3BV3A

Morpholino pyrrolotriazine p38 alpha map kinase inhibitor compound 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
338
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and SAR of new pyrrolo[2,1-f][1,2,4]triazines as potent p38 alpha MAP kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 101
structure length 338
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bv3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bv3A01
2VAGA 1UNGA 3PE2A 5IQDA 2HCKA 5CSHA 3FJQE 3KGAA 3A4OX 2QD9A 3DKCA 4Y5HA 1BX6A 4QMMA 1Y6AA 2W1FA 3HA6A 3V5TA 4N57A 2Y4IC 3L8XA 3ZBFA 4CFUA 2FVDA 4M8TA 1MRVA 4O22A 4DBXA 4BTFA 2J51A 2XK7A 2GHLA 4TWOA 3A7IA 2REIA 4J98A 5EW9A 3FLZA 2QO7A 3LCSA 4FSUA 3PZHA 4TNDA 3W55A 4I23A 4JR3A 1J1CA 1XH4A 4YUQA 4FSYA 4NKAA 3ZUVA 2EVAA 2X2KA 5GZ8A 3R00A 1Z9XA 2UV2A 4OW8A 4PQNA 2C6EA 4EOMA 2R2PA 2WD1A 4LL0A 1Q4LA 4BCKA 3RK7A 2C6TA 4MWHA 4OAVB 5JSMA 3N51A 1WVYA 3K5VA 3NYOA 3ORLA 1V0PA 4X2JA 4F7SA 2UW8A 3WI6A 2BZIB 3QKKA 5ACKA 5DG5A 3RPOA 3F69A 4D1SA 4YHTA 4ASXA 1OL2A 4GFMA 4O6EA 4AZWA 5KMOA 4ZZNA 3KF7A 4WNMA 3FXXA 4A9UA 3AC3A 2VGOA 1K2PA 4JI9A 4O6LA 3VC4A 5EKNA 5E4HA 2YACA 4IX4A 1YI3A 4IZYA 2EUFB 4L3PA 5HGIA 2WTKC 4OTGA 3WF5A 4GFGA 3ZDUA 3MB6A 4JNWA 4EZ7A 4CFNA 5BVWA 5DBXA 4IAKA 3TJCA 2C6MA 4FT0A 5CU0A 4R1VA 2C0OA 4GKIA 5CXZA 1Y57A 4TYGA 1ZMUA 4MD8E 3V8SA 4BDKA 3LW0A 5F20A 2BRGA 3CP9A 3GEQA 3MFSA 4EBVA 3ANRA 3UTOA 3ROYA 3QTSA 3VIDA 3VWAA 3R7IA 4KINA 1MUOA 4WSQA 5J1WA 2NNWB 3DAJA 5ANKA 5ETIA 3HLLA 3VS4A 2YM6A 3OWLA 4U5JA 3ANQA 3EQHA 2XS0A 3Q4CA 3Q53A 3QTZA 4FTKA 4KIPA 1YI4A 4NTSA 4Q2AA 4BZOA 3PY1A 4EK3A 3HUCA 4PRJA 4E3CA 5GJFA 4O0VA 3KL8A 4OTQA 3VJNA 4DGMA 3FQSA 5HLNA 4KBAA 4R5SA 2PUPA 2YIWA 1VZOA 5HE0A 5IKWA 2VNYA 2XH5A 3CY3A 1YXUA 2BMCA 4EOKA 4QMWA 2JAVA 3COIA 3V01A 4PY1A 2R9SA 3CKWA 1P4OA 3D5XA 4PPAA 5JK3A 4FYOA 2HIWA 1OKVA 3CTJA 3UZRA 2BZJA 4GT3A 4V01A 3UQFA 4FBXA 2R4BA 3COMA 3RI1A 4FZDB 4A07A 3IW6A 3L9LA 2BDFA 1KUTA 4L01A 4IB3A 2OXXA 4G2FA 4XV3A 3UMWA 4EKKA 4CXAA 3IOPA 4I6BA 2WMSA 3RJCA 4Z7GA 5J5TA 5KMLA 2NRUA 4FYNA 2YZAA 5LVOA 4O7TA 5M09A 2PMLX 3FZOA 3G6HA 3U9CA 3VUMA 4MXCA 1WBWA 3OY1A 4O0XA 4I93A 5DRBA 3W2RA 3WF9A 1FVRA 5KBQA 3FLNC 2YM7A 3GVUA 4KB8A 4ITJA 4LV5A 3ZSGA 4C4FA 5IU2A 5K0KA 4OR5A 3FYJX 2F7EE 2H96A 4FG8A 4YJPA 4ZTSA 2DQ7X 5HCZA 4F6SA 3MV5A 2J2IB 3RVGA 3H10A 3LXLA 3KN5A 3LXNA 1H07A 4Z16A 3F2NA 1R0EA 3M11A 3BYVA 3R7VA 1UNHA 3CJFA 3FQHA 1XJDA 1J91A 3EN9A 4AGCA 4EOLA 5LOHA 4EH2A 3QTRA 2QC6A 2QOIA 3R9OA 3QCQA 4BCHA 4LRKA 3PVGA 5D12A 4C4HA 4R1YA 2OF2A 2PZRA 3LQ5A 4FTMA 3BLRA 4XLIA 4OGRA 5J9ZA 4J8MA 4EH7A 4RGJA 3JY9A 4O0SA 1H27A 3VBTA 4NCTA 4I94A 4WHZA 3JR1A 5IEXA 1SZMA 3F7WA 3NNVA 4B9DA 4HVGA 3TI1A 2VWUA 3SLSA 1OVEA 2JKMA 3RWPA 2BILB 2VTSA 3AT3A 3ORZA 5TF9A 3EQIA 1K3AA 1OIQA 3DBEA 2FA2A 3ENMA 2QURA 3VUKA 5GZAA 4G3EA 3WZDA 3IW7A 3BHTA 4W4WA 4FNXA 2C6IA 3RCJA 4FNYA 3FMKA 5GIPE 2GU8A 2PU8A 3I5NA 2PWLA 4FTAA 4O86A 4QOXA 3LFAA 3FZRA 3QQGA 5LJJA 4P90A 5DT0A 5E8SA 4C4EA 2CNQA 2IN6A 3UC4A 1JKLA 3CQEA 3KCKA 4E6DA 3KK9A 3BYUA 4ZY6A 3W33A 2J0MB 4QP9A 2RFDA 2O8YA 3I6WA 2CNUA 2C1BA 4BDGA 4L46A 4B0GA 4UMTA 4DFNA 4MEDA 3ZM9A 5LMBA 3BRBA 2RF9A 3QLFA 4EH5A 3NWWA 4YBJA 2DWBA 3E8DA 4R3RA 4YZCA 2YCQA 3QZHA 2B1PA 3EKNA 3D5UA 4MVFA 5D11A 3PXYA 3A4PA 2VWVA 5F94A 5I9ZA 4FEVA 2BDJA 3QRJA 4C7TA 3GOPA 5IA0A 5JH6A 4ALUA 3F61A 4L9IA 4CGAA 5JGDA 4I3ZA 2ESMA 1BL7A 2YHVA 4H05A 5EW3A 4BCFA 2UW4A 4MXYA 3DBDA 5AUVA 2UZOA 1QPDA 4D28A 3LCDA 1Y6BA 4XHKB 3UODA 4FSNA 3KMMA 3KRXA 2C5OA 4JRVA 4QYEA 4AFEA 4ZTQA 2VTJA 3AD6A 4A7CA 4WG5A 4M7IA 4NFMA 4JT3A 2OZOA 4E6AA 4L3JA 4ZMFA 3TNPC 4RWKA 4EUTA 1UWJA 2JDRA 1UU9A 3FZSA 4EI4A 3BELA 4ZTLA 4R77A 3KRLA 3ZRMA 2WGJA 5AR3A 3QQHA 3ZTXA 3SHEA 2J9MA 3Q2MA 3GI3A 4U3YA 4IHPA 5DNRA 4UN0C 4MAOA 5B0XA 3R73A 3QRTA 1O6YA 4GG5A 3NRMA 4QTCA 5CLPA 3LQ3A 4QP4A 4X2FA 1A48A 4LQMA 3AC1A 3G0EA 5CALA 4NZWB 4OTIA 3LKMA 2YDJA 4QMPA 4MHAA 4LV8A 1H28A 3CEKA 4CRSA 5FLFA 2VTTA 2O0UA 4Y83A 3W2CA 3WIKA 4I0SA 4YP8A 3PYYA 2F7ZE 4KSPA 3UG2A 1G8AA 1OPLA 1KV1A 3WYYA 5E8UA 4JS8A 4JDHA 2YABA 3EFWA 4CLIA 3UO6A 3C7QA 4RSSA 5E8TA 1H00A 1YQJA 4JBPA 1OKZA 3E63A 3ZM4A 4E5AX 2OGVA 3MBLA 1DI8A 2WU6A 1IAJA 1PXKA 2BRBA 2CN8A 3KA0A 4BCJA 5CAVA 2RFEA 3D5WA 4CQGA 4EONA 1Q8YA 2IG7A 2WKMA 5L6OA 3WZUA 4G34A 4I5MA 4EOSA 4TTHB 3DK7A 5L2TA 1H1RA 1GOLA 2UZTA 3OCGA 4A9RA 2PZ5A 3HECA 4H3QA 4L44A 4O0WA 1L8TA 5I9WA 2QOLA 3DFCB 3MY0A 3NUPA 5AIKA 3MN3A 5HESA 4ACDA 3PXFA 4QQCA 5M4UA 4NM7A 3QRUA 4ALVA 4FKRA 5EM8A 1OIUA 4G9CA 2W9FB 3LOKA 2UZVA 3EFJA 3NLBA 5CXHA 3PPZA 4TKSA 3L8SA 4GRBA 5LVNA 2WTVA 2H8HA 4BGGA 3BU3A 4AA4A 2XNBA 3OS3A 3R21A 4C2VA 2BIKB 4ZSLA 4EL9A 3GBZA 5M57A 2UW9A 2V62A 4IWDA 4BCPA 4NM3A 3PPKA 4TT7A 2F57A 2C4GA 3DJ6A 1R3CA 5IA5A 3VUIA 3A60A 2XIZA 2WIPA 3ELJA 4RJ7A 2C3IB 5EG3A 2BAQA 3RTPA 2UZNA 2J90A 3R9HA 4LRMA 4EC9A 2PVMA 4ZY5A 3QWJA 3SRVA 5IUHA 4NU1A 4FGBA 1O6LA 1JKSA 1W83A 3LCOA 4J53A 4U0IA 5FQDC 3IOKA 4ANNA 5JKGA 3OHTA 2BKKA 3DU8A 3DOGA 4GW8A 4EQUA 3BLHA 3NSZA 3LLAA 5A4TA 4YMJA 5EM6A 2R3MA 4IX3A 1YHWA 3PWYA 4MWIA 4QRCA 5K3YA 