERZE 3PPKA 4Z16A 3FMMA 5C01A 3ACKA 4LOOA 5L6OA 2HZNA 1R39A 4JQ8A 2PE2A 4BDDA 1H25A 1Y8GA 4CXAA 3OBGA 4NU1A 4IXPA 1VYWA 5FDXA 3DY7A 2EB2A 3NYNA 4UWYA 4AW1A 4CVAA 3LCSA 2OU7A 2OICA 4YC3A 3CY3A 3GCSA 5AP0A 1Y6BA 2YWPA 2VRXA 4XNEA 2JIUA 2PMIA 3Q4TA 5HE0A 2WMBA 2NRYA 5JSMA 3VS2A 4PPAA 3O7LD 4FTJA 4NM0A 2YWVA 2HWOA 3EZVA 4O22A 1P4OA 2WHBA 2W1CA 2YIXA 5DI1A 4BTKA 3BGPA 4CQEA 4QMMA 2V55A 4UMTA 2YCRA 5EM5A 4F1OA 1XBCA 2ZMDA 4PRJA 2OXYA 3LLTA 4TWCA 2YEXA 2X7OA 2JLDA 3FBVA 3HP2A 4ASXA 3I7BA 5FLFA 1OBDA 3QHWA 3C4EA 3FUPA 5E4HA 3CE3A 4PMSA 4F6SA 3WF6A 1FBNA 1J3HA 2WEIA 1REKA 3K54A 1SNXA 3MYGA 3P7CA 4OT6A 3QCSA 3V04A 3ZXZA 5EKNA 2R3KA 5DLSA 5K4IA 3LJ0A 3H9OA 3RPVA 1PXJA 3EYGA 4GJ2A 4BDCA 5LXMA 3HAMA 1OKYA 3BELA 2QLQA 4HCTA 5CAQA 3WIKA 4PX6A 1XH9A 2CGUA 5DYJA 3UNKA 1Q61A 1MUOA 3DQXA 3NIZA 5IF1A 2XVDA 3L8VA 4F09A 2FA2A 3GFEA 4JBVA 3U54A 3K2LA 4QMWA 5K9IA 4I1ZA 3NDMA 1Q99A 2PUNA 4FKLA 4DHFA 4MXOA 3OUKA 5AAFA 4AFJA 1QPEA 5HX8A 1SVGA 3OOMA 3WIGA 3QQLA 2BCJA 1GOLA 3LIJA 4H1MA 2VUWA 4CFWA 5HBEA 4C4FA 4KIKB 4WO5A 4MBIA 3RK7A 4Q5HA 5HD7A 2XNEA 4FUXA 4J71A 2Z7SA 1J7LA 1GZKA 2ITNA 4E5BA 3HX4A 4BDJA 5LMKC 3H9RA 2B0QA 1VR2A 1HOWA 5AR4A 5HESA 5GZAA 5G1XA 2P3GX 3IOPA 2F2UA 4DBXA 4C35A 3M42A 5M06A 2ZVAA 3C50A 2UZOA 2VTMA 5AV4A 1AGWA 2ZV2A 4F99A 2OLCA 3FAAA 3UG1A 3ORIA 4BTMA 3EKKA 3LCKA 4BDAA 5CSWA 5C8NA 2R3HA 1YHSA 2WMUA 3OY3A 4ZAUA 4FSUA 4ACMA 1UNLA 4LYNA 3ZEWA 1M14A 4F1TA 1V0PA 4O0VA 2GNHA 5HIEA 4HCUA 3BU3A 1JSTA 3E5AA 3ZO4A 4R7HA 2ERKA 4HGSA 5IQDA 4D2PA 3MY1A 3FZPA 2VWVA 5DN3A 1IAJA 4O27B 4YC8A 4AGDA 3R73A 4BHZA 3C4ZA 2WQNA 4GRBA 3ALNA 4UYNA 3DPKA 3HNGA 3UVQA 4FTAA 4ORKA 4FKWA 4EK3A 2YIWA 3NYVA 4QTAA 2XBJA 5BYZA 5AUYA 1NVSA 1R0EA 4KBCA 2WTVA 4HGEA 4M69B 3VBTA 5JFVA 2ZYBA 4ANQA 2OXXA 3D2KA 4W4XA 3ZXTA 4KIKA 4GEOA 1GIHA 4DEEA 5F4NA 4E4MA 2W05A 4RIOA 2YA9A 1WBWA 3IKAA 4YJPA 2QONA 1KOAA 3QCYA 4J52A 5L2SA 3ZLXA 3DT1A 3LXNA 4HVSA 4XUFA 5I9UA 2PVLA 5FM2A 2X4ZA 2CLXA 3QF9A 3TNPC 4PP9A 4V01A 1LPUA 1IEPA 3IONA 3FMDA 1BMKA 4BBMA 3K3JA 3QGWA 5ACKA 3PJCA 3TXOA 3NUNA 3QU0A 2JIVA 5IUHA 3VRYA 3S3IA 4IM3A 3HUBA 5ETCA 4OW8A 3D5UA 3LMGA 4FIHA 3ENHA 4IACA 4M15A 4YTHA 3QTRA 4TYHA 3FL5A 1VEBA 3LXKA 3NUUA 5CEIA 3TACA 4RWKA 3F3WA 5HVYA 3TDVA 3L8PA 3Q4UA 5IH4A 2QOHA 4O0TA 4XMOA 5EI6A 2G9XA 4APCA 5IQCA 2W1EA 3T9IA 2X39A 3MTFA 5LMAA 3PYYA 2W1HA 3QRJA 1KWPA 2VU3A 4QMYA 1JWHA 4AX8A 4FTKA 4FNWA 3MFRA 3VF8A 3AD4A 3B2WA 4M69A 5EQYA 3HZTA 5H3QA 3A99A 3WZKA 2QHNA 2XNPA 4AE9A 3TT0A 3KN5A 2RFSA 4RIXB 3ZFMA 3I7CA 1F3MC 5KNJA 2W5AA 4K77A 4JAJA 5ANOA 3W32A 3KULA 3JYAA 1PMUA 3HA8A 4YJTA 5A3XA 4D4YA 5EK7A 2VO0A 3MESA 5I4NA 3SG9A 2JFLA 1GZ8A 4EOOA 2BRNA 2OJJA 3E63A 3R63A 1WCCA 4QMXA 5I0BA 4QT1A 4AOTA 4ZLZA 2GNGA 3ODZX 3DKGA 1Z5MA 5DIAA 4RLKA 4X3FB 1TVOA 3R2BA 4GV1A 4AP7A 1XH6A 4IFCA 4DT9A 2J7TA 3AC4A 2XIXA 3AMAA 3KMUA 3KK8A 3KY2A 3QTQA 3R7IA 4AQCA 4A9SA 5AUUA 4DT8A 4D1ZA 4D9TA 5DH3A 4BI0A 4HVHA 3D7TA 3E88A 4EQCA 3E62A 3FI4A 3E64A 4P5ZA 5B2KA 3A60A 3G0FA 5HE2A 2X8EA 5BYYA 4U3ZA 3HMOA 5IUIA 2BHEA 1ZYSA 3DCVA 5IPJA 4O21A 5JEBA 3PXZA 4U8ZA 4KKHA 3POOA 4GW8A 4XH6A 3UMWA 3L8XA 4FSZA 1XBAA 4J53A 4R1YA 4TWOA 2IN6A 3ACJA 3ZRLA 5J5SA 4JQ7A 2PTKA 3COMA 4PDOA 5EDPA 2V7OA 4O2PA 5HO8A 3ZO1A 4BIDA 3S2PA 3QBNA 5ITAA 2C3JA 2EXMA 3PXFA 4GL9A 5CSXA 3W2QA 5CNOA 4KABA 4K33A 2WGJA 4HOKA 5M4IA 3Q3BA 4Q5EA 5CF5A 3ERKA 4C3RA 2RL5A 4JDHA 4R77A 3DU8A 3W2PA 3R1YA 2IO6A 4J97A 3D9VA 2W99B 