3BV3A

Morpholino pyrrolotriazine p38 alpha map kinase inhibitor compound 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
338
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Synthesis and SAR of new pyrrolo[2,1-f][1,2,4]triazines as potent p38 alpha MAP kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 338
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bv3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bv3A01
4EK8A 3EFJA 5DI1A 4GS6A 4JG8A 1OM1A 3DKCA 3DXQA 2YACA 4FEVA 5E7RA 4F9WA 2FH9A 3KXHA 5A6OA 2F7ZE 3QRIA 4A9YA 4R78A 2GPHA 3FPQA 2RFSA 3AT2A 3H9OA 3FXZA 4DHFA 2XB7A 3QQLA 1IG1A 1E1VA 1YXSA 3GFEA 5HKMA 2YDKA 4MHAA 3KRRA 4D2SA 4KD1A 4EKLA 3OXTA 2OIDA 3TZMA 4F1OA 4DH1A 3SW4A 4CKRA 5E8SA 4USEA 2XK6A 3HL7A 3LAUA 3PA4A 1Q8WA 3BBTB 3DKOA 2R3JA 1Q8TA 2R3GA 3P7BA 3BV2A 1YKRA 4PWNA 3TUDA 1ND4A 5AP7A 3EHAA 4AW0A 1KWPA 4KNBA 4U43A 2QKWB 5CS6A 4RPVA 4I93A 4R5SA 2WMRA 4U44A 4CT2A 4HZRA 3ULIA 4E4XA 2OO8X 3F3WA 2VO3A 3QA8A 4A7CA 3QLGA 5AIRA 3PY0A 5KHXA 4JQ8A 2IN6A 4U40A 4WD5A 4D2VA 3MESA 4DG3E 3AT3A 4LL5A 3O8PA 3KVXA 5K3YA 2WD1A 3IPHA 3O8TA 2R3PA 2YM4A 4GYIA 4MVFA 3ZDIA 3ORPA 3I7BA 1V0OA 3R9HA 1YOLA 4FT3A 3FLNC 1Q3WA 3DB6A 4JRVA 3U9CA 3FYKX 4ORKA 5L4QA 4M3QA 3T9TA 4AZWA 2WQBA 3F5PA 3LXLA 4YPSA 3UOLA 3ZRLA 3DQXA 3EJ1A 3F2AA 3SRVB 2UW5A 3TACA 3UOKA 3KREA 5IA0A 3C7QA 3C4ZA 3FEGA 4RX8A 4JDHA 3NNVA 5HG8A 1SVEA 3BU5A 1OIRA 2PVFA 5HBHA 4IQ6A 5LCKA 4S30A 5KHWA 3VUTA 1AGWA 2I40A 2Y9QA 2A27A 4ID7A 4QQ5A 2UZTA 4GK4A 4QNYA 5IQAA 3ZEWA 1ERKA 4GFMA 4LGGA 2OKRA 3D7ZA 4PNKA 3QQGA 1H07A 1Z57A 4OAUC 3LJ0A 3GOPA 1KOAA 1W7HA 3PUPA 3VNTA 4NM0A 5FXSA 4ANBA 5M51A 2X1NA 3IK3A 4MXXA 4RC4A 1JAMA 2I0VA 5M4FA 5J1WA 3CD3A 2W5AA 2CGWA 3QBNA 4G31A 2B0QA 3SOCA 4YHJA 2BTSA 5HIEA 4PTCA 3QD0A 5CU2A 4AGUA 3C0IA 1K3AA 3A8XA 4EL9A 3DDPA 3FSKA 2CCIA 3DJ7A 3FMEA 2PMLX 3I6WA 4EH4A 5DT4A 3B2WA 3QA0A 2C6KA 5FTOA 5KE0A 5KMNA 3T3VA 2O64A 2JKKA 2C5VA 4D5HA 3E92A 2F9GA 4CZYB 5CSPA 3C5IA 3DLZA 5AMNA 2W9ZB 5EG3A 5AX9A 4NIFA 3KF4A 4NUSA 3RKBA 3U51A 3VC4A 5A4CA 3PWYA 3OC1A 3DV3A 3BBWA 3QQJA 5B2MA 4CQEA 2R3QA 4I23A 3UVQA 5LMAA 5IF1A 3EWHA 3RPYA 2WTCA 2J90A 3TNWA 4BTMA 2V5QA 1SVGA 3W8LA 4DYMA 4AW5A 2YEXA 4IHPA 4FKSA 3FZPA 3HMMA 4PUZA 2R3HA 3R2BA 3QCSA 4XLVA 4GVJA 5CSVA 4QMTA 5L2WA 4XV1A 3R02A 4ASZA 2X2KA 4FK6A 1Y6AA 4NEUA 2RKUA 4C02A 3FL5A 5HX6A 4FE2A 1DS5A 3IQ7A 3OT3A 5CF8A 1ATPE 3R9OA 4ZY4A 2QNJA 4EZ3A 3ACKA 3OCSA 2YDIA 4ACDA 4ZOGA 2QURA 4XUFA 4RJ3A 2BHHA 4Y46A 3KMWA 3QUEA 2OJ9A 3I6UA 5EW8A 5ANEA 4UWCA 4FKJA 4BKJA 4FTAA 4G1WA 4S32A 2PVKA 3Q04A 2H6DA 5DR6A 5CQUA 5GIPE 4UMTA 4W9XA 4O7WA 2YLEA 5AEPA 4MKCA 5ACKA 5M53A 4TYIA 1PMVA 2WMVA 3FHIA 1PXLA 4O7LA 5ANJA 4QP3A 3NUSA 4QTDA 3R1YA 4AX8A 4E5AX 2PE2A 4RC3A 5K4JA 3NAXA 3ZZWA 5CU4A 1WAKA 3CIKA 3FC2A 3EN6A 2W4KA 5BVFA 1PXJA 4NFNA 2OSCA 2VWUA 3D5UA 3MFSA 4YJOA 3R7UA 3V04A 3W16A 2ITZA 2BIKB 3COMA 1MQ4A 3CC6A 5DVRA 2CNQA 5I9YA 3E8NA 2XK8A 3EN7A 5BVOA 2CKPA 1CTPE 3RMFA 5I9UA 4TPTA 2I6LA 3OOGA 5H2UA 3UPZA 3CTHA 2XP2A 4CG9A 4I21A 1U59A 4Y73A 5EYCA 3TNHA 4NL0A 4ASEA 4JAJA 5BMMA 3P86A 4XRLA 4LM5A 4L7FA 2YABA 3CY3A 5E8XA 4F65A 3UP7A 2VNYA 3FLQA 4IDVA 1ZYSA 1JQHA 2H96A 3PSBA 4M66A 5FRIA 5HIDA 3TKUA 4F70A 4BCQA 4DN5A 3TIZA 4IAAA 1ZZLA 5HEZA 3HUCA 2XKDA 4YZDA 2HXQA 5L6OA 4QP2A 4CCBA 1UKHA 1KE5A 3LFFA 3OS3A 3RM6A 4XRJA 2OJJA 3MTLA 3QYWA 3BWFA 1H28A 3DJ5A 5DOSA 3S4QA 4C4JA 3W1FA 5D10A 4ZS4A 4WG3A 4FTTA 3HV7A 4OT5A 4BHNA 5HO7A 4NW6A 2NNWB 1TQMA 4FKWA 3AC5A 3ANQA 4LG4A 4F64A 3SD0A 2ZVAA 4WG5A 3EIDA 3NIZA 4FV3A 3BV3A 3ZMMA 2Z7SA 2B54A 1G8AA 3WI6A 3JYAA 4AT3A 3DCVA 3VHKA 1NXKA 4FKVA 2V7AA 3PG3A 4L45A 3HMNA 4TN6A 4IC8A 3DB8A 3LFBA 4O0UA 5JGAA 3DBQA 4DTBA 3ET7A 2C3IB 4MXYA 4JR3A 2C5YA 2QHMA 3M2WA 3EKKA 3KMUA 1A9UA 3DY7A 1CKJA 3SA0A 3GC8A 4RJ4A 4FX3A 4FT9A 5CALA 5I9XA 4O7YA 3PIZA 5AUZA 3R9RA 4O0WA 4O21A 5IA5A 3R01A 3SKCA 5KO1A 3ATTA 4DEAA 4GRBA 5HO6A 4EBVA 4FT5A 1R78A 4GT5A 3MIYA 5FXQA 2G01A 2Y8OA 3CGOA 2W1EA 2PE1A 5CAOA 4FSRA 4G6NA 5F94A 2O8YA 4WNOA 4ZTMA 2GHGA 1QPEA 2PSQA 2Y4PA 3KULB 4BCNA 3VBYA 3LFCA 1CKIA 5AP4A 3A8WA 4RFMA 3THBA 5CF6A 4YMJA 4O82A 3ZM4A 2HK5A 4O27B 1KV1A 1Q8ZA 2WZJA 5DA3A 1KE6A 4HGSA 4G9CA 1XR1A 2F2CB 5JRQA 3ELJA 1OIQA 4F6UA 4RQKA 4E6DA 4CSVA 3DK7A 5M56A 3UQFA 4BKZA 4IWPA 3BGZA 3HDMA 3CKWA 3TT0A 4CFVA 3HKOA 2EB2A 3SXRA 4H3PA 3L9NA 5EM6A 1YXVA 2ITVA 5LVLA 4CXAA 4OTQA 3UVPA 3UODA 5JRSA 2FO0A 4U5JA 1WBSA 4BR3A 4KIQA 3SLSA 4KRCA 2W05A 4FZ6A 3DJ6A 3IW4A 4HGTA 3EQRA 2E2BA 3UMXA 4RC2A 4UX9A 3OVVA 3NCGA 1YOMA 5AAEA 4GL9A 3MB7A 3ANRA 3CD8A 5IUIA 4O7ZA 1TVOA 5IUHA 1OKVA 3C0GA 4AFEA 1UNHA 1PY5A 5CENA 3RK5A 3QTRA 3V5PA 4S34A 4UXQA 4QTBA 3WF6A 2XKEA 4FODA 4EH3A 4C7TA 3FMHA 2UW9A 1DAWA 4BYIA 2VTMA 4A06A 2YAKA 5E1SA 2VTQA 3P7CA 5GHVA 3O17A 2OJGA 2KULA 3PXYA 5ETFA 3HX4A 3SGCA 4MX9A 4ZZOA 2ITQA 3ORXA 3BPRA 4JDJA 2RF9A 3MDYA 2P2IA 2OG8A 1O6LA 2GS7A 5FEQA 1QCFA 4QYFA 3BRBA 2PMOX 4LRJA 3FMLA 5E8VA 5AUXA 1V1KA 3AMAA 4X6QC 3BU6A 2C1AA 4MXOA 3C1XA 5ANGA 5F9EA 4PNIA 4OTWA 3HV4A 3EN4A 1P14A 4EC9A 2GHLA 1IAHA 4DT9A 4EJ7A 4F9CA 1RQQA 