4C8BA 2IVVA 4DH5A 5D41A 5B2LA 5AFVA 3IS5A 2JIUA 2PHKA 1YOJA 3LFQA 4D1ZA 5K0XA 3WF8A 2PVFA 3HV4A 3TL8A 3I79A 4S31A 2OU7A 2A27A 5D7AA 4QYFA 2EXCX 4ZLZA 3V5PA 5TOZA 4JQ8A 3KXHA 3VF8A 2X39A 3AD4A 1RW8A 3QLGA 4P4CA 4LFIA 4QNYA 4I92A 2XYNA 3KRJA 3O8PA 2WIHA 3DKGA 4DG2E 2G01A 3QUEA 1LUFA 2BIYA 3GOKA 4FNWA 4XJ0A 5CQUA 4DFYA 4JDIA 4FI1A 3PXRA 3NUAA 3KB7A 5ANEA 5L3AA 2ZV9A 2JGZA 3CD8A 3IW5A 4JIKA 3C5UA 4A4XA 4YTCA 1BL6A 4LGDA 3QRKA 4RJ5A 3RP9A 5FXRA 3VBYA 2IVSA 3NGAA 5C4LA 4BKJA 4YZDA 4D4YA 3PJCA 3P86A 1W7HA 3R8LA 4YLJA 2GTMA 2C5VA 4QTDA 3MPTA 4BHZA 3K5UA 1JSTA 2WHBA 4DBNA 4F9CA 4A06A 2A1AB 3U8WA 2CMWA 4PF4A 3SG8A 5JFVA 4FL3A 2XMYA 2I0VA 3O23A 5BX0A 1YOMA 5GINE 3ULZA 5IQBA 1M7NA 1H26A 1YI6A 3PXZA 2ZAZA 4FTOA 4GU6A 1GY3A 3UVPA 5HD4A 2OJ9A 2OH0E 5E92A 5BYZA 4BIEA 3A7FA 2GNHA 1LR4A 5AADA 3GCUA 3AGMA 4GL9A 5AEPA 4MF1A 2W17A 4AT3A 4FSRA 2HWPA 4JDJA 1Q61A 3H9OA 4MKCA 4IB5A 1LP4A 4GU9A 4CFXA 3PVWA 3OCSA 3Q60A 4WRGA 4YHFA 2VV9A 4U40A 4PTCA 3TDWA 5HD7A 3F3UA 1ZARA 2OICA 3E3BX 3NCZA 3MTLA 1XH7A 3PY0A 3QYWA 4FICA 4RBLA 3RBWA 4N0SA 2BVAA 3HMIA 5LVLA 1KSWA 2ETRA 2G2FA 3F3ZA 2RSVA 3Q2JA 3MA6A 5FDPA 4ZP5A 3IKAA 5KCVA 4RC4A 5ETFA 4FIJA 3PFQA 5AP7A 3LFEA 3OT8A 3A62A 4EKLA 4FKWA 4K1BA 1QMZA 3TUCA 1DAYA 1PXJA 3PP0A 2O64A 4LMUA 3UBDA 2OIQA 2OZAA 4AAAA 5AA8A 4FNZA 4CV8A 1IA9A 2OXYA 1KE5A 3FHIA 5BNJA 3UP2A 3AG9A 2Z8CA 3CC6A 1UA2A 3Q9YA 2WMQA 2WMTA 2BHHA 3DDPA 3KMUA 4FT3A 4E4XA 5ANDA 4I5CA 2X8IA 4PX6A 2UUEA 5J1VA 4AGWA 2VZ6A 3BCEA 3EQBA 4RZWA 4NL0A 3MH1A 4KIQA 5ETAA 4KD1A 3FUPA 5DMZA 3PRFA 5CS6A 5HQ0A 1AGWA 2WZJA 5ICPA 2WEVA 3QTIA 3UVQA 3KCFA 2XNOA 4C3PA 2R3GA 4WBBB 1J1BA 2R3QA 4B6LA 5F1ZA 1YXVA 4QMSA 4U7ZA 4WG3A 3U87A 5HVYA 3MFUA 5CU4A 3FQEA 3R28A 3D94A 3KKVA 1S9JA 4O83A 4V0GA 2R0IA 3PIZA 4XP3A 4UBAA 5JFSA 3FI2A 2HZ0A 3CR0A 5DR9A 4X7QA 3KVXA 3R8ZA 5JQ5A 4ZOGA 3T3UA 4GUEA 3DNEA 4DYMA 3FI8A 4NT4A 3SXRA 1XWSA 1R78A 3MVJA 2W05A 4IC8A 5CQWA 3RCDA 4U6RA 4E6CA 2CLQA 4HOKA 4I5HA 2AC3A 3O8UA 4JBOA 5JEBA 1ZYSA 3UPZA 3PSCA 4YTIA 4HJOA 1M14A 3A2CA 4FV6A 1ZYJA 2ACXA 3LCTA 3OXZA 4WKQA 5D1JA 3UVRA 2W1CA 2PUNA 3O8TA 3MJ1A 1LPUA 1OITA 5EYMA 4RIXA 3UIMA 2WOTA 4USEA 3CTHA 2B53A 4FT9A 4FT7A 4JBQA 4D5HA 3C0GA 5M4CA 1OUYA 3HX4A 3FC2A 4IFGA 5IG1A 2BZHB 4FEXA 4DLJA 3F5PA 3O7LB 4I22A 2ZV7A 4DEHA 5E8WA 3AXWA 4YR8A 2R0UA 4WNKA 3F3WA 1CDKA 3LJ2A 2BDWA 5EHLA 2WB8A 4DLIA 1UU8A 4EHVA 4DN5A 2UZWE 3GXLA 4BCNA 4QMQA 4EYMA 4CZYB 3JVSA 4O0TA 2BRNA 2BTRA 4FKJA 4N6YA 4YJTA 2WOUA 2X7OA 4GH2A 3CS9A 3OWPA 3CQWA 1GZKA 5IH6A 5H9BA 5I0BA 4RC2A 4BYJA 3MJ2A 5LCKA 3DGKA 2XNPA 3EQRA 5HO6A 3ZSIA 4Z55A 4AA0A 4AE9A 5FTGA 1XBBA 4X3JA 2RFSA 3UNZA 2JDSA 3UPXA 4BDFA 4CFWA 1PKGA 5CI6A 3LFSA 4FZAB 5HG8A 4AG8A 4CMOA 2C1AA 5AAEA 2R5TA 3OXIA 5CTPA 4Y95A 3C4FA 3CIKA 3QKMA 2X7FA 3VBQA 2FH9A 5DWRA 2I6LA 2WMAA 4ZZOA 2LAVA 3TXOA 3AMAA 3Q4TA 4JRNA 5DVRA 4MCVA 1DAWA 4NW5A 5AR8A 4LOOA 5LWMA 5A6OA 4O1PA 3MIYA 2OFVA 5AP3A 1U54A 4XG4A 4KSQA 3ZLWA 1E1XA 2C0IA 5EQYA 4FSWA 1OMWA 5HICA 1GNGA 4I4EA 3U51A 2B9HA 2XK6A 4EQMA 3H3CA 3FEGA 4Y85A 1Q5KA 4I20A 5ANOA 3SQQA 4PMMA 4ACMA 2GCDA 4IAFA 3HRBA 2RGPA 4XUFA 3KK8A 4UZHA 3JUHA 4F0FA 5J9YA 2VO6A 3SC1A 1CKIA 3SKCA 2B54A 4IB1A 3ZEPA 1FVTA 2VTOA 3FZTA 3TIZA 1BI7A 1HOWA 3KQ7A 3RZFA 4WBOA 4ZJIA 4BZDA 5E90A 3VS1A 4FZ7A 2BAJA 2FSLX 3NW6A 5EI8A 3THBA 4DGLC 1H8FA 2VWBA 4FV0A 5BYYA 3MGYA 4O82A 4IVBA 1U5QA 3KVWA 4TYEA 4M69B 4X2KA 4U81A 1K9AA 1ZYLA 2JAMA 1URWA 5K9IA 3U4UA 4FKTA 5EOBA 4O0YA 4XV9A 4F4PA 5IISA 4C4GA 4DE4A 4FODA 2X2MA 2O5KA 1WAKA 3DAEA 3FL4A 4TY1A 1ZMWA 3I1AA 3MFRA 4FTQA 3VRYA 3VS3A 4F09A 5I3RA 4FEQA 3OC1A 4PPCA 5CVHA 5CZIA 4DEGA 5LWNA 5T68A 4DT9A 1AD5A 3AMBA 1JSVA 1OPJA 3R7OA 4OBQA 4QP3A 1YDTE 3ZRKA 3FWQA 3B8RA 2VTIA 4YO6A 1H25A 4BDAA 4IADA 2O63A 2ZM1A 4RQVA 2HWOA 4CZUA 2ITWA 1KV2A 5JT2A 3I6UA 4HNFA 4PDSA 4HVSA 5AR7A 3TNIA 3IW4A 3TT0A 3A99A 4BTJA 4EHEA 5DGZA 3IDCA 4LRJA 4BR3A 2VX0A 2OH4A 3PG1A 4DFLA 3OXTA 5F95A 3C4EA 5CENA 4FK6A 4O0RA 4ACHA 1UV5A 3QTUA 3PPJA 3RAWA 4F99A 3KXXA 5AV4A 4YGAA 3VULA 5HO8A 1H01A 3TKIA 1DI9A 4MTAA 3VBWA 4B7TA 4O7RA 4NKSA 4CCUA 4O7VA 3JVRA 5FBNC 3WE8A 5HCXA 3JS2A 2UW0A 3FLQA 3I7BA 2W4KA 3FLWA 4JJRA 4UWCA 3NR9A 5K5XA 3GFEA 2XP2A 4FIGA 3E7OA 4IX6A 1Y91A 4X0MA 4D4VA 4QMNA 4RX7A 2IW8A 3TIYA 4ENYA 5BMSA 4K33A 3UIUA 3GCQA 3VUHA 1ZAOA 3FY2A 3KEXA 1XH6A 1GZNA 2UVXA 2NPQA 3HRFA 4KBKA 4MXZA 4PDOA 5I9XA 5KE0A 4ZEGA 3PY3A 4GKHA 2WNTA 3ERKA 3IQ7A 4C0TA 2J5EA 5IPJA 2JC6A 4DEIA 2BPMA 4X3FB 3V5LA 4FL1A 2WQBA 4FV8A 3MVLA 2HZIA 5HU9A 4IWOA 3G2FA 4OT6A 1XH9A 1Q3DA 4WUNA 3Q5IA 3FLYA 3GFWA 4L8MA 4ZS4A 4WIHA 4FTNA 5EQEA 3E3PA 4IMYA 4J1RA 3FZPA 4A9TA 4BCIA 5L8KA 4RFZA 5GJDA 4RIOA 2WTDA 3ACJA 1QL6A 2KULA 2W5BA 2PVKA 3LJ1A 3BEGA 3ODYX 3DKOA 4A4OA 3ZFMA 1X8BA 3POOA 5E1EA 4DAWA 4EOQA 2PE0A 3O71A 4QPAA 4PMTA 3GCVA 3U9NA 1CMKE 4G5PA 5EKOA 3GU8A 1CTPE 2Y6OA 4M0ZA 3U6IA 2CKOA 2FB8A 4IQ6A 2IZSA 1Q62A 4ERWA 2GS2A 5TT7A 1OM1A 2RG6A 1PXLA 1RJBA 4RQKA 5C8MA 2IO6A 1JNKA 3BYOA 1Q24A 2P4IA 3G33A 4ZAUA 3II5A 3F9NA 3BWJA 3UQGA 3F3VA 4QYHA 4IWPA 3FKLA 3G9LX 4QD6A 5A4QA 3P7BA 3R8PA 3JY0A 3FDNA 