4F6WA 1SVHA 4ZS4A 2PVYA 4MVFA 2BRGA 2R3NA 3LVPA 3SLSA 3WYXA 3DXPA 2ITPA 4QMLA 5CEPA 4GT4A 1DS5A 4NIFA 3ORXA 4LRMA 2OO8X 3FQSA 3UYSA 3FV8A 3T3VA 2R64A 4WNPA 3V01A 3ZLSA 4RJ6A 5KE0A 1GIIA 4BC6A 4E6DA 5I5ZA 5JKGA 1UV5A 3GU6A 3G33A 1NXKA 4ZS0A 2X6EA 5IU2A 4XP2A 4FK6A 4FV7A 3HDMA 4BICA 4V0GA 4BRXA 3F66A 4FV0A 3QLGA 4I5HA 5K0KA 3CY2A 2XNNA 3GFWA 4QMUA 4AXAA 4EBWA 1GZNA 4FZDB 4AZTA 2GNIA 5F9EA 3VIDA 4JLCA 3PA5A 4LQMA 4TYGA 3U55A 4RWJA 3LKMA 3O8TA 3SX9A 2BMCA 4L68A 4R5YA 4FG7A 4AG8A 4AT5A 4GK4A 2UW0A 2WIPA 4WSQA 3ZM9A 2PVRA 5E8VA 3RHXA 3D7ZA 4I3ZA 4JRVA 3SW4A 4AACA 2H34A 3PSBA 3L9PA 5HHWA 4A9TA 4MXXA 4E1ZA 4FSMA 4YO4A 4Y73A 4AT4A 1PMEA 4H3PA 4XG6A 4CNHA 4HPTE 1H28A 3SXFA 5T6KA 3G0EA 3UE4A 3UOJA 2XYUA 3MFTA 4B9DA 1Q8ZA 4HZSA 1R78A 2VN9A 4YUQA 2QODA 4ZLOA 4ITIA 3TV7A 3WYYA 1XO2B 4U45A 2E9PA 3U6JA 4FT9A 3VQHA 4RQKA 4TN6A 2O64A 3D5XA 4TTHB 4LL5A 5CU0A 1Q3WA 4YJRA 4ITJA 1GNGA 3EQHA 4LRKA 2CGXA 4AN9A 1OECA 4BDGA 4A9RA 5AP3A 2GHGA 5CSVA 3NUPA 3GQLA 2W06A 4I0SA 5CI7A 3RTPA 2WQBA 3U9NA 1A06A 3HV5A 3ZU7A 2GFCA 4R3PA 4ERWA 3IDPA 2C6KA 3RK5A 5JQ8A 4EK4A 1OIYA 2C6DA 5LVPA 3WARA 4FODA 2FUMA 3Q32A 4LUDA 3SC1A 4XG8A 2VWBA 5E8TA 4WG4A 3W55A 4CFNA 1Q4LA 4RFMA 4MWHA 5TE0A 4XEYA 3T3UA 2J0KA 1ZLTA 2VTTA 2YHVA 3AT3A 3P86A 5DFPA 5FTQA 1FOTA 3E92A 5CENA 4DFNA 5I3RA 4RX5A 3P5KA 2C1BA 4IX6A 4FT7A 5EKOA 2QNJA 5JH6A 4NH1A 5LVOA 3EQPA 5CLPA 3ULIA 2HXLA 4BY9E 2CCHA 1M52A 5E8UA 2W1GA 5DG5A 4YSJA 4UBAA 5AUVA 3TKHA 5EM7A 5LOHA 2B9FA 3PY0A 3DQWA 4I0RA 5ACBC 3CGFA 4GYIA 1J1BA 1PHKA 3DV3A 4EOLA 5FWKK 2W4OA 3V5PA 3EFLA 3NUXA 3LJ2A 2ETMA 4NKAA 5EDQA 2XS0A 5HE3A 4G6OA 4ZTLA 2B55A 1ZY5A 4DGGA 3ZYAA 2EXEA 4X2NA 5LMKA 4LV5A 5AAEA 2J9MA 4RZWA 4YMJA 4S31A 1YRPA 1UU8A 3DNEA 3OTUA 5AUZA 4XS2A 4ANBA 1BYGA 3PY3A 2EVAA 2XA4A 4RVTA 3ZBXA 2B7AA 1JSUA 4EZ5A 3D83A 3U8WA 3P4KA 2YCFA 2PWLA 3QKMA 4IAKA 4DN5A 4KIQA 3W2CA 3QZHA 3UC3A 3BWFA 2WNTA 5TF9A 4RBLA 4ZK5A 4CD0A 5HKMA 2J4ZA 5KMKA 3IW4A 4GS6A 4O0UA 4CTBA 4K6ZA 1YXVA 5EI2A 3MI9A 1M2RA 3OP5A 4UV0A 5CS6A 5CU2A 2WKMA 2WEVA 5FP6A 2HIWA 3P79A 5EOBA 2ACXA 2Q0NA 4EWQA 3FXXA 4W9XA 5DT3A 3NUSA 5L6PA 2WU7A 4WT6A 3ZUVA 3AXWA 3TEIA 3ZZWA 4D1SA 5IA1A 1QCFA 4MQ2A 4FTQA 4QMZA 3I1AA 4ENYA 4O6EA 3VW6A 5FXRA 3RCDA 3VUKA 2OG8A 1OIUA 4RA5A 2C6EA 1ZRZA 2J0JA 3Q4ZA 3UG2A 2CJMA 3SV0A 4I4EA 1JBPE 4L43A 3EQGA 4W4VA 4EUTA 5BPYA 3H4JA 2E9UA 4BI2A 3HKOA 3VS4A 5JGBA 5LMBA 1CDKA 5CT7A 3O51A 4IX5A 2XNGA 1Y6AA 4FIFA 4O6LA 1URWA 5EFQA 3PLAE 3QXOA 1OPLA 2YJSA 2R3GA 2WTDA 2YLFA 5TO8A 3FE3A 1UU9A 4QRCA 4FNYA 3VBXA 1OB3A 1BLXA 1NY3A 4IH8A 5DBXA 4CV8A 3GU8A 4CKRA 5EM6A 3A4PA 3VUIA 2BUJA 2P4IA 3HECA 3KFAA 3R7UA 5L4QA 1Q3DA 3F5XA 4YHJA 2GFSA 5E8SA 2VWUA 3PVBA 4RZVA 1JNKA 2ZJWA 5BVFA 4O0WA 5CU6A 2DQ7X 3KK9A 4YJNA 4DLIA 4EKKA 3NW7A 5J9YA 3EL7A 4DG3E 2QO9A 4BYJA 5HG9A 2I0HA 4RC4A 4FKGA 4YZBA 4EORA 3Q5IA 4A4OA 1YI4A 4UWBA 2VTLA 2BFXA 3BYSA 5ANIA 5FG8A 5DE2A 4FNXA 4DEAA 3PJ3A 3I4BA 5E1SA 3ORLA 5B7VA 3N51A 4RIWA 4JDJA 4NK9A 4WOVA 4ITHA 5TKDA 3SVVA 3B2TA 4F0FA 4A9UA 2YIQA 2FB8A 1AD5A 3VF9A 5AUWA 2BAJA 5E8XA 3EQIA 4GIHA 1H24A 2B9HA 4OAVB 2Z60A 4IB5A 2RF9A 3BRBA 5KBQA 5K3YA 4GKHA 4WNKA 4J8NA 5JFWA 2CHLA 2R3QA 4S30A 5AA8A 3BBWA 4ZXTA 1UNHA 2QR8A 4NTSA 3I79A 5FDPA 4S32A 4QP7A 4JVGA 1P4FA 3KRXA 4E26A 2O5KA 3LLAA 4LFIA 3EH9A 4EH2A 4D5KA 3P23A 2WTJA 4FZFB 4S2ZA 4UMRA 5IA4A 2C5VA 4DE4A 4RVKA 1XR1A 2JKQA 5CEMA 3WZJA 3QQJA 4BBEA 3QQUA 2E9VA 1H0VA 2C6MA 2SRCA 