3BV3A

Morpholino pyrrolotriazine p38 alpha map kinase inhibitor compound 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
338
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and SAR of new pyrrolo[2,1-f][1,2,4]triazines as potent p38 alpha MAP kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 101
structure length 338
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bv3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bv3A01
3ITZA 4UMQA 4D2WA 4KWPA 5EDQA 3LJ1A 1Q61A 3PTGA 4FNYA 2IW8A 4DLIA 1ZY4A 2UW7A 1P2AA 4TKSA 4TWPA 2C3JA 3QC9A 3U51A 3S95A 2JITA 4EJ7A 1OUYA 2VO3A 5AR3A 4DCAA 2GFCA 2F4JA 2XKFA 3NSZA 2OF2A 5CX9A 5JQ8A 4ZTHA 2OICA 3NW6A 4DFBA 1H1SA 3FI4A 2ACXA 4IBMA 4WRGA 5FXRA 5AV2A 4KIQA 4XJ0A 3F3VA 1WBNA 5IUIA 2W1FA 2OF4A 4HCVA 3FZTA 2BILB 2VTIA 4RPVA 3QHRA 4O0XA 4OT5A 3DB6A 3RKBA 2WNTA 3I60A 2XIYA 2EB2A 4FKQA 4GJ3A 4F9AA 4TL0A 5LWNA 3EQHA 4Y83A 1OL6A 3ANRA 4Q2AA 3E63A 4QMQA 5FG8A 5GJFA 4DFYA 4IH8A 4FGBA 5K0KA 1CKIA 2I0EA 5M09A 1U54A 4O0VA 1O9UA 4EC8A 4DFXE 5IPJA 3BRBA 3V8WA 3FC1X 1FVVA 2CMWA 2ZV7A 3ZZEA 4NTSA 1T46A 3BHYA 4ONAA 3FPQA 4YHJA 4EK5A 3E93A 5HTBA 3DXQA 4DEGA 3SAYA 1Y8YA 3TDWA 4IWOA 5JEBA 3CD3A 5D12A 4PDYA 5CAQA 5L2TA 4BWKA 4X2NA 5DGZA 5TF9A 5KX8A 4ANLA 4TTHB 3VAPA 3G2FA 5IH5A 4XP0A 1NVRA 2GHLA 4H3BA 4NZWB 3W2RA 4AZSA 2XJ2A 3VBXA 4AQCA 3COKA 4TT7A 3RZFA 3AGLA 2EVAA 3G5DA 1TQPA 3I4BA 4W4XA 5JMSA 3LXLA 3VHKA 4ZAUA 3IDBA 4U8ZA 4AZVA 4YTFA 1PYEA 3HDNA 1BLXA 4KBCA 4EOOA 3WOWA 2VO7A 4G3GA 5I5ZA 1MUOA 3D83A 3SW7A 3C50A 4IJPA 1J7LA 2BRGA 5ANEA 2XK9A 1V0BA 3W10A 4BTJA 4Q9ZA 4ZLOA 2HCKA 3GU4A 3UGCA 3CQEA 4EYMA 4JX7A 4UWYA 5L8KA 2E9UA 2CNQA 3BX5A 3QUEA 5CXHA 4FSUA 2DS1A 2YIRA 1WMKA 4FSMA 4MBIA 1SVHA 2GS6A 3SKCA 2UZLA 1PYXA 1WAKA 3HX4A 1UV5A 5I3OA 3L8XA 2XIRA 5KBQA 3BEGA 4N57A 1WBWA 4NTTA 2R64A 5AMNA 5L8JA 4CQEA 3MB7A 4MNFA 4FKOA 4QOXA 3TCPA 5CWZA 3UOKA 2RFDA 3A99A 3GEQA 3QQJA 4QP4A 4ZY5A 2ETKA 4YPSA 2A2AA 1PMEA 1QPJA 2IVVA 3E8EA 4DGNA 4X2FA 4RX5A 3NPCA 3DNDA 5J8IA 5E8VA 3PDTA 4KBAA 4HGEA 4PL3A 1CKJA 2CKEA 2OFVA 3KA0A 3PIZA 5E1SA 5ETIA 4E1ZA 4KKHA 3MY1A 4W4WA 3COMA 4RVTA 3GVUA 4YZCA 2UVXA 5L6OA 3QRTA 5GJDA 4JBPA 2W4JA 2IW9A 4Y5HA 3WBLA 1WVYA 3D4QA 4BHNA 3A7FA 4O7SA 1TVOA 2NP8A 4HYIA 4NCTA 1GOLA 5DYJA 1OL2A 5KMKA 2W1ZA 4F63A 2XYNA 3OS3A 4G6LA 4APPA 2RG6A 1UA2A 4DCEA 2YDKA 2J7TA 4ZOGA 1JKKA 5HD4A 4PX6A 4ORKA 4U3YA 4FEVA 2Y9QA 3P78A 3PPJA 3QKMA 3P79A 4IZAA 2QR8A 1H01A 4MXXA 3POOA 3MWUA 4IB3A 2R3RA 2WTKB 4JDJA 3ROCA 4TYEA 4RIYA 4CTBA 4DLJA 4HGTA 1A06A 1BKXA 2R3NA 2VD5A 4C3RA 3GENA 3TJCA 3V01A 2O64A 3EZVA 3OCGA 4EH7A 5BQ0A 1O6KA 2C6OA 3O17A 2ZV2A 3AGMA 5IQCA 4O0WA 2WPAA 4QQ5A 5HQ0A 2XK8A 4N6ZA 5AV0A 2CPKE 3G6GA 4O84A 5GIOE 3CTHA 4GIHA 5EQYA 4USFA 2B55A 3FMKA 3H9OA 2YAKA 1K2PA 3P86A 5FTOA 4EUUA 4WG3A 5F95A 1OM1A 2UW6A 1WBPA 3HGKA 4PDOA 4MNEB 2H34A 4ZTSA 2ONLA 3CLYA 3MY5A 4ZEGA 5GINE 4IC8A 3LXNA 3IOKA 4C02A 5EQPA 4IXPA 4G5PA 4NIFA 5KHXA 1MQBA 2PWLA 3E62A 3FLNC 3QCYA 4RJ5A 3EFWA 2P0CA 2FO0A 1ZAOA 4MF1A 1IRKA 1OPJA 3OTVA 4FKWA 1RE8A 5JRQA 5M55A 3NIZA 3Q5ZA 4RC3A 1RJBA 2UZUE 4UZDA 4MD8E 3UVQA 4X6RA 4Q5HA 2GHGA 1VYZA 3MVMA 4E4NA 2WTCA 2PMNX 3L9PA 4FOBA 2C5OA 3KMWA 2JIUA 4FNXA 3QGWA 4D4VA 3U87A 4PMPA 4A7CA 5ETAA 3R8VA 1PW2A 5TR6A 3TT0A 4CFNA 4JVGA 5C1QB 3QTRA 4O7LA 1PMNA 2B1PA 4IAZA 3NYOA 5ANGA 1PXIA 4WT6A 5A4CA 3DBEA 3OUKA 2UZOA 3P0MA 4IDTA 4KSPA 3IDPA 4MBJA 5HG5A 5ITAA 3ODZX 3PXRA 3RPOA 4GVAA 2BR1A 4GT3A 5IUGA 2WTVA 3FI3A 1Z9XA 2F49A 5LQFA 5M4IA 4NFMA 1WZYA 5EDPA 3OCTA 4ZSAA 3U4UA 4QYGA 4GKHA 3KULA 4J1RA 5HU9A 1LPUA 3QA8A 4YJPA 4TN6A 4QT1A 2PE0A 4IM3A 2XCHA 1PF8A 4YLKA 3R7UA 5HTCA 3R8MA 4M7IA 3Q9XA 3H0YA 2IN6A 3HZTA 4P5QA 3UG2A 4CXAA 5IQDA 4FEXA 2G2HA 3L8SA 5CEPA 3V5WA 2VTAA 4FEWA 4AZTA 2UVYA 3P23A 4M84A 5FGKA 3VUHA 2W96B 3AT4A 4L3LA 4O86A 2I0YA 5CSHA 1REJA 2QG5A 2XKCA 1JNKA 4TNBA 3OXTA 3T8OA 3ZO3A 1W8CA 2GNFA 2QC6A 5BMSA 1FMOE 3D5VA 4HW7A 3VUTA 3TDVA 4K33A 