3E7VA 4LI5A 4R3CA 3H0YA 4M0YA 5IEYA 1G8SA 2OF4A 1SVGA 4ZZMA 4MXAA 3QF9A 4GK3A 2QODA 4FR4A 1PY5A 1YXXA 3R2YA 4HPTE 4GV1A 4PL4A 3QTWA 5CAPA 5DOSA 3LZBA 1PXIA 3BGQA 4NIFB 3VW6A 2C0TA 2J50A 5FD2A 3L9PA 5J7HA 2PULA 1CM8A 5J9LA 2W5HA 3CTQA 4D4SA 4M14A 3BQRA 1Q97A 4FMQA 4O1OA 5CEKA 4UWBA 4YHJA 4UX9A 3D14A 1WZYA 1Z57A 3A7JA 4ENXA 4EK6A 3D7ZA 4FV1A 2UVYA 3R2BA 4RPVA 2J0JA 4TWCA 3AGLA 3RAKA 3HP5A 4RVTA 3POZA 3UJGA 4MQ1A 3VVHA 4CD0A 1V1KA 2WMXA 5EI6A 2GFCA 4BKZA 2I40A 2QU6A 4F6UA 3R1YA 1PXOA 3K3JA 2VTMA 3UIXA 1B38A 2FUMA 4JQEA 3GQIA 2VTPA 4YC6A 4W4YA 4BN1A 3UQCA 1GIIA 3VAPA 3GB2A 4OTFA 2QVSE 3LLTA 1RDQE 2J0KA 4Y72A 1Q8UA 1XKKA 4NWMA 3ZLYA 2VX3A 3ZO1A 3EN7A 3NUNA 3H4JA 3ZC5A 2GTNA 1LEWA 4C59A 4EH9A 5IQGA 2J6MA 4IZAA 4NW6A 3W2PA 2W7XA 3FMMA 5LVPA 3LJ0A 2GDOA 4JAJA 4JIAA 5IH5A 5LCJA 5DEYA 2YCRA 1V0OA 5FEQA 4RWJA 3MIAA 5C8NA 4NIFA 3V3VA 2PVHA 3EZVA 4R3PA 5AX9A 2OIBA 5IQFA 3D7TB 3RALA 3EYGA 4ZLOA 3UIBA 4E4MA 3KXZA 3RHXA 2EB3A 3C1XA 3ATSA 4X2NA 4FKVA 5D10A 4UALA 4AACA 2Q83A 2XM8A 5ANJA 3LE6A 2UW5A 5M4IA 2CPKE 3TDVA 2Y4IB 3PUPA 3R7GA 4FKOA 4P5QA 4YBKA 5GJGA 5TR6A 3ET7A 1NA7A 1BYGA 4EOPA 2XB7A 4LUEA 5CNOA 3EQFA 3OZ6A 4RA5A 2ITOA 4TZRA 3DFAA 3EFKA 2ITQA 4DGNA 2XCKA 3NNUA 4K6ZA 4QQJA 1PXPA 4EWQA 3QQLA 4CKJA 5AM7A 3ZS5A 4II5A 3DQWA 2BRHA 4BIDA 4MQ2A 2ZB1A 4YTFA 4XH6A 2OSCA 3AMYA 5KUPA 5AIRA 4X2GA 5IUGA 1W8CA 5AAFA 5KZ0A 3F7ZA 1WBOA 3EMGA 5DN3A 5LMAA 4FKIA 1F3MC 4UWYA 3H0ZA 4GVAA 2HENA 2E9UA 5HIBA 3N4VA 1TKIA 5A54A 5A6NA 2PVLA 4F08A 4U45A 4MXXA 1W84A 4H36A 2IW9A 4WD5A 1TQIA 2OJGA 3GNIB 2XEYA 4RFYA 4U9AA 4NFNA 4O96A 4ASZA 2J0LA 5KKRB 5DR6A 4QMVA 3U6HA 4FOBA 1FPUA 4L45A 4TPTA 3DBCA 3LFBA 5E1SA 3SOAA 2GHMA 4OTRA 5B2MA 4X3FA 3F6XA 4IAAA 3DPKA 3MW1A 4OBOA 5B2KA 5HO7A 5EDQA 1YDSE 3EN6A 1NVRA 4HVHA 5DA3A 5C8KA 5JQ8A 4L7SA 3UDBA 3NS9A 2CLXA 5DPVA 5H3QA 2ZDTA 3GT8A 4XP0A 5C1QB 4ZTRA 1XQZA 3PXKA 5AUWA 3PA5A 3QKLA 4H58A 4YJNA 3WF6A 3ZHPC 4BCGA 1WBTA 3MWUA 2Y9QA 4U44A 3BHYA 3V6RA 3GCSA 4FTTA 3RPSA 3LXPA 2O65A 3R63A 2JFLA 5M56A 3TZ9A 3CLYA 3E62A 2YFXA 3WILA 3R8VA 2WQMA 3MY5A 3HMNA 3Q9XA 3V04A 5M06A 4AZSA 3EZRA 3ZO2A 4U80A 5FWKK 2GNJA 2QR7A 5FTOA 5CSPA 2XK9A 4PL5A 4N4SA 4QO9A 3IDBA 4RC3A 1KE9A 4BWXA 4ANMA 4F0IA 4TYJA 2CDZA 3WF7A 3C0IA 4RIWA 2W9ZB 2QOBA 5TKDA 4BVUA 3EQDA 2YERA 4AGDA 4EH4A 4FA2A 1NW1A 5E8ZA 3RNYA 2W5AA 1YDRE 2BAKA 2GFSA 3D0EA 4HGTA 1Y8GA 2X9FA 4DF3A 1FOTA 1I09A 2QKRA 5HE3A 2CJMA 3R9NA 2XNMA 4DEAA 4DCEA 3KF4A 2B52A 4QPSA 4XG3A 3WZKA 1R0PA 5BQ0A 2VNWA 4NK9A 4C3FA 3SOCA 4O0UA 2YJRA 5JZNA 2GMXA 4CV9A 4ZLYA 5FUTA 2PMIA 4XG2A 5DEWA 1WBVA 2ITNA 2JIVA 1FMOE 1H4LA 3NNXA 4LOPA 4QTEA 4XP2A 4O81A 2C6DA 5BUIA 3VHKA 5AR5A 5FXQA 4BWPA 4DINA 5I9YA 5J95A 3DXPA 5JRSA 1RE8A 3KXGA 3PJ2A 2Y0AA 2OG8A 5AAGA 5LXMA 3QQKA 3N9XA 4IVCA 3UNKA 5A9UA 2YDKA 2ITYA 4HNIA 3FMLA 2GSFA 3FC1X 4K18A 5TO8A 3TV6A 1F5QA 1NVQA 4XMOA 4CFVA 2WMBA 3DJ5A 2XZSA 2YIQA 1OKYA 4JL9A 5AP0A 3TG1A 4ANBA 5AUZA 4BBFA 4BC6A 3BE9A 4YLLA 1GZ8A 1W82A 4RVMA 3ZCLA 4CTCA 5C9CA 3O51A 3FZ1A 2XF0A 5CSVA 4Q5HA 4EH3A 4QP8A 4EH6A 2XIRA 1OL1A 3CGFA 3OVVA 3BPRA 4H3BA 4YZMA 4AOTA 3BYSA 3O17A 4JXFA 4KKGA 3Q96A 5E8XA 3ROCA 5CAQA 2ITXA 4BICA 4JVGA 4F9WA 1NXKA 3HNGA 4CMTA 2Q0BA 3PLSA 4DFUA 3CXWA 4FV4A 2UVZA 3QHRA 2PY3A 5FEEA 2B9FA 3V5QA 5DYJA 4RMZA 4L00A 4E1ZA 4IAZA 1JPAA 1IASA 2VTHA 4KIKB 3VW8A 2YEXA 3R02A 4RJ6A 1JBPE 5AX3A 1U59A 3E5AA 3DBFA 3DV3A 2XK4A 4S30A 5BVKA 1QCFA 1G3NA 3BU5A 1SNUA 4LGHA 5ETCA 5CEPA 4DCAA 2B7AA 3ODZX 2XYUA 2WTKB 4FSZA 2CSNA 5IUIA 3L8VA 5FP6A 3D83A 3AT4A 5L4QA 4PTGA 2ERKA 1VJYA 2VO7A 2X8DA 3Q4ZA 2PE2A 1XHAA 3ZU7A 2R3OA 2CCHA 4EK4A 4FGRA 4U43A 5CSWA 4ZTNA 2XNGA 3E92A 3FSFA 3O2MA 2GPHA 4BI2A 4M84A 3LQ8A 4RLKA 3GQLA 5EYKA 2W1GA 3QC4A 4U79A 4X21A 2HW7A 4U3ZA 2UZEA 4WNPA 2XCHA 1SMHA 4QP1A 1KOBA 3DTWA 3OG7A 3PSBA 4J95A 3U54A 4G5JA 4NYEA 4BZNA 3WZEA 3AD5A 2E9OA 3FSKA 4IACA 4Y46A 5ACBC 5I4NA 3PXQA 3R30A 1WBNA 2Z02A 3QA8A 4XX9A 2O3PA 4APCA 4ZTMA 1IRKA 3C4XA 3KULB 4F6WA 2FSMX 3O7LD 2JEDA 1YWRA 4FV3A 3ZUTA 1MQ4A 4CTBA 3G9NA 4G6LA 3E93A 4OTDA 2PL0A 2G2IA 4FSTA 3SVVA 3SW7A 2Q0NA 3EHAA 4IEBA 2YM8A 3OD6X 4CYIA 4K9YA 2QNJA 2EXEA 3QWKA 5FEDA 1FBNA 4UZDA 3SA0A 4O7SA 2JDVA 3QTXA 2PVJA 5A4EA 2PUIA 4K77A 4EHGA 1J7IA 5M53A 3C51A 4DTAA 1YXSA 2VTRA 2YAAA 2ZJWA 1CKJA 1YHSA 5FP5A 1OI9A 4ANSA 4C4JA 2C47A 2OJIA 4V04A 1ZY4A 4IX5A 4EOIA 3TNQB 2G9XA 4AA5A 4D4RA 3SXFA 3HAMA 3FMNA 5CT0A 4JQ7A 4BGHA 3GC7A 5HNGA 3ORXA 5EK7A 4G17A 4QP6A 5CAOA 3E8EA 3HMMA 4V0GB 5AJQA 3E8NA 2FSTX 4APPA 1YVJA 5BUJA 3OTUA 3P9JA 3AC4A 3F88A 4M66A 3DXNA 3IDPA 2HAKA 3I0QA 1R39A 2HELA 4GG7A 3FMHA 3MB7A 2B4SB 3PA3A 4FOCA 3QZGA 1XBAA 4FIFA 1JOWB 1KE8A 4B4LA 3ZO4A 5HX8A 5AM6A 2C30A 3ORPA 3ZYAA 3C0HA 3TZ7A 4ERKA 4BY9E 2HK5A 3HYHA 5FG8A 4LG4A 4AW0A 1YXTA 2EXMA 3GC0A 2WEIA 3LFFA 1GIHA 4HVIA 2IJMA 3PRIA 4RT7A 1OL5A 3FXWA 3DK6A 3DK3A 3KULA 3LXKA 3Q4UA 3QGWA 3B8QA 4FSMA 4I0RA 4IDVA 3CE3A 2H34A 4KS8A 5HE1A 2W1HA 2OLCA 2X2LA 2OZAB 3LCKA 3LFCA 2R3KA 3U6JA 4GIIA 5E91A 3QC9A 4DFBA 2W1EA 4O21A 3KU2A 4IDTA 3FPMA 4AW5A 3ORIA 4OTHA 3CQUA 3IG7A 4F7NA 1BI8A 1YWVA 2XRUA 