4DH5A 4JI9A 3GC8A 4NWMA 3LFSA 2V5QA 2IJMA 3FLSA 3DFAA 3I0OA 2OFUA 3RPOA 2JDTA 4NKSA 4DEIA 4DYMA 4C0TA 3CXWA 4C57A 2P0CA 5HU9A 4BGHA 4BGGA 2BPMA 3UIUA 3E8EA 1TQIA 3PPZA 4P7EA 2BILB 2ITQA 2CDZA 3RM7A 3C4WA 1UWJA 4FR4A 4ZMFA 2W0JA 2R3LA 4P5QA 4N57A 4GUEA 2RG5A 2XEYA 2JEDA 4HW7A 3NLBA 3NW6A 3HDNA 3QCQA 4MXCA 2XK6A 4F9CA 2PSQA 2Z2WA 2PMNX 4HYUA 5HO6A 4KKGA 3D94A 2OIBA 3OC1A 3A8XA 2UW8A 3ZC6A 3MTLA 3A7IA 3OFMA 2JKKA 4KRCA 4QMPA 5IQEA 3KVWA 4E4LA 3QKLA 4ZMEA 1Q24A 3RAKA 4QYYA 4EH9A 3TI1A 2XNMA 2W4KA 4AWIA 4EOQA 4FTIA 1E9HA 4OTDA 2CSNA 3R8UA 5CYIA 2ZDTA 5JQ5A 4BCNA 5AM7A 3VULA 3HYHA 1OIRA 2A4LA 2WMRA 3FLNC 2W96B 2WTWA 3KL8A 3LFNA 2ZDUA 5HBJA 1J7IA 1OUYA 4GFMA 5CZIA 5CEQA 4Z7GA 4PY1A 4XLIA 2W7XA 5CVGA 3DZOA 1T45A 3FMEA 5HLWA 5EHOA 3HP5A 3SQQA 3RAIA 1KV2A 2VV9A 4CZTA 1JVPP 2XJ2A 5M4UA 3HMNA 2C3KA 2XZSA 2CMWA 3GCPA 3QX4A 4KB8A 4FT3A 3EQFA 2PVJA 5I3OA 2XIKA 1CTPE 3UQGA 5JZJA 3UO4A 3PY1A 4BN1A 3WF9A 5JRSA 5HG8A 2OKRA 4XG4A 5C26A 3PJ2A 4H39A 3BU5A 3FLYA 4D2VA 3QLFA 3Q2MA 3P0MA 3VRZA 4LUEA 4CKJA 4RPVA 3UP7A 1YWVA 3U51A 1VJYA 2A1AB 4JG8A 3RK9A 3HMPA 1RE8A 3EQCA 4X3FC 4YP8A 3BHYA 3PSCA 1Q5KA 3O2MA 1PXIA 3CD8A 2F7EE 4M0YA 5C8MA 1ZY4A 3FWQA 4KWPA 3ZRKA 3ZRMA 2JDVA 3OMVA 3LPBA 1PW2A 4AU8A 3VBVA 3HGKA 3GU5A 4OBPA 3VUHA 4NM3A 3E87A 3L9NA 2UV2A 4IB1A 4IZ7A 4YPSA 4ZSEA 4C33A 5CSPA 1NT2A 5IQBA 3CTJA 4ANLA 4O7RA 2VZ6A 3F82A 4HGTA 3CIKA 4LOPA 4PL4A 3NX8A 5FTOA 3TIYA 2C6IA 4IJPA 4BCIA 3U6IA 4BKZA 2O0UA 1WFCA 3MVLA 5M57A 3PTGA 3FMKA 2WPAA 1IRKA 2QG5A 4EKLA 2LGCA 4XV1A 1K9AA 1QL6A 4IE9A 4P4CA 4XV3A 2UZBA 3C13A 3KF4A 1WVWA 4O86A 4JNWA 4GT5A 4IC8A 2H9VA 4Y8DA 3R9RA 2BROA 2J5FA 2WAJA 4RGJA 3HV7A 3SHEA 3WE4A 2XRWA 1YI3A 3HA6A 3IOKA 4F7LA 4ZTQA 3QA0A 2YISA 2XJ1A 3KVXA 4ZZOA 2GU8A 3D0EA 2IZTA 2OZOA 3CCNA 4FEQA 3R01A 3D15A 4PTEA 2ITUA 4FTUA 2JGZA 3Q96A 4QP1A 4WBOA 4ALWA 4AS0A 3OCGA 2GHLA 1ZYDA 3TJCA 3PFQA 3SXRA 4R7IA 3OCSA 3N4TA 4FZ7A 4HYHA 1APME 1H8FA 3SW7A 4CTCA 3JS2A 3NMUF 1G3NA 3DKOA 4YZMA 2QU6A 4L3JA 2X2LA 4AN3A 1WBSA 4CLJA 4ZY6A 1MQ4A 4TYEA 4FIJA 3DXNA 3QZIA 4AZSA 1PYXA 5A9UA 4CCUA 2XIYA 5HGIA 4YZDA 3CSVA 2JITA 3AC8A 3P08A 4B99A 3REPA 4B7TA 3MPTA 2PK9A 4QTEA 1Y91A 2LAVA 5CAUA 3VBYA 3SG8A 2C6LA 3SXSA 3ZO2A 4I41A 4O83A 5KCVA 4HGLA 4MCVA 3ITZA 2O63A 3BWJA 1XH4A 4JRNA 3TZ7A 2XK3A 4WG3A 4AOJA 4EC9A 1E1XA 1LR4A 4JIKA 3Q9XA 4RFYA 2VTOA 4FV2A 4QMSA 3RJCA 5J7BA 2C0TA 3DJ7A 4GUBA 4IVBA 4L3PA 5FD2A 3KN6A 3K5VA 5L8LA 4O91A 4DGMA 4L01A 4CYJA 5IA0A 4O84A 3RI1A 3R0TA 5AP2A 4FSNA 3OF0A 4BTJA 2W1FA 1OL1A 3R7YA 2BZIB 3CTHA 4KS8A 3KKVA 3CD3A 5LVNA 4KAOA 5KKRC 5J1VA 5J9LA 3W10A 3MBLA 2WB8A 2IZRA 2QKWB 4UZDA 5K4JA 5C1QB 2QR7A 5FGKA 2I40A 5KMIA 2E9OA 2VAGA 2IW9A 1YOJA 1O6YA 3AOXA 4YHTA 5JFSA 3S0OA 5LWMA 4A4LA 3MJ2A 3LJ1A 1DI9A 2UVYA 4WNMA 4L7FA 4A4XA 3IGGA 4N6YA 3O96A 3NUYA 4G3FA 3RWPA 3UIMA 3GU7A 3UIXA 1RQQA 4EHEA 3Q53A 3BEGA 5E1EA 3R8PA 3NYXA 3PIYA 4MD9E 4NTTA 2FVDA 5K5NA 1WVXA 4U7ZA 3FI3A 4NW6A 2VTHA 1FQ1B 4DGLC 3UZTA 2J2IB 3R1QA 1R1WA 2GNLA 3MFUA 4IB0A 4MF1A 5DEWA 2HYYA 2YCQA 3H30A 3V5TA 2CGVA 4O1OA 4A06A 2J0MB 1WZYA 3DKFA 3GEQA 2ZM4A 3IDBA 2C69A 1OZ1A 4IAIA 4NSTA 3TKUA 3ET7A 3QQFA 4MKCA 4C4EA 4NM7A 4J98A 2BDFA 1RW8A 3CJGA 3PWDA 2AC3A 4X2KA 3UZPA 4BCPA 4ID7A 4YURA 4FVQA 3D5VA 4MXAA 1UU7A 1QMZA 3A7GA 3VO3A 4PWNA 1ATPE 2REIA 1PJKA 4QTCA 3RMFA 4QMQA 3BE9A 4FZAB 4DITA 4USFA 4LM5A 4B6LA 3GNIB 2OXDA 3WZEA 5CAPA 3ZS5A 1UA2A 3VJOA 1GIJA 4QMNA 