4RRVA 2R7BA 4C4EA 3MY0A 4QQJA 3UPXA 2VWBA 2UZNA 4FZDB 3C4WA 3ANQA 3W2QA 4OTFA 2WO6A 5AUZA 2EWAA 1FOTA 4FICA 3UP2A 4ANNA 4L42A 2C5NA 4BCMA 4EQMA 4CVAA 4PPCA 2QO9A 4R1VA 5CNNA 4DH1A 4O81A 1ATPE 1HCKA 1XWSA 3NCZA 5E7RA 5BMMA 3POZA 5L8LA 5DR2A 4BN1A 4G3FA 4D4YA 2BIKB 2W9ZB 3DT1A 4FNZA 4DFNA 4X6QC 1M2PA 4L9IA 4YO4A 1M2QA 3BI6A 3DJ5A 4RG0A 2CDZA 4NKSA 4RJ6A 4EK6A 1YHWA 3MVJA 3BBTB 3BU3A 3P7BA 3QYZA 1H8FA 1M52A 5CAUA 2O2UA 3OMVA 4UY9A 4DITA 3MI9A 5B2MA 4HZSA 4DTAA 4A9TA 1H00A 2ZM3A 4FTUA 4LMUA 4NJDA 4IB0A 3RPRA 5IA4A 4F6WA 4PV0A 1UU3A 2BRBA 4J71A 3LFBA 4L8MA 2OG8A 4FZFB 4UWCA 3F3ZA 2R3MA 4KRDA 4M15A 5AUXA 4GFMA 3P9JA 4I3ZA 3UC4A 4BDEA 2QURA 2VTSA 4OTHA 4AA5A 2QCSA 2DWBA 3O0GA 3F9NA 2B9HA 4OTPA 5CU4A 5EK7A 4MXZA 2ZMCA 3PP0A 5DG5A 2J0KA 3QF9A 4RFYA 2E2BA 2J6MA 5CANA 4MWHA 5CVFA 4X21A 3DPKA 4GK4A 3DBDA 3RGFA 3GI3A 4XH6A 1ZOGA 1W84A 4WD5A 3GFEA 5AIRA 4D2TA 4QQCA 3NUSA 1T45A 2V7OA 4I93A 4EQUA 4MHAA 5HNBA 4CEGA 2HY81 2BHHA 5DT3A 4GEOA 1GZ8A 5F20A 5AR5A 2IJMA 4FKGA 4G3DA 4CRSA 1UNLA 4F65A 3O8UA 4GT4A 1JVPP 4J99A 2PZYA 1JKTA 2GS7A 1XBAA 3UZRA 4LRKA 3AD5A 2ZOQA 1WBSA 4NH1A 4CFVA 4MCVA 5H8GA 5C8KA 3N4VA 1LR4A 4FV7A 4DEHA 4IWQA 1B39A 4AW5A 2OZAB 2VNWA 3LFCA 3QYWA 3D5XA 3KN5A 4AGDA 4CT1A 5I9UA 3E64A 2FSLX 4I6QA 1Q5KA 2EU9A 3BHVA 2NRUA 2W1HA 2WMTA 2X0GA 2PYWA 1Q41A 3A7JA 4TWCA 3PXKA 2FGIA 3LAUA 4MTAA 2QOFA 2C1BA 3EFJA 3R7OA 5FEDA 3FSFA 3I5ZA 2QODA 3KXZA 2CJMA 3TZMA 1OITA 2W17A 2R5TA 3CP9A 3D5WA 3QCXA 2E9OA 4KAOA 5AX3A 1IAHA 3UQGA 1GY3A 3ZZWA 3QHWA 2VO0A 4BY9E 2CKPA 2G9XA 4KKGA 4UEUA 1OI9A 3V6SA 3DB8A 3RM6A 2VTLA 3EQBA 3LJ2A 4AN3A 5IU2A 3LLAA 2LAVA 4QYHA 3MPAA 3OXZA 4IZ5A 3UOJA 2UVZA 5CAVA 5L2SA 2BRHA 3WF8A 2OO8X 3HVCA 4LFIA 2B54A 1ZYJA 3IW4A 4FV3A 5C8NA 4U81A 5LOHA 4IAKA 5LVNA 5J7HA 4M0ZA 5EYKA 1ZOEA 5AR4A 4F08A 3DAEA 4BZDA 4FIJA 4ALVA 1YXVA 2YISA 2JDOA 2R3KA 3CJFA 3PZEA 3VJOA 3ZDIA 1F0QA 3S00A 4GUBA 3PA3A 1OKVA 5IQIA 2JGZA 3PJ2A 2ITQA 2VO6A 4QMZA 3TTIA 5DMZA 3FI2A 1ZWSA 3BHHA 4FT9A 5H9BA 2XB7A 5AM6A 4FG9A 1CKPA 3LFFA 5C26A 1R78A 4YZDA 2WIHA 3AMAA 3O8PA 3EB0A 2H6DA 3PG1A 3ZU7A 4ENXA 2WTIA 3RVGA 1FGIA 3LFSA 3CD8A 4YBKA 4XG7A 4ACGA 2CCIA 3OEZA 3SRVA 5GZ8A 5KKRB 2GTNA 3FBVA 2CLQA 2G15A 1E1XA 4ZTLA 3U6IA 3Q52A 2Q83A 3LMIA 3VQHA 1QPEA 4UMPA 3SD0A 3BGPA 5CSXA 3HLLA 3EQDA 3R9NA 3CTJA 3GC0A 2YWPA 3VWAA 4ASXA 1R39A 2IO6A 4I4EA 4CRLA 5HD7A 5TKDA 5DT0A 1W82A 3U6JA 2OZAA 4WUAA 1AGWA 5LXMA 1PXNA 4QD6A 3LFNA 4BDBA 3DFAA 4MH7A 3JVRA 3HUBA 2WTDA 4FK3A 4KIPA 4QNAA 4D0WA 2GDOA 1YHSA 3FMEA 3PLAE 2VRXA 5AADA 2ERZE 4IVCA 5DH3A 4YPDA 4MXOA 4O2ZA 4O7RA 4JRNA 4IWPA 3FY2A 3FE3A 3ZSGA 5H2UA 4WNOA 1ND4A 4R78A 2VWUA 4AOJA 4R77A 3Q53A 1O6LA 3ORPA 4B8LA 2XUUA 5DOSA 3KVXA 5C03A 3QQUA 3WF7A 3R1YA 4LUDA 5M06A 5J87A 4IM0A 4L7FA 2X2MA 3C4ZA 1FVRA 3AC2A 1OIYA 4MNEA 3KXHA 4G6NA 4I6BA 3D14A 1MRYA 4QP6A 2JAVA 2W0JA 2F7ZE 2YCQA 5CT7A 5CSVA 3H0ZA 3PPZA 5BUJA 4ERKA 4CG9A 4G3CA 4BDHA 4CV8A 4R8QA 3PPKA 1J91A 2IVSA 2XA4A 4F7LA 1KOAA 1Y6BA 4QMPA 4A4OA 4O82A 2WMXA 5FBNC 1XBCA 3S2PA 3FMDA 4X2KA 3TKHA 3TZ7A 3SVVA 4Y85A 4USDA 3RAHA 4YSJA 4KS7A 4OAVB 1U54B 3PE1A 4KNBA 3NEWA 3RAIA 4W8DA 3QRJA 4R5SA 3FMLA 4FTRA 4I0TA 5HHWA 5HKMA 5JGDA 5KMNA 1O6YA 1PKGA 3MSSA 3E5AA 4WRSA 2R0IA 5DR6A 4AGUA 5L4QA 4GUEA 5TT7A 1J7IA 3L8VA 4JI9A 1H1RA 1R3CA 4KIOA 5IH6A 4PPAA 1OKZA 4D2SA 1NA7A 2VZ6A 4JBQA 5A6OA 3QD0A 5HX8A 1KV2A 5DT4A 4E6QA 4DH5A 4EOLA 3C0IA 3MH2A 4KABA 3QLGA 2A27A 5HG8A 3RWQA 1HCLA 5FBOA 4AS0A 1H0VA 4EOQA 3DZOA 2IWIA 2WHBA 3CBLA 3U54A 1OPLA 4O1PA 2VX3A 3CIKA 4N0SA 4CQGA 4CMOA 4XOYA 3PJ3A 5KZIA 3ZMMA 4L67A 1H24A 2XKDA 3NLBA 4O2PA 3RPSA 3FYJX 4BIEA 3CR0A 1JKLA 2WELA 1H08A 3GUBA 4IEBA 3PJ1A 1M17A 3KCFA 3IDCA 3R28A 4ALUA 4RIXA 4DG0E 3BYOA 5E4HA 2JBOA 3HNGA 5IA0A 3ZEWA 4KD1A 4BCHA 3TNWA 3R7IA 3TZ9A 5BYYA 5DR9A 4RLKA 1SMHA 1URWA 5BVNA 1FGKA 3PWDA 4NWMA 4LGDA 4FTQA 4IAFA 4OTIA 4ZK5A 1E1VA 3E7OA 3FXWA 4BKZA 4FTAA 1ZMUA 3IO7A 3S4QA 4BBFA 4AT5A 4BF2A 4JQ8A 