3KL8A 3LXPA 3BI6A 4JNWA 4NFMA 3WIKA 4C3PA 4HGEA 3QTZA 4UMUA 4PQNA 5HNGA 1CDKA 2BRMA 3KRLA 2X8EA 1P5EA 3RINA 3P78A 4KB8A 3ENMA 4YZMA 3RAWA 2QOFA 5EKNA 2XBJA 2XNEA 2ZB1A 4GG7A 2Z2WA 5H8BA 3QRTA 2YIQA 4BCHA 4C33A 2C6MA 5CU0A 5AR5A 4CFNA 2G15A 4BDFA 3BHTA 2JKQA 2UVZA 4H58A 2R3OA 3DNDA 4IFGA 4YTHA 1A48A 3EYHA 4QMZA 2IW6A 4AUAA 2IZUA 3F2NA 3EQIA 3P0MA 2YLFA 4O2PA 3R7VA 4C61A 3TDWA 3OCGA 4YJPA 4IZYA 3GUBA 4IWDA 4BCOA 3ACJA 1ZY5A 3AD4A 3NAYA 2YJRA 3PWDA 3LCKA 4FV5A 4IAKA 3V5QA 4E20A 3BEGA 1PKGA 1M17A 2YJSA 2VWBA 3R63A 3TI1A 3UPXA 4BGQA 5JFSA 3LW0A 4FL3A 5IEVA 2YERA 2JBPA 4H1MA 4USFA 4JG7A 2OIQA 3JUHA 4UB7A 4AZFA 4DFLA 5KX8A 3R8MA 3NYNA 4ACGA 1Y91A 2OFUA 4WA9A 3AGMA 4FZFB 4G9RA 4UMQA 3QC9A 2Q83A 3TDVA 4OTRA 3CXWA 4H3QA 2YIYA 2XRWA 3AD5A 4P4CA 5ANKA 4RFYA 3W2PA 2XM8A 4FSTA 3WE4A 5C03A 5M44A 4J98A 2WMSA 2W1GA 2JDOA 2XVDA 5KNJA 4FNWA 1GZOA 3A7FA 1M2RA 4JX3A 1SZMA 2PTKA 4JS8A 1WBTA 5BYYA 3S0OA 2R3MA 2BR1A 1H0WA 4IX5A 4E73A 2BAJA 3Q9YA 4CRLA 1YI4A 3LFSA 4WNKA 2C6LA 4DG0E 4V0GB 4I94A 5CY3A 4K2RA 2WMBA 4EHZA 4FMQA 4FTUA 2VTRA 2YCQA 1DI8A 3V5LA 3LXKA 3GENA 3ZU7A 2O5KA 4GEOA 4JDIA 4RG0A 3PZEA 3EFKA 4R8QA 3R7EA 2B4SB 4J71A 4Y5HA 5HVYA 3UIBA 4KSQA 5AUWA 3FKNA 3ORTA 5L8KA 2B9IA 2I1MA 5AP5A 4M0YA 2PUPA 4DINA 5M06A 2RFEA 4YSMA 3SXSA 5M57A 5KKRB 4J1RA 1PXOA 5CQWA 2OF2A 1R3CA 5DIAA 4RIWA 4X7QA 2CGVA 5FM2A 3VBTA 4O7SA 2W1DA 1YWRA 4Z7HA 4NYEA 3LOKA 4F9BA 1BI7A 2XCHA 3HP5A 2RGPA 3L9PA 4ERKA 4E93A 1CMKE 3MY0A 5IH4A 2QKRA 4MK0A 4XHKB 4NJDA 2EXEA 1Q3DA 4I0SA 1S9JA 2ITNA 4H36A 4O0YA 5D7AA 2OIBA 4FTMA 2JFMA 3I0QA 4WSQA 5F4NA 4ARKA 2RL5A 4BN1A 4AQCA 3FI3A 4M12A 1WBOA 3DS6A 3G2FA 4EH7A 4AZSA 4PF4A 2Z7LA 4QPMA 3H3CA 2FSTX 2NP8A 2OBJA 2VTIA 3MPMA 3LVPA 4NW5A 4EC8A 4ZAUA 2IG7A 3MVLA 3TXOA 3ZCLA 5J1VA 4KS8A 3IGGA 4KBKA 4KIKA 5CXHA 4DGMA 1XQZA 1U5RA 3KCFA 4ONAA 2E9NA 3TUBA 1GAGA 3C50A 4M84A 4QQCA 1OVEA 3FHRA 4KS7A 3FDNA 3ZXZA 3H0ZA 3I60A 3ZO4A 4BIDA 1UV5A 5BVNA 5ACBC 4ZTQA 5CXZA 1ZZ2A 3ORZA 3D5WA 4U6RA 2HZ0A 4QP4A 4WT6A 3R1NA 3UOHA 4XEYA 4TYHA 4W8DA 4IEBA 4DFYA 4Y95A 5IMXA 4IBMA 3GP0A 4D2WA 4TYHB 5CEQA 4S33A 1H1QA 5GJFA 3W32A 4IANA 3RCJA 2C6OA 3LQ5A 2HY0A 5IKWA 4M69A 3NNUA 3FMJA 3M42A 4FOBA 1YXUA 2EWAA 3E8DA 3FMMA 3HRBA 2W4OA 3BHYA 5ETAA 2JKOA 4LFIA 4M69B 1KE7A 5GINE 3O7LD 2BZKB 4HYHA 3OY3A 3D9VA 2A1AB 4OBQA 4RGJA 4RSSA 4TWOA 1Z9XA 4FTOA 3DLSA 4NSTA 3LFNA 3UG2A 3QUPA 3Q4TA 4IVDA 3V5WA 4DG2E 1LP4A 2P3GX 1PXPA 2X4ZA 3QTUA 2WNTA 2UZEA 1M7QA 3FWQA 3NUYA 4FSMA 3EB0A 4XP3A 1PXIA 1YHWA 3ZEPA 3G6HA 3V8TA 5J79A 3PA3A 4BHZA 5AR7A 3QCXA 1OL1A 2JDVA 2Y4IB 3GEQA 4FKUA 1KSWA 4DT8A 2X0GA 2XM9A 3ENHA 3QX2A 3LZBA 5L8JA 4FEQA 3JY9A 5IDPA 4QP9A 1OKYA 4WSYA 5J7HA 2OZAA 3LQ8A 4L43A 3O96A 1U54A 3H4JA 4OTPA 1IEPA 3F61A 4AA0A 3R73A 3LMGA 3NPCA 4PMMA 5EH0A 2XNBA 4TT7A 5FEDA 4MNEB 4HPTE 3GU8A 4FR4A 2R3FA 4CT1A 4NKSA 5HESA 3Q32A 4WG4A 3QZIA 4ZZMA 4DEBA 3F5GA 4DH7A 4E26A 4EWHA 3CQUA 4ZJVA 1MRVA 1M7NA 2VTNA 5DE2A 3RP9A 3PA5A 4ASDA 4RLKA 4WRSA 4CRSA 1Q8YA 3LCDA 5H8EA 5IU2A 3WF8A 4O83A 4E6QA 4JX7A 4Z16A 4ZLZA 2VO0A 4PL4A 4JDKA 5I4NA 4H3BA 4C4HA 5LXMA 4TZRA 5AP1A 3MPTA 3FMKA 3S1HA 5F20A 1H1SA 2IZSA 2ERZE 3OG7A 3POOA 5K5XA 4YTFA 3QRUA 5CAVA 3LM5A 4RVLA 4DFBA 4O91A 4BB4A 4YJUA 5IH5A 4FIHA 1OZ1A 4QPAA 3G33A 4LQMA 3EL7A 4IC7A 4XG2A 4XX9A 5CVFA 2FUMA 4PV0A 5DT3A 3UC3A 2HELA 3PY3A 1OKZA 4UZHA 5DLSA 5AX3A 2PZRA 4UEUA 5IQCA 5EYDA 3MJ2A 1XBAA 3SOAA 3I5NA 2REIA 1XKKA 2UW8A 4R7HA 4A9TA 4D2RA 1O6KA 2RFDA 3NW7A 5AA8A 2R3KA 3Q52A 2JAMA 4PRJA 1T46A 3UBDA 5A4TA 4J8MA 4OAVB 3WF7A 3SHEA 1GZKA 1RW8A 1JNKA 3GC0A 2Z8CA 4RIXB 4LUDA 5JGBA 3GCQA 3MV5A 4FSWA 2YM6A 4XP2A 4BICA 4CZTA 3ZLXA 3A7HA 1MUOA 3CEKA 5D11A 4ZSEA 2IVVA 4FYNA 3O7LB 3ZC5A 3IS5A 1R39A 5HG7A 2QLUA 4AOIA 2PZIA 5HHWA 5K0XA 2QO2A 2FGIA 2ZYBA 3PE2A 2C5NA 2XEZA 5EQPA 2CMWA 3PP0A 3TKHA 2PZYA 4GMYA 3VS0A 1REKA 2SRCA 2P33A 3FZTA 4XBRA 5J8IA 4MWIA 3RZFA 5A6NA 1J7IA 2OGVA 3RWQA 3SG8A 4DGOA 2YFXA 3AMYA 2UVXA 3GQIA 3IDBA 3VS4A 5HU9A 4JQ7A 4IWOA 3QU0A 2VTHA 2V62A 1IRKA 2UZBA 2W96B 3II5A 2R4BA 3TUCA 3F3ZA 2ZM4A 3DZQA 3PSCA 4UV0A 2R3LA 3GNIB 2J50A 5FM3A 4BDHA 4RWLA 5HTCA 2E9PA 1W8CA 2QI8A 5IQBA 2C47A 5M07A 2J0KA 3KXGA 4W4YA 4CVAA 2IJMA 4BBEA 4YJQA 5CSXA 2QO7A 3ETAA 4FV8A 3WIGA 3VUKA 3QGWA 2FA2A 2BZHB 4YP8A 4J53A 1WVWA 5KZIA 4DH8A 4DAWA 3LM0A 1OUYA 2R3RA 1P4FA 4U80A 4AN9A 1J7UA 5FWKK 2CGUA 3VULA 3NCZA 4NM5A 4UZDA 5FBOA 3FC1X 4N70A 4EH8A 1YWVA 3UO6A 3PVUA 5L6PA 2ZV7A 2BAQA 4FKGA 4ITJA 5DHJA 2VTAA 5KMMA 5KUPA 1JKTA 5AWMA 2JDRA 4UWBA 5A14A 2HCKA 2LAVA 3QFVA 5LOHA 3CTJA 4MXAA 5GIOE 4L3JA 4NT4A 3D2KA 3R2YA 3KRJA 2CLXA 2AC3A 2J0LA 2YITA 4YGAA 3DNEA 2R64A 4QMYA 4B99A 5KMJA 3V8SA 1SVHA 1V0PA 2WGJA 2QU6A 4DGNA 3QLFA 1U4DA 2A4LA 5FXRA 4FIEA 4JRNA 1K2PA 4BI1A 2BCJA 4QMPA 5J95A 2ZAZA 1F5QA 4X2FA 4CTCA 3D15A 2O63A 5DRBA 2GS6A 4HYIA 2F49A 3R04A 5D12A 3WZDA 4X2JA 4AU8A 4CD0A 2XEYA 3VRYA 5HTBA 2FSMX 4ALWA 1TQPA 4TRLA 5JT2A 3ROCA 4O7VA 3FSFA 3UTOA 3RJCA 1L3RE 4NH1A 5AP2A 4MWHA 4JR7A 3Q9ZA 2ZV9A 2YWVA 2VZ6A 1H01A 4FIIA 4QP8A 5JKGA 4XV2A 5CAPA 2J7TA 3N51A 3PPJA 3MYGA 1OB3A 