2XUUA 2J90A 5BVWA 4R5SA 4EYMA 4U9AA 5DRBA 1YXTA 3PIXA 2UZTA 2PZYA 5A4EA 4TNDA 2BR1A 3JVRA 5IUGA 3R7EA 3UPXA 1M2QA 3Q5ZA 3U6HA 2W4JA 4H3BA 1FGIA 3G6HA 2UZLA 1GJOA 2PUUA 3MJ1A 4M84A 4CRSA 4I6QA 4IWQA 1W98A 3MDYA 4QPMA 4O7NA 4F9WA 3IG7A 5J5TA 1WBPA 2VGOA 2X7FA 4M12A 4J1RA 4LG4A 1ZWSA 4QTDA 3WF7A 3UZRA 2HZ0A 2ZAZA 3PZEA 3CLYA 1P2AA 2G2IA 2RFNA 4K2RA 4JT3A 3FDNA 2VX0A 3VS5A 4OR5A 4D55A 3RWQA 4O81A 4YBKA 2C47A 2YCSA 2YM4A 3EMGA 3NRMA 4FVPA 2F4JA 4BHNA 5AR2A 1O9UA 3IPHA 2YACA 4HVGA 4NL0A 1YOLA 4QYHA 2W9ZB 3FPQA 3M1SA 5HTIA 4BVUA 3O71A 4QP9A 2XIRA 1IA9A 4FEWA 3TKIA 4EZ7A 5HBHA 4AAAA 2X2MA 4FSRA 4ZY4A 3F69A 2BZJA 4EH8A 1DAWA 3AQVA 4EWHA 4ZSLA 2X4FA 3VUGA 2ITOA 1CKPA 2WO6A 3PXKA 4JQEA 5C4KA 1J1CA 2ZOQA 4FOBA 4FTNA 2NRUA 3ORNA 3ELJA 2OJ9A 4JX3A 4F0GA 4Q2AA 4G3DA 4BDIA 4CT1A 2V22A 5HLNA 1J7UA 4K0YA 2YAKA 5HNIX 4ZTRA 4RX7A 5KMNA 5KMJA 1BUHA 4RJ5A 4DTAA 2C3IB 2BTSA 2GS6A 4DG0E 2PVMA 2VNYA 1KSWA 4UMUA 2XEZA 4DBNA 3RPSA 5B2LA 3RAWA 3PPJA 3LMIA 4XV9A 4FMQA 4AA0A 4G17A 4K8AA 2I0VA 4M8TA 4LI5A 4H05A 3TM0A 4YJSA 5CEOA 4BTFA 2WMSA 2PU8A 5HORA 1WAKA 4AW5A 3JVSA 3KQ7A 3IW6A 1Q8YA 3PJ8A 2ETRA 3LE6A 4F7JA 3AC2A 4JR7A 2P2HA 1LP4A 2JD5A 3AT4A 4W8EA 3S95A 5GHVA 3SOAA 1NW1A 1SMHA 1J91A 5CT0A 5A6NA 3BEAA 2J5EA 2ZV9A 5D41A 2I0YA 3ZO3A 3C1XA 3Q6WA 4NJ3A 3VHEA 4ANNA 2DS1A 1Y8YA 2UW6A 3T9TA 4EK6A 1PXOA 4CZUA 3QRUA 4R78A 1VYZA 2OH4A 3GGFA 3U4WA 5KO1A 1NA7A 1K2PA 2XF0A 5BVOA 3Q4CA 4RSSA 1Y57A 3F3UA 3TUCA 3SDJA 3HV3A 5DPVA 5J87A 4AE6A 4C2WA 5A6OA 2HOGA 4USDA 4C2VA 2R3JA 1IR3A 4KBKA 4G6LA 2BDJA 3RZFA 1URCA 2W1DA 4MBJA 3HL7A 4I92A 4I22A 4RIXA 4BCMA 4PMPA 1CMKE 1YHVA 2VWIA 2QCSA 4FV3A 1Z57A 4FK3A 3DDPA 3OW4A 4FV1A 3WF8A 3QD0A 2BKKA 2F49A 3I81A 5CX9A 2CLQA 4UYAA 1U4DA 1ZYJA 3I6UA 4FOCA 3QTXA 3WF5A 3QRTA 1YXXA 4PF4A 4QQJA 2VO3A 4X6RA 1Q41A 1ZZ2A 5E8WA 4NZWB 5KZ0A 4PPBA 4U97A 4X3FA 2ITVA 4PV0A 5GZ9A 3DAJA 1M17A 4R7BA 5AP1A 3BYUA 3G5DA 1H1SA 3MH1A 4N0SA 4N4SA 2WMTA 4F65A 3DBDA 3ZTXA 4NYEA 2RGPA 2C6OA 4I4FA 4Q9SA 4HCVA 3Q9YA 4A9YA 2UW7A 4C8BA 2HENA 4MNFA 1PKGA 4AA4A 2WMAA 3LM5A 4PTGA 5DHJA 4G16A 5C8KA 2XCKA 4MHAA 1BI7A 1U5QA 3PXYA 4RC3A 4F9YA 4F7NA 5LCJA 2GCDA 3ZONA 4U81A 5HG5A 4EJ7A 3PP0A 2PZIA 3ZM4A 2QOLA 2WTIA 4LMNA 3NCGA 2CKQA 1FMKA 3B8QA 2VTPA 2V62A 4Z9LA 2CN5A 3NR9A 2XYNA 2ZB1A 4R3RA 4U43A 4Y72A 2QOBA 5EQPA 2IVTA 5FP5A 3THBA 2YM3A 3KMMA 4LOQA 1G5SA 1SM2A 4FKTA 1ZYCA 2NPQA 3FZSA 2E9NA 3OEFX 4IAAA 2F2CB 1I44A 4IVCA 3R1NA 4IZAA 4MTAA 4N6ZA 4DTKA 4GCJA 3FEGA 3GU4A 3D14A 1OITA 5IQFA 3HRFA 5AFVA 4X2FA 3LFDA 2WFYA 3R2YA 2Y8OA 2OH0E 5CWZA 5H8GA 5T68A 4QPAA 2R0UA 4R1VA 2VTQA 4CZYB 5KKRB 4X6QC 4JG6A 5KHXA 1E1VA 2B4SB 2QO2A 3QA8A 3ZC5A 3BGQA 4EOKA 3UBDA 2YAAA 5C03A 3DNDA 2AC5A 4Z55A 3A62A 2R0IA 4EH5A 5C4LA 4FG8A 4JR3A 5CEKA 4AF3A 4ALVA 4EEVA 3FJQE 3IK3A 4NEUA 4M97A 4D2TA 1U54B 5LCKA 3KXMA 4EHZA 4JG7A 3OTVA 3LM0A 5IA5A 2QLUA 5IKWA 2VD5A 5HX6A 5FEEA 1ZZLA 2IWIA 2XK8A 1IASA 2VTJA 4MXYA 5AIRA 5EH0A 5AR5A 3EFWA 3ID6C 2XMYA 3Q9WA 1UNGA 4O7LA 3QC9A 4BDHA 3UO6A 3E3BX 3D4QA 2X9FA 5AUXA 4BCOA 4N70A 4C37A 4DFYA 5LJJA 3FXZA 5LARA 4YTIA 4BCJA 1H1QA 4IDTA 5ANEA 4CQGA 5JGAA 1REJA 4FKOA 4OLIA 4M0ZA 4C7TA 1ZOGA 1YWRA 3BV3A 3OT8A 4TNBA 5CY3A 3PJ1A 5AV2A 2BZHB 2R2PA 3MIAA 4XG7A 4XG9A 3D5WA 3MA6A 4NFNA 5EM8A 3QTZA 5FXSA 3CR0A 4FV6A 4RRVA 4GG5A 3SRVB 3QCXA 2YM6A 5A4LA 4EONA 4HNIA 4EOSA 2F7XE 4C61A 1CKIA 5IQAA 1PF8A 1GAGA 3QX2A
chains in the Genus database with same CATH superfamily