4YZ9A 3FXZA 3A61A 3TJDA 4AAAA 4DBNA 3PE2A 3RNYA 5EQEA 3JXWA 3N9XA 3UYTA 4FC0A 4F9BA 4DEEA 3GU6A 4XP3A 4A06A 2V22A 1ZZ2A 1ZZLA 4QTAA 3QTWA 4RJ7A 1LUFA 5F1ZA 4ANOA 2C3LA 4YJNA 2XBJA 4EWHA 4ZMEA 4ZY4A 4UBAA 4EUTA 3ZO4A 4K6ZA 3VF9A 4AW1A 3V5JA 4O0YA 3NUYA 3PY1A 3PXFA 4IB1A 3T3VA 4FKJA 2PUUA 4NM3A 3ZUVA 3DAKA 1RQQA 5CTPA 4A07A 4L7SA 3QTQA 3DQWA 3QWJA 3VHEA 4F9CA 3W18A 5IQHA 5HORA 2OLCA 2CKOA 3DQXA 3ZBXA 1QPCA 1OVEA 2F7EE 3R2BA 2FA2A 3CGFA 3RINA 2HWPA 3R02A 1W98A 4R3RA 4YJRA 4MVFA 4FT0A 2DYLA 4NYEA 2ZAZA 4JDHA 4K18A 2VTRA 4FSWA 2B0QA 2GNJA 2F7XE 3DOGA 4XP2A 1XH4A 3G6HA 4PPBA 1RDQE 2PVHA 2X6EA 3FL4A 4AWIA 3COIA 3M11A 3I79A 3R21A 4IVDA 2B52A 1R0PA 1J7UA 3E8NA 3ZO2A 3NW5A 3QCSA 4A9UA 1OPKA 3PJCA 3R63A 4G5JA 2XH5A 4WSYA 2OGVA 2XVDA 5M4CA 2QHNA 1WVWA 4X2GA 2XK7A 3IS5A 4QP1A 4ASDA 4HVHA 4M67A 3TIZA 5CEKA 4YZNA 4IADA 4EOIA 2P4IA 3S0OA 5JT2A 1YW2A 5EKOA 3QKKA 2XNPA 4ANSA 3RHKA 4DGOA 1YOLA 5IQGA 5HVYA 5BNJA 5CS6A 4AT3A 1Y6AA 4BHZA 3RK5A 5HVKA 4HPTE 4UMUA 5AUVA 3PIXA 5JH6A 2QKRA 5DEYA 5FEEA 5A14A 3NYVA 4JJRA 3GBZA 4FGRA 1DAYA 5HIBA 4V01A 3ERKA 3MS9A 4I5CA 2F57A 4PL5A 4XBUA 1A9UA 4EK3A 4IM2A 3V5QA 4FT3A 1Q97A 3PSBA 2CN5A 4X3FA 3JYAA 3HAMA 3NYXA 4HVDA 3OY3A 4Y8DA 2HELA 4GRBA 4C4JA 3KCKA 4FF8A 1G5SA 5A4TA 4I0RA 3ZBFA 4XCUA 5IEYA 5HNIX 3UMXA 3OTUA 1Q8ZA 5EM5A 3KRWA 1WBTA 1BUHA 1UWHA 2RG5A 3D9VA 4R5YA 1Y8GA 3FQEA 4C61A 3GOPA 5E1EA 4GU6A 1H1PA 2XIKA 5IA5A 3KXNA 3OT3A 3EN9A 2O63A 3ROYA 5JZJA 2C6TA 3GT8A 4M12A 4E3CA 5HICA 3H9FA 2W05A 1GIHA 4MXYA 5D41A 4AE6A 2C5YA 5JFXA 3QZGA 4IFCA 2PZ5A 4RJ3A 2UW4A 4C2WA 5EH0A 2OK1A 4WIHA 3PA4A 4U3ZA 3T3UA 3PXYA 4GCJA 5J9YA 1PXKA 2XRUA 2AYPA 4PDPA 4K0YA 5HNGA 4CGAA 2YITA 4FYOA 3MW1A 4YNOA 2PULA 1JLUE 4JBVA 3QQLA 4H39A 2JDRA 4HCUA 2X2KA 4P2KA 4A4XA 2VTJA 3NUUA 1UKIA 3C4FA 1W83A 2V5QA 5CVHA 1XR1A 4FK6A 4B4LA 1UKHA 3GQIA 4G16A 5I4NA 3SQQA 3VS4A 2PL0A 4IVBA 5T3QA 3KF7A 1VYWA 3UC3A 3ZHPC 3LM5A 5KE0A 4QYYA 4BWXA 5JKGA 1H28A 4EOKA 4B7TA 2AUHA 2HXLA 3HP2A 3R6XA 3UPZA 4BIDA 3C7QA 4ZZNA 4CFXA 4QMLA 1YI4A 3ZRLA 1XKKA 5CF5A 4IMYA 4CZUA 5CI6A 2CGUA 3R8ZA 5IA1A 3SG9A 3ZUTA 3WIKA 4U9AA 5C8MA 4C4HA 4FKLA 3FY0A 3PXZA 4RWKA 3UTOA 1IASA 1XQZA 5HO7A 1ZMVA 3ZC6A 2OJIA 3OWKA 3BCEA 4IAIA 4U43A 3FMNA 3OW4A 2WMUA 1MQ4A 4DC2A 4DH8A 2JIVA 4I21A 5AUWA 5HBHA 3R9HA 4AZEA 3NNVA 5KHWA 3N51A 3VBWA 5K4JA 4D1ZA 1Q99A 4Y5QA 3FLSA 4FBXA 5CALA 1BI7A 4GIIA 5FQDC 3DU8A 3IONA 4EYJA 4YC3A 5EW9A 4AGCA 5FM2A 3Q9WA 2UZEA 4M13A 3R9DA 4FTOA 3Q6WA 3ALNA 3TV7A 1H25A 5CF8A 2PVYA 4NM7A 2C6LA 5AM7A 3BLRA 4GYIA 1CMKE 3ATTA 2Z7QA 4EHEA 3D7TB 5A9UA 4PMMA 4OTDA 1IR3A 3D0EA 4K8AA 4V04A 4YJTA 5BVWA 5ETFA 5JGAA 3DDPA 2C68A 3MIAA 5J9LA 3HV5A 2W1DA 3R2YA 2VNYA 4BFMA 3BV2A 3NWWA 4I0SA 3RMFA 4D5KA 3NMUF 2ITPA 3OZ6A 1YXUA 4JDIA 1KE5A 3I5NA 2VTNA 2RFNA 3MH3A 5KNJA 2ITNA 2J50A 4YSMA 2PTKA 1ZYSA 3F88A 3GU7A 3W1FA 4BGQA 2PVJA 4U45A 5AJQA 4JQEA 3RI1A 3ZRMA 5DLSA 3HL7A 2C3IB 5D10A 3QQKA 3ZXTA 2PZPA 5K3YA 4JR3A 2PVLA 1GZNA 4U41A 2C1AA 2W4KA 4BC6A 3II5A 4J96A 2R3GA 4QTDA 5ANJA 4YJUA 4UWBA 3OY1A 4DAWA 4C3FA 3BKBA 4Z9LA 4JT3A 1AQ1A 2BKZA 1L8TA 3FKOA 5AP1A 3V6RA 3W32A 4CCBA 4E4XA 2G2FA 2BRMA 5AAFA 3UVRA 4EEVA 5LARA 3ULIA 2ITWA 3ORLA 3QRKA 5CZIA 3UNJA 3RM7A 3OC1A 4UYAA 4FTTA 4UX9A 2Z02A 3FMHA 4BGHA 4C38A 3N4TA 3C4XA 3PG3A 2ZDUA 3ORNA 3Q9ZA 3QTUA 4PWNA 3VC4A 3C0GA 4FKTA 4RVMA 5E8UA 4AXAA 4PL4A 3LVPA 3LKMA 3QUPA 4KB8A 5DFPA 3BEAA 4HNFA 3BWFA 4E6DA 2I7QA 2ONLC 4GV1A 1ZARA 4CCUA 4BDDA 3ZC5A 4EOMA 2PVFA 4QPSA 5BUEA 3QD3A 3GP0A 3F2RA 5HCXA 3UG1A 5JFVA 3FL5A 4KIKB 4ZXTA 4FEUA 4YLJA 3EHAA 4M8TA 3DK3A 4BIBA 5EKNA 4IIRA 4NW5A 3R30A 3PRIA 1J1BA 4I4FA 5JK3A 2C69A 5K5NA 4W9WA 3LJ0A 5HESA 4C36A 5FXQA 3MA6A 2W5HA 4FZAB 4U97A 4K77A 5I9VA 3FSKA 4G31A 4TW9A 3BE9A 4XMOA 2OU7A 5DHJA 5EYDA 4USEA 2JKMA 3C51A 2X4ZA 4L6QA 3QALE 4QTCA 3U9CA 4F4PA 5J5TA 2BKKA 2XYUA 5M07A 2X9FA 4HYSA 4OTWA 3PVWA 4AZFA 2JDSA 5EM7A 5ICPA 2OZOA 3FJQE 1YHVA 3EQIA 1YWRA 4C57A 4O7TA 