1QMZA 4HNIA 4DGLC 3QTXA 3RGFA 2VTSA 3DFAA 3NZ0A 3T3UA 2QLQA 3K54A 3PXFA 2QOLA 3DBDA 5LMBA 1IAJA 3G9NA 4YPDA 4CFUA 3FZ1A 4PTEA 3P7AA 2W17A 2BMCA 5LVOA 4N57A 3KRXA 4ZIMA 4ZXTA 3KN6A 1YWNA 3QALE 2PUIA 3DTCA 3QZGA 3EQBA 4GJ3A 3R8LA 2G2HA 3FMNA 4YJRA 3SDJA 5DN3A 4G2FA 4YNEA 4FEWA 3FLSA 4PDPA 3U8WA 4B7TA 4XG8A 4YLJA 2YCRA 4YZBA 5HBJA 4C4FA 3LHJA 4RIYA 1OITA 3IGOA 4FTCA 4FZDB 4EOIA 1SYKA 1WBVA 3EYGA 4EEVA 2CPKE 5CU6A 1HCKA 1BL6A 5I3OA 2X2MA 4R3PA 3R9DA 4IW0A 3ODZX 3Q2MA 2VWIA 3AC3A 2JC6A 1H0VA 4AT5A 5CF5A 4NIFB 4O7TA 4YJVA 3BZ3A 4DEGA 3LFDA 2C1BA 3ZHPC 3RPVA 3IW6A 3TTIA 3WE8A 5KMOA 4BZDA 4ACCA 1PYEA 3S3IA 5EYMA 5FDPA 5LARA 5M09A 4J95A 4A4XA 2GFSA 1BKXA 1I44A 5CSHA 1LEZA 3BWJA 5AV3A 5GJDA 5ANIA 4F7SA 3A4PA 1GY3A 5BMSA 4F9YA 4XNEA 3EZRA 3OTUA 1FMKA 2XH5A 4JBQA 2PVRA 3I81A 5D9HA 3PPZA 2JIUA 3HDNA 3GBZA 2C6IA 4A9RA 2PPQA 1OECA 5HX8A 4AGWA 4O38A 3BELA 4TYEA 4OTIA 4UALA 5HE3A 3OEZA 2XNMA 2QR7A 3C4CA 3MH3A 3D94A 3FYJX 4I6QA 4YO6A 2BHEA 1PMUA 4WHZA 3UGCA 5BVEA 5J87A 4ZSLA 4QMQA 3PXZA 4M67A 3UIMA 3ROYA 5AIKA 4AOTA 4D55A 3DBEA 3SX9A 1Q99A 3TTJA 5DRDA 4BDBA 5J9LA 4GW8A 3F69A 1ZARA 2DYLA 3C0HA 3DBFA 2X6DA 2ITTA 3QKKA 4IB0A 2VO6A 4NWMA 3E62A 3CS9A 2YDJA 3HYHA 3N9XA 2HAKA 1HCLA 3HV5A 3R8ZA 2XK7A 4CMTA 3R28A 1B38A 4HZSA 5HOAA 3ZOSA 1SNUA 2I0EA 2J6MA 3PLAE 5BUEA 3ZZEA 4HYUA 3KA0A 4QMWA 5TKDA 3BIZA 2VTOA 3REPA 4DTKA 3PZHA 5IEXA 2R0IA 3E8CA 3LFAA 4U41A 4F99A 3MN3A 5FDXA 4OBOA 2NRYA 1BLXA 3KN5A 4O2ZA 2CKQA 3GI3A 3A7GA 4XG6A 1FPUA 4FZ7A 3R8PA 1PMNA 1DM2A 1YQJA 1YRPA 5HD4A 5BVKA 1STCE 5HZNA 3QWJA 4D4RA 1OMWA 2CKOA 3FI2A 3JY0A 4G3DA 3VVHA 2PYWA 5IQGA 4G3FA 5CI6A 5AAFA 2WB8A 2IZTA 3QQHA 1Y8YA 3GQLA 3R7YA 4C3FA 1PW2A 4AA4A 4DA5A 3W2CA 4K1BA 3AOXA 4N4SA 4YHFA 3IECA 5HVKA 5AV1A 2PUNA 1VZOA 5CEIA 4EHEA 4FSZA 3QD4A 4XG3A 2BIYA 1Y8GA 3VN9A 3LMHA 5LJJA 4YO4A 5K0KA 4DLIA 5KBRA 1OI9A 4PTGA 1FGKA 3PXQA 3PTGA 5IQHA 4AACA 2OF4A 3RHKA 4CEGA 3CBLA 2J2IB 3KF7A 4LV8A 2UVYA 3ERKA 3AC8A 3EQDA 3GU4A 3AC1A 4YUQA 3FQEA 5BPYA 4OUCA 3AXWA 3K2LA 2UW4A 3EN5A 2WQOA 4D0WA 4P90A 4U0IA 4U3YA 4F1TA 4LL0A 2BDFA 5CVGA 2CGXA 2WELA 2G2FA 5C9CA 1H26A 2FB8A 4I3ZA 1OL6A 3IONA 4AGCA 4MF0A 3F82A 4K0YA 4BWPA 3LKMA 3VQHA 4HVDA 3NVMB 5IA2A 4IJ9A 4L7SA 5A54A 4BDDA 1NA7A 3HA6A 4Q5HA 4RWKA 4YJNA 4G34A 5ETIA 2OXDA 5E8ZA 2YN8A 4IIRA 2IW8A 4IB3A 3E7OA 3HZTA 4PPAA 2WMAA 2X7FA 4RX9A 2C6DA 4GV1A 3VBXA 5BX0A 3K3IA 3L8PA 3D7TA 4NM7A 4YTIA 2BALA 5B2LA 1YHVA 3GCPA 3R00A 5HG9A 4X2GA 4C4EA 3V5JA 2XIXA 3QGYA 4DFUA 4ZMEA 4NZWB 3MWUA 4F09A 4KBAA 1OIUA 1W0XC 4M8TA 4EK3A 3ZRKA 1ZOGA 3A60A 4M0ZA 4RIOA 3VQUA 3RPSA 4CFFA 3RWPA 1KV2A 1G5SA 3SAYA 2ONLC 4AN3A 4CMUA 1FMOE 3Q60A 5DEYA 4A4LA 1XBBA 4UY9A 4PX6A 1T45A 2XJ1A 2GSFA 3IW8A 3MVJA 2R5TA 3PJ2A 4FTJA 2EB3A 4MF1A 2R7BA 4GG5A 3B8RA 3O71A 4IM2A 2EU9A 4P2KA 5FGKA 4BIBA 4EORA 4D5KA 4FIFA 2BRBA 4GCJA 3B2TA 5HGIA 4C0TA 5LVPA 4C2WA 3FLYA 1JOWB 5AP0A 2J0JA 3E8EA 4OR5A 3NRMA 3NEWA 1OPKA 1JWHA 3OOMA 4FUXA 5AR3A 4BC6A 1E1XA 4OGRA 3BKBA 2VWXA 4HCTA 4I4FA 3S00A 5C4KA 3BHVA 4G3EA 1B39A 4G17A 4UWYA 4FG9A 2JIVA 2CN5A 2VX1A 2ZDTA 4O7RA 1OL5A 2PZPA 3LFQA 3W8QA 5KMKA 5BYLA 3W2OA 5L2TA 4O0XA 3DXPA 4FV2A 4L44A 5H8GA 2VTTA 4F7LA 1W98A 4JIAA 4QMOA 3W55A 3FMDA 4V01A 3RNIA 3EN9A 3ORLA 1UNGA 1WBPA 4OTGA 3P23A 3U54A 4F6SA 5IH6A 2JGZA 3KRWA 2AUHA 4HCUA 3UYTA 2V0DA 3AC2A 4QMLA 4YLLA 2UUEA 4GVAA 4B4LA 2WIPA 1S9IA 2J4ZA 2VWWA 4IAIA 2A0CX 4JXFA 5HG5A 5CEOA 3NGAA 5AM6A 1AD5A 2W1ZA 3Q9WA 3VUIA 4GKIA 5JZNA 4TTHB 1BL7A 4IH8A 3RPRA 5DNRA 3ZYAA 5JEBA 3DGKA 4BTJA 3KXZA 5DT0A 4ZSJA 3PXRA 4X3JA 4M15A 4IAZA 1OPJA 3ZFMA 4ANQA 1Q41A 3SC1A 4YJTA 3OWPA 2X9FA 4MBLA 2F4JA 1IASA 4LOPA 4TWPA 2Z7RA 3WZKA 3EKNA 3Q6WA 5HI2A 4EH9A 4YBJA 1FVTA 3L1SA 3VF8A 5J9ZA 2W1HA 3CLYA 4MD9E 4A07A 5E92A 5AUUA 2UZDA 2WMTA 2WU7A 2QC6A 4CLIA 3BYOA 3GU7A 3C4EA 5KZ0A 2XK9A 3UDBA 2YISA 4O1PA 3NUNA 2W06A 4I5PA 4UBAA 3BLRA 5HTIA 2UW7A 2XJ0A 5EW9A 5EK7A 4QRCA 4D4YA 5CEMA 3NNWA 4I6FA 4KA3A 4F6WA 4J7BA 1GOLA 2F2UA 5FBNC 3U4UA 2WTJA 4AAAA 4Y85A 2WEIA 2OK1A 4O1OA 3BYVA 1E9HA 5CANA 3SVVA 2J0MB 4BI2A 4DLJA 4MXZA 3F2RA 3MJ1A 3Q5IA 1JBPE 2BKKA 4FUYA 3NMUF 4I92A 4IZAA 3R8VA 2ITOA 3WYYA 1FGIA 1WCCA 3CPCA 5L2QA 4MYGA 2R9SA 1PXNA 4CFMA 1J3HA 4X3FA 1PJKA 5IMEA 3COHA 1Q24A 5DGZA 3WF5A 3KEXA 4EONA 3AT4A 1Q61A 2HY81 4CYIA 2GNLA 2VRXA 3VUDA 4XS2A 3O51A 2YIWA 3NUAA 3FXWA 4IAFA 3PVBA 5BQ0A 3VRZA 1YDTE 2X8DA 2XIKA 3MW1A 4LMUA 4PY1A 2DQ7X 3I7CA 4MAOA 5FG8A 3VUMA 3IDPA 4AS0A 5AA9A 3DTWA 1V0BA 1J1CA 2OJFE 3PXKA 3MA6A 3CKXA 4GIHA 3EFLA 5GZ9A 4D9UA 3Q4UA 2BAKA 2FSLX 2LGCA 4IJPA 2XIYA 2VNWA 3NNXA 3FI4A 5B2KA 2OFVA 3LMIA 2JFLA 4EOLA 5CI7A 2GQRA 4L67A 4FKPA 2YCSA 4B8LA 4EZ5A 3MVHA 4ENYA 2GS2A 3MB6A 4G16A 4ZTNA 2W9FB 1JKSA 1XH7A 3P79A 4HYSA 4BCIA 3NYXA 3JS2A 2Z7QA 3OBJA 4RA5A 3SQQA 3CPBA 1ZLTA 2WQEA 4J97A 4ZLYA 3ZS5A 1R0PA 3VBWA 2YIXA 4WRGA 5DWRA 4CV8A 2ZJWA 2HOGA 1FINA 3BYMA 4FNZA 4DCAA 2PVNA 3Q6UA 4F7NA 4Z7GA 2CLQA 3CJGA 3QWKA 4AW1A 4YZCA 4C35A 5A4QA 3RAHA 4R77A 3OXIA 3FZOA 4G3GA 3OFMA 4RIWB 4E5WA 3V3VA 1ZRZA 4FT0A 1I09A 4O0SA 4EOKA 2C68A 2J0IA 1M2QA 1NVQA 3QKMA 