5HVJA 2HW7A 2HXQA 2O3PA 3HEGA 4JX7A 4C58A 3QQGA 4XOZA 5E90A 1A9UA 1XH5A 3F3TA 4WUNA 3CJFA 3LCTA 3TMOA 3GT8A 2V0DA 3UOKA 4YSMA 4F4PA 5CSHA 2W17A 2WQMA 4S34A 3OCBA 4F70A 4HVIA 4NM5A 2JAMA 4OAUC 5DT4A 2XALA 3TJDA 4OTRA 3P9JA 4QYFA 4WUAA 5H9BA 4D4SA 4QYEA 2ONLC 3BZ3A 2A2AA 2P55A 4C36A 4FTCA 5BUEA 2QQ7A 3NFFB 2PPQA 3TNIA 1XJDA 3UOLA 3QD2B 4MEDA 2GPHA 4HJOA 3PG1A 5AADA 1PYEA 4CFVA 3DBCA 4EQUA 4DDIA 2NNWB 3W8QA 4E6QA 5E92A 4DINA 2VX3A 4RJ8A 2I7QA 5IA3A 4U80A 2IPXA 4OTPA 3RALA 2ZV7A 4FI1A 4FKUA 3ZLYA 4J96A 4PL5A 2PYWA 3O5AA 1R0PA 2PZRA 3UO5A 2H8HA 3FI2A 3NGAA 1DAYA 2VX1A 2YERA 4QP8A 4OTQA 4I5MA 3WOWA 5IA2A 4ZTSA 4D58A 5AIKA 4G3CA 4B4LA 3LFFA 3EKNA 3BBTB 3H9FA 3O0GA 1KOBA 3ZCLA 2PL0A 4IVAA 3PG3A 4FSTA 3KU2A 2X8IA 4TYIA 4L00A 5D11A 3TDWA 4YTCA 3MB6A 4CMTA 5IMXA 4EC8A 4LGHA 1W84A 3KXNA 3QTWA 4XYFA 4XRJA 1H0WA 3RBWA 4O7VA 2Z7RA 4TY1A 4QQTA 5I9WA 4AW0A 5D12A 3GC0A 3CC6A 4ACDA 4FV8A 5EG3A 3LCOA 2OK1A 3Q9ZA 2XNOA 3EN4A 3EYHA 3TZ9A 4V04A 3CPCA 4QP6A 4HVDA 4CG8A 4BB4A 3NVMB 3PUFC 4ASDA 5GNKA 2BAQA 3VS3A 4CG9A 4XCUA 3RVGA 1OI9A 3GCVA 4JDKA 5F94A 4X7QA 3V5QA 5A54A 2GTNA 3A7HA 4L8MA 4OTGA 5TT7A 1WVYA 1STCE 4AGUA 4QMOA 2OWBA 3E93A 4U6RA 3FZ1A 3DLSA 3NNUA 2WIHA 4TYJA 3R8VA 1G8AA 4BWPA 3QRIA 2CPKE 2IVSA 5AA9A 1ZOEA 1QPCA 3S00A 3IO7A 4ERKA 3MPAA 3IQ7A 1XQZA 4TW9A 4C4JA 1U59A 3F7ZA 5HIBA 3CTQA 5G6VA 4WG5A 4G9RA 3HLLA 3R6XA 5EOLA 3PE2A 4RIYB 3FY0A 2WMVA 3MGYA 3OWPA 1SVEA 4BKYA 4DGNA 3FI8A 5C27A 2YLEA 3PWYA 4BJJB 5EYDA 2QC6A 2BKZA 5L6WL 2X0GA 4XP0A 4FKVA 3QAME 3QRKA 1OGUA 3PDTA 4Y85A 2B9JA 3KMWA 3AC5A 4R6VA 3PZHA 3NAXA 2JFMA 4TKSA 3UDBA 2UW5A 4O1PA 3MV5A 5JN2A 1MRUA 3BQRA 4UMQA 3F2NA 2YDJA 4EYJA 4DTBA 2OGVA 2VWXA 5CASA 2HW6A 2WOTA 3ZHPC 3QXPA 4OBQA 2UW9A 4W4YA 2BVAA 3OD6X 4ZSJA 2Y6OA 4JXFA 5KMMA 4D4VA 4S33A 2Y4PA 3DTCA 3QD3A 4YU2A 2RG6A 2X0OA 4YO6A 3TNHA 3C7QA 3W18A 2W5BA 3AC3A 2YJRA 4GIIA 1QPDA 1ZYLA 2VGPA 4F7SA 4UALA 1TQPA 3UPZA 2BDWA 2ESMA 4BCQA 2C5YA 3FZOA 3AKKA 3GOPA 5EI8A 1JSVA 3PUPA 3EQDA 4XHKB 4C4HA 3QUPA 4RJ7A 2I0EA 4HYIA 2GHMA 2GS7A 3AGMA 3NUAA 4WBBB 2F7ZE 2PHKA 4G5PA 5J7HA 3O23A 5L2TA 4YZNA 1XHAA 2R3RA 3FY2A 4TXCA 5HOAA 4CT2A 1ZARA 3S4QA 2HWPA 1W83A 4I5PA 1U46A 2GQGA 4RFZA 3RZBA 3R8MA 4AXFA 3UIBA 5H8BA 1WBOA 2VNWA 3I5ZA 2KTYA 4H1JA 1HCLA 3LQ8A 4GU9A 3JR1A 3W33A 3MVHA 1OVEA 2Y4IB 3RHKA 4PNIA 3MWUA 4X2JA 3MN3A 4DLJA 4YR8A 5KHWA 1Z9XA 4USEA 1M7QA 4U5JA 4PTCA 3NNXA 3ROYA 1LUFA 4JJRA 2EXCX 4CKIA 3V8TA 3AC1A 5A4QA 3G6GA 4QD6A 1XBBA 4AXCA 4M68A 1PMVA 2FSMX 3VWAA 4DH3A 5J95A 3NZ0A 3TTJA 4AZVA 4FNZA 4Z7HA 1OIQA 1DM2A 2OJFE 2XIZA 4PMTA 4O96A 1YDTE 5D9HA 3ATSA 3F7WA 5FTGA 5HVKA 4XLVA 5E8YA 1OKVA 3QUEA 5M4FA 2HY0A 3EN6A 4I94A 1PMNA 3V3VA 4Z3VA 4GG7A 3QWJA 4YJUA 4D4RA 1WBTA 3LMHA 4GJ3A 4XX9A 2XK4A 3KRWA 5LVLA 3SAYA 2GQSA 1QPJA 2QU5A 3FYKX 2R4BA 5AAGA 2CNVA 3F5UA 4JBPA 2IZSA 3VS1A 4B8MA 4MK0A 1H08A 5I9ZA 4D28A 4O4FA 3FLZA 5BNJA 4YJQA 3R9HA 2Z7LA 2BIKB 3MPMA 1U5RA 2QURA 4QQ5A 2Y7JA 5L8JA 2FSOX 4XRLA 1CKJA 5TR6A 2WXVA 3OT3A 4LGDA 5FXQA 3HVCA 3VN9A 5D7AA 4LGGA 3EN9A 4MD8E 5ANJA 4O4EA 3TIZA 3R30A 5JMSA 4E5AX 1PXKA 2PZ5A 5AX3A 5IQGA 3F6XA 1W7HA 3LQ5A 1G8JA 3VHKA 3LXPA 5A46A 2OW3A 2VTSA 4YJVA 3MH3A 3VBQA 4E5WA 2ZB0A 2X7GA 5ANDA 1ZMUA 4ZSAA 5JK3A 4NCTC 3N4VA 1R3CA 1JLUE 4L42A 2BHHA 3ODYX 5CU3A 3NW5A 5IDNA 3IDCA 3P7AA 5IQIA 3F9NA 2XM9A 3QKKA 4BCHA 4CFFA 4C4GA 1XMLA 3TUCA 2O8YA 3EJ1A 4QP2A 1FVVA 2XKEA 1YKRA 3OWJA 