4FL2A 4DEIA 2R3PA 4K9YA 5LVLA 5AV3A 2ETMA 4BCQA 1XHAA 3EQPA 3PXQA 2UZTA 3QD4A 4MD9E 4E4MA 5HGIA 4BDJA 3VBVA 5E8YA 4NCTC 4J7BA 2ITYA 3LFQA 4YTIA 4CLIA 1H4LA 1GZKA 4FTJA 3WF9A 3ZFXA 3GFWA 4EHVA 4BB4A 4QMWA 4IVAA 3MFSA 4HVGA 3K2LA 4R7IA 2OXXA 4YZMA 3R8LA 2WMAA 4PRJA 5IEVA 1Y57A 4FG7A 4A9SA 3NVKI 2VTOA 3W2PA 5BVEA 5C27A 1J3HA 4OBPA 2FB8A 2XIZA 1XH9A 5GZAA 3G90X 4FMQA 3KXGA 4RX7A 4RMZA 2QOIA 5DIAA 4BTFA 2W9FB 4BCIA 2PHKA 3TKUA 1S9JA 2W5AA 4G3EA 4I41A 5B2KA 4F64A 2G2IA 4RQKA 3ZSHA 3QUDA 4QP7A 1E9HA 4O7NA 4BYJA 3LFEA 1GIIA 2X8EA 3KRLA 2PE1A 3O2MA 4KA3A 4ITJA 2W1IA 2YZLA 4C33A 5HG9A 1WCCA 2YACA 4C58A 5CT0A 4II5A 2JKOA 1OUKA 2UW8A 1U5QA 2AC3A 3CKWA 4FR4A 4XG4A 4YBJA 4IANA 4BI2A 3BGZA 5IG1A 4DE4A 3KGAA 1V0PA 3JVSA 4U7ZA 4YP8A 1H27A 5ACBC 4D4RA 4OW8A 1MRUA 4AN2A 4C3PA 4EZ7A 4A9RA 3NNUA 5AIKA 2ITZA 4DG3E 4FSYA 2WMRA 4NSTA 5ANDA 2XF0A 3LW0A 4XOZA 2VGPA 4TYGA 5EHOA 3ZLWA 4BBEA 1PXOA 4EKLA 3VUIA 5AFVA 2F2UA 2JAMA 3JS2A 3ORXA 4FZ6A 5DRBA 1IEPA 3RBWA 3HV4A 3EWHA 2HIWA 3NCGA 4QRCA 4DA5A 1SVEA 2UW3A 4QYEA 5ANIA 4RFZA 5CENA 3VS2A 5AV4A 5E8XA 1REKA 3ZTXA 2Y4PA 3DKCA 4RIOA 2IG7A 3GU8A 3C5IA 3QKLA 5KMIA 3TUCA 2BROA 1FBNA 4O6LA 2WTWA 5DE2A 5GIPE 4RVLA 4CLJA 5CU6A 3K5VA 4DGGA 4LL0A 4OAUC 2NRYA 4CKJA 4MXCA 1Q24A 4OBOA 4OGRA 4DN5A 3FC2A 2WXVA 4MK0A 5FDXA 3TI1A 4FTMA 2ZM4A 1NT2A 1CTPE 5IQBA 3IW6A 3MYGA 4ID7A 3IOPA 5EM8A 4CMUA 2AC5A 3Q4ZA 2YABA 4MAOA 4DH7A 4M14A 2QR7A 3FQSA 4QMVA 5CEIA 3ZUUA 2SRCA 5CU0A 4FTNA 3ZLXA 1YDSE 2BTRA 2GNLA 4HGLA 4QPAA 2YCFA 3EKKA 3V5TA 3OOGA 1QCFA 1BX6A 1OIQA 2CGVA 2RFSA 3FMMA 3QLFA 5M4UA 3UO4A 2HW7A 4F0FA 2H8HA 5I3RA 2OI4X 2PVKA 3CKXA 3CXWA 3QBNA 3HMIA 4FKPA 1UU7A 3DDQA 3CPBA 4GK2A 3EYGA 3HMPA 4X2JA 4HGSA 1LP4A 4S2ZA 5EDRA 4QMXA 4XG6A 2CKQA 4ZMFA 4C62A 2RKUA 5EI8A 4RFMA 4H36A 4IHPA 5T6KA 3O7LB 2XMYA 4LOPA 4B0GA 4UZHA 1UU9A 2WMBA 2HXQA 4YZBA 1KE9A 3ODYX 2YDIA 2KULA 4I5HA 4TWNA 2BVAA 1PMUA 3HMMA 2J0MB 4GFOA 3VS0A 5F9EA 4FKSA 4FV4A 2GPHA 3MVHA 5DN3A 5IDNA 3EQCA 3ZLSA 4KKEA 2HZ0A 1M14A 3KB7A 3VS7A 4ANMA 2YZAA 4OBQA 4EOPA 5M56A 4IX4A 4RGJA 5FTGA 4I24A 3DKFA 4D9TA 3WZJA 3FKNA 4MXAA 3ATSA 5HBJA 3R71A 3FYKX 4L3PA 3G0FA 3UOLA 5HE3A 3LPBA 3UE4A 2FYSA 3VIDA 4XBRA 2ZDTA 5BYZA 3ORKA 3OT8A 2W1EA 2HK5A 4WO5A 4D2PA 3TUBA 2YWVA 2BDFA 3D7ZA 5J95A 3HMNA 3KRRA 4S32A 3OFMA 2XK6A 3AG9A 5L6WL 5HE1A 4CKIA 5E90A 1B6CB 3OF0A 3NUNA 3VW8A 4YUQA 1SNXA 2GSFA 2WD1A 4ZY6A 3OROA 4FSNA 2WQBA 4EBWA 5KKRC 4BR3A 1PMVA 3OEFX 2WAJA 1W0XC 2REIA 3LQ8A 4BCPA 2WIPA 2VTMA 3TWJA 2HAKA 4QQTA 5KMMA 1PRYA 1NVSA 3UO5A 4TZRA 3C9WA 4O91A 2Y4IC 3AD6A 3O50A 4XV2A 5IMEA 3C4EA 3QD2B 1U5RA 4D9UA 4N4SA 2J0IA 4F9WA 3FDNA 5I9YA 4NL0A 4NEUA 4LM5A 4P90A 2WEIA 3DKGA 3D5UA 4K2RA 1QMZA 2VWZA 3GGFA 5AV1A 4EH6A 5IEXA 2WMQA 3ALOA 4OLIA 3ZONA 3R9OA 1VZOA 2NPQA 3OBGA 2PMIA 2EXEA 1H07A 2QI8A 1FINA 2YM4A 3MGYA 4AN9A 2OBJA 4IX3A 4FTLA 3SLSA 5TE0A 4EC9A 3HV3A 4FV2A 3OHTA 4XG9A 4RZWA 1MRVA 4TRLA 3ENMA 4FUXA 3TV6A 2JKKA 5K9IA 3QZFA 2HZNA 3KF4A 4FSTA 2CGWA 3NDMA 4FVPA 4FV6A 3D2IA 4M69A 5BPYA 3CJGA 3MH1A 4BCGA 4J98A 4JIKA 4XLVA 5J1WA 4FEQA 1OKYA 4AFEA 4Z16A 3WI6A 2UW9A 4LG4A 3TNPC 4M69B 5EHLA 3G9LX 4XS2A 3PWYA 3C0HA 4RX8A 2OJFE 3AC4A 4ACHA 3QTXA 2WU7A 5L2QA 5IZFA 3KREA 3H4JA 3FHRA 3KFAA 3QU0A 2DUVA 3R7GA 1BI8A 4QP8A 2OXDA 4K11A 4W9XA 3VW6A 2LGCA 4FTIA 4DGMA 2G1TA 2GNIA 1L3RE 3TIYA 3W2CA 3R7VA 3E88A 4OTRA 3EFKA 2R3FA 4FSZA 3F7WA 2W5BA 3LOKA 3GC7A 2XCKA 4RIWB 5DBXA 3FLZA 3NZ0A 3IGOA 3E3PA 5FLFA 4HPUE 4TYHA 4LOOA 4XUFA 2OH0E 3GCQA 1FPUA 2WOUA 3SHEA 3EL8A 3NYNA 3VVHA 4EH2A 4ZTMA 5AUUA 3TXOA 4S33A 1P4OA 3FZRA 3CEKA 2BFXA 2C6IA 3GC8A 5D1JA 2VWVA 5FUTA 3DLZA 3GCSA 5HCYA 2Y7JA 4FIHA 4GG7A 4EH5A 3TM0A 5LMAA 4BDAA 1OKWA 4QMOA 4FV9A 2BZKB 3QQHA 4LV8A 4V05A 4MD7E 4F6SA 3MN3A 4JAJA 2YCSA 4QP3A 3SDJA 4K1BA 1YXTA 5HO6A 2NNWB 4EQCA 2HZ4A 2B9JA 5KMOA 2BUJA 3OW3A 1M7QA 1LEZA 4O7VA 4MYGA 4FT7A 3LQ5A 4OR5A 5DWRA 3WYXA 4DGLC 2IZRA 2YM8A 4GJ2A 3T9IA 4BBMA 2P3GX 5E8SA 2ZM1A 