4HVIA 3DOGA 4KIPA 3H9RA 2YWPA 4JBVA 1IR3A 3DAKA 3OUKA 3H10A 4HJOA 4EK5A 1NVRA 1P2AA 1XH9A 4AZTA 2E9VA 4ZTHA 5ANDA 3D14A 5B7VA 3V01A 3PJ8A 4BKYA 2F7EE 4A4OA 3BE9A 4EWQA 4TKSA 5CZHA 4GFGA 4AGDA 4QMMA 4D1XA 5KMLA 5E4HA 3HV6A 4QOXA 2ERKA 1SMHA 2R3IA 4E1ZA 5FP5A 2GDOA 4FT7A 5FTGA 4YC8A 4KKGA 1BUHA 1ZMWA 3WILA 3U87A 3O50A 3ZDUA 4CGAA 3F66A 3RZBA 4GFOA 1H8FA 5G1XA 4BZNA 5ITAA 4O0VA 3A61A 4KIOA 5EOBA 3RAKA 4ALUA 2V7OA 3MIAA 3QCQA 1PXKA 1Q4LA 3R30A 4YURA 2J5EA 2ZMDA 3M11A 3EQFA 5EM7A 3TV6A 3MGYA 2O65A 1JSUA 1YOJA 2RIOA 3ODYX 4KIKB 2Y6MA 4ITHA 5CSWA 5TF9A 3OY1A 1ZXEA 2IW9A 4N6ZA 1H27A 4LOQA 4D0XA 1RDQE 2ETKA 4LRKA 5HNIX 4X3FC 4RVKA 1GIJA 3QF9A 2VN9A 3BE2A 1BI8A 2UZUE 4I1ZA 3SV0A 4XG4A 3KXMA 4HOKA 2WTIA 5D7VA 3SXFA 5JQ8A 4IX4A 5IA4A 3P4KA 4O6EA 3UOJA 3C13A 3CE3A 2X7OA 5JK3A 2WHBA 3O2MA 3TG1A 3U6IA 1G8SA 4TWNA 5K5NA 3G90X 3RBWA 4GSBA 4CCUA 4CKIA 3OZ6A 2B7AA 1H25A 1OL7A 4EQUA 4UYAA 2PY3A 1IA9A 4RJ8A 4ACHA 5TOZA 4IM3A 4BL1A 2BDWA 1LR4A 2NPQA 3VS5A 4L6QA 5L2SA 1ZOEA 5FP6A 2QD9A 2GNIA 4ZMFA 4C36A 4UYNA 3MFUA 3HMOA 4U3ZA 5IZFA 4FGBA 2X9EA 3GC9A 4L01A 3HA8A 4YC6A 4FOCA 2JLDA 4IXPA 4DEIA 1PRYA 1J1BA 4II5A 4W4VA 3M1SA 3RPOA 3FLWA 4S2ZA 4XCUA 3BU3A 4HVSA 5AUVA 2W5HA 1GZNA 5HE2A 3FY2A 2UZNA 4XJ0A 4B9DA 4FICA 2B55A 2RG5A 4FF8A 2QODA 4BWKA 2G9XA 4ENXA 5IEYA 2WOTA 3QQFA 2WAJA 2C69A 5HLPA 4TNDA 5T68A 2AC5A 2WTKB 4R3RA 4BDEA 1APME 1ZMUA 5J9YA 2WTWA 1O9UA 4EQCA 3KCKA 4FKLA 4PDSA 4X21A 1YXTA 2OZAB 4XG9A 5I3RA 1U54B 3KGAA 3OF0A 4CYJA 4C4GA 4E6AA 1RE8A 2Q0BA 3IKAA 4AFJA 2XKFA 3UQGA 5FD2A 5K4IA 3W33A 1LEWA 4DH5A 2X2LA 3HUBA 5EW3A 2YZLA 2OH4A 3FQHA 1LUFA 1SM2A 4M7IA 2XYUA 3I5ZA 5E1EA 5IA3A 3ORNA 5ANOA 5HE1A 2QCSA 2ZM1A 4EYJA 3A99A 4DGGA 5BUJA 4AZEA 4JBPA 3MH0A 1XBCA 4U45A 5G6VA 4ZY5A 1M14A 2NRUA 1KOBA 2GMXA 4ANSA 3QHWA 1IA8A 2O2UA 4LYNA 4YC3A 3DT1A 1UU9A 4N6YA 5CT7A 3IG7A 2XK3A 2JBOA 3EQGA 4EBWA 4DBXA 4F7JA 2BFYA 4G3CA 4BCGA 4BDGA 2Y0AA 3R0TA 3EQPA 2YM5A 3DAJA 3H30A 3VUGA 4F0IA 3EZVA 4C4IA 2UV2A 1F0QA 4FV4A 4FVRA 4PP7A 4HGLA 4C62A 5M4UA 1NW1A 3CSVA 3TJDA 5ICPA 5JGDA 3WOWA 5LQFA 4Z55A 4DBNA 1GZ8A 3QKLA 3IOKA 3CR0A 3MBLA 1JPAA 4X0MA 4R1VA 4E4MA 4QO9A 1P4OA 2UW0A 3C9WA 5AUYA 2CNVA 5T6KA 2XKCA 3G5DA 3R7OA 2W99B 3FQSA 4ERWA 5LCJA 4C8BA 3L8SA 3WBLA 1VR2A 1OBDA 2XS0A 3LCTA 3E63A 5JQ5A 4KBCA 5EHLA 1DAYA 3VBQA 3BCEA 3PVGA 3U55A 3Q3BA 4AE6A 5CAUA 1PF8A 3F3TA 5IQFA 2QQ7A 4JIKA 3DFCB 4QMXA 4G5JA 2PUUA 5A4EA 3KQ7A 4MBJA 5FTQA 5J5SA 2VTLA 3KU2A 4RX7A 4FYOA 4WKQA 2BVAA 2CKEA 3AQVA 3FL4A 1G3NA 4WUAA 3TZ9A 2J9MA 4PMSA 3PYYA 3LQ3A 3ZO1A 3VS1A 5EQEA 2GNGA 4QP7A 1XO2B 2BZIB 2Y7JA 2PVLA 3LJ2A 1M52A 3ZSGA 2H9VA 3QXOA 3FZRA 4WBBB 4FV0A 4C37A 4L8MA 4C59A 4D28A 4J52A 4U79A 4WIHA 1J91A 3QZHA 3U9NA 2X4FA 3KKVA 5TR6A 3ZFXA 4BCMA 4PL5A 3OXZA 2XF0A 4GIIA 1H4LA 2WMUA 4XP0A 2Y4IC 3C4FA 3PPKA 3D5XA 3W2QA 1OUKA 4AP7A 2B1PA 2GU8A 4ZSGA 4XMOA 3BLQA 5M55A 3RK7A 3S2PA 4E5BA 3NYVA 3V5TA 4IB5A 3NUPA 1XH4A 5AR4A 1Q5KA 3DKGA 3ZSIA 5HU3A 2JKMA 2O0UA 2OI4X 4RA4A 4QQJA 5CNNA 5EKOA 4IWQA 4AA5A 4C58A 5DG5A 3MI9A 2WO6A 3HECA 3KB7A 4RBLA 3JVSA 2W0JA 4OTFA 5DH3A 4BDAA 5BUIA 3FAAA 4PDYA 1XHAA 4RT7A 4EH6A 4FGRA 5IISA 4F1MA 2V55A 2CHLA 4DFXE 4GUBA 5JZJA 3D4QA 4CQGA 4JQEA 4LRMA 2YM3A 4RFZA 1W83A 3W2SA 2XNNA 3O8UA 4FTNA 4I5CA 4IX3A 4JI9A 5EI6A 3PIXA 4NK9A 5AV4A 3S95A 3G0EA 5M4IA 3EH9A 1GIIA 3MY5A 4PMPA 4FKQA 3UMWA 3BX5A 3NUUA 4Y72A 4DFZE 2EUFB 4L68A 5AJQA 3E88A 3F5UA 2B53A 2Y6OA 5FQDC 5ETCA 3ZUTA 5JN2A 3QC4A 4I0TA 1BYGA 2WMXA 5TE0A 3RM7A 4HPUE 3KXXA 1B6CB 1H1WA 3NUXA 3A62A 3PSDA 5EFQA 4U97A 3VW8A 2B52A 2YM7A 4DEHA 4JBOA 4WNMA 3PDTA 2XIZA 2R2PA 2XNOA 1ZMVA 3PRIA 3D83A 4FVQA 5JFWA 3NR9A 2PVHA 4OLIA 3R71A 3ZO2A 3OWKA 4MD7E 4CZUA 4J99A 2C0TA 4ANMA 3SRVA 3C4WA 3LXNA 4XYFA 3V8WA 4QYEA 4TW9A 3BHHA 5EI8A 3ZSHA 3FKLA 3KK8A 4RWIA 2BFXA 5E9EA 4U9AA 3Q53A 4LGDA 1MRYA 3E93A 3C4XA 2GNHA 2HWOA 3QZFA 4GUEA 2QONA 3VAPA 4BVUA 5HQ0A 2B9HA 4FNXA 3GU6A 4W8EA 3LLAA 3AMBA 3KVWA 2C0IA 4ANOA 4BTFA 5GJGA 3OMVA 3V51A 4DH3A 3QD2B 3CCNA 4XV9A 4IM0A 3MS9A 5C8NA 3LJ1A 4IADA 3L8VA 3KC3A 2YAAA 3UC4A 4AXAA 2PE0A 1YDSE 2G2IA 4XH6A 5HLWA 2BILB 3R8UA 3DXNA 4RIYB 2J5FA 4EOSA 4BBFA 5HVJA 2ACXA 4R1YA 4V05A 2FSOX 2QOCA 4FZAB 4BDIA 5AFVA 4L46A 3F88A 3ULZA 4FEXA 3TM0A 5IQEA 2UZWE 3FPMA 4RZWA 4UMRA 4PP9A 4CV9A 5C4LA 3BLHA 4EYMA 4FV6A 3PVWA 3UYSA 2G1TA 3ZTXA 2HYYA 3MA3A 1YHSA 4I5HA 4YJSA 3MPAA 1UKIA 2WFYA 3T9IA 4LMNA 3CY2A 4XV3A 3CJFA 4QYYA 4FEUA 3HEGA 3NX8A 3O0GA 3IO7A 5E8UA 3ALNA 5FLFA 5H3QA 1OGUA 4C57A 4AT4A 2BTRA 5E8YA 1UWJA 3EQHA 4FVPA 5L6WL 3OCBA 4MH7A 4TYJA 5AR8A 4YNOA 4FKTA 4AG8A 1URCA 2QOHA 3QTQA 3UIUA 4G6OA 2C3KA 4QD6A 3D2IA 3TCPA 3DQWA 2CJMA 1JKKA 3IDCA 4IFCA 2PULA 4MXCA 2GQGA 2EVAA 5JH6A 4MD8E 2QOOA 3RALA 5HCZA 4LOOA 4JLCA 2FYSA 4M97A 4MQ1A 2QU5A 4OTHA 3RK9A 4EQMA 1LPUA 4L42A 4Q9SA 2BUJA 2C6EA 3G6GA 4E4LA 2PK9A 4DITA 4C34A 4F9AA 3WZJA 4BDJA 5I9VA 4W4XA 3W10A 3TEIA 2X39A 2IO6A 3COKA 2C3LA 4MCVA 5HCXA 4BCKA 3PG1A 2OWBA 5EDQA 3W2RA 3F7ZA 3HRFA 3RNYA 3QRKA 4Y8DA 2XK4A 4U42A 2UW3A 4EK4A 5CNOA 4EOJA 4NJ3A 3GT8A 4O7NA 1VJYA 2UZLA 3MH1A 