3LFDA 3MSSA 5HTCA 4RX5A 3N4UA 2QQ7A 2P0CA 3QCXA 4XBRA 2E9PA 4E4NA 5AP2A 4PNKA 1U4DA 4K8AA 2AYPA 4FKLA 4IC7A 4DHFA 5IF1A 3V51A 3P5KA 3ZLXA 3HV7A 4XS2A 4GIHA 4WOVA 3ZLSA 3R7UA 3BQCA 3TNWA 3HV6A 2J0IA 5CY3A 3DS6A 2CHLA 3OOMA 3QQUA 5IA1A 5HORA 5KX8A 4AZTA 4N70A 2YCSA 4FF8A 1OBGA 5BPYA 1MRUA 4Y73A 4U8ZA 3MPAA 3NVMB 3D2KA 1BUHA 3P79A 4EORA 4E5WA 3OCTA 3MI9A 3MH3A 2W06A 3PSDA 4IJ9A 2A4LA 3DB8A 2WMRA 4BI1A 3OBJA 2XKFA 4IAYA 3ZMMA 5KBRA 1PXNA 2PSQA 2VTNA 3LMGA 4QMUA 4YNEA 3NDMA 4IM3A 5AR2A 3F82A 5EYDA 2SRCA 3OROA 4WO5A 5H8GA 2XK8A 3T8OA 4F1OA 2WMWA 2XA4A 3C4WA 1ZXEA 2ZMDA 3KN6A 2QO2A 4AU8A 2BUJA 2WMVA 3ORMA 5JGAA 1DS5A 1YWNA 4YJQA 5AUYA 3DBQA 5EH0A 4IB0A 2QONA 5BVDA 2WFYA 4XNEA 2EWAA 2YDIA 3DNDA 5CF4A 5IZFA 3TUBA 4ANQA 1PF8A 1U46A 5HIDA 2W96B 2WU7A 4FKPA 3KXNA 4RX8A 1OBDA 4AN3A 5C27A 4OTWA 5IMEA 3O50A 1Q8TA 4C3RA 2I7QA 1BLXA 4DFXE 2YLFA 3FMJA 4IM0A 4K11A 1V0BA 2XKDA 3CGOA 3S95A 3TNHA 3F5XA 4JX7A 1ZWSA 2GS7A 4YC8A 1XH5A 3G5DA 4C36A 3GCPA 3QZIA 5E9EA 1FGIA 3W2SA 5JRQA 2C5NA 2W4JA 3GP0A 4G6OA 4FC0A 3A8WA 3TTIA 2YWPA 4NEUA 4CKIA 4AXAA 1OL6A 3OEZA 4I21A 4PL3A 3PG3A 4FEUA 2QLQA 1E9HA 4O2ZA 4W9WA 5ANGA 5AP5A 3QX4A 3NMUF 3FL5A 1GIJA 2FO0A 2WO6A 3IONA 4FZ6A 4DTKA 1AQ1A 2QHMA 5G6VA 3R6XA 3LMIA 4GYGA 2EB2A 4M97A 2W1IA 4FSQA 4WA9A 4Y5QA 4ZXTA 4BDCA 4UMUA 3HRCA 4NM5A 3P78A 4FTLA 3W2OA 2P55A 2R7BA 3QD0A 4LUDA 5HLPA 2R3PA 2UW3A 4J71A 5CF6A 2XBJA 4ZJJA 1WFCA 4F7JA 4CKRA 2ERZE 3ZZWA 3QU0A 1B39A 3MDYA 4RIWB 3QL8A 5KKRC 3EYHA 3P1AA 4YLKA 3SRVB 2RG5A 4LM5A 1REJA 4F63A 2BTSA 2PZPA 4A4LA 1OB3A 3EJ1A 3FKOA 1SVHA 1KE6A 3R9DA 2R3RA 4IW0A 4DGGA 4E5BA 5AUTA 3UO4A 4R6VA 2BRMA 3QQFA 3QUDA 5E7RA 3IPHA 4O38A 2YIRA 2C3JA 5AV3A 3QFVA 4FVQA 4DC2A 5I9VA 4CG9A 2HY0A 5IQEA 4E4LA 2XKCA 1H1QA 1SNXA 3LHJA 4D2RA 3JYAA 3G51A 1FMKA 2PZIA 3F2RA 2NRYA 4ZSEA 2X0GA 2VX1A 4RVKA 2R3JA 3OOGA 4M3QA 3M42A 4XCUA 5HI2A 2F2CB 2IVTA 2OIDA 3NAYA 2QOFA 4GVJA 4RRVA 2P3GX 3BWFA 4C58A 2CKPA 2HZ4A 5DLSA 3VS5A 5C01A 3I7CA 4XLVA 5HG7A 4FG9A 4KKHA 3R83A 2ETKA 3A8XA 1PW2A 4D2VA 3QBNA 4IIRA 3QAME 5H8BA 3AOXA 3UC3A 2BALA 1ND4A 3Q3BA 3ZONA 3ALNA 1UNLA 1SVEA 1UWHA 3PIXA 1P5EA 4BKYA 2C6KA 5EQPA 2CKQA 3KY2A 1I44A 4B8MA 2IPXA 1VYWA 4L7FA 4DG3E 1M2QA 2A19B 3NAXA 2JDTA 2Y6MA 2YISA 4FVPA 3TWJA 2XKEA 2VTAA 4AZFA 4EBWA 5KHWA 4YJRA 1VYZA 3PVUA 4PP9A 3R1QA 3ALOA 5DHJA 3LM0A 3BI6A 3HUBA 2Z7RA 4YO4A 4E6QA 5IEVA 1UVRA 2BZKB 4RJ8A 3GENA 1REKA 2VWWA 3LM5A 3D4QA 3VS2A 3SW4A 4F1TA 1E1VA 4BCOA 5KMIA 4ZSAA 2OXDA 4O2PA 2G2HA 3RWQA 3N4TA 4YTHA 4NJ3A 5AV0A 3QCSA 3ZUUA 3IK3A 4AF3A 3R22A 3ETAA 2F49A 4L43A 4L53A 1J7UA 2ZM4A 4UMRA 3DXQA 4O91A 3JXWA 5DT3A 4ACCA 4F64A 2ONLC 3FI4A 4DH7A 2YLEA 4UYNA 1W0XC 4G9RA 5HG9A 2QG7A 4ORKA 3K54A 3ULIA 4YURA 2OKRA 1SYKA 4D2PA 2B55A 3QHWA 4ID7A 3NUXA 4OLIA 4QQ5A 5EYCA 4IANA 4GS6A 1BMKA 3EL8A 2B9JA 2R3HA 4HCTA 1GZOA 3DY7A 4MD7E 3IGOA 1PYXA 3NEWA 4WRSA 3VS6A 4A9YA 4UEUA 3W2QA 1J3HA 4ONAA 4L67A 4RLLA 4DGOA 5LVMA 4HYIA 1LEZA 2JIIA 4M67A 4XEYA 2VRXA 3PJ8A 1FGKA 4AT5A 1H08A 4PMSA 2B9IA 3RK9A 4GJ2A 5EM5A 3FXZA 1L3RE 4RIYB 3VUGA 5CANA 2Y7JA 2WELA 1FQ1B 3OBGA 2IWIA 2QG5A 4EUUA 2R3LA 3B2WA 3D2IA 2UZLA 4HYHA 1M17A 2QHNA 3H30A 3ZXZA 5ITAA 5KHXA 4XBUA 3AC5A 4DTBA 5DFPA 4USDA 3R8UA 1WMKA 3EH9A 3QA0A 3S1HA 3QALE 2G1TA 4CQEA 3PZEA 4J8NA 2CGWA 3HMPA 1ATPE 1IA8A 2GNFA 3DZQA 3K2LA 4ANOA 5BUEA 4MNEA 3CKXA 4C4IA 5IQCA 3UMXA 2YCFA 1YRPA 2ITTA 3Q52A 3FMEA 3VHEA 5L8LA 3OEFX 4QMLA 1PKDA 4GT4A 4XRJA 4AFJA 4DH1A 5JN2A 1RQQA 5HOAA 3QZFA 5E8YA 4RZVA 4X6RA 2F9GA 3WYXA 4UYAA 4ASDA 2YM5A 2JBPA 1T45A 3BZ3A 4USFA 3OFMA 3VUTA 5M44A 4QTBA 2VWZA 1URCA 1H1PA 4RJ3A 4F65A 1R1WA 3IO7A 1XH8A 2Z7QA 5IQIA 4W8DA 3RAIA 5HLWA 4XV1A 2PUUA 3VBXA 2JD5A 5D9HA 4HPUE 5EI2A 3VO3A 5CEIA 3OY3A 4AX8A 4CT1A 4YSMA 2QO9A 4D2SA 4AUAA 2VU3A 2JITA 1U5RA 3RZBA 4OUCA 4BI0A 4YPDA 5IMXA 2IVUA 4WUAA 1M7QA 4D2TA 2PVRA 3RPRA 2XNNA 3I81A 4EC8A 1FVVA 4CYJA 4J97A 2WTCA 3PA4A 5AWMA 5DI1A 4CNHA 4KKEA 3D15A 2WTIA 3S2PA 3NYVA 2YIXA 2QOHA 5F4NA 3HZTA 3W18A 4GT5A 3MTFA 4ZSJA 5EFQA 3BV3A 2UZUE 1P14A 2BKZA 3PJ3A 4I5PA 4H1MA 2E2BA 5CU2A 4IBMA 3NW7A 4IVAA 4JOAA 3ZC6A 4TWNA 4BDIA 3PTGA 1A9UA 3TUDA 4KRCA 5FBOA 4EQCA 3W8QA 2IZRA 4YSJA 4XG7A 3PE1A 1JSUA 5L8JA 1A06A 1UU7A 4F70A 1PRYA 1BKXA 4H3PA 4W4XA 4MBJA 2OFUA 4AW2A 3D5VA 5D7VA 3A7HA 4FIHA 4FKGA 4IZ7A 2VD5A 4QT1A 4DEEA 2GNLA 4KS7A 4GJ3A 4MD9E 4TWPA 4HZRA 4JBVA 5HTIA 2Y8OA 1PMVA 4I4FA 3CSVA 5BYLA 2UW6A 3WOWA 3W8LA 3LMHA 3W16A 3FAAA 3AT2A 4RA4A 2QR8A 5AUXA 4PTEA 4RWLA 5AV1A 4BBMA 2UZDA 4LMNA 5CU6A 4OT5A 4XYFA 4L3LA 3RPVA 4E73A 4IVDA 2F2UA 3HMOA 4QQTA 4FX3A 4QNAA 3QUPA 3D9VA 3H9RA 3PP1A 1H24A 4MH7A 1GAGA 3S0OA 4FVRA 3HV3A 5M07A 2YAKA 3F2AA 3BGPA 2VWIA 4AE6A 3R71A 1M52A 4KIKA 5AP1A 3TKHA 2VO0A 4R5YA 4RWIA 2X4ZA 2YN8A 3DT1A 4BDBA 4FIEA 4O7LA 2OBJA 2ITVA 1UKIA 4QTAA 4PWNA 5GIOE 5I9UA 3DAKA 4PP7A 3HVCA 2RIOA 5M55A 2JKQA 1ZMVA 3COHA 3NW5A 2C3LA 3VRZA 5J5SA 1WCCA 2A0CX 4YC3A 3EIDA 1Q99A 4QMTA 4ALWA 5CVGA 5HU3A 3BHUA 4O7NA 4XV2A 4V05A 3DTCA 5M4FA 4CT2A 5AUUA 3KMWA 3V5WA 4X3FC 4KA3A 4MNFA 4YZNA 3ZRLA 5HG5A 3OTVA 3DJ7A 5TE0A 