4AT4A 4F0GA 2V7AA 3I7BA 2FUMA 4X7QA 4D1SA 5CQUA 5E92A 5M51A 3RZBA 2XZSA 4BVUA 2QO2A 3W8QA 2CSNA 5CASA 5FTQA 3PIYA 5EOBA 3VUGA 1FQ1B 3RHXA 3AD4A 3DS6A 5AP3A 3FZ1A 4BGGA 5K5XA 5D7VA 2ITUA 3BYUA 4FV8A 2BDWA 4U42A 4X3JA 4WUNA 3V5PA 4YTCA 4F6UA 2HENA 3VBTA 2WTKC 3CY3A 4GMYA 4Y46A 5HO8A 3REPA 5AUTA 4FODA 1Q8TA 2Z60A 5DA3A 2JFLA 3C4CA 2GTMA 3BHTA 3DBQA 2YM6A 5DEWA 3EQFA 5EFQA 3E7VA 5IQEA 4R6VA 4I6FA 3RCDA 4IZ7A 1OL7A 3GCUA 4P7EA 2FH9A 1VR2A 2JC6A 3Q96A 3QTSA 3EQRA 3TACA 3LCOA 2OH4A 3V04A 4X0MA 4YC6A 2OXYA 4DBXA 4WBOA 3RNIA 3VUKA 3Q04A 2HW6A 3DBCA 2IZTA 4IX6A 3ID6C 4B9DA 2R4BA 1Q3WA 2YLEA 1PKDA 2R3OA 4YU2A 1SZMA 3HRCA 2J0JA 1SVGA 3QAME 5B0XA 4S34A 2BTSA 1UU8A 3L9NA 1FVTA 3DK7A 2FSMX 3FI8A 4M0YA 4C4GA 4NW6A 4C4FA 1W7HA 2GNHA 4CZYB 1BL6A 2WQEA 3GOKA 3DJ6A 2J0LA 4EKKA 2UW0A 4O1OA 1KUTA 4Q9SA 3WZDA 4C37A 4JIAA 4NU1A 4CZTA 3KY2A 4FKVA 4QTEA 4MQ1A 3ZDUA 4UV0A 2E9PA 3LLTA 3MJ1A 4EWQA 3HKOA 4QP9A 2JFMA 5E9EA 4IC7A 3NIEA 3L9MA 3MA3A 3MH0A 3QTIA 4FKUA 5GNKA 3NAXA 2IW6A 4D5HA 5J5SA 3QZHA 2Z7RA 4J95A 4BDGA 1OECA 2C47A 2P2HA 4YO6A 4FVQA 4WBBB 5A46A 4XV9A 4QO9A 3V51A 4LYNA 3PA5A 2KTYA 3MB6A 3ORIA 3Q3BA 4ACCA 3CE3A 4I92A 3AT3A 5H8BA 4MBLA 2JEDA 2X39A 5DRDA 3W2OA 4AG8A 3KK8A 1OMWA 4L01A 1WBVA 4HZRA 4XG8A 3L8PA 2HOGA 3E87A 3V8SA 1H1QA 1Q8YA 1U59A 1LEWA 3PSCA 3BELA 1R0EA 3M1SA 3RJCA 2VAGA 2XNBA 4L43A 3SXRA 4HOKA 2R3HA 4EJNA 1I09A 4AZWA 3E3BX 4APCA 3W8LA 4F1MA 3Q4TA 3MDYA 3IGGA 4RC4A 5JZNA 2BZHB 4KS8A 3Q9YA 4G9RA 3VUDA 5FDPA 5IA2A 3UBDA 5AAGA 4R1YA 5HLWA 4LV5A 1KV1A 2RF9A 4G1WA 4FKIA 5KZ0A 4OUCA 3HMOA 2XJ0A 2C3KA 4GYGA 3SXSA 4D28A 3V3VA 1PXPA 3SOAA 3CQUA 2X2LA 4IAAA 4W8EA 2QOKA 4R3PA 5BYLA 3R22A 5IH4A 4FTKA 4E20A 5KMLA 3HV6A 3OVVA 4TY1A 3F3UA 1OB3A 2PVMA 4HCTA 4E6CA 2PUPA 4C2VA 5JFWA 3GU5A 4D58A 2PZRA 2Z7LA 2IVTA 2XJ1A 3A7HA 5M44A 3B8RA 2UZWE 1IG1A 3SRVB 3W16A 4QMYA 5M57A 4NT4A 4F0IA 5T68A 2WQOA 3KRJA 5JN2A 4BDIA 5CEQA 3EKNA 3AC1A 3KL8A 3C13A 1U4DA 4E26A 3O96A 4LGHA 2IZUA 2XEZA 3KN6A 3BBWA 4QPMA 4KINA 3U8WA 4U6RA 3BZ3A 1ZOHA 3ZRKA 3VJNA 1YOMA 4AOTA 3D94A 2X8DA 3NGAA 4FG8A 4D55A 3DTWA 3QFVA 5HIDA 3WILA 4ZLYA 4MQ2A 1IAJA 3ZSIA 3QQGA 4M66A 5D11A 2R2PA 2CCHA 3DZQA 3FPMA 4E5AX 3PYYA 4RJ4A 2ITOA 4U44A 5LWMA 2BAKA 1KE8A 4BKJA 3F66A 2YDJA 3FXXA 3EN7A 2JD5A 2YAAA 4PMTA 5AEPA 1PXJA 3A4OX 3B2WA 3JY0A 3DTCA 3MESA 4KIKA 2R9SA 4G17A 2BFYA 2ZVAA 3KVWA 1JBPE 3F69A 2PY3A 5HLPA 1VJYA 2B53A 1ZY5A 5CVGA 5CEOA 2ZV8A 4L45A 2WU6A 3QZIA 2QHMA 4O6EA 5B7VA 4LMNA 5AP4A 2PZIA 3CS9A 4JR7A 5M53A 3SG8A 3NVMB 3RPVA 4NM0A 4I1ZA 4L44A 2ZV9A 3R1SA 3BQRA 4B6LA 3RCJA 4FZ7A 5LVMA 5AR2A 2C6EA 2W99B 5J7BA 2H96A 2HZIA 2Z2WA 3TNIA 3UP7A 3EN5A 3W55A 2XP2A 4A9YA 3U6HA 3DGKA 4IAYA 4YJSA 5IMXA 5I9XA 3NAYA 4EZ3A 4TYIA 3ZFYA 1PXLA 3MBLA 4HYHA 5BUIA 1XBBA 4YJVA 3DXPA 3IW8A 2YCRA 4JX3A 2W1GA 3BPRA 3ENHA 4JLCA 1OL1A 3RWPA 5B2LA 4CTCA 4FIGA 3K3IA 4JNWA 5IDPA 3DAJA 4JOAA 4HNIA 2BZIB 3DA6A 5CAOA 3EMGA 1QPDA 2WMVA 3GQLA 3L1SA 4NKAA 5KMJA 3ORTA 4R7BA 2EXMA 5TOZA 5A4EA 2QD9A 5JQ5A 1CDKA 4F1OA 3OXIA 4IE9A 4LRMA 2CNUA 3KU2A 3UODA 2O65A 4FVRA 3BYMA 3R8PA 4GFGA 2QOOA 3OBJA 4P5ZA 3F2NA 4ZTNA 3FUPA 4E5WA 3QX2A 2X7GA 4M97A 2YHVA 2VTPA 3TNQB 4YURA 5CU2A 3BV3A 2PUIA 4MWIA 4AACA 2B9IA 3A62A 2I40A 1YI6A 2ITVA 4HYUA 2A0CX 4P4CA 3UNKA 1BMKA 3KMUA 2NO3A 3R8UA 4CFWA 4LI5A 4RJ8A 2XK3A 3AC3A 1Q8UA 3I0OA 4LOQA 5A6NA 1HOWA 2V0DA 1DS5A 3LIJA 3ORMA 3WZKA 4DEDA 4PDSA 5CSWA 5HZNA 1CSNA 2CNVA 2B9FA 3PLSA 4DYMA 4D4SA 4ALWA 3AT2A 4NM5A 2CHLA 1ZRZA 3BHUA 2E9VA 3P1AA 4IWDA 5A4QA 4RVKA 5D7AA 4U0IA 2QVSE 5EHYA 3LE6A 4CV9A 4RA4A 3HRBA 2W1CA 4IX5A 2WQMA 2VTHA 1RW8A 1KSWA 4QP2A 2G01A 2C5VA 1PHKA 3U4WA 3T9TA 4FIIA 4CG8A 4E5BA 3R0TA 2X1NA 2GCDA 1P14A 3AC8A 1JWHA 2H9VA 2J90A 3EFLA 2JIIA 3MJ2A 4O38A 3ZH8A 3I6UA 5I9WA 4NUSA 2YJSA 3HV7A 2X7FA 3O51A 4AP7A 3TN8A 2I6LA 3O7LD 4JDKA 3F3TA 3VO3A 5ETCA 4EZ5A 3BE2A 2BRNA 4JG8A 3ZS5A 2XRWA 3FLQA 4S31A 5IQFA 4U5JA 4EL9A 2OIDA 2WKMA 5AWMA 3A60A 3VNTA 