4QPSA 1Q62A 2QHMA 1FINA 3CEKA 3EL8A 5BVEA 4AT3A 2CN8A 3BCEA 3KF7A 4AUAA 4XP3A 3HAVA 2FYSA 2O2UA 4E8AA 4U79A 4RX8A 2VTRA 5E91A 4DCEA 4JAIA 4FE2A 3C0IA 3BHTA 3FKNA 3QZFA 1H4LA 3F61A 2BAKA 3BE2A 3R1SA 4FKPA 4KINA 5FM3A 1CSNA 4LV8A 4PDSA 5JT2A 1BL7A 2J51A 3QYWA 5D7VA 3W1FA 4YNEA 4L3LA 3KCFA 5FBNC 3AT2A 4UXLA 3UTOA 2C0OA 3P78A 4U41A 4D0WA 2X9EA 3UODA 4DH1A 5LWNA 4EH3A 2OBJA 4FKRA 2FH9A 3FSKA 3SD0A 4Y5QA 4EQMA 4O7SA 3PXRA 2UZWE 2Y6MA 5AEPA 3S1HA 3OS3A 4J7BA 3DBEA 3GVUA 4EOIA 3ROCA 3TZ8A 2DWBA 4B8LA 1OBGA 4FIEA 3BYVA 1IA8A 5CF8A 2PUPA 1UWHA 1F0QA 3DAEA 4IJ9A 2H96A 1LEWA 1CM8A 3HMMA 3QUDA 2I6LA 3GCQA 3MB7A 4G31A 4KSQA 4NUSA 4XBRA 4PDPA 2IG7A 4O82A 5FUTA 4K1BA 3AD5A 4IHPA 2C0IA 3QQKA 4M7IA 2OIDA 3EB0A 1G8SA 5I9VA 4DA5A 3T8OA 1NVRA 2OJIA 4FF8A 4X0MA 2ITWA 5IISA 2RSVA 2QG7A 5GJGA 3VONA 3II5A 5M07A 2UZDA 3LQ3A 3KXXA 3C4FA 2ONLA 5K0XA 1OL2A 3DDQA 3V6SA 4FGRA 4L67A 3CS9A 2ITYA 1SNUA 3EFJA 4GFGA 3V5JA 3VNTA 5IG1A 4XV2A 1YVJA 3O8UA 4IAFA 4O4BB 1O6KA 3BLRA 1MRYA 4G5JA 4EUUA 3OOGA 3L9MA 4ASEA 4KD1A 3NS9A 4CFMA 4F0IA 3NEWA 1TKIA 5LVMA 3BLQA 2BRBA 2HELA 4MWIA 1AQ1A 4PL3A 3LOKA 5HICA 3H0YA 2VWWA 2ETKA 4RC2A 4ACGA 2PE0A 4F64A 1W0XC 4W8DA 2ITXA 4C02A 4FT5A 4J8MA 5CI6A 4F1MA 2CKEA 4ANOA 5HZNA 3PRIA 4G9CA 2QOIA 3VBWA 4FX3A 3R83A 5TOZA 1S9JA 4OGRA 5AMNA 4D2SA 3FHRA 4RQVA 3PVWA 3IECA 3LFAA 1RDQE 4FSYA 4JIAA 4BYIA 1M2PA 5EYMA 4FA2A 5DVRA 5M4CA 1PKDA 5DR2A 3PSDA 2QOCA 3MH2A 4I6FA 3LFEA 3NAYA 3MH0A 4Y95A 3QC4A 4C3PA 3PE1A 5HE1A 1DI8A 3F5GA 2YABA 4C4IA 5J79A 3W0SA 1WBVA 1X8BA 5GZ8A 5EW3A 5ETIA 3U87A 5HO7A 5EW8A 3FZRA 1OKWA 5L8KA 2JBPA 4FV5A 4AGCA 3FMNA 4JBQA 3BHHA 1OL6A 1Q8UA 4EZ3A 4R3CA 1KE8A 4DEBA 3VS7A 3ZFYA 3NNVA 5A4CA 3LFQA 4O7ZA 4FSWA 3I6WA 4RWLA 5HCYA 3BX5A 4AZFA 4LL0A 3GUBA 4BF2A 4EH7A 1F5QA 4D1XA 4NW5A 2DYLA 3IW8A 3BHVA 1EH4A 1H1RA 2XJ0A 5AUTA 1ZMVA 2G01A 2WTCA 4FTOA 1BL6A 4RLLA 3QD4A 3ORTA 5BUIA 4IZ5A 3ZFXA 2P2IA 4FC0A 4FKJA 3CP9A 4KBAA 4O0RA 5AR8A 4UB7A 4WD5A 5FEQA 3O17A 3R21A 5L2IA 3GBZA 3CQEA 3AKJA 2QOOA 3VAPA 3DK7A 3NWWA 4FTMA 2J0IA 2P33A 2PVNA 4IAYA 5F95A 4C59A 3QL8A 4IWOA 3R8LA 1H07A 3FKOA 3UP2A 5L2WA 5EW9A 3UVPA 3PVGA 3V8WA 1GY3A 3V5LA 3JXWA 4AFEA 4CCBA 3Q6UA 5M55A 5DRDA 3W2SA 3KA0A 4TYHB 4ZLYA 3B8RA 1FVRA 3CQUA 4UX9A 1H1PA 4FUYA 4KIPA 4ZIMA 3LZBA 1YOMA 2ZM3A 4O0XA 3AMBA 4QNYA 2CKPA 2Y9QA 3PA4A 3DB6A 4ZTNA 3KGAA 3CBLA 1OL5A 4MD7E 5HU3A 4V05A 3DBFA 3UYTA 3NVKI 3TNQB 3AD6A 4OTHA 4IVDA 3R9NA 1B39A 2XM8A 1H00A 1B6CB 4FZ6A 3TTIA 4BR3A 4PP7A 1XH8A 4FEUA 5EQEA 4GYGA 2V7AA 3EZRA 3DB8A 3QALE 4EHGA 4YPDA 3UGCA 1IAHA 2QD9A 1V0OA 2W5HA 3IS5A 4BZNA 3FLQA 4FTRA 2R9SA 4D2WA 2I1MA 4IANA 4M67A 4KA3A 3COIA 2BFYA 2C4GA 3QTIA 5ETAA 4X2GA 3MVMA 5GINE 3KULB 5BUJA 3RAHA 5AP4A 1XH7A 4M3QA 5EHYA 3ETAA 4GU6A 4ZJVA 3ZSGA 4FTLA 2XB7A 5CU4A 4L7SA 3TZMA 1GZOA 2PVHA 4U3YA 4G2FA 3KRJA 3MA3A 3ZOSA 2R7IA 3K5UA 3LXLA 4YLLA 3TV6A 2PUIA 5CAVA 3PRFA 2XK7A 1MQBA 2G15A 4APPA 4ZP5A 2FSTX 4E4XA 4E73A 4BDKA 1SYKA 3JUHA 2X81A 3D7TB 4IMYA 3ZSHA 5AR7A 2G2FA 2GMXA 4L46A 1OPJA 5GJDA 4EH4A 4ZSGA 3ZH8A 3M2WA 3IW5A 3W8LA 2JBOA 4ANSA 5M51A 3F2RA 3VJNA 4C62A 4EOPA 3R22A 4WSYA 4PNKA 4TT7A 2UW4A 2UVZA 4JS8A 5CANA 2JDOA 3BV2A 3GP0A 4I5CA 3EIDA 4MH7A 4ACHA 4BWXA 5CF6A 5A14A 2IVUA 4IX3A 3ZZEA 5FBOA 3R28A 5EDRA 5HNGA 3P5JC 2J50A 3TG1A 2G1TA 4E93A 4DFLA 2PZPA 4O0SA 2Q83A 1ND4A 2C68A 1IG1A 2IVVA 2IZUA 4I21A 4DG2E 3QGYA 3EWHA 3CGOA 4FIIA 3DJ5A 4FV4A 2CNUA 4C38A 