2ONLA 3N4UA 3POZA 2W7XA 3PJ3A 3Q96A 3GOKA 4OBPA 3QD3A 2ZDUA 4MNFA 5EHOA 2OZOA 4DE4A 1XH5A 3AG9A 3QUDA 2HIWA 4ANLA 5GZ8A 4FL2A 3UZRA 3CQWA 2VU3A 4YU2A 2KTYA 3GXLA 3JXWA 2HW6A 3FLZA 4YBKA 1ZYCA 3QCYA 5C26A 1W84A 1JSTA 2NO3A 2P2HA 3VS7A 3ALOA 4R6VA 3DKFA 1YXXA 4WOVA 4O96A 2WMWA 4JOAA 5L3AA 3O23A 3GC7A 4OT6A 3HV3A 4RJ6A 4AZVA 3MFTA 1ZOHA 3FBVA 5LWMA 3D5VA 3OHTA 3NW5A 3G51A 4BZOA 1X8BA 3MSSA 4EH2A 5AUTA 2ZV8A 4IMYA 2W5BA 4FNYA 5DR2A 4RMZA 2X8IA 4HW7A 3UNZA 4MBIA 4FA2A 4EOOA 5CASA 2JDTA 1NVSA 1UU7A 4FL1A 3E5AA 1H08A 4O22A 4JVGA 2JDSA 2JEDA 3EMGA 5HNBA 5M4CA 3Q2JA 3TNQB 4FSUA 1RJBA 5J7BA 2P0CA 3JR1A 4PMTA 5A46A 5HBEA 3BQRA 3MFRA 3KK9A 3BQCA 1ZWSA 5AM7A 4KKHA 4XLIA 2OXYA 4CTBA 4NU1A 4D1SA 3R83A 4ZTSA 1GIHA 5EQYA 2IZRA 4WUNA 3COIA 4L52A 4GT3A 4AOJA 3E3BX 2X6EA 2PHKA 3UO4A 4O0TA 1R1WA 4GU6A 4DFNA 3QL8A 3ZBFA 3ATSA 3QHRA 3E64A 3KFAA 3QQUA 1ZYJA 5BYZA 2ITXA 2UZOA 4CKJA 2W4JA 4GT4A 2V22A 1VYZA 3ZUUA 4Z3VA 1KUTA 4YR8A 4I5MA 3OW3A 3PY1A 4L3LA 1NT2A 3ZRMA 4QTEA 2YCFA 4DTAA 3W18A 3BHUA 3B8QA 1FBNA 4N0SA 2XZSA 3L9MA 2VGOA 5DBXA 4Q5EA 4O6LA 4EOMA 5E8TA 5B0XA 5AAGA 2QHNA 4Y5QA 3ZLWA 3VF9A 4RQVA 4QMSA 5CWZA 3EL8A 3ZONA 2RG6A 3UJGA 3T8OA 4UMPA 1Q8UA 4ZS0A 5E90A 3UNJA 1Y6BA 5LMKA 3D7TB 3LPBA 4M14A 4ZEGA 5IUGA 1PYXA 4ACMA 3NVKI 3FXXA 5BVWA 3OEFX 3IW7A 4EJNA 1O6YA 3D0EA 4USDA 4O86A 4CFWA 4D2TA 4R7BA 5CZIA 4EK6A 4ASXA 3QXPA 3KULA 1Y57A 4AW2A 2GQSA 1R0EA 2XNGA 3TJCA 4I24A 3PRFA 4OTDA 3DAEA 2EXCX 2GCDA 3VHEA 3U6JA 3F6XA 1QPDA 4IACA 3VIDA 4YTCA 3QTIA 4D1ZA 2P4IA 5AV2A 4NM3A 5EYKA 5HCYA 1U5QA 3NIEA 3P08A 3QQKA 4QYGA 4ZY6A 2O3PA 4D9TA 3JPVA 2ETMA 5A4LA 4WNPA 1UU8A 2CCHA 4LV5A 4BDCA 1CM8A 1ZY4A 2VWYA 4X6RA 4BTKA 3QYZA 2XCKA 5TT7A 5A9UA 4GU9A 3H0YA 3PIYA 3VS6A 4TXCA 2VV9A 3G15A 3VS2A 4BCFA 2BRNA 5CYIA 5CVHA 3CGFA 2H34A 3P5KA 5CU3A 3FY0A 3DBCA 4FI1A 4FKOA 3UP2A 3KMMA 2F7XE 3LLTA 3PFQA 1J7LA 4BFMA 5CT0A 2XNPA 4BWXA 4F0GA 3KXNA 3R7IA 3NS9A 5HD7A 3WARA 4GYGA 2CDZA 4V04A 3IW5A 3CP9A 5BVDA 3QRJA 2PMNX 3TIYA 4I22A 2R7IA 3UQCA 4ZP5A 1L8TA 4FBXA 2X81A 2VUWA 3GGFA 5LVMA 3U4WA 2VD5A 2IVSA 5BNJA 4BCJA 4KUJA 1KE8A 2C6TA 2ZMCA 2DS1A 5F1ZA 3AC4A 5HIBA 2PZ5A 1CKPA 2QOQA 1YVJA 4FIGA 1VEBA 2QOBA 2VTJA 4LUEA 5TO8A 2I7QA 4DC2A 4E6CA 4IB1A 5C8MA 4IAYA 2ZOQA 3QX4A 3BEAA 3OW4A 3VBVA 4QP6A 4YZ9A 4K18A 4I41A 4I20A 1UU3A 4KAOA 5JSMA 3U6HA 2HENA 4EUUA 3R1SA 2YIRA 4KRDA 1JSVA 4BGHA 4D4VA 5K9IA 3FV8A 2RFNA 2ZM3A 4BYJA 4JAIA 2WQNA 3PP1A 2VWVA 2ITYA 3N4VA 5L2IA 5JMSA 4I4EA 4LGHA 2XA4A 3MY1A 4K77A 2CN8A 2CSNA 4QNAA 3JVRA 3Q4CA 4QTCA 4EOQA 4NCTA 4QMNA 1H24A 5AP6A 2HZIA 5FEEA 2WMQA 2WTVA 4RRVA 2XIRA 5I5ZA 5LMKC 3P9JA 1H1RA 4XOZA 2OU7A 4TWCA 5EHYA 3Q5ZA 2YZAA 3Q9XA 3OT8A 2OICA 4KWPA 1BMKA 4DEEA 5DMZA 1H00A 4H39A 3DK3A 3PJCA 4AN2A 4FKRA 4R7IA 4P5ZA 4IVAA 1VYWA 4BY9E 1WZYA 2PL0A 5I9WA 1XH8A 2VTPA 5CTPA 4QMVA 1WVYA 3GB2A 4BCPA 4TNBA 2DUVA 3HVCA 4AE9A 1XWSA 4PPCA 4I6HA 4GKHA 2OW3A 3LCSA 4X3FB 1PKDA 4ZTLA 3F3UA 1REJA 2E9UA 4CG8A 3V6SA 1WBWA 2YHVA 4MEDA 4E4NA 4LI5A 2GNFA 3BGPA 2PU8A 3CTQA 5I9ZA 2WIHA 4IX6A 4G5PA 4JG6A 2QG7A 3L9LA 4ZSAA 2BZJA 3HMIA 4MQ2A 2XYNA 2Z02A 1CSNA 1URWA 5DYJA 1MRUA 4FG8A 3PE1A 3F7WA 5E8WA 1XH6A 4S31A 4UN0C 5IG1A 4HNFA 3K5VA 3HMPA 4I0RA 2RSVA 3G0FA 4FTLA 4XG7A 3EFWA 1PMEA 4APPA 4FC0A 3VS3A 1YI3A 4A9SA 3ZO3A 2GTNA 3HRCA 3C5UA 3PJ1A 3R9NA 3EQCA 4WO5A 3L8XA 4BIEA 1QPJA 5CEPA 2I0HA 1OL2A 2WOUA 2OXXA 5CEKA 2JITA 4KSPA 4BF2A 2VGPA 1KE9A 1YW2A 4B0GA 3R1QA 4EI4A 4F63A 4RVMA 4V0GA 5HE0A 3RCDA 2VAGA 4JJRA 4R5YA 3RVGA 3HP2A 3BYSA 5IQDA 4PPBA 4XBUA 4K11A 2UW6A 4RJ7A 3BYUA 2QR8A 2BRGA 4IZ7A 4L53A 4U8ZA 4FTIA 4I6BA 1XJDA 1M2PA 2OH0E 3UG1A 4F4PA 5IPJA 2XMYA 4HVHA 3K3JA 4RVTA 3ZBXA 4K33A 3NDMA 3F3VA 3OD6X 5E91A 3UO5A 5H9BA 4EHVA 3PLSA 4K8AA 2BPMA 2H8HA 2YA9A 4TYGA 3UVRA 4BRXA 5KMIA 3FI8A 2I0YA 1WFCA 3R21A 3ZFYA 3DDQA 1JLUE 3VWAA 4CMOA 5KCVA 1OBGA 4ZK5A 4IVBA 2X7GA 2YM8A 1YI6A 2HWPA 4L00A 4D2PA 3N4TA 3F9NA 4QYHA 4NCTC 2IWIA 3GCUA 5AADA 4ALVA 1UWHA 2QOKA 3K5UA 3A7IA 4O81A 4U7ZA 2AYPA 3R22A 3WZUA 2C30A 4IE9A 4WBOA 3RI1A 5IA1A 1MQBA 2BRHA 3I1AA 3TKIA 4L3PA 5HO8A 5M08A 3GVUA 4B6LA 4OW8A 3GCVA 1W82A 1OIYA 2ITUA 3Q4ZA 3DZOA 3DU8A 4DCEA 3NWWA 4J8NA 3SG9A 3ZH8A 3FZSA 2HW7A 5DR9A 3ZXTA 3DA6A 4D58A 1PHKA 3ZC6A 3FUPA 4X2KA 3ZLSA 4W4WA 5T3QA 3HAMA 4JL9A 4D4SA 2R0UA 3SW7A 1FQ1B 2IVUA 4EHGA 3NLBA 3VW6A 3WF9A 3GU5A 4KINA 1UA2A 1Z5MA 3MH2A 5AV0A 2ITWA 3LE6A 3TNPC 4L9IA 3A4OX 4ZZNA 5FUTA 3AGLA 2ZB0A 2Q0NA 1FOTA 2ESMA 2XJ2A 4X2NA 1A06A 4YSJA 5HORA 1WBNA 4Z9LA 4EZ7A 4IVCA 4EUTA 2Z60A 4B8MA 5DPVA 2A19B 5EM8A 4ZJJA 1BX6A 3TV7A 2P55A 3KY2A 2F57A 4H1JA 3R6XA 5C27A 3TN8A 3OUNB 1HOWA 4QPSA 2BKZA 3QTSA 4GK3A 4NTTA 4QTAA 3VJOA 3NW6A 3OWLA 1TKIA 5C01A 5AP3A 4GJ2A 3E87A 4HVGA 2HZNA 1EH4A 3RTPA 3ZUVA 1ZYLA 1UVRA 1WMKA 4ITIA 5HICA 3UIXA 5KBQA 2BDJA 2VX3A 5CAQA 1QPCA 4FIJA 4Y83A 4YLKA 5D41A 3ZLYA 2GFCA 3ZM9A 3TL8A 5DFPA 1FVVA 4C3RA 3QAME 1OKWA 4CFXA 1TQIA 2B9JA 2PMIA 4EKKA 1K9AA 4C38A 3IOPA 3TZ7A 5JFVA 4RZVA 4IDTA 3HAVA 3OWJA 4KKEA 2A2AA 3MVMA 1H1PA 3FE3A 2C4GA 4HCVA 3OCTA 5IDNA 2DWBA 1NY3A 4O84A 2QO9A 2WPAA 