3P5KA 1KE7A 3F82A 2JLDA 4DFLA 1YI3A 4GKIA 4IZYA 4EOJA 3EN6A 5FEQA 3M42A 3FMJA 3NW7A 3CTQA 4QNYA 5FWKK 3E92A 2R0UA 4XRLA 3F5PA 2XBAA 3PY0A 4OT6A 4YGAA 1ZXEA 3RPYA 3UO6A 1YQJA 2ITTA 4ZS0A 4F7NA 4EH8A 3KULB 1PY5A 1URCA 4FIEA 3MV5A 3DNEA 4E8AA 5LMBA 4BTKA 4Z7HA 3I81A 3NR9A 4FNWA 4I20A 3LHJA 4M68A 4YHFA 1YRPA 2YA9A 4UXQA 5CZHA 4BCFA 2PE2A 4FV1A 3G15A 1B38A 2WOTA 4RZVA 5AA8A 3JUHA 4GVJA 2A1AB 4WG4A 1F3MC 4S30A 3R1QA 2W4OA 1DM2A 2X7OA 4FL1A 4H3QA 4E73A 4ARKA 3JR1A 2QNJA 3MIYA 4GL9A 4LGGA 4XV1A 5E91A 4Z55A 2XNEA 4BYIA 2OFUA 5AUYA 5JGBA 2FSTX 3NUPA 3WE8A 2O8YA 4FI1A 4CT2A 3DY7A 2WB8A 4XRJA 4ZSEA 4LL5A 3ZXZA 2PSQA 2Y0AA 3FV8A 2PVNA 3LMGA 3LFDA 5AP7A 4ZTRA 3RAWA 3WZUA 5I0BA 5IQAA 3R7YA 3ZFMA 3FZPA 4JG6A 4KUJA 2GNGA 3LXKA 3EYHA 3HUCA 4AX8A 2QU5A 3ETAA 4XYFA 1BL7A 3FZOA 4ANQA 3OWLA 4NIFB 5HBEA 3L9LA 2X9EA 2QG7A 3K5UA 3TZ8A 4ERWA 2QOBA 4ZSGA 2GS2A 5FP5A 4FTCA 4C7TA 4G6OA 2O3PA 1TKIA 4YJOA 1DAWA 3A7IA 2VWXA 3KK9A 5HG7A 4BDCA 3NRMA 5LVOA 4Q5EA 5HTIA 5CEMA 2ZYBA 4L3JA 3EL7A 4EH4A 4XV3A 2Z8CA 5HEZA 3ZYAA 2XK4A 2F9GA 2UZVA 3BYSA 3MFUA 4J8NA 3DBFA 4CD0A 2VN9A 4BZNA 4UXLA 5IISA 4WOVA 5DNRA 4RWJA 4F7JA 3LCTA 3OD6X 4J52A 3UIXA 1H1WA 3M2WA 2PK9A 4FSQA 5D9HA 2BZJA 2RGPA 4D2VA 2XM8A 5BVOA 3QWKA 1EH4A 5I9ZA 2B4SB 4RIWA 1JKSA 2VTTA 2QQ7A 1Y91A 2VV9A 3GC9A 1SYKA 3PY3A 4FYNA 4UMTA 2GU8A 4J97A 1V0OA 5FM3A 1S9IA 1YXXA 4GW8A 2PVRA 4FL3A 4RC2A 2X6DA 3UYSA 4F9YA 3SGCA 3DLSA 2EUFB 2ETRA 4L52A 4DT8A 5M08A 3K3JA 4O96A 4ZJIA 5A4LA 3PUPA 5L2IA 2WMWA 2UW5A 4EI4A 5CF4A 1ZMWA 3P7AA 3LZBA 2JKQA 2PMLX 4DT9A 4DHFA 2ERKA 1UNGA 4I22A 4AW0A 3EQGA 3BLHA 4IQ6A 5BVDA 5HI2A 3HA8A 4FT5A 3SW4A 2ESMA 1FMKA 1YDTE 2QU6A 1YDRE 5F4NA 3QXOA 5ACKA 3QTZA 2FSOX 2QOLA 1APME 5AX9A 4BKYA 4LRJA 4H58A 4C4IA 1OIUA 2PUNA 3ZM4A 4DFZE 1XO2B 4FV5A 4L46A 4O27B 4TYHB 4BZOA 2QLQA 2YIXA 3PFQA 4EHGA 3ZEPA 4FA2A 1MP8A 3RK7A 2GFSA 4F99A 3QGYA 4BCKA 4AW2A 5J9ZA 4E6AA 2QOHA 2QO7A 2B7AA 5CQWA 5AP2A 5J79A 3CY2A 3U9NA 3A8WA 4RX9A 3CQWA 3OCSA 4I5PA 4XHKB 4F70A 4UYNA 3BLQA 3VRZA 2YIYA 4YTHA 4PNIA 5LJJA 3QL8A 1TQMA 4GSBA 2VX0A 1F5QA 4YR8A 2ZMDA 3UQFA 4MEDA 2BPMA 3ELJA 3F3WA 4I5MA 4MKCA 3G9NA 2WGJA 5E8WA 2WEVA 3NNXA 4FX3A 4W4YA 2C30A 4FKRA 4IW0A 3R7EA 4U40A 3O8TA 3PSDA 4F1TA 4WA9A 3ZM9A 1PXMA 4AE9A 2CGXA 3VS6A 4CYIA 4EK4A 3MPMA 3ACJA 4IJ9A 4JL9A 4RWLA 3Q2JA 3FHIA 5A3XA 4Y95A 4BI1A 1V1KA 4O22A 3KXXA 3TNHA 4DEAA 4DG2E 3HAVA 5GHVA 2Z7SA 3B8QA 3K54A 3UIUA 1PJKA 3HA6A 3R1NA 4PMSA 2XM9A 4DH3A 5HCZA 1Q8WA 4JS8A 5HX6A 2VX1A 5JSMA 2O5KA 2OIQA 2W7XA 3CGOA 4C59A 4XG3A 4ZTQA 5JFSA 1JPAA 1GAGA 4ZLZA 4UB7A 1JOWB 3ZOSA 4XLIA 3NX8A 3HECA 2HWOA 2J2IB 3RTPA 1VEBA 5L6PA 5IA3A 1XH6A 3UVPA 2JDTA 2QKWB 3O23A 4C8BA 2VGOA 2QOCA 3WZEA 3FEGA 3AQVA 1KWPA 1Z57A 2BCJA 4CKRA 3H10A 4R7HA 4D1XA 4O21A 2XKEA 3F6XA 5H3QA 3BWJA 2Y6OA 4WKQA 3VUMA 4BDFA 3PP1A 4WNKA 5HIEA 3VBQA 5EM6A 5EG3A 3COHA 3AMYA 4BCNA 3GXLA 5KO1A 2OSCA 3ZLYA 1YXSA 5DVRA 5EW8A 3IK3A 3MFTA 3Q5IA 4B8MA 4C0TA 3QX4A 3WF6A 3SC1A 5AA9A 2VWIA 2X4FA 1GZOA 4Z3VA 3F2AA 3VS5A 3GCPA 1H0WA 3UIBA 2OKRA 4CFMA 4F09A 4BCJA 3F7ZA 1XH7A 4JXFA 2EB3A 4GS6A 4PUZA 4GK3A 3ZO1A 4BL1A 5BVKA 2DQ7X 3QRUA 4QMUA 1I44A 3S3IA 3TEIA 1IA9A 3LM0A 4O0RA 3IQ7A 4YHTA 5FRIA 3TG1A 3WF5A 4E93A 5KUPA 2R7IA 3F5XA 4H1JA 1Q62A 2J51A 4H1MA 3VN9A 3N4UA 2HY0A 3EJ1A 2YEXA 3DFCB 3HEGA 3QA0A 4EOSA 3UOHA 5K4IA 3SA0A 3QXPA 3BQCA 2P55A 3FAAA 4I23A 3QQFA 2O0UA 3F61A 4L68A 4G34A 3RALA 5H8EA 4J53A 3G51A 2CN8A 3HP5A 2OW3A 3CCNA 3FLYA 4PNKA 3V5LA 3AOXA 3LCDA 4KSQA 4C35A 4RBLA 3OWPA 5CI7A 3H3CA 3UQCA 3UNZA 2EXCX 3LCKA 3KKVA 1JAMA 3AC5A 2GHMA 1WVXA 2Y4IB 1XH8A 2YM7A 3FLWA 4Y72A 4ZP5A 4E7WA 5CNOA 1M2RA 2C0IA 2QLUA 1ZLTA 3D7TA 4IACA 1U46A 3OUNB 1STCE 2WTJA 1YKRA 5AP6A 3RAKA 3MVLA 4YNEA 1UNHA 3OP5A 3LMHA 4U80A 1Q4LA 3QC4A 2RIOA 3I1AA 5A54A 1DI9A 4PY1A 5JRSA 2BALA 1OBDA 3VBYA 2X81A 2Y8OA 3GCVA 4FSRA 4UMRA 1H26A 3ZCLA 4JRVA 5CU3A 3SXFA 1NY3A 3QCQA 5EI6A 3KXMA 3W33A 5EW3A 1X8BA 4YLLA 1KOBA 