4TWPA 2WMWA 3TWJA 4GVJA 1H1WA 3FHIA 3NSZA 3M11A 4GKIA 2JKOA 5H8EA 2BRMA 3N4UA 4MYGA 3OHTA 1XWSA 4O38A 4AW2A 4F9BA 4O7WA 2PY3A 4NIFB 3KIOC 1PXPA 4I24A 2QO7A 5KZIA 3RGFA 1H27A 5AP6A 4CV9A 2Y0AA 4DFBA 4QDVA 2CCIA 3LCDA 4OUCA 4YLJA 4YTFA 2YM7A 1UKHA 5M53A 4CFXA 4Y5HA 4PDYA 1H01A 4EL9A 3DS6A 3ULZA 3G90X 3O7LB 3P1AA 5HTCA 5M56A 1KE9A 3OZ6A 4F6UA 1KUTA 3BL9A 5E8ZA 4UXQA 4BGQA 1UVRA 3EN7A 4V0GB 4WRGA 4ZEGA 5GIOE 2ZMCA 3ZSIA 4KKEA 2WQEA 3HV6A 3ZBFA 2VWYA 5K5XA 4O0YA 3FMJA 4MAOA 4TRLA 3WILA 3AKLA 4EK5A 4ALUA 3PLSA 3OWKA 4J95A 3KCKA 3PP1A 3C4XA 4KS7A 2YZAA 4RVLA 5EHLA 1ZAOA 4GSBA 3FC1X 4EJNA 3AMYA 5M44A 4ZJJA 1T46A 3P7BA 4G34A 2PVFA 3MS9A 2UZVA 1PXNA 1KE5A 2JDSA 3I0QA 3ALOA 3MSSA 5JRQA 2DUVA 3PXQA 5CVFA 1YI6A 5DMZA 3C9WA 1BI8A 3NNWA 2R3IA 3GI3A 3O8PA 4MX9A 4NCTA 2XK9A 4GH2A 4DEHA 3DKCA 4G3GA 5HTBA 1JAMA 2HZIA 4L52A 2WQOA 4NJDA 3GQIA 5EYCA 2Q0BA 4I0TA 2QOKA 4O7YA 4X21A 3V8SA 4X3JA 5DWRA 3FXWA 3E7OA 4IEBA 4LMUA 2GTMA 4M14A 2RFEA 3C5UA 4YLKA 3OXIA 3ATTA 1OKZA 1YQJA 1Q97A 3UOHA 3FL4A 2YIRA 4EOMA 1ZOHA 3A8WA 3MIYA 3HRBA 4K11A 1L3RE 2AUHA 3A61A 4KIOA 4Y46A 5JZNA 4XOYA 3QTUA 1P5EA 1JQHA 2HY81 3FPMA 3FMLA 5IDPA 4IDVA 4JDIA 4Q9ZA 3DBQA 3OROA 3EQRA 3MFSA 5M09A 3DJ6A 2WOUA 2F9GA 2QI8A 4RJ3A 4GMYA 2VTAA 2CNQA 2PVKA 3FC2A 4HZRA 5CNNA 1OL7A 3RP9A 4CGAA 5BX0A 4MXZA 2B54A 4FKIA 3A4OX 4QP4A 2UZUE 4KSPA 2WTKC 1FPUA 3AGLA 1MRVA 3U4UA 2Y4IC 3BGZA 4RMZA 4ASZA 3ML1A 2RIOA 2A19B 2C30A 4E20A 4EK8A 4FSQA 3R9DA 1KV1A 4YZCA 3U9CA 2BRHA 4AA5A 3FSFA 3ZEPA 3OEZA 3LW0A 2HZ4A 2R3OA 4QTBA 3FMHA 3I5NA 4F9AA 3BU6A 3UVRA 3ORKA 2QVSE 1FMOE 5DR6A 2OF2A 3KC3A 2XH5A 3QHRA 4O2ZA 2G2HA 3F3VA 3OXZA 1OM1A 1BX6A 3ANQA 3DXQA 4JL9A 5DOSA 1WBNA 4E6CA 2FSLX 3IGOA 5JFXA 3JPVA 5DGZA 3COKA 2B52A 3BL7A 4D0XA 3L8SA 3OW3A 1Q8WA 5DT0A 2YZLA 2R3MA 5CZHA 1OUKA 1RJBA 3R00A 3BYMA 5GJFA 4C3FA 1YXUA 3TN8A 4KUJA 5H2UA 4WKQA 4M66A 4C34A 5DA3A 2R5TA 5HEZA 2NO3A 4A7CA 4PUZA 2CGWA 3G2FA 3H3CA 1KE6A 4E3CA 4J99A 4FG9A 4DEGA 5DEYA 5HG7A 3MW1A 4CMOA 1JKSA 2BTRA 2VO6A 5AV3A 4DH8A 3QQHA 2YDKA 2XKCA 4RG0A 3R7GA 2OF4A 4L53A 4CFUA 3KXHA 2O65A 1ERKA 3QZGA 4ZY5A 4FGBA 4UEUA 5FRIA 3IW7A 3VUTA 3F5PA 4IQ6A 2E2BA 4W9WA 2C5NA 3GENA 2RFDA 4XG2A 4HYSA 3UC4A 5HD4A 4CRLA 5GIPE 4FEXA 4XG3A 4FYOA 3C51A 3WZDA 4BIEA 2A27A 4GK3A 3UMXA 4FEVA 5BYLA 3FQHA 2JC6A 3DLZA 3R8ZA 3DK3A 1UKIA 3W16A 2H6DA 5AP5A 5IZFA 1A48A 4U0IA 4F63A 1I09A 4DH7A 4QO9A 4EBVA 3GC7A 4RA4A 3R04A 2UVXA 1U54A 2EU9A 2PMLX 3VC4A 3TUBA 4D5HA 2WD1A 4ZZMA 1V1KA 3BYOA 5D10A 5BMMA 2JKMA 4DFXE 2OJGA 3E7VA 5J8IA 4GFOA 5BMSA 5AX9A 3ZMMA 1LEZA 2XBAA 4IW0A 4YBJA 5CAOA 1P14A 2JAVA 2YM8A 3KRRA 3Q04A 3R7VA 3ZUUA 3H10A 2FGIA 3FZTA 5KMOA 4QNAA 4G3EA 4FL2A 2VO7A 4U44A 5B0XA 3NPCA 3TCPA 1MP8A 2ZM1A 3UJGA 4BFMA 1NVQA 3ORPA 5AR3A 3SKCA 3L1SA 2W1ZA 4FKQA 4RJ4A 2J6MA 3G51A 3FKLA 3KEXA 5ICPA 5KBRA 3EN5A 2OSCA 4AN2A 2NYAA 3SRVA 4TZRA 2C1AA 2EUFB 4K9YA 5E7RA 3FQEA 4BWKA 5M08A 4OTWA 4ANMA 1PXMA 2XP2A 4RX9A 3W2RA 4BIBA 3K3IA 4EOJA 5DR9A 4ZTHA 3OBJA 3TV4A 2WMQA 3BPRA 3DFCB 5IMEA 4I6HA 3I60A 1YW2A 3OVVA 5CQUA 1OPKA 3PA3A 5ANGA 5AV0A 1FGKA 4MQ1A 4CSVA 3F88A 3R71A 3N9XA 3OCTA 2X2KA 3WBLA 4W4WA 4BZOA 3A7JA 4IBMA 3E8NA 2FO0A 3C5IA 2ITZA 5L2QA 2VTIA 4AZEA 4O7TA 3PIZA 1BKXA 3RPRA 3E3PA 3RM6A 2CKOA 4FL1A 4RIWB 4BCFA 4IWPA 1YDSE 2YIYA 3R02A 4IWDA 4MF0A 4AZWA 3UQCA 2HAKA 3W0RA 2EWAA 1PXLA 3BI6A 2X8DA 5J9ZA 2KULA 1ZXEA 2YFXA 2X6DA 4TWNA 4YHFA 3DOGA 3UQFA 3O50A 4ZOGA 