3VF9A 4BDJA 4BGQA 1OIRA 4NH1A 3LPBA 3DCVA 5EDPA 2VUWA 5CEMA 5J79A 2X6EA 2P2HA 3IECA 5C03A 3G15A 4FIIA 2HXLA 3E8CA 2WTWA 3LVPA 3Q5ZA 1HCKA 4G16A 4Y8DA 3W10A 5CAUA 1HCLA 3EL7A 4MK0A 2OI4X 4YZBA 4D0WA 3B2TA 4FKSA 4DH3A 3OF0A 2OK1A 2AC5A 3R8MA 4KWPA 5FTQA 4J52A 3WIGA 1H1WA 2HY81 5F9EA 4XG8A 4EZ3A 5HVJA 2F7XE 2XIXA 5HCYA 2R3FA 5K5NA 2YWVA 4C34A 1TQMA 4RFMA 4GSBA 4HYUA 5BVFA 2YA9A 3RPYA 2R3IA 4RX9A 2YM3A 2RFNA 4TYIA 1JKTA 2VWXA 3NX8A 4DFZE 1PXMA 3OUNB 3UG1A 5DT4A 1PHKA 4PUZA 4IJPA 2BFYA 5EHYA 3MA3A 3AC8A 2WQOA 3QD2B 3UE4A 5IA4A 4G6NA 2X1NA 3C4ZA 4ZTHA 4HW7A 3OT3A 5IQAA 5IA2A 2UZBA 3AC2A 2JKOA 3MH0A 2KTYA 5HBJA 5L2WA 1U54B 2X4FA 3TTJA 2I1MA 4C57A 2YITA 2Z7SA 5AP4A 3KFAA 5I5ZA 3A61A 1P2AA 4XG6A 2FSOX 4O7WA 1NT2A 5T3QA 3I0OA 2PZYA 4BBEA 1ZZLA 2BCJA 2EU9A 1ZOHA 3R1SA 4Z9LA 2W1ZA 2XK3A 3HDMA 1M2PA 3P08A 1B6CB 4AOJA 5CF5A 3QCYA 4D0XA 4LGGA 4ZSGA 5DIAA 3NIZA 3EQGA 2VN9A 1KOAA 2IZUA 2VTLA 4P7EA 3V8WA 3V5JA 4AQCA 3RK5A 4UMPA 3NNWA 2P33A 4C33A 2XNEA 4I1ZA 4FTCA 3FPQA 4S34A 3HP2A 4NSTA 4KIOA 5DE2A 4AS0A 4DEDA 4HCVA 3P7AA 1EH4A 2C3KA 5L6WL 4E8AA 4ASEA 4AT4A 4EEVA 2J7TA 4XRLA 4BDDA 4L6QA 3WZJA 3L9MA 4CFFA 4KBCA 2AUHA 5JFWA 4HVDA 4RJ4A 3QYZA 4J7BA 5KMKA 3NCGA 5T6KA 3HDNA 3KREA 1WBSA 1IG1A 4JAIA 4EK8A 3OP5A 4Q9SA 3UGCA 1OL7A 3V8TA 2QOCA 1Q8ZA 2PE1A 1QPEA 4D1XA 5C4KA 2PPQA 2JKKA 5HTBA 4DG0E 3VQHA 2UW7A 4FTJA 4R8QA 1Y8YA 4JDKA 4IZ5A 3C50A 4TXCA 4AN2A 5CU3A 2WAJA 1ZZ2A 3EB0A 5HHWA 5J8IA 4YJSA 2Z2WA 4CMUA 3FKNA 4CVAA 4O7ZA 4E26A 4XG9A 2WPAA 2XIKA 4AGUA 4MXOA 1UKHA 1OPKA 2ONLA 3TCPA 4EH8A 1H0VA 3MVHA 1IEPA 5HE2A 1Q8WA 4N6ZA 3L9NA 4YNOA 4C61A 3WBLA 4IWQA 4TRLA 2IW6A 3FHRA 4AZVA 5HKMA 3VBVA 5M08A 2QKWB 3ZDIA 3ZBXA 4PPBA 3SD0A 2HXQA 4IH8A 4BFMA 4BIBA 5HBEA 4WT6A 1ZRZA 3ZO3A 4U97A 4WG4A 3P0MA 4I6QA 3G0FA 3UP7A 4MF0A 4MBIA 3EQCA 2I0HA 3EFLA 3RNIA 3LIJA 3BGZA 4FTIA 1Q41A 4G3DA 2HW6A 3P7CA 2CNVA 2QOQA 3GU6A 4W4VA 3ACKA 4GK2A 4FV7A 4GUBA 4D9UA 4QMZA 3KRRA 4EZ5A 2BROA 2W1DA 4JG8A 4JLCA 5EOLA 2A2AA 4IFCA 4BTKA 4D58A 5A46A 3SX9A 5L6PA 3D7TA 3S4QA 1O9UA 2OW3A 1IR3A 2RKUA 3AQVA 3ZFXA 3MESA 3C4CA 2QI8A 3I5ZA 3R7YA 5DR2A 2HZNA 5HVKA 3M1SA 4P5ZA 2WXVA 5HIEA 3EN5A 4C62A 2XEZA 2V55A 5GZ9A 2Y4PA 3WE4A 3O0GA 3GU4A 5H8EA 2Z60A 4KUJA 3FV8A 1OIYA 5EDRA 1T46A 3DQXA 4JR7A 1JKKA 3CJGA 4HGLA 4TYHA 3PJ1A 2RL5A 4CEGA 1MRYA 1MQBA 4GEOA 4KABA 4D5KA 4FTRA 4DT8A 3F5UA 4MNEB 5LQFA 2ZDUA 1FINA 5JFXA 4XOZA 1SM2A 3NUYA 3SDJA 5EHOA 4XOYA 4IE9A 4BTMA 5LMKA 1JAMA 3VJOA 4R78A 2W99B 4DA5A 3BV2A 3Q9WA 3Q32A 3R9RA 3SXSA 3UOJA 3U55A 4NJDA 4YU2A 4EJ7A 1TQPA 3R01A 3NUUA 4DEBA 4DH8A 4L52A 1WVWA 4ITIA 2YJSA 2QU5A 3R0TA 5IDNA 5KMMA 2V5QA 4RIYA 3CPBA 4HCUA 2R7IA 3MYGA 2HYYA 3FLSA 4DITA 3IGGA 2CGVA 2J5FA 3I60A 4F9BA 3OWJA 4K2RA 5JGBA 4UXLA 1VEBA 3GC8A 4UMQA 4HGEA 4S2ZA 1J7LA 3MH2A 1JWHA 4PV0A 3BBTB 4ACGA 3SV0A 2X81A 2Z7LA 5J87A 4BB4A 4LL5A 3UYSA 1PJKA 5CYIA 5E8VA 2QOKA 3WARA 3HGKA 1TVOA 4I6HA 3QGYA 5FRIA 3CD3A 4E7WA 4FE2A 4HGSA 5HBHA 3R1NA 4ZS0A 4RVLA 3BU6A 2XJ2A 5JMSA 3UOLA 4ANLA 3BYMA 3HEGA 3G6GA 1WVXA 3ENHA 4P2KA 4AWIA 5C26A 1OKWA 1OZ1A 2PTKA 4FEWA 3GUBA 5BVNA 1NVSA 5K4JA 3COKA 5IQHA 3A7GA 1W98A 3UNJA 3EWHA 5CSXA 4AP7A 2JBOA 2XJ1A 3HA8A 4QPMA 1YOLA 2CGUA 1M2RA 3C13A 3G90X 3NIEA 3PVBA 4TNBA 5GNKA 3ZFYA 2NP8A 1JQHA 3NZ0A 3ORKA 2ETMA 2H6DA 5H2UA 4Q9ZA 4QMXA 2YIYA 5KNJA 4OTPA 1ZY5A 5EW8A 1ZOEA 2ZMCA 2HOGA 3UYTA 2E9NA 4I41A 3EKKA 3JPVA 3NPCA 5LMKC 3O96A 2GHGA 4YPSA 4FUXA 3RHKA 5KO1A 1ERKA 3RAHA 3F66A 5HZNA 3TKUA 1G5SA 3NVKI 2P2IA 2V0DA 1CKPA 2ZB0A 2QLUA 4TW9A 5CX9A 2XVDA 5DRDA 3VUDA 2DYLA 2PYWA 2OO8X 2PVNA 3DLZA 4IM2A 4FT5A 3VNTA 4G1WA 4JX3A 3P4KA 2PVYA 4CCBA 2I0YA 3TV4A 4R7IA 4ARKA 3H9FA 3OWKA 2JDOA 4M12A 3NYXA 4MBLA 4HYSA 4C35A 3BE2A 4CFMA 5ANIA 5CT7A 4YJVA 5AA9A 2X9EA 3RKBA 3Q6WA 2C69A 4F1MA 4G3GA 2GQRA 3LFNA 4LYNA 4QP7A 3UOHA 4A9SA 4B8LA 4C02A 3EQPA 1UU3A 2DS1A 1WBPA 2OJJA 3PWDA 5CNNA 3GC9A 3VS7A 5JZJA 3SGCA 3MPMA 4MYGA 1F0QA 3ATTA 3NUSA 3ITZA 3P23A 3OW3A 3FYKX 4WNOA 5EM7A 3DA6A 4CSVA 2E9VA 4TL0A 4R7BA 4ZJVA 4H1JA 4L42A 2IZTA 3Q04A 4PMPA 2CN5A 4O84A 3OUKA 1PMNA 2BFXA 2ZV8A 4FL2A 1Z5MA 3OCBA 3KC3A 4OBPA 5GHVA 1VR2A 3PLAE 4KNBA 4QMYA 1PMUA 5AP6A 3ZEWA 2GQGA 2LGCA 1XO2B 3M2WA 2VO3A 3GGFA 3MY1A 4FV9A 1YHVA 3BHHA 2XM9A 5HEZA 3W1FA 4Z3VA 4YZ9A 3QD4A 4NTTA 2GNIA 2C6LA 5CI7A 5L2IA 3HL7A 1XR1A 3QQJA 4MX9A 4NM0A 5HNIX 3S00A 4G3CA 3UZTA 1Q3WA 4BDEA 1PYEA 4BCQA 4CG8A 4ZMEA 2V7AA 3Q6UA 2QCSA 2WMUA 4PDPA 5IDPA 3PDTA 2ZV2A 3T9IA 2X6DA 3RMFA 3V6SA 1CSNA 5CWZA 4J96A 5L2QA 4CLJA 2WQEA 3ZH8A 4FTUA 3BLQA 2VWYA 4E20A 3QD3A 5B7VA 2ZOQA 4Q5EA 3UOKA 5M51A 4NCTC 1XBCA 4EJNA 4YJUA 4G31A 3OW4A 5I3OA 4D55A 3TV7A 4GYIA 5K4IA 5G1XA 2ZYBA 4S33A 1OGUA 2XRWA 3Q9ZA 4M69A 4BL1A 5CASA 1P4FA 4QYYA 2OWBA 3TZ8A 3IW8A 3U4WA 5FGKA 5HX6A 3E64A 4H39A 3TZMA 2B0QA 3BHVA 3CCNA 5DH3A 4I24A 3ZOSA 1IAHA 4QP2A 5LARA 1ZYCA 4C37A 5IH4A 2ZVAA 1DM2A 2YZLA 5J7BA 2H9VA 1NY3A 3BX5A 4PNIA 2J4ZA 1STCE 4W9XA 4I6FA 1S9IA 4AZEA 2CGXA 4ZK5A 4KAOA 3MVMA 3DZOA 1OECA 2V7OA 3MS9A 2O2UA 4EYJA 4EOJA 2R64A 3BKBA 3LAUA 4FK3A 2C5XA 4KRDA 3KXMA 5CZHA 4GK4A 4AOIA 