2WTDA 2BROA 2CNUA 5KKRC 4FK3A 2WU6A 1DI9A 1FVRA 3OROA 5EOLA 3MTFA 4QP1A 4EOPA 4ZTRA 3HLLA 2ZV2A 5J5TA 4AF3A 4F0FA 2XRUA 3EOCA 3BGQA 4ANNA 4M13A 1QL6A 4MNEA 4RLLA 2J51A 3DK6A 5EDRA 2HZ4A 2E9OA 4Q9ZA 2WEVA 4J96A 2VX0A 4E7WA 1U46A 4H05A 1UNLA 3HGKA 5D1JA 5JFXA 3I79A 1ZYDA 3OP5A 4K6ZA 4JT3A 5GZAA 2C0OA 2W1FA 2WQMA 4PDOA 4QQTA 4RWJA 2C5OA 5IQIA 1WVXA 3A2CA 3LIJA 3ORIA 4BDKA 5A3XA 4AWIA 3F5XA 4FTQA 3RAIA 5LWNA 4CLJA 5CLPA 2B9FA 2ETRA 2W1IA 3V6RA 5F95A 4DEDA 4TL0A 2W1CA 3WYXA 1SNXA 4FSQA 4FV1A 3TWJA 4FSNA 2FVDA 4FTRA 1MP8A 5EDPA 1AQ1A 4RJ5A 1YDRE 2JD5A 3UNKA 4Q2AA 3E7VA 3FJQE 1OPLA 5I0BA 2C5XA 2GTMA 4YZNA 4P7EA 3ID6C 2PWLA 4C2VA 4FKIA 3UE4A 4YHTA 4G6LA 4APCA 3VUHA 2XBAA 5C8KA 2VO7A 4GK2A 4TY1A 4UXLA 2ITPA 4MTAA 1JKLA 4XOYA 2IPXA 5LVNA 3I4BA 3TZ8A 4PL3A 3UZTA 1F3MC 2PVMA 3G9LX 3TNIA 5CX9A 3CQEA 5HLNA 4FTKA 3GFWA 4M68A 2R3NA 3VJNA 5CF4A 2PVYA 1Q62A 3E3PA 3TV4A 5DEWA 2IVTA 3OBGA 4QMUA 2HXLA 2OLCA 5L8LA 4QT1A 1GJOA 1JVPP 3UZPA 3QTWA 3DPKA 4E8AA 3GCSA 4RIXA 4CNHA 4ZLOA 4W9WA 4FSYA 3I0OA 4NKAA 3RHXA 5GNKA 3C51A 3H9FA 3ORKA 2EXMA 2GNJA 4U81A 3VO3A 4FG7A 3WZEA 4RX5A 5AR2A 5EI2A 3LCOA 4O0RA 2GHMA 4FV9A 3P1AA 2WXVA 3R7GA 2C3JA 2UZVA 1GNGA 2QVSE 4A9UA 3ORMA 3FKOA 2OJIA 2XUUA 3HNGA 4E3CA 3NYOA 5C1QB 2VWZA 2QOIA 4NTSA 3AD6A 1PXMA 4EH5A 4K9YA 4GH2A 4F08A 1Q97A 3LFEA 5EM5A 1ZAOA 2PVJA 4BGGA 4BI0A 3OTVA 4ZJIA 3A7JA 4BBMA 2JIIA 4DF3A 4R3CA 2WKMA 2WTKC 3NSZA 2QG5A 4P5QA 3ITZA 2JAVA 4KABA 4IZ5A 4FV7A
chains in the Genus database with same CATH superfamily
4EK8A 3EFJA 5DI1A 4GS6A 4JG8A 1OM1A 3DKCA 3DXQA 2YACA 4FEVA 5E7RA 4F9WA 2FH9A 3KXHA 5A6OA 2F7ZE 3QRIA 4A9YA 4R78A 2GPHA 3FPQA 2RFSA 3AT2A 3H9OA 3FXZA 4DHFA 2XB7A 3QQLA 1IG1A 1E1VA 1YXSA 3GFEA 5HKMA 1TFFA 2YDKA 4MHAA 3KRRA 4D2SA 4KD1A 4EKLA 3OXTA 2OIDA 3TZMA 4F1OA 4DH1A 3SW4A 4CKRA 5E8SA 4USEA 2XK6A 3HL7A 3LAUA 3PA4A 1Q8WA 3BBTB 3DKOA 2R3JA 1Q8TA 2R3GA 3P7BA 3BV2A 1YKRA 4PWNA 3TUDA 1ND4A 5AP7A 3EHAA 4AW0A 1KWPA 4KNBA 4U43A 2QKWB 5CS6A 4RPVA 4I93A 4R5SA 2WMRA 4U44A 4CT2A 4HZRA 3ULIA 4E4XA 2OO8X 3F3WA 2VO3A 3QA8A 4A7CA 3QLGA 5AIRA 3PY0A 5KHXA 4JQ8A 2IN6A 4U40A 4WD5A 4D2VA 3MESA 4DG3E 3AT3A 4LL5A 3O8PA 3KVXA 5K3YA 2WD1A 3IPHA 3O8TA 2R3PA 2YM4A 4GYIA 4MVFA 3ZDIA 3ORPA 3I7BA 1V0OA 3R9HA 1YOLA 4FT3A 3FLNC 1Q3WA 3DB6A 4JRVA 3U9CA 3FYKX 4ORKA 5L4QA 4M3QA 3T9TA 4AZWA 2WQBA 3F5PA 3LXLA 4YPSA 3UOLA 3ZRLA 3DQXA 3EJ1A 3F2AA 3SRVB 2UW5A 3TACA 3UOKA 3KREA 5IA0A 3C7QA 3C4ZA 3FEGA 4RX8A 4JDHA 3NNVA 1W2CA 5HG8A 1SVEA 3BU5A 1OIRA 2PVFA 5HBHA 4IQ6A 5LCKA 4S30A 5KHWA 3VUTA 1AGWA 2I40A 2Y9QA 2A27A 4ID7A 4QQ5A 2UZTA 4GK4A 4QNYA 5IQAA 3ZEWA 1ERKA 4GFMA 4LGGA 2OKRA 3D7ZA 4PNKA 3QQGA 1H07A 1Z57A 4OAUC 3LJ0A 3GOPA 1KOAA 1W7HA 3PUPA 3VNTA 4NM0A 5FXSA 4ANBA 5M51A 2X1NA 3IK3A 4MXXA 4RC4A 1JAMA 2I0VA 5M4FA 5J1WA 3CD3A 2W5AA 2CGWA 3QBNA 4G31A 2B0QA 3SOCA 4YHJA 2BTSA 3P5JC 5HIEA 4PTCA 3QD0A 5CU2A 4AGUA 3C0IA 1K3AA 3A8XA 4EL9A 3DDPA 3FSKA 2CCIA 3DJ7A 3FMEA 2PMLX 3I6WA 4EH4A 5DT4A 3B2WA 3QA0A 2C6KA 5FTOA 5KE0A 5KMNA 3T3VA 2O64A 2JKKA 2C5VA 4D5HA 3E92A 2F9GA 4CZYB 5CSPA 3C5IA 3DLZA 5AMNA 2W9ZB 5EG3A 5AX9A 4NIFA 3KF4A 4NUSA 3RKBA 3U51A 3VC4A 5A4CA 3PUFC 3PWYA 3OC1A 3DV3A 3BBWA 3QQJA 5B2MA 4CQEA 2R3QA 4I23A 3UVQA 5LMAA 5IF1A 3EWHA 3RPYA 2WTCA 2J90A 3TNWA 4BTMA 2V5QA 1SVGA 3W8LA 4DYMA 4AW5A 2YEXA 4IHPA 4FKSA 3AKJA 3FZPA 3HMMA 4PUZA 2R3HA 3R2BA 3QCSA 4XLVA 4GVJA 5CSVA 4QMTA 5L2WA 4XV1A 3R02A 4ASZA 2X2KA 4FK6A 1Y6AA 4NEUA 2RKUA 2X0QA 4C02A 3FL5A 5HX6A 4FE2A 1DS5A 3IQ7A 3OT3A 5CF8A 1ATPE 3R9OA 4ZY4A 2QNJA 4EZ3A 3ACKA 3OCSA 2YDIA 4ACDA 4ZOGA 2QURA 4XUFA 4RJ3A 2BHHA 4Y46A 3KMWA 3QUEA 2OJ9A 3I6UA 5EW8A 5ANEA 4UWCA 4FKJA 4BKJA 4FTAA 4G1WA 4S32A 2PVKA 3Q04A 2H6DA 5DR6A 5CQUA 5GIPE 4UMTA 4W9XA 4O7WA 2YLEA 5AEPA 4MKCA 5ACKA 5M53A 4TYIA 1PMVA 2WMVA 3FHIA 1PXLA 4O7LA 5ANJA 4QP3A 3NUSA 4QTDA 3R1YA 4AX8A 4E5AX 2PE2A 4RC3A 5K4JA 3NAXA 3ZZWA 5CU4A 1OGYA 1WAKA 3CIKA 3FC2A 3EN6A 2W4KA 5BVFA 1PXJA 4NFNA 2OSCA 2VWUA 3D5UA 3MFSA 4YJOA 3R7UA 3V04A 3W16A 2ITZA 2BIKB 3COMA 1MQ4A 3CC6A 5DVRA 2CNQA 5I9YA 3E8NA 2XK8A 3EN7A 5BVOA 2CKPA 1CTPE 3RMFA 5I9UA 4TPTA 2I6LA 3OOGA 5H2UA 3UPZA 3CTHA 4QDEA 2XP2A 4CG9A 4I21A 1U59A 4Y73A 5EYCA 3TNHA 4NL0A 4ASEA 4JAJA 5BMMA 3P86A 4XRLA 4LM5A 4L7FA 2YABA 3CY3A 5E8XA 4F65A 3UP7A 2VNYA 3FLQA 4IDVA 1ZYSA 1JQHA 2H96A 3PSBA 4M66A 5FRIA 5HIDA 3TKUA 4F70A 4BCQA 4DN5A 3TIZA 4IAAA 1ZZLA 5HEZA 3HUCA 2XKDA 4YZDA 2HXQA 5L6OA 4QP2A 4CCBA 1UKHA 1KE5A 3LFFA 3OS3A 3RM6A 4XRJA 2OJJA 3MTLA 3QYWA 3BWFA 1H28A 3DJ5A 5DOSA 3S4QA 4C4JA 3W1FA 5D10A 4ZS4A 4WG3A 4FTTA 3HV7A 4OT5A 4BHNA 5HO7A 4NW6A 2NNWB 1TQMA 4FKWA 3AC5A 3ANQA 4LG4A 4F64A 3SD0A 2ZVAA 4WG5A 3EIDA 3NIZA 4FV3A 3BV3A 3ZMMA 2Z7SA 2B54A 1G8AA 3WI6A 4LV7A 3JYAA 4AT3A 3DCVA 3VHKA 1NXKA 4FKVA 2V7AA 3PG3A 4L45A 3HMNA 4TN6A 4IC8A 3DB8A 3LFBA 4O0UA 5JGAA 3DBQA 4DTBA 3ET7A 2C3IB 4MXYA 4JR3A 2C5YA 2QHMA 3M2WA 3EKKA 3KMUA 1A9UA 3DY7A 1CKJA 3SA0A 3GC8A 4RJ4A 4FX3A 4FT9A 5CALA 5I9XA 4O7YA 3PIZA 5AUZA 3R9RA 4O0WA 4O21A 5IA5A 3R01A 3SKCA 5KO1A 3ATTA 4DEAA 4GRBA 5HO6A 4EBVA 4FT5A 1R78A 4GT5A 3MIYA 