3TNWA 4KNBA 3JY9A 4FICA 4L9IA 3D2IA 3PVUA 1VZOA 4PMMA 3MY5A 4QOXA 4IAZA 2YM5A 3W2OA 2B53A 4YJOA 3Q2JA 4OBOA 2GNFA 4U40A 5B2MA 4DEDA 4B0GA 5E9EA 2OFVA 5LQFA 4IC7A 4ARKA 3RKBA 4IADA 2WU6A 3F2AA 1JPAA 4GK2A 4IM0A 4WNOA 3HV4A 4A07A 3TUDA 4HNFA 5CVHA 4FTTA 3GC9A 2EB3A 4I93A 3CQWA 4IB3A 2BIYA 3FYJX 3RPYA 1TQMA 3GCUA 2WELA 4LRJA 3R7OA 3EHAA 3GXLA 5BQ0A 4FIGA 4O4DA 1PY5A 4GT3A 4FVRA 3NCZA 3BQCA 3LHJA 2R3FA 3ORMA 3BHUA 5IEXA 2JDRA 4FT0A 3RNYA 4AOIA 4OTIA 4YC6A 4CEGA 4IIRA 3LFCA 4OT5A 4Y83A 4II5A 4RVMA 2BZKB 2OZAB 3C0HA 3RNIA 2QKRA 3ZLWA 1VLRA 1XKKA 4NFMA 5IEYA 3DA6A 4IX4A 1WMKA 3DTWA 3Q52A 3HRCA 4WA9A 3SOCA 5I9XA 5KMLA 3V5WA 4AXDA 2PULA 5HLPA 4ZZNA 3UNJA 4DDGA 5HIDA 3E8CA 3VUMA 4RT7A 3CPBA 4CLIA 1W82A 2UZEA 2Z7QA 3DGKA 1M7NA 5IH6A 5CF4A 3VW8A 4E4NA 2HK5A 2C5OA 5I9YA 3MY0A 4EHVA 3FLWA 4BL1A 5IQHA 3LAUA 3BLHA 4BDEA 1JKTA 2A0CX 5AM6A 5KX8A 3A2CA 2ZV8A 4BCGA 3GOKA 4QQCA 1Q8TA 3E8DA 1K3AA 4I23A 4R8QA 2R3PA 3Q60A 2UUEA 4RIYA 1JKKA 3ZDIA 2W9FB 1L8TA 3JY0A 2RKUA 4YZ9A 2PMOX 5CALA 3OWLA 4LDTA 5AWMA 2YN8A 3LFBA 4ONAA 4BJJA 4DFZE 5CXZA 4H36A 5T3QA 2ITTA 3RINA 5BVNA 3AG9A 3EOCA 4I6BA 4P90A 4XBUA 1JOWB 3QTSA 3DZQA 5HCXA 4HPUE 4FV9A 3ZUTA 4QMVA 3ZDUA 3HMIA 3VS6A 2QOFA 3KREA 2WTKB 2C6TA 4WIHA 4BZDA 1H26A 5IEVA 4IZYA 4BDBA 4K18A 2WZJA 5EYKA 4PPCA 1YDRE 3CKWA 4WRSA 2OZAA 3SA0A 4YNOA 4UN0C 5AV1A 4QMTA 2Z8CA 4BKJA 1JKLA 2W1IA 3G9NA 3V6RA 3V51A 4ACCA 3DK6A 2GNJA 1KE7A 2UW3A 4DCAA 2JIIA 5HI2A 1V0BA 4BDFA 1HCKA 5A4TA 1YWNA 2XKFA 5BVKA 4G1WA 5F1ZA 4CMUA 2B1PA 3L9LA 4JOAA 3OG7A 2PE1A 2HCKA 4UMPA 4OTFA 3KXZA 1B38A 4XJ0A 5ANKA 2VTNA 3EQBA 4U42A 5HNBA 3UNZA 4EI4A 5J1WA 4L6QA 3OUNB 2AYPA 3A7FA 4QP3A 1XMMA 5KUPA 2QOQA 4UWCA 5C9CA 5HQ0A 3R9OA 2VWZA 2A98A 2BALA 4I20A 4GVAA 1W8CA 3OY1A 3QYZA 5FQDC 1SZMA 4DF3A 3VUDA 2NP8A 3POZA 2XKDA 4CYIA 4PQNA 1FVTA 2IW6A 4M13A 4MNEB 4G6NA 3GB2A 4BI1A 5AP7A 4D2RA 1YXSA 2GQRA 3H0ZA 4JBOA 5DNRA 4BCKA 4KRDA 2OIQA 2XNBA 5HCZA 4E7WA 3CKXA 4BBFA 3DAKA 3EFKA 3NYOA 3WZUA 4FKSA 4TPTA 3QFVA 3W0NA 5CTPA 4F08A 4UY9A 1UU3A 2XRUA 1YHWA 2YDIA 3NIEA 5CQWA 4H3QA 4QYGA 1O6LA 2GDOA 3WI6A 2GSFA 5BVDA 3VQUA 4FYNA 4IFGA 2GS2A 5CXHA 4L44A 3VS0A 4EH6A 4ZTMA 4ENXA 1PRYA 1S9IA 4FL3A 2C5XA 4L45A 3COHA 4DC2A 3W0OA 4WHZA 4TL0A 3C0GA 3KB7A 1ZMWA 5L3AA 4E6AA 4RWIA 3C4CA 3KXGA 4DFUA 5F20A 3QWKA 3SGCA 3MVJA 2XCHA 3G9LX 5ETFA 2UZNA 5D1JA 4FBXA 3ORZA 2X0PA 2YITA 3BKBA 3BIZA 5FEDA 3RCJA 2R7BA 4H58A 2C3LA 3WE8A 2Z02A 4D9UA 3HUCA 3F3ZA 4YGAA 3ANRA 2IW8A 3VVHA 3TL8A 5IH5A 5JGDA 3G15A 4MBLA 3ENMA 2B9IA 4IM2A 2OI4X 4ZJIA 4DGOA 3KRLA 3OXTA 1OMWA 4MNEA 4AGWA 5AJQA 2J0LA 2WMXA 4NT4A 4DAWA 2X1NA 4UZHA 2F57A 4P2KA 5BV3A 2ERZE 3PPKA 4Z16A 3FMMA 5C01A 3ACKA 4LOOA 5L6OA 2HZNA 1R39A 4JQ8A 2PE2A 4BDDA 1H25A 1Y8GA 4CXAA 3OBGA 4NU1A 4IXPA 1VYWA 5FDXA 3DY7A 2EB2A 3NYNA 4UWYA 4AW1A 4CVAA 3LCSA 2OU7A 2OICA 4YC3A 3CY3A 3GCSA 5AP0A 1Y6BA 2YWPA 2VRXA 4XNEA 2JIUA 2PMIA 3Q4TA 5HE0A 2WMBA 2NRYA 5JSMA 3VS2A 4PPAA 3O7LD 4FTJA 4NM0A 2YWVA 2HWOA 3EZVA 4O22A 1P4OA 2WHBA 2W1CA 2YIXA 5DI1A 4BTKA 3BGPA 4CQEA 3BLAA 4QMMA 2V55A 4UMTA 2YCRA 5EM5A 4F1OA 1XBCA 2ZMDA 4PRJA 2OXYA 3LLTA 4TWCA 2YEXA 2X7OA 2JLDA 3FBVA 3HP2A 4ASXA 3I7BA 5FLFA 1OBDA 3QHWA 3C4EA 3FUPA 2XAOA 5E4HA 3CE3A 4PMSA 4F6SA 3WF6A 1FBNA 1J3HA 2WEIA 1REKA 3K54A 1SNXA 3MYGA 3P7CA 4OT6A 3QCSA 3V04A 3ZXZA 5EKNA 2R3KA 5DLSA 5K4IA 3LJ0A 3H9OA 3RPVA 1PXJA 3EYGA 4GJ2A 4BDCA 5LXMA 3HAMA 1OKYA 3BELA 2QLQA 4HCTA 5CAQA