4U42A 3ZZEA 3C9WA 2QOOA 4U41A 2XIYA 4WSYA 5AV2A 4NUSA 4ZY4A 2BR1A 3RM6A 2X8EA 2XUUA 4EHZA 4CRLA 2GQSA 3CY2A 3EOCA 3ID6C 4EWHA 4D2WA 3L1SA 1MP8A 2ZM3A 4Z7HA 4TYHB 3UO5A 4M13A 4FKQA 4F9AA 2WTJA 5AMNA 4ITHA 4FV5A 3E88A 3BEAA 4YJOA 5FM3A 5CEOA 4UXQA 4ZIMA 4QMOA 4BYIA 5BVEA 5CEQA 1ZLTA 3SAYA 4G3FA 4F7LA 2PMNX 4HZSA 1YKRA 3DDQA 2DUVA 1QPJA 3QX2A 2XBAA 3TEIA 5A4CA 4BRXA 2OJFE 3TM0A 2C68A 4BWKA 3HV5A 4FG7A 4X6QC 3UZPA 4M15A 4F0GA 1ZYDA 5CVFA 2VTQA 2VGPA 4UY9A 2V22A 4E93A 3TJDA 2CCIA 1GJOA 4UB7A 3OMVA 4J99A 4FZFB 4D9TA 2CKEA 3QRIA 3QXPA 5FXSA 3TACA 3GU5A 4QYGA 4OAUC 3KRWA 4IXPA 3TN8A 5FDXA 4AW1A 4EK5A 5IA3A 3BBWA 2W4OA 3E87A 2FYSA 1ZOGA 2BHEA 2ITZA 5KZIA 3RGFA 5CF8A 4O7YA 5A4LA 5KMJA 3HKOA 3DKFA 4LOQA 3S3IA 1H0WA 1PMEA 3F3TA 2X7GA 2ITPA 2PMOX 3K3IA 3CBLA 1JLUE 3QTQA 1APME 1H1SA 3I4BA 5AR4A 3BIZA 5FM2A 3EN4A 4L68A 4BDHA 4C2WA 3FI3A 1OUKA 1KWPA 5L2SA 3QXOA 2XJ0A 4EOOA 4AN9A 4O27B 2C5YA 3ZXTA 2GS6A 3FY0A 4IAIA 3NYNA 3RM7A 3T3VA 3ZSHA 4UV0A 3PIYA 2GNGA 4BCMA 4FKUA 5BVOA 4JG7A 3MFTA 5KMNA 3VN9A 3W32A 4BF2A 3SG9A 2W0JA 4RIXB 4S32A 4CZTA 3C5IA 3VS0A 2JFMA 3FMDA 3FE3A 3RINA 3VQUA 4I0TA 3ORTA 2WQNA 3ORNA 4JG6A 3HAVA 2ITUA 4FV2A 4M68A 3R04A 4W8EA 1QPCA 4RG0A 4K0YA 2PK9A 3FBVA 5HNBA 3DLSA 4GCJA 4B99A 2FGIA 3F5GA 3L8PA 5BMMA 4TN6A 2JLDA 3DB6A 4C38A 4R7HA 4F9YA 4BHNA 5A14A 4GMYA 2C6OA 1YW2A 5A3XA 2YM4A 1KE7A 1O6KA 2G15A 3REPA 2F4JA 3CPCA 4FUYA 2NO3A 2I0EA 3R7EA 2R3NA 3T9TA 4PDYA 1JVPP 4GFOA 3GU7A
chains in the Genus database with same CATH superfamily
2VAGA 1UNGA 3PE2A 5IQDA 2HCKA 5CSHA 3FJQE 3KGAA 3A4OX 2QD9A 3DKCA 4Y5HA 1BX6A 4QMMA 1Y6AA 2W1FA 3HA6A 3V5TA 4N57A 2Y4IC 3L8XA 3ZBFA 4CFUA 2FVDA 4M8TA 1MRVA 4O22A 4DBXA 4BTFA 2J51A 2XK7A 2GHLA 4TWOA 3A7IA 2REIA 4J98A 5EW9A 3FLZA 2QO7A 3LCSA 4FSUA 3PZHA 4TNDA 3W55A 4I23A 4JR3A 1J1CA 1XH4A 4YUQA 4FSYA 4NKAA 3PUFC 3ZUVA 2EVAA 2X2KA 5GZ8A 3R00A 1Z9XA 2UV2A 4OW8A 4PQNA 2C6EA 4EOMA 2R2PA 2WD1A 4LL0A 1Q4LA 4BCKA 3RK7A 2C6TA 4MWHA 4OAVB 5JSMA 3N51A 1WVYA 3K5VA 3NYOA 3ORLA 1V0PA 4X2JA 4F7SA 2XANA 2UW8A 3WI6A 2BZIB 3QKKA 5ACKA 5DG5A 3RPOA 3F69A 4D1SA 4YHTA 4ASXA 1OL2A 4GFMA 4O6EA 4AZWA 5KMOA 4ZZNA 3KF7A 4WNMA 3FXXA 4A9UA 3AC3A 2A98A 2VGOA 1K2PA 4JI9A 4O6LA 3VC4A 5EKNA 5E4HA 2YACA 4IX4A 1YI3A 4IZYA 2EUFB 4L3PA 5HGIA 2WTKC 4OTGA 3WF5A 4GFGA 3ZDUA 3MB6A 4JNWA 4EZ7A 4CFNA 5BVWA 5DBXA 4IAKA 3TJCA 2C6MA 4FT0A 5CU0A 4R1VA 2C0OA 4GKIA 5CXZA 1Y57A 4TYGA 1XMLA 1ZMUA 4MD8E 3V8SA 4BDKA 3LW0A 5F20A 2BRGA 3CP9A 3GEQA 3MFSA 4EBVA 3ANRA 3UTOA 3ROYA 3QTSA 3VIDA 3VWAA 3R7IA 4KINA 1MUOA 4WSQA 5J1WA 2NNWB 3DAJA 5ANKA 5ETIA 3HLLA 3VS4A 2YM6A 3OWLA 4U5JA 3ANQA 3EQHA 2XS0A 3Q4CA 3Q53A 3QTZA 4FTKA 4KIPA 1YI4A 4NTSA 4Q2AA 4BZOA 3PY1A 4EK3A 3HUCA 4PRJA 4E3CA 5GJFA 4O0VA 3KL8A 4OTQA 3VJNA 4DGMA 3FQSA 5HLNA 4KBAA 4R5SA 2PUPA 2YIWA 1VZOA 5HE0A 5IKWA 2VNYA 2XH5A 3CY3A 1YXUA 2BMCA 4EOKA 4QMWA 2JAVA 3COIA 3V01A 4PY1A 2R9SA 3CKWA 1P4OA 3D5XA 4PPAA 5JK3A 4FYOA 2HIWA 1OKVA 3CTJA 3UZRA 2BZJA 4GT3A 4V01A 3UQFA 4FBXA 2R4BA 3COMA 3RI1A 4FZDB 4A07A 3IW6A 3L9LA 2BDFA 1KUTA 4L01A 4IB3A 2OXXA 4G2FA 4XV3A 3UMWA 4EKKA 4CXAA 3IOPA 4I6BA 2WMSA 3RJCA 4Z7GA 5J5TA 5KMLA 2NRUA 4FYNA 2YZAA 5LVOA 4O7TA 5M09A 2PMLX 3FZOA 3G6HA 3U9CA 3VUMA 4MXCA 1WBWA 3OY1A 4O0XA 4I93A 5DRBA 3W2RA 3WF9A 1FVRA 5KBQA 3FLNC 2YM7A 3GVUA 4KB8A 4ITJA 4LV5A 3ZSGA 4C4FA 5IU2A 5K0KA 3W0QA 4OR5A 3FYJX 2F7EE 2H96A 4FG8A 4YJPA 4ZTSA 2DQ7X 5HCZA 4F6SA 3MV5A 2J2IB 3RVGA 3H10A 3LXLA 3KN5A 3LXNA 1H07A 4Z16A 3F2NA 1R0EA 3M11A 3BYVA 3R7VA 1UNHA 3CJFA 3FQHA 1XJDA 1J91A 3EN9A 4AGCA 4EOLA 5LOHA 4EH2A 3QTRA 2QC6A 2QOIA 3R9OA 3QCQA 4BCHA 4LRKA 3PVGA 5D12A 4C4HA 4R1YA 3PFYA 2OF2A 2PZRA 3LQ5A 4FTMA 3BLRA 4XLIA 4OGRA 5J9ZA 4J8MA 4EH7A 4RGJA 3JY9A 4O0SA 1H27A 3VBTA 4NCTA 4I94A 4WHZA 3JR1A 5IEXA 1SZMA 3F7WA 3NNVA 4B9DA 4HVGA 3TI1A 2VWUA 3SLSA 1OVEA 2JKMA 3RWPA 2BILB 2VTSA 3AT3A 3ORZA 5TF9A 3EQIA 1K3AA 1OIQA 3DBEA 2FA2A 3ENMA 2QURA 3VUKA 5GZAA 4G3EA 3WZDA 3IW7A 3BHTA 4W4WA 4FNXA 2C6IA 3RCJA 4FNYA 3FMKA 5GIPE 2GU8A 2PU8A 3I5NA 2PWLA 4FTAA 4O86A 4QOXA 3LFAA 3FZRA 3QQGA 5LJJA 4P90A 5DT0A 5E8SA 1ST0A 4C4EA 2CNQA 2IN6A 3UC4A 1JKLA 1W2CA 3CQEA 3KCKA 4E6DA 3KK9A 3BYUA 4ZY6A 3W33A 2J0MB 4QP9A 2RFDA 2O8YA 3I6WA 2CNUA 1XMMA 2C1BA 4BDGA 4L46A 4B0GA 4UMTA 4DFNA 4MEDA 3ZM9A 5LMBA 3BRBA 2RF9A 3QLFA 4EH5A 3NWWA 4YBJA 2DWBA 3E8DA 4R3RA 4YZCA 2YCQA 3QZHA 2B1PA 3EKNA 3D5UA 4MVFA 5D11A 3PXYA 3A4PA 2VWVA 5F94A 5I9ZA 4FEVA 2BDJA 3QRJA 4C7TA 3GOPA 5IA0A 5JH6A 4ALUA 3F61A 4L9IA 4CGAA 5JGDA 4I3ZA 2ESMA 1BL7A 2YHVA 4H05A 5EW3A 4BCFA 2UW4A 4I6LA 4MXYA 3DBDA 5AUVA 2UZOA 1QPDA 4D28A 3LCDA 1Y6BA 4XHKB 3UODA 4FSNA 3KMMA 3KRXA 2C5OA 4JRVA 4QYEA 4AFEA 4ZTQA 2VTJA 3AD6A 4A7CA 4WG5A 4M7IA 4NFMA 4JT3A 2OZOA 4E6AA 4L3JA 2XAOA 4ZMFA 3TNPC 4RWKA 4EUTA 1UWJA 2JDRA 1UU9A 3FZSA 4EI4A 3BELA 4QDVA 4ZTLA 4R77A 2X0PA 3KRLA 3ZRMA 2WGJA 5AR3A 3QQHA 3ZTXA 3SHEA 2J9MA 3Q2MA 3GI3A 4U3YA 4IHPA 5DNRA 4UN0C 4MAOA 5B0XA 3R73A 3QRTA 4O4BB 1O6YA 4GG5A 3NRMA 4QTCA 5CLPA 3LQ3A 4QP4A 4X2FA 1A48A 4LQMA 3AC1A 3G0EA 5BV3A 5CALA 4NZWB 4OTIA 3LKMA 2YDJA 4QMPA 