1JSUA 2R3QA 4OTGA 4UN0C 2YLFA 4BCOA 4YMJA 2Q0BA 4AGWA 4BDKA 1JSVA 3GB2A 2YFXA 2VWYA 1ZYDA 4AF3A 2A4LA 2J9MA 3BU5A 3LQ3A 1Q3DA 4O0SA 1OZ1A 2ZJWA 3A7GA 3KC3A 3OWJA 4BI0A 2BAJA 4AA4A 5HU3A 5DI1A 1ZYCA 1ZYLA 2HYYA 4QMMA 2VTQA 4DINA 5FXSA 3V8TA 4RT7A 1YOJA 2GQRA 3C5UA 1WFCA 5CY3A 3UDBA 3ORZA 1Z5MA 4FV0A 4I6HA 3P08A 4WG5A 2I1MA 2XNMA 4WNMA 2YIWA 4X3FB 3Q32A 4IDVA 1XJDA 2BIYA 2A19B 2CLXA 5HE2A 5K0XA 2C6KA 5EI2A 5CF6A 4MX9A 2C0TA 1OGUA 4GH2A 4QTBA 4DTKA 1SM2A 4CFUA 4RLLA 2XIXA 3D15A 2UZBA 4MF0A 4ZJVA 4WHZA 3EZRA 3KRXA 4CYJA 5AR8A 2J4ZA 2J5EA 2WQNA 2JDVA 4L53A 4F7SA 5CSPA 3FWQA 1NVQA 2ZB0A 3H30A 3PVGA 2BDJA 1NXKA 3CC6A 4RA5A 2JBPA 4ZZMA 4XNEA 4JG7A 4BICA 2XEYA 4DTBA 1AD5A 3O71A 2Q0NA 4H05A 2IZSA 2YJRA 3E8CA 4ACDA 4ZZOA 3H9RA 4FE2A 3P4KA 4C34A 4GG5A 4HVIA 3PJ8A 2ITXA 3DKOA 5LMKC 5E8TA 3KMMA 2YIQA 3FKLA 2WMSA 4R3CA 3D2KA 2OIBA 3DK6A 2XNOA 5IF1A 4TYJA 4Y73A 5C4LA 1QL6A 3I6WA 4FOCA 4ZS4A 2C4GA 4EBVA 3I7CA 3OCBA 3PRFA 4EK8A 3R9RA 1YWNA 3IECA 1XH5A 3Q4CA 4L00A 4WSQA 4GT5A 3VF8A 5G6VA 3F5UA 4QYFA 3Q2MA 2C6MA 3A8XA 3LFAA 5C9CA 3EOCA 1G3NA 5C01A 4EORA 4O7YA 3KQ7A 1M7NA 2E9NA 5EOLA 2IPXA 3CPCA 4BTMA 4ENYA 5FP6A 3FZSA 1P5EA 3HRFA 4KRCA 3EN4A 3IKAA 5J1VA 2GQSA 2BHEA 3HDMA 4ASZA 1SNUA 5DPVA 3DV3A 4O0TA 3A4PA 4EH3A 3ULZA 4W4VA 4AUAA 4D0XA 2WFYA 4TWOA 3IG7A 3UJGA 3I0QA 4AOIA 2ZB1A 4Z7GA 5L3AA 5G1XA 1DI8A 2Y6MA 4AA0A 1BYGA 3KEXA 4QMTA 4O83A 4N70A 1OL5A 4RIXB 4QMSA 3LCSA 1K3AA 4PTGA 3VRYA 5KBRA 5EYMA 3BIZA 2BAQA 3IPHA 4CFFA 4QMNA 4DFUA 1GJOA 5HOAA 4NK9A 4J8MA 3HYHA 2I0VA 3BGQA 3NUXA 3Q4UA 4RIYB 3W2SA 4XX9A 1TQIA 4DF3A 5IKWA 2RFEA 3TTJA 2BMCA 4PP9A 5F94A 3WIGA 4EONA 3SOCA 2FVDA 4V0GA 5LVPA 3S1HA 4G2FA 5HE0A 4XEYA 2YERA 2C0OA 2XNGA 3DXNA 3MFRA 3VS3A 4BRXA 4ASEA 5FD2A 3THBA 2UZDA 4A4LA 4V0GB 3F5GA 4O7WA 2YM3A 4ITIA 1KE6A 2V62A 4NFNA 2UV2A 3U55A 4GU9A 4CMTA 3B2TA 4U79A 4PTCA 1ERKA 3Q60A 4LQMA 3PZHA 2VUWA 4I94A 4ITHA 2OJGA 2XNNA 3NNWA 3DJ7A 4PTEA 5E8ZA 3E8DA 4YJQA 5AAEA 1CM8A 3ET7A 3G33A 2OJ9A 3MTLA 1G8AA 3DCVA 2R3IA 5GJGA 3VULA 1A48A 5CAPA 2QOQA 4JQ7A 3EIDA 5BX0A 1JQHA 4RSSA 3JY9A 3R83A 1G8SA 4CSVA 1NW1A 2F2CB 5AP0A 2PPQA 4YC8A 5AP5A 3BU6A 4ZJJA 4HVSA 1P4FA 3UMWA 3Q6UA 2PU8A 3P7CA 3R00A 2VU3A 5EYCA 3PVUA 3MTFA 5LMKA 3CSVA 5KCVA 5GZ9A 3RK9A 4AFJA 3UIMA 4TPTA 4D2RA 3TUDA 2YN8A 5BVFA 3R01A 3R73A 1R1WA 5AR7A 1YWVA 2RSVA 5M4FA 4ZSLA 2QONA 4ANBA 3G0EA 3PVBA 5LCKA 2C5XA 2P33A 3OOMA 1OIRA 5LCJA 5C4KA 2R3JA 3AMBA 5HLNA 4N6YA 3VQUA 4JBOA 3UZTA 1GNGA 4TNDA 4G9CA 4B99A 1J1CA 5TO8A 3TV4A 4O7ZA 4UALA 3ACKA 4PQNA 3WYYA 4PF4A 3TKIA 2YM5A 3AXWA 4E4LA 5CXZA 2W06A 1UWJA 1WBOA 2RL5A 5HVJA 4RQVA 3NUAA 3MPTA 2C6DA 2P2IA 4LUEA 3IW5A 3UZPA 4KBKA 4X3FC 4XG2A 3LXPA 5IUHA 2UUEA 3SV0A 4EH9A 4EHZA 4PP7A 4FUYA 3SX9A 4CNHA 3OG7A 3QRIA 4IB5A 2GMXA 1UVRA 2IVUA 4DEBA 2I0HA 2OWBA 4IFGA 1JSTA 4M3QA 1K9AA 2VWWA 4ZSJA 3WARA 4HJOA 2OJJA 2GQGA 1YVJA 3BYVA 3RP9A 2X8IA 1OBGA 4ACMA 5ANOA 4O0UA 4WNPA 3C1XA 3NS9A 2XS0A 4ZIMA 5ANKA 4BWPA 5CYIA 2R3LA 1IA8A 5L2WA 5CLPA 3EH9A 3IW7A 3A2CA 3FQHA 4FIFA 3JPVA 1GIJA 2J5FA 2WZJA 3TL8A 3GNIB 2PMOX 4AU8A 4OTQA 3WE4A 3R04A 4JAIA 4NJ3A 4TXCA 4RWIA 3VS1A 2V55A 4H3PA
chains in the Genus database with same CATH superfamily
3ITZA 4UMQA 4D2WA 4KWPA 5EDQA 3LJ1A 1Q61A 3PTGA 4FNYA 2IW8A 4DLIA 1ZY4A 2UW7A 1P2AA 4TKSA 4TWPA 2C3JA 3QC9A 3U51A 3S95A 3PUFC 2JITA 4EJ7A 1OUYA 2VO3A 5AR3A 4DCAA 2GFCA 2F4JA 2XKFA 1W2CA 3NSZA 2OF2A 5CX9A 5JQ8A 4ZTHA 2OICA 3NW6A 4DFBA 1H1SA 3FI4A 2ACXA 4IBMA 4WRGA 5FXRA 5AV2A 4KIQA 4XJ0A 4AQKA 3F3VA 1WBNA 5IUIA 2W1FA 2OF4A 4HCVA 3W0OA 3FZTA 2BILB 2VTIA 4RPVA 3QHRA 4O0XA 4OT5A 3DB6A 3RKBA 2WNTA 3I60A 2XIYA 2EB2A 4FKQA 4GJ3A 4F9AA 4TL0A 5LWNA 3EQHA 4Y83A 1OL6A 3ANRA 4Q2AA 3E63A 4QMQA 5FG8A 5GJFA 4DFYA 4IH8A 4FGBA 5K0KA 1CKIA 2I0EA 5M09A 1U54A 4O0VA 1O9UA 4EC8A 4DFXE 5IPJA 3BRBA 3V8WA 3FC1X 1FVVA 2CMWA 2ZV7A 3ZZEA 4NTSA 1T46A 3BHYA 4ONAA 3FPQA 4YHJA 4EK5A 3E93A 5HTBA 3DXQA 4DEGA 3SAYA 1Y8YA 3TDWA 