5FXQA 2G01A 2Y8OA 3CGOA 2W1EA 2PE1A 5CAOA 4FSRA 4G6NA 5F94A 2O8YA 4WNOA 4ZTMA 2GHGA 1QPEA 2PSQA 2Y4PA 3KULB 4BCNA 3VBYA 3LFCA 1CKIA 5AP4A 3A8WA 4RFMA 3THBA 5CF6A 4YMJA 4O82A 3ZM4A 2HK5A 4O27B 1KV1A 1Q8ZA 2WZJA 5DA3A 3W0PA 1KE6A 4HGSA 4G9CA 1XR1A 2F2CB 5JRQA 3ELJA 1OIQA 4F6UA 4RQKA 4E6DA 4CSVA 3DK7A 5M56A 3UQFA 4BKZA 4IWPA 3BGZA 3HDMA 3CKWA 3TT0A 4CFVA 3HKOA 2EB2A 3SXRA 4H3PA 3L9NA 5EM6A 1YXVA 2ITVA 5LVLA 4CXAA 4OTQA 3UVPA 3UODA 5JRSA 2FO0A 4U5JA 1WBSA 4BR3A 4KIQA 3SLSA 4KRCA 2W05A 4FZ6A 3DJ6A 3IW4A 4HGTA 3EQRA 2E2BA 3UMXA 4RC2A 4UX9A 3OVVA 3NCGA 1YOMA 5AAEA 4GL9A 3MB7A 3ANRA 3CD8A 5IUIA 4O7ZA 1TVOA 5IUHA 1OKVA 3C0GA 4AFEA 1UNHA 1PY5A 5CENA 3RK5A 3QTRA 3V5PA 4S34A 4UXQA 4QTBA 3WF6A 2XKEA 4FODA 4EH3A 4C7TA 3FMHA 2UW9A 1DAWA 4BYIA 2VTMA 4A06A 2YAKA 5E1SA 2VTQA 3P7CA 5GHVA 3O17A 2OJGA 2KULA 3PXYA 5ETFA 3HX4A 3SGCA 4O4DA 4MX9A 4ZZOA 2ITQA 3ORXA 3BPRA 4JDJA 2RF9A 3MDYA 2P2IA 2OG8A 1O6LA 2GS7A 5FEQA 1QCFA 4QYFA 3BRBA 2PMOX 4LRJA 3FMLA 5E8VA 5AUXA 1V1KA 3AMAA 4X6QC 3BU6A 2C1AA 4MXOA 3C1XA 5ANGA 5F9EA 4PNIA 4OTWA 3HV4A 3EN4A 1P14A 4EC9A 2GHLA 1IAHA 4DT9A 4EJ7A 4F9CA 1RQQA 3KL8A 3LXPA 3BI6A 4JNWA 4NFMA 3WIKA 4C3PA 4HGEA 3QTZA 4UMUA 4PQNA 5HNGA 1CDKA 2BRMA 3KRLA 2X8EA 1P5EA 3RINA 3P78A 4KB8A 3ENMA 4YZMA 3RAWA 2QOFA 5EKNA 2XBJA 2XNEA 2ZB1A 4GG7A 2Z2WA 5H8BA 3QRTA 2YIQA 4BCHA 4C33A 2C6MA 5CU0A 5AR5A 4CFNA 2G15A 4BDFA 3BHTA 2JKQA 2UVZA 4H58A 2R3OA 3DNDA 4IFGA 4YTHA 1A48A 3EYHA 4QMZA 2IW6A 4AUAA 2IZUA 3F2NA 3EQIA 3P0MA 2YLFA 4O2PA 3R7VA 4C61A 3TDWA 3OCGA 4YJPA 4IZYA 3GUBA 4IWDA 4BCOA 3ACJA 1ZY5A 3AD4A 3NAYA 2YJRA 3PWDA 3LCKA 4FV5A 4IAKA 3V5QA 4E20A 3BEGA 1PKGA 2YJSA 1M17A 2VWBA 3R63A 3TI1A 3UPXA 4BGQA 5JFSA 4BJJB 3LW0A 4FL3A 5IEVA 3AKKA 2YERA 2JBPA 4H1MA 4USFA 4JG7A 2OIQA 3JUHA 4UB7A 4AZFA 4DFLA 5KX8A 4DHIB 3R8MA 3NYNA 4ACGA 3AKLA 1Y91A 2OFUA 4WA9A 3AGMA 4FZFB 4G9RA 4UMQA 3QC9A 2Q83A 3TDVA 4OTRA 3CXWA 4H3QA 2YIYA 2XRWA 3AD5A 4P4CA 5ANKA 4RFYA 3W2PA 2XM8A 4FSTA 3WE4A 5C03A 5M44A 4J98A 2WMSA 2W1GA 2JDOA 2XVDA 5KNJA 4FNWA 1GZOA 3A7FA 1M2RA 2ZFYA 4JX3A 1SZMA 2PTKA 4JS8A 1WBTA 5BYYA 3S0OA 2R3MA 2BR1A 1H0WA 4IX5A 4E73A 2BAJA 3Q9YA 4CRLA 1YI4A 3LFSA 4WNKA 2C6LA 4DG0E 4V0GB 4I94A 5CY3A 4K2RA 2WMBA 4EHZA 4FMQA 4FTUA 2VTRA 2YCQA 1DI8A 3V5LA 3LXKA 3GENA 3ZU7A 2O5KA 4GEOA 4JDIA 4RG0A 3PZEA 3EFKA 4R8QA 3R7EA 2B4SB 4J71A 4Y5HA 5HVYA 3UIBA 4KSQA 5AUWA 3FKNA 3ORTA 5L8KA 2B9IA 2I1MA 5AP5A 4M0YA 2PUPA 4DINA 5M06A 2RFEA 4YSMA 3SXSA 5M57A 5KKRB 4J1RA 1PXOA 5CQWA 2OF2A 1R3CA 5DIAA 4RIWA 4X7QA 2CGVA 5FM2A 3VBTA 4O7SA 2W1DA 1YWRA 4Z7HA 4NYEA 3LOKA 4F9BA 1BI7A 2XCHA 3HP5A 2RGPA 3L9PA 4ERKA 4E93A 1CMKE 3MY0A 5IH4A 2QKRA 4MK0A 4XHKB 4NJDA 2EXEA 1Q3DA 4I0SA 1S9JA 2ITNA 4H36A 4O0YA 5D7AA 2OIBA 4FTMA 2JFMA 3I0QA 4WSQA 5F4NA 4ARKA 2RL5A 4BN1A 4AQCA 3FI3A 4M12A 1WBOA 3DS6A 3G2FA 4EH7A 4AZSA 4PF4A 2Z7LA 4QPMA 3H3CA 2FSTX 2NP8A 2OBJA 2VTIA 3MPMA 3LVPA 4NW5A 4EC8A 4ZAUA 2IG7A 3MVLA 3TXOA 3ZCLA 5J1VA 4KS8A 3IGGA 4KBKA 4KIKA 5CXHA 4FJVA 4DGMA 1XQZA 1U5RA 4LDTA 3KCFA 4ONAA 2E9NA 3TUBA 1GAGA 3C50A 4M84A 4QQCA 1OVEA 3FHRA 4KS7A 3FDNA 3ZXZA 3H0ZA 3I60A 3ZO4A 4BIDA 1UV5A 5BVNA 5ACBC 4ZTQA 5CXZA 1ZZ2A 3ORZA 3D5WA 4U6RA 2HZ0A 4QP4A 4WT6A 3R1NA 3UOHA 4XEYA 4TYHA 4W8DA 4IEBA 4DFYA 4Y95A 5IMXA 4IBMA 3GP0A 4D2WA 4TYHB 5CEQA 4S33A 1H1QA 5GJFA 3W32A 4IANA 3RCJA 2C6OA 3LQ5A 2HY0A 5IKWA 4M69A 3NNUA 3FMJA 3M42A 4FOBA 1YXUA 2EWAA 3E8DA 3FMMA 3HRBA 2W4OA 3BHYA 5ETAA 2JKOA 4LFIA 4M69B 1KE7A 5GINE 3O7LD 2BZKB 4HYHA 3OY3A 3D9VA 2A1AB 4OBQA 4RGJA 4RSSA 4TWOA 1Z9XA 4FTOA 3DLSA 4NSTA 3LFNA 3UG2A 3QUPA 3Q4TA 4IVDA 3V5WA 4DG2E 1LP4A 2P3GX 5HX8A 1PXPA 2X4ZA 4MUQA 3QTUA 2WNTA 2UZEA 1M7QA 3FWQA 3NUYA 4FSMA 3EB0A 4XP3A 1PXIA 1YHWA 3ZEPA 3G6HA 3V8TA 5J79A 3PA3A 4BHZA 5AR7A 3QCXA 1OL1A 2JDVA 2Y4IB 3GEQA 4FKUA 1KSWA 4DT8A 2X0GA 2XM9A 3ENHA 3QX2A 3LZBA 5L8JA 4FEQA 3JY9A 5IDPA 4QP9A 1OKYA 4WSYA 5J7HA 2OZAA 3LQ8A 4L43A 3O96A 1U54A 3H4JA 4OTPA 1IEPA 3F61A 4AA0A 3R73A 3LMGA 3NPCA 4PMMA 5EH0A 2XNBA 4AXCA 4TT7A 5FEDA 4MNEB 4HPTE 3GU8A 4FR4A 2R3FA 4CT1A 4NKSA 5HESA 3Q32A 4WG4A 3QZIA 4ZZMA 4DEBA 3F5GA 4DH7A 4E26A 4EWHA 3CQUA 4ZJVA 1MRVA 1M7NA 2VTNA 5DE2A 3RP9A 3PA5A 4ASDA 4RLKA 4WRSA 4CRSA 3BL7A 1Q8YA 3LCDA 5H8EA 5IU2A 3WF8A 4O83A 4E6QA 4JX7A 4Z16A 4ZLZA 2VO0A 4PL4A 4JDKA 5I4NA 4H3BA 4C4HA 1ST0A 5LXMA 4TZRA 5AP1A 3MPTA 3FMKA 3S1HA 5F20A 1H1SA 2IZSA 2ERZE 3OG7A 3POOA 5K5XA 4YTFA 3QRUA 5CAVA 3LM5A 4RVLA 4DFBA 4O91A 4BB4A 4YJUA 5IH5A 4FIHA 1OZ1A 4QPAA 3G33A 4LQMA 3EL7A 4IC7A 4XG2A 4XX9A 5CVFA 2FUMA 4PV0A 5DT3A 3UC3A 2HELA 3PY3A 1OKZA 4UZHA 5DLSA 5AX3A 4DHZA 2PZRA 4UEUA 5IQCA 5EYDA 3MJ2A 1XBAA 3SOAA 3I5NA 2REIA 1XKKA 2UW8A 4R7HA 4A9TA 4D2RA 1O6KA 2RFDA 3NW7A 5AA8A 2R3KA 3Q52A 2JAMA 4PRJA 1T46A 3UBDA 5A4TA 4J8MA 4OAVB 3WF7A 3SHEA 1GZKA 1RW8A 1JNKA 3GC0A 2Z8CA 4RIXB 4LUDA 5JGBA 3GCQA 3MV5A 4FSWA 2YM6A 4XP2A 4BICA 4CZTA 3ZLXA 3A7HA 1MUOA 3CEKA 5D11A 4ZSEA 2IVVA 4FYNA 3O7LB 3ZC5A 3IS5A 1R39A 5HG7A 2QLUA 4AOIA 2PZIA 5HHWA 5K0XA 2QO2A 2FGIA 2ZYBA 3PE2A 2C5NA 2XEZA 5EQPA 2CMWA 3PP0A 3TKHA 2PZYA 4GMYA 3VS0A 1REKA 2SRCA 