4MHAA 4LV8A 1H28A 3CEKA 4CRSA 5FLFA 2VTTA 2O0UA 4Y83A 3W2CA 3WIKA 4I0SA 4YP8A 3PYYA 2F7ZE 4KSPA 3UG2A 1G8AA 1OPLA 1KV1A 3WYYA 5E8UA 4JS8A 4JDHA 2YABA 3EFWA 4CLIA 3UO6A 3C7QA 4RSSA 5E8TA 1H00A 1YQJA 4JBPA 1OKZA 3E63A 3ZM4A 4E5AX 2OGVA 3MBLA 1DI8A 2WU6A 1IAJA 1PXKA 2BRBA 2CN8A 3KA0A 4BCJA 5CAVA 2RFEA 3D5WA 4CQGA 4EONA 3BL9A 1Q8YA 2IG7A 2WKMA 5L6OA 3WZUA 4G34A 4I5MA 4EOSA 4TTHB 3DK7A 5L2TA 1H1RA 1GOLA 2UZTA 3OCGA 4A9RA 2PZ5A 3HECA 4H3QA 4L44A 4O0WA 1L8TA 5I9WA 2QOLA 3DFCB 3MY0A 3NUPA 5AIKA 3MN3A 5HESA 4ACDA 3PXFA 4QQCA 5M4UA 4NM7A 3QRUA 4ALVA 4FKRA 5EM8A 1OIUA 4G9CA 3P5JC 1W2FA 2W9FB 3LOKA 2UZVA 2XALA 3EFJA 3NLBA 5CXHA 3PPZA 4TKSA 3L8SA 4GRBA 5LVNA 2WTVA 2H8HA 4BGGA 3BLAA 3BU3A 4AA4A 2XNBA 3OS3A 3R21A 4C2VA 2BIKB 4ZSLA 4EL9A 3GBZA 5M57A 2UW9A 2V62A 4IWDA 4BCPA 4NM3A 3PPKA 4TT7A 2F57A 2C4GA 3DJ6A 1R3CA 5IA5A 3VUIA 3A60A 2XIZA 2WIPA 3ELJA 4RJ7A 2C3IB 5EG3A 2BAQA 3RTPA 2UZNA 2J90A 3R9HA 4LRMA 4EC9A 2PVMA 4ZY5A 3QWJA 3SRVA 5IUHA 4NU1A 3TMOA 4FGBA 1O6LA 1JKSA 1W83A 3LCOA 4J53A 4U0IA 5FQDC 3IOKA 4ANNA 5JKGA 3OHTA 2BKKA 3DU8A 3DOGA 4GW8A 4EQUA 3BLHA 3NSZA 3LLAA 2AQXA 5A4TA 4YMJA 5EM6A 2R3MA 4IX3A 1YHWA 3PWYA 4MWIA 4QRCA 5K3YA 4C8BA 2IVVA 4DH5A 5D41A 5B2LA 5AFVA 3IS5A 2JIUA 2PHKA 1YOJA 3LFQA 4D1ZA 5K0XA 3WF8A 2PVFA 3HV4A 3TL8A 3I79A 4S31A 2OU7A 2A27A 5D7AA 4QYFA 2EXCX 4ZLZA 3V5PA 5TOZA 4JQ8A 3KXHA 3VF8A 3UDTA 2X39A 3AD4A 1RW8A 3QLGA 4P4CA 4LFIA 4QNYA 4I92A 2XYNA 3KRJA 3O8PA 2WIHA 3DKGA 4DG2E 2G01A 3QUEA 1LUFA 2BIYA 3GOKA 4FNWA 4XJ0A 5CQUA 4DFYA 4JDIA 4FI1A 3PXRA 3NUAA 3KB7A 5ANEA 5L3AA 2ZV9A 2JGZA 3CD8A 3IW5A 4JIKA 3C5UA 4A4XA 4YTCA 1BL6A 4LGDA 3QRKA 4RJ5A 3RP9A 5FXRA 3VBYA 2IVSA 3NGAA 5C4LA 4BKJA 4YZDA 4D4YA 3PJCA 3P86A 1W7HA 3R8LA 4YLJA 2GTMA 2C5VA 4QTDA 3MPTA 4BHZA 3K5UA 1JSTA 2WHBA 4DBNA 4F9CA 4A06A 2A1AB 3U8WA 2CMWA 4PF4A 3SG8A 5JFVA 4FL3A 2XMYA 2I0VA 3O23A 5BX0A 1YOMA 5GINE 3ULZA 5IQBA 1M7NA 1H26A 1YI6A 3PXZA 3AKKA 2ZAZA 4FTOA 4GU6A 1GY3A 3UVPA 5HD4A 2OJ9A 2OH0E 5E92A 5BYZA 4BIEA 3A7FA 2GNHA 1LR4A 5AADA 3GCUA 3AGMA 4GL9A 5AEPA 4MF1A 2W17A 4AT3A 4FSRA 2HWPA 4JDJA 1Q61A 3H9OA 4MKCA 4IB5A 1LP4A 4GU9A 4CFXA 3PVWA 3OCSA 3Q60A 4WRGA 4YHFA 2VV9A 4U40A 4PTCA 3TDWA 5HD7A 3E3BX 1ZARA 2OICA 3F3UA 3NCZA 3MTLA 1XH7A 3PY0A 3QYWA 4FICA 4RBLA 3RBWA 4N0SA 2BVAA 3HMIA 5LVLA 1KSWA 2ETRA 2G2FA 3F3ZA 2RSVA 3Q2JA 3MA6A 5FDPA 4ZP5A 3IKAA 5KCVA 4RC4A 5ETFA 4FIJA 3PFQA 5AP7A 3LFEA 3OT8A 3A62A 4EKLA 4FKWA 4K1BA 1QMZA 3TUCA 1DAYA 1PXJA 3PP0A 2O64A 4LMUA 3UBDA 2OIQA 2OZAA 4AAAA 5AA8A 4FNZA 4CV8A 1IA9A 2OXYA 1KE5A 3FHIA 5BNJA 3UP2A 3AG9A 2Z8CA 4BJJA 3CC6A 1UA2A 3Q9YA 2WMQA 2WMTA 2BHHA 3DDPA 3KMUA 4FT3A 4E4XA 5ANDA 4I5CA 2X8IA 4PX6A 2UUEA 5J1VA 4AGWA 2VZ6A 3BCEA 3EQBA 4RZWA 4NL0A 3MH1A 4KIQA 5ETAA 4KD1A 3FUPA 5DMZA 3PRFA 5CS6A 5HQ0A 2AEGA 1AGWA 2WZJA 5ICPA 2WEVA 3QTIA 3UVQA 4F78A 3KCFA 2XNOA 4C3PA 2R3GA 4WBBB 1J1BA 2R3QA 4B6LA 5F1ZA 1YXVA 4QMSA 4U7ZA 4WG3A 3U87A 5HVYA 3MFUA 5CU4A 3FQEA 3R28A 3D94A 3KKVA 1S9JA 4O83A 4V0GA 2R0IA 3PIZA 4XP3A 4UBAA 5JFSA 3FI2A 2HZ0A 3CR0A 5DR9A 4X7QA 3KVXA 3R8ZA 5JQ5A 4ZOGA 3T3UA 4GUEA 3DNEA 4DYMA 3FI8A 4NT4A 3SXRA 1XWSA 1R78A 3MVJA 2W05A 4IC8A 5CQWA 3RCDA 4U6RA 4E6CA 2CLQA 4HOKA 4I5HA 2AC3A 3O8UA 4JBOA 5JEBA 1ZYSA 3UPZA 3PSCA 4YTIA 4HJOA 1M14A 3A2CA 4FV6A 1ZYJA 2ACXA 3LCTA 3OXZA 4WKQA 5D1JA 3UVRA 2W1CA 2XARA 2PUNA 3O8TA 3MJ1A 1LPUA 1OITA 5EYMA 4RIXA 3UIMA 2WOTA 4USEA 3CTHA 2B53A 4FT9A 4FT7A 4JBQA 4D5HA 3C0GA 5M4CA 1OUYA 3HX4A 3FC2A 4IFGA 5IG1A 2BZHB 4FEXA 4DLJA 3F5PA 3O7LB 4I22A 2ZV7A 4DEHA 5E8WA 3AXWA 4YR8A 2R0UA 1TFFA 4WNKA 3F3WA 1CDKA 3LJ2A 2BDWA 5EHLA 2WB8A 4DLIA 1UU8A 4EHVA 4DN5A 2UZWE 3GXLA 4BCNA 4QMQA 4EYMA 4CZYB 3JVSA 4O0TA 2BRNA 2BTRA 4FKJA 4N6YA 4YJTA 2WOUA 2X7OA 4GH2A 3CS9A 3OWPA 3CQWA 1GZKA 5IH6A 5H9BA 5I0BA 4RC2A 4BYJA 3MJ2A 5LCKA 3DGKA 2XNPA 3EQRA 5HO6A 3ZSIA 4Z55A 4AA0A 4AE9A 5FTGA 1XBBA 4X3JA 2RFSA 3UNZA 2JDSA 3UPXA 4BDFA 4CFWA 1PKGA 5CI6A 3LFSA 4FZAB 5HG8A 4AG8A 4CMOA 2C1AA 5AAEA 2R5TA 3OXIA 5CTPA 4Y95A 3C4FA 3CIKA 3QKMA 2X7FA 3VBQA 2FH9A 5DWRA 2I6LA 2WMAA 4ZZOA 2LAVA 3TXOA 3AMAA 3Q4TA 1ST4A 4JRNA 5DVRA 4MCVA 1DAWA 4NW5A 5AR8A 4LOOA 5LWMA 3NFGB 5A6OA 4O1PA 3MIYA 2OFVA 5AP3A 1U54A 4XG4A 4KSQA 3ZLWA 1E1XA 2C0IA 5EQYA 4FSWA 1OMWA 5HICA 1GNGA 4I4EA 3U51A 2B9HA 2XK6A 4EQMA 3H3CA 3FEGA 4Y85A 1Q5KA 4I20A 5ANOA 3SQQA 4PMMA 4ACMA 2GCDA 4IAFA 3HRBA 2RGPA 4XUFA 3KK8A 4UZHA 3JUHA 4F0FA 5J9YA 2VO6A 3SC1A 1CKIA 3SKCA 2B54A 4IB1A 3ZEPA 1FVTA 2VTOA 3FZTA 3TIZA 1BI7A 1HOWA 3KQ7A 3RZFA 4WBOA 4ZJIA 4BZDA 5E90A 3VS1A 4FZ7A 2BAJA 2FSLX 3NW6A 5EI8A 3THBA 4DGLC 1H8FA 2VWBA 4FV0A 5BYYA 3MGYA 4O82A 4IVBA 1U5QA 3UDZA 3KVWA 4TYEA 4M69B 4X2KA 4U81A 1K9AA 1ZYLA 2JAMA 1URWA 5K9IA 3U4UA 4FKTA 5EOBA 4O0YA 4XV9A 4F4PA 5IISA 2IEWA 4C4GA 4FODA 4DE4A 2X2MA 2O5KA 1WAKA 3DAEA 3FL4A 4TY1A 1ZMWA 3I1AA 3MFRA 4FTQA 3VRYA 3VS3A 4F09A 5I3RA 4FEQA 3OC1A 4PPCA 5CVHA 5CZIA 4DEGA 5LWNA 5T68A 4DT9A 1AD5A 3AMBA 2NYAA 1JSVA 1OPJA 3R7OA 4OBQA 4QP3A 1YDTE 3ZRKA 3FWQA 3B8RA 2VTIA 4YO6A 1H25A 4BDAA 4IADA 2O63A 2ZM1A 4RQVA 2HWOA 4CZUA 2ITWA 1KV2A 5JT2A 3I6UA 