4IWOA 5JEBA 3CD3A 5D12A 4PDYA 5CAQA 5L2TA 4BWKA 4X2NA 5DGZA 5TF9A 5KX8A 4ANLA 4TTHB 3VAPA 3G2FA 5IH5A 4XP0A 1NVRA 2GHLA 4H3BA 4NZWB 3W2RA 4AZSA 2XJ2A 3VBXA 4AQCA 3COKA 4TT7A 3RZFA 3AGLA 2EVAA 3G5DA 1TQPA 3I4BA 4W4XA 5JMSA 3LXLA 3VHKA 4ZAUA 3IDBA 4U8ZA 4AZVA 4YTFA 4QDVA 1PYEA 3HDNA 1BLXA 4KBCA 4EOOA 3WOWA 2VO7A 4G3GA 5I5ZA 1MUOA 3D83A 3SW7A 3C50A 4IJPA 1J7LA 2BRGA 5ANEA 2XK9A 1V0BA 3W10A 4BTJA 4Q9ZA 4ZLOA 2HCKA 3GU4A 3UGCA 3CQEA 4EYMA 4JX7A 4UWYA 5L8KA 2E9UA 2CNQA 3BX5A 3QUEA 5CXHA 4FSUA 2DS1A 2YIRA 1WMKA 4FSMA 4MBIA 1SVHA 2GS6A 3SKCA 2UZLA 1PYXA 1WAKA 3HX4A 1UV5A 5I3OA 3L8XA 2XIRA 5KBQA 3BEGA 4N57A 1WBWA 4NTTA 2R64A 5AMNA 5L8JA 4CQEA 3MB7A 4MNFA 4FKOA 4QOXA 3TCPA 5CWZA 3UOKA 2RFDA 3A99A 3GEQA 3QQJA 4QP4A 4ZY5A 2ETKA 4YPSA 2A2AA 1PMEA 1QPJA 2IVVA 3E8EA 4DGNA 4X2FA 4RX5A 3NPCA 3DNDA 5J8IA 5E8VA 3PDTA 4KBAA 4HGEA 4PL3A 1CKJA 2CKEA 2OFVA 3KA0A 3PIZA 5E1SA 5ETIA 4E1ZA 4AXEA 4KKHA 3MY1A 4W4WA 3COMA 4RVTA 3GVUA 4YZCA 2UVXA 5L6OA 3PFYA 3QRTA 5GJDA 4JBPA 2W4JA 2IW9A 4Y5HA 3WBLA 1WVYA 3D4QA 4BHNA 3A7FA 4O7SA 1TVOA 2NP8A 4HYIA 4NCTA 1GOLA 5DYJA 1OL2A 5KMKA 2W1ZA 4F63A 2XYNA 3OS3A 4G6LA 4APPA 2RG6A 1UA2A 4DCEA 2YDKA 2J7TA 4ZOGA 1JKKA 5HD4A 4PX6A 4ORKA 4U3YA 4FEVA 2Y9QA 3P78A 3PPJA 3QKMA 3P79A 4IZAA 2QR8A 1H01A 4MXXA 3POOA 3MWUA 4IB3A 2R3RA 2WTKB 4JDJA 3ROCA 4TYEA 4RIYA 4CTBA 4DLJA 4HGTA 1A06A 1BKXA 2R3NA 2VD5A 4C3RA 3GENA 3TJCA 3V01A 2O64A 3EZVA 3OCGA 4EH7A 5BQ0A 1O6KA 2C6OA 3O17A 2ZV2A 3W0NA 3AGMA 5IQCA 4O0WA 2WPAA 4QQ5A 5HQ0A 2XK8A 4N6ZA 5AV0A 2CPKE 3G6GA 4O84A 5GIOE 3CTHA 4GIHA 5EQYA 4USFA 2B55A 3FMKA 3H9OA 2YAKA 1K2PA 3P86A 5FTOA 4EUUA 4WG3A 5F95A 1OM1A 2UW6A 1WBPA 3HGKA 4PDOA 4MNEB 2H34A 4ZTSA 2ONLA 3CLYA 3MY5A 4ZEGA 5GINE 4IC8A 3LXNA 3IOKA 4C02A 5EQPA 4IXPA 4G5PA 4NIFA 5KHXA 1MQBA 2PWLA 3E62A 3FLNC 3QCYA 4RJ5A 3EFWA 2P0CA 2FO0A 1ZAOA 4MF1A 1IRKA 1OPJA 3OTVA 4FKWA 1RE8A 5JRQA 5M55A 3NIZA 3Q5ZA 4RC3A 1RJBA 2UZUE 4UZDA 4MD8E 3UVQA 4X6RA 4Q5HA 2GHGA 1VYZA 3MVMA 4E4NA 2WTCA 2PMNX 3L9PA 4FOBA 2C5OA 3KMWA 2JIUA 4FNXA 3QGWA 4D4VA 3U87A 4PMPA 4A7CA 5ETAA 3R8VA 1PW2A 5TR6A 3TT0A 4CFNA 4JVGA 5C1QB 3QTRA 4O7LA 1PMNA 2B1PA 4IAZA 3NYOA 5ANGA 1PXIA 4WT6A 5A4CA 3DBEA 3OUKA 2UZOA 3P0MA 4IDTA 4KSPA 3IDPA 4MBJA 5HG5A 5ITAA 3ODZX 3PXRA 3RPOA 4GVAA 2BR1A 3W0SA 4GT3A 5IUGA 2WTVA 3FI3A 1Z9XA 2F49A 5LQFA 5M4IA 4NFMA 1WZYA 5EDPA 3OCTA 4ZSAA 3U4UA 4QYGA 4GKHA 3KULA 4J1RA 5HU9A 1LPUA 3QA8A 4YJPA 4TN6A 4QT1A 2PE0A 4IM3A 2XCHA 1PF8A 4YLKA 3R7UA 5HTCA 3R8MA 4M7IA 3Q9XA 3H0YA 2IN6A 3HZTA 4P5QA 3UG2A 4CXAA 5IQDA 4FEXA 2G2HA 3L8SA 5CEPA 3V5WA 2VTAA 4FEWA 4AZTA 2UVYA 3P23A 4DDIA 4M84A 5FGKA 3VUHA 2W96B 3AT4A 4L3LA 4O86A 2I0YA 5CSHA 1REJA 2QG5A 2XKCA 1JNKA 4TNBA 3OXTA 3T8OA 3ZO3A 1W8CA 2GNFA 2QC6A 5BMSA 1FMOE 3D5VA 4HW7A 3VUTA 3TDVA 4K33A 4RRVA 2R7BA 4C4EA 3MY0A 4QQJA 3UPXA 2VWBA 2UZNA 4FZDB 3C4WA 3ANQA 3W2QA 4OTFA 2WO6A 5AUZA 2EWAA 1FOTA 4FICA 3UP2A 4ANNA 4L42A 2C5NA 4BCMA 4EQMA 4CVAA 4PPCA 2QO9A 4R1VA 5CNNA 4DH1A 4O81A 1ATPE 1HCKA 1XWSA 3NCZA 5E7RA 5BMMA 3POZA 5L8LA 5DR2A 4BN1A 4G3FA 4D4YA 2BIKB 2W9ZB 3DT1A 4FNZA 4DFNA 4X6QC 1M2PA 4L9IA 4YO4A 1M2QA 3BI6A 3DJ5A 4RG0A 2CDZA 4NKSA 4RJ6A 4EK6A 1YHWA 3MVJA 3BBTB 3BU3A 3P7BA 3QYZA 1H8FA 1M52A 5CAUA 2O2UA 3OMVA 4UY9A 4DITA 3MI9A 5B2MA 4HZSA 4DTAA 4A9TA 1H00A 2ZM3A 4FTUA 4LMUA 4NJDA 4IB0A 3RPRA 5IA4A 4F6WA 4PV0A 1UU3A 2BRBA 4J71A 3LFBA 4L8MA 2OG8A 4FZFB 4UWCA 3F3ZA 2R3MA 4KRDA 4M15A 5AUXA 4GFMA 3P9JA 4I3ZA 3UC4A 4BDEA 2QURA 2VTSA 4OTHA 4AA5A 2QCSA 2DWBA 3O0GA 3F9NA 2B9HA 4OTPA 5CU4A 5EK7A 4MXZA 2ZMCA 3PP0A 5DG5A 2J0KA 3QF9A 4RFYA 2AQXA 2E2BA 2J6MA 5CANA 4MWHA 5CVFA 4X21A 3DPKA 4GK4A 3DBDA 3RGFA 3GI3A 4XH6A 1ZOGA 1W84A 4WD5A 3GFEA 5AIRA 4D2TA 4QQCA 3NUSA 1T45A 2V7OA 4I93A 4EQUA 4MHAA 5HNBA 4CEGA 2HY81 2BHHA 5DT3A 4GEOA 1GZ8A 5F20A 5AR5A 2IJMA 4FKGA 4G3DA 4CRSA 1UNLA 4F65A 3O8UA 4GT4A 1JVPP 4J99A 2PZYA 1JKTA 2GS7A 1XBAA 3UZRA 4LRKA 3AD5A 2ZOQA 1WBSA 4NH1A 4CFVA 4MCVA 