2P33A 3FZTA 4XBRA 5J8IA 4MWIA 3RZFA 5A6NA 1J7IA 2OGVA 3RWQA 3SG8A 4DGOA 2YFXA 3AMYA 2UVXA 3GQIA 3IDBA 3VS4A 5HU9A 4JQ7A 4IWOA 3QU0A 2VTHA 2V62A 1IRKA 2UZBA 2W96B 3II5A 2R4BA 3TUCA 3F3ZA 2ZM4A 3DZQA 3PSCA 4UV0A 2R3LA 3GNIB 2J50A 5FM3A 4BDHA 4RWLA 5HTCA 2E9PA 1W8CA 2QI8A 5IQBA 2C47A 5M07A 3W0MA 2J0KA 3KXGA 4O4BB 4W4YA 4CVAA 2IJMA 4BBEA 4YJQA 5CSXA 2QO7A 3ETAA 4FV8A 3WIGA 3VUKA 3QGWA 2FA2A 2BZHB 4YP8A 4J53A 1WVWA 5KZIA 4DH8A 4DAWA 3LM0A 1OUYA 2R3RA 1P4FA 4U80A 4AN9A 1J7UA 5FWKK 2CGUA 3VULA 3NCZA 4NM5A 4UZDA 5FBOA 3FC1X 4N70A 4EH8A 1YWVA 3UO6A 3PVUA 5L6PA 2ZV7A 2BAQA 4FKGA 4ITJA 5DHJA 2VTAA 5KMMA 5KUPA 1JKTA 5AWMA 2JDRA 4UWBA 5A14A 2HCKA 2LAVA 3QFVA 1W2DA 5LOHA 3CTJA 4MXAA 5GIOE 4L3JA 4NT4A 3D2KA 3R2YA 3KRJA 2CLXA 2AC3A 2J0LA 2YITA 4YGAA 3DNEA 2R64A 4QMYA 4B99A 5KMJA 3V8SA 1SVHA 1V0PA 2WGJA 2QU6A 4DGNA 3QLFA 1U4DA 2A4LA 5FXRA 4FIEA 4JRNA 1K2PA 4BI1A 2BCJA 4QMPA 5J95A 2ZAZA 1F5QA 4X2FA 4CTCA 3D15A 2O63A 5DRBA 2GS6A 4HYIA 2F49A 3R04A 5D12A 3WZDA 4X2JA 4AU8A 4CD0A 2XEYA 3VRYA 5HTBA 2FSMX 4ALWA 1TQPA 4TRLA 5JT2A 3ROCA 4O7VA 3FSFA 3UTOA 3RJCA 1L3RE 4NH1A 5AP2A 4MWHA 4JR7A 3Q9ZA 2ZV9A 2YWVA 2VZ6A 1H01A 4FIIA 4QP8A 5JKGA 4XV2A 5CAPA 2J7TA 3N51A 3PPJA 3MYGA 1OB3A 1QMZA 4HNIA 4DGLC 3QTXA 3RGFA 2VTSA 3DFAA 3NZ0A 3T3UA 2QLQA 3K54A 3PXFA 2QOLA 3DBDA 4I6LA 5LMBA 1IAJA 3G9NA 4YPDA 4CFUA 3FZ1A 4PTEA 3P7AA 2W17A 2BMCA 5LVOA 4N57A 3KRXA 4ZIMA 4ZXTA 3KN6A 1YWNA 3QALE 2PUIA 3DTCA 3QZGA 3EQBA 4GJ3A 3R8LA 2G2HA 3FMNA 4YJRA 3SDJA 3UDSA 5DN3A 4G2FA 4YNEA 4FEWA 3FLSA 4PDPA 3U8WA 4B7TA 4XG8A 4YLJA 2YCRA 4YZBA 5HBJA 4C4FA 3LHJA 4RIYA 1OITA 3IGOA 4FTCA 4FZDB 4EOIA 1SYKA 1WBVA 3EYGA 4EEVA 2CPKE 5CU6A 1HCKA 1BL6A 5I3OA 2X2MA 4R3PA 3R9DA 4IW0A 3ODZX 3Q2MA 2VWIA 3AC3A 2JC6A 1H0VA 4AT5A 5CF5A 4NIFB 4O7TA 4YJVA 3BZ3A 4DEGA 3LFDA 2C1BA 3ZHPC 3RPVA 3IW6A 3TTIA 3WE8A 5KMOA 4BZDA 4ACCA 1PYEA 3S3IA 5EYMA 5FDPA 5LARA 5M09A 4J95A 4A4XA 2GFSA 1BKXA 1I44A 5CSHA 1LEZA 3BWJA 5AV3A 5GJDA 5ANIA 4F7SA 3A4PA 1GY3A 5BMSA 4F9YA 4XNEA 3EZRA 3OTUA 1FMKA 2XH5A 4JBQA 2PVRA 3I81A 5D9HA 3PPZA 2JIUA 3HDNA 3GBZA 2C6IA 4A9RA 2PPQA 1OECA 4FRFA 4AGWA 4O38A 3BELA 4TYEA 4OTIA 4UALA 5HE3A 3OEZA 2XNMA 2QR7A 3C4CA 3MH3A 3D94A 3FYJX 4I6QA 4YO6A 2BHEA 1PMUA 4WHZA 3UGCA 5BVEA 5J87A 4ZSLA 4QMQA 4AQKA 3PXZA 1XMLA 4M67A 3UIMA 3ROYA 5AIKA 1W2FA 4AOTA 4D55A 3DBEA 3SX9A 1Q99A 3TTJA 5DRDA 4BDBA 5J9LA 4GW8A 3F69A 1ZARA 2DYLA 3C0HA 3DBFA 2X6DA 2ITTA 3QKKA 4IB0A 2VO6A 4NWMA 3E62A 3CS9A 2YDJA 3HYHA 3N9XA 2HAKA 1HCLA 3HV5A 3R8ZA 2XK7A 4CMTA 3R28A 1B38A 4HZSA 5HOAA 3ZOSA 1SNUA 2I0EA 2J6MA 3PLAE 5BUEA 3ZZEA 4HYUA 3KA0A 4QMWA 5TKDA 3BIZA 2VTOA 3REPA 4DTKA 3PZHA 5IEXA 2R0IA 3E8CA 3LFAA 4U41A 4F99A 4DDGA 3MN3A 5FDXA 4OBOA 2NRYA 1BLXA 3KN5A 4O2ZA 2CKQA 3GI3A 3A7GA 2AQXA 1FPUA 4FZ7A 4XG6A 3R8PA 1PMNA 1DM2A 1YQJA 1YRPA 5HD4A 5BVKA 1STCE 5HZNA 3QWJA 4D4RA 1OMWA 2CKOA 3FI2A 3JY0A 4G3DA 3VVHA 2PYWA 5IQGA 4G3FA 5CI6A 5AAFA 2WB8A 2IZTA 3QQHA 1Y8YA 3GQLA 3R7YA 4C3FA 1PW2A 4AA4A 4DA5A 3W2CA 4K1BA 3AOXA 4N4SA 4YHFA 3IECA 5HVKA 5AV1A 2PUNA 1VZOA 5CEIA 4EHEA 4FSZA 3QD4A 4XG3A 2BIYA 1Y8GA 3VN9A 3LMHA 5LJJA 4YO4A 5K0KA 4DLIA 5KBRA 1OI9A 4PTGA 1FGKA 3PXQA 3PTGA 5IQHA 4AACA 2OF4A 3RHKA 4CEGA 3CBLA 2J2IB 3KF7A 4LV8A 2UVYA 3ERKA 3AC8A 3EQDA 3GU4A 3AC1A 4YUQA 3FQEA 5BPYA 4OUCA 3AXWA 3K2LA 2UW4A 3EN5A 2WQOA 4D0WA 4P90A 4U0IA 4U3YA 4F1TA 4LL0A 2BDFA 5CVGA 2CGXA 2WELA 2G2FA 5C9CA 1H26A 2FB8A 4I3ZA 1OL6A 3IONA 4AGCA 4MF0A 3F82A 4K0YA 4BWPA 3LKMA 3VQHA 4HVDA 3NVMB 5IA2A 4IJ9A 4L7SA 5A54A 4BDDA 4QDVA 1NA7A 3HA6A 4Q5HA 4RWKA 4YJNA 4G34A 5ETIA 2OXDA 5E8ZA 2YN8A 4IIRA 2IW8A 4IB3A 3E7OA 3HZTA 4PPAA 2WMAA 2X7FA 4RX9A 2C6DA 4GV1A 3VBXA 5BX0A 3K3IA 3L8PA 3D7TA 4NM7A 4YTIA 2BALA 5B2LA 1YHVA 3GCPA 3R00A 5HG9A 4X2GA 4C4EA 3V5JA 2XIXA 3QGYA 4DFUA 4ZMEA 4NZWB 4JMQA 3MWUA 4F09A 4KBAA 1OIUA 1W0XC 4M8TA 4EK3A 3ZRKA 1ZOGA 3A60A 4M0ZA 4RIOA 3VQUA 3RPSA 4CFFA 3RWPA 1KV2A 1G5SA 3SAYA 2ONLC 4AN3A 4CMUA 1FMOE 3Q60A 5DEYA 4A4LA 1XBBA 4UY9A 4PX6A 1T45A 2XJ1A 2GSFA 3IW8A 3MVJA 2R5TA 3PJ2A 4FTJA 2EB3A 4MF1A 2R7BA 4GG5A 3B8RA 3O71A 4IM2A 2EU9A 4P2KA 5FGKA 4BIBA 4EORA 3ML1A 4D5KA 4FIFA 2BRBA 4GCJA 3B2TA 5HGIA 4C0TA 5LVPA 4C2WA 3FLYA 1JOWB 5AP0A 2J0JA 3E8EA 4OR5A 3NRMA 3NEWA 1OPKA 1JWHA 3OOMA 4FUXA 5AR3A 4BC6A 1E1XA 4OGRA 2XARA 3BKBA 2VWXA 4HCTA 4I4FA 3S00A 5C4KA 3BHVA 4G3EA 1B39A 4G17A 4UWYA 4FG9A 2JIVA 2CN5A 2VX1A 2ZDTA 4O7RA 1OL5A 2PZPA 3LFQA 3W8QA 5KMKA 5BYLA 3W2OA 5L2TA 4O0XA 3DXPA 4FV2A 4L44A 4AXDA 5H8GA 2VTTA 4F7LA 1W98A 3W0RA 4JIAA 4QMOA 3W55A 3FMDA 4V01A 3RNIA 3EN9A 3ORLA 1UNGA 1WBPA 4OTGA 3P23A 3U54A 4F6SA 5IH6A 2JGZA 3KRWA 2AUHA 4HCUA 3UYTA 2V0DA 3AC2A 4QMLA 4YLLA 2UUEA 4GVAA 4B4LA 2WIPA 1S9IA 2J4ZA 2VWWA 4IAIA 2A0CX 4JXFA 5HG5A 5CEOA 3NGAA 5AM6A 1AD5A 2W1ZA 3Q9WA 3VUIA 4GKIA 5JZNA 4TTHB 1BL7A 4IH8A 3RPRA 5DNRA 3ZYAA 5JEBA 3DGKA 4BTJA 3KXZA 5DT0A 4ZSJA 3PXRA 4X3JA 4M15A 4IAZA 1OPJA 3ZFMA 4ANQA 1Q41A 3SC1A 4YJTA 3OWPA 2X9FA 4MBLA 2F4JA 1IASA 4LOPA 4TWPA 2Z7RA 3WZKA 3EKNA 3Q6WA 5HI2A 4EH9A 4YBJA 1FVTA 3L1SA 3VF8A 5J9ZA 2W1HA 3CLYA 4MD9E 4A07A