4HNFA 4PDSA 4HVSA 5AR7A 3TNIA 3IW4A 3TT0A 3A99A 4BTJA 4EHEA 5DGZA 4AXFA 3IDCA 4LRJA 4BR3A 2VX0A 2OH4A 3PG1A 4DFLA 3OXTA 5F95A 3C4EA 5CENA 4FK6A 4O0RA 4ACHA 1UV5A 3QTUA 3PPJA 3RAWA 4F99A 3KXXA 5AV4A 1VLRA 4YGAA 3VULA 5HO8A 1H01A 3TKIA 1DI9A 4MTAA 3VBWA 4B7TA 4JMQA 4NKSA 4CCUA 4O7VA 3JVRA 4O7RA 5FBNC 3WE8A 5HCXA 3JS2A 2UW0A 3FLQA 3I7BA 2W4KA 3FLWA 4JJRA 4UWCA 3NR9A 5K5XA 3GFEA 2XP2A 4FIGA 3E7OA 4IX6A 1Y91A 4X0MA 4D4VA 4QMNA 4RX7A 2IW8A 3TIYA 4ENYA 5BMSA 4K33A 3UIUA 3GCQA 3VUHA 1ZAOA 3FY2A 3KEXA 1XH6A 1GZNA 2UVXA 2NPQA 3HRFA 4KBKA 4MXZA 4PDOA 5I9XA 5KE0A 4ZEGA 3PY3A 4GKHA 2WNTA 3ERKA 3IQ7A 4C0TA 2J5EA 4O4DA 2JC6A 4DEIA 5IPJA 2BPMA 4X3FB 3V5LA 4FL1A 2WQBA 4FV8A 3MVLA 2HZIA 5HU9A 4IWOA 3G2FA 4OT6A 1XH9A 3AKJA 1Q3DA 4WUNA 3Q5IA 3FLYA 3GFWA 4L8MA 4ZS4A 4WIHA 4FTNA 5EQEA 3E3PA 4IMYA 4J1RA 3FZPA 4A9TA 4BCIA 5L8KA 4RFZA 5GJDA 4RIOA 2WTDA 3ACJA 1QL6A 2KULA 2W5BA 2PVKA 3LJ1A 3BEGA 3ODYX 3DKOA 4A4OA 3ZFMA 1X8BA 3POOA 5E1EA 4DAWA 4EOQA 2PE0A 3O71A 4QPAA 4PMTA 3GCVA 3U9NA 1CMKE 4G5PA 5EKOA 3GU8A 1CTPE 2Y6OA 4M0ZA 3U6IA 2CKOA 2FB8A 4IQ6A 2IZSA 1Q62A 4ERWA 2GS2A 5TT7A 1OM1A 2RG6A 1PXLA 1RJBA 4RQKA 5C8MA 2IO6A 1JNKA 3BYOA 1Q24A 2P4IA 3G33A 4ZAUA 3II5A 3F9NA 3BWJA 3UQGA 3F3VA 4QYHA 4IWPA 3FKLA 3G9LX 4QD6A 5A4QA 3P7BA 3R8PA 3JY0A 3FDNA 3E7VA 4LI5A 4R3CA 3H0YA 4M0YA 5IEYA 1G8SA 2OF4A 1SVGA 4ZZMA 4MXAA 3QF9A 4GK3A 2QODA 4FR4A 1PY5A 1YXXA 3R2YA 4HPTE 4GV1A 4PL4A 3W0OA 3QTWA 5CAPA 5DOSA 3LZBA 1PXIA 3BGQA 4NIFB 3VW6A 2C0TA 2J50A 5FD2A 3L9PA 5J7HA 2PULA 1CM8A 5J9LA 2W5HA 3CTQA 4D4SA 4M14A 3BQRA 1Q97A 4FMQA 4O1OA 5CEKA 4UWBA 4YHJA 4UX9A 3D14A 1WZYA 1Z57A 3A7JA 4ENXA 4EK6A 3D7ZA 4FV1A 2UVYA 3R2BA 4RPVA 2J0JA 4TWCA 3AGLA 3RAKA 3HP5A 4RVTA 3POZA 3UJGA 4MQ1A 3VVHA 4CD0A 1V1KA 2WMXA 5EI6A 2GFCA 4BKZA 2I40A 2QU6A 4F6UA 3R1YA 1PXOA 3K3JA 2VTMA 3UIXA 1B38A 2FUMA 4JQEA 3GQIA 2VTPA 4YC6A 4W4YA 4BN1A 3UQCA 1GIIA 3VAPA 3GB2A 4OTFA 3W0MA 2QVSE 3LLTA 1RDQE 2J0KA 4Y72A 1Q8UA 1XKKA 4NWMA 3ZLYA 2VX3A 3ZO1A 3EN7A 3NUNA 3H4JA 3ZC5A 2GTNA 1LEWA 4C59A 4EH9A 5IQGA 2J6MA 4IZAA 4NW6A 3W2PA 2W7XA 3FMMA 5LVPA 3LJ0A 2GDOA 4JAJA 4JIAA 5IH5A 5LCJA 5DEYA 2YCRA 1V0OA 5FEQA 4RWJA 3MIAA 5C8NA 4NIFA 3V3VA 2PVHA 3EZVA 4R3PA 5AX9A 2OIBA 5IQFA 3D7TB 3RALA 3EYGA 4ZLOA 4AXCA 3UIBA 4E4MA 3KXZA 3RHXA 2EB3A 3C1XA 3ATSA 4X2NA 4FKVA 5D10A 4UALA 4AACA 2Q83A 2XM8A 5ANJA 3LE6A 2UW5A 5M4IA 2CPKE 3TDVA 2Y4IB 3PUPA 3R7GA 4FKOA 4P5QA 4YBKA 5GJGA 5TR6A 3ET7A 1NA7A 1BYGA 4EOPA 2XB7A 4LUEA 5CNOA 4DDIA 3EQFA 3OZ6A 4RA5A 2ITOA 4TZRA 3DFAA 3EFKA 2ITQA 4DGNA 2XCKA 3NNUA 4K6ZA 4QQJA 1PXPA 4EWQA 3QQLA 4CKJA 5AM7A 3ZS5A 4O4CA 4II5A 3DQWA 2BRHA 4BIDA 4MQ2A 2ZB1A 4YTFA 4XH6A 2OSCA 3AMYA 5KUPA 5AIRA 4X2GA 5IUGA 1W8CA 5AAFA 5KZ0A 3F7ZA 1WBOA 3EMGA 5DN3A 5LMAA 4FKIA 1F3MC 4UWYA 3H0ZA 4GVAA 3W0NA 2HENA 2E9UA 5HIBA 3N4VA 1TKIA 5A54A 1G8KA 5A6NA 2PVLA 4F08A 4U45A 4MXXA 1W84A 4H36A 2IW9A 4WD5A 1TQIA 2OJGA 3GNIB 2XEYA 4RFYA 4U9AA 4NFNA 4O96A 4ASZA 2J0LA 5KKRB 5DR6A 4QMVA 3U6HA 4FOBA 1FPUA 4L45A 4TPTA 3DBCA 3LFBA 5E1SA 3SOAA 2GHMA 4OTRA 5B2MA 4X3FA 3F6XA 4IAAA 3DPKA 3MW1A 4OBOA 5B2KA 5HO7A 5EDQA 4FRFA 1YDSE 3EN6A 1NVRA 4HVHA 5DA3A 5C8KA 5JQ8A 4L7SA 3UDBA 3NS9A 2CLXA 5DPVA 5H3QA 2ZDTA 3GT8A 4XP0A 5C1QB 4ZTRA 1XQZA 3PXKA 5AUWA 3PA5A 3QKLA 4H58A 4YJNA 3WF6A 3ZHPC 4BCGA 1WBTA 3MWUA 2Y9QA 4U44A 3BHYA 3V6RA 4BJJB 3GCSA 4FTTA 3RPSA 3LXPA 2O65A 3R63A 2JFLA 5M56A 3TZ9A 3CLYA 3E62A 2YFXA 3WILA 3R8VA 2WQMA 3MY5A 3HMNA 3Q9XA 3V04A 5M06A 4AZSA 3EZRA 3ZO2A 4U80A 5FWKK 2GNJA 2QR7A 5FTOA 5CSPA 2XK9A 4PL5A 4N4SA 4QO9A 3W0SA 3IDBA 4RC3A 1KE9A 4BWXA 4ANMA 4F0IA 4O4FA 4TYJA 2CDZA 3WF7A 3C0IA 4RIWA 2W9ZB 2QOBA 5TKDA 4BVUA 3EQDA 2YERA 4AGDA 4EH4A 4FA2A 1NW1A 5E8ZA 3RNYA 2W5AA 1YDRE 2BAKA 2GFSA 3D0EA 4HGTA 1Y8GA 2X9FA 4DF3A 1FOTA 1I09A 2QKRA 5HE3A 2CJMA 3R9NA 2XNMA 4DEAA 4DCEA 3KF4A 2B52A 4QPSA 4XG3A 3WZKA 1R0PA 5BQ0A 2VNWA 3KIOC 4NK9A 4C3FA 3SOCA 4O0UA 2YJRA 5JZNA 2GMXA 4CV9A 4ZLYA 5FUTA 2PMIA 4XG2A 5DEWA 1WBVA 2ITNA 2JIVA 1FMOE 1H4LA 3NNXA 4LOPA 4QTEA 4XP2A 4O81A 2C6DA 5BUIA 3VHKA 5AR5A 5FXQA 4BWPA 4DINA 5I9YA 5J95A 3DXPA 5JRSA 1RE8A 3KXGA 3PJ2A 2Y0AA 2OG8A 5AAGA 5LXMA 3QQKA 3N9XA 4IVCA 3UNKA 5A9UA 2YDKA 2ITYA 4HNIA 3FMLA 2GSFA 3FC1X 4K18A 5TO8A 3TV6A 1F5QA 1NVQA 4XMOA 4CFVA 2WMBA 3DJ5A 2XZSA 2YIQA 1OKYA 4JL9A 5AP0A 3TG1A 4ANBA 5AUZA 4BBFA 4BC6A 3BE9A 4YLLA 1GZ8A 1W82A 4RVMA 3ZCLA 4CTCA 5C9CA 3O51A 3FZ1A 2XF0A 5CSVA 4Q5HA 4EH3A 4QP8A 4EH6A 2XIRA 1OL1A 3CGFA 3OVVA 3BPRA 4H3BA 4YZMA 4AOTA 3BYSA 3O17A 4JXFA 4KKGA 3Q96A 5E8XA 3ROCA 5CAQA 2ITXA 4BICA 4JVGA 4F9WA 1NXKA 3HNGA 4CMTA 2Q0BA 3PLSA 4DFUA 3CXWA 4FV4A 2UVZA 3QHRA 2PY3A 5FEEA 2B9FA 3V5QA 5DYJA 4RMZA 4L00A 4E1ZA 4IAZA 1JPAA 1IASA 2VTHA 4KIKB 3VW8A 2YEXA 3R02A 4RJ6A 1JBPE 5AX3A 1U59A 3E5AA 3DBFA 3DV3A 2XK4A 4S30A 5BVKA 1QCFA 1G3NA 3BU5A 1SNUA 4LGHA 5ETCA 5CEPA 4DCAA 2B7AA 3ODZX 2XYUA 2WTKB 4FSZA 2CSNA 5IUIA 3L8VA 5FP6A 3D83A 3AT4A 5L4QA 4PTGA 2ERKA 1VJYA 2VO7A 2X8DA 3Q4ZA 2PE2A 1XHAA 3ZU7A 2R3OA 2CCHA 4EK4A 4FGRA 4U43A 5CSWA 4ZTNA 2XNGA 3E92A 3FSFA 3O2MA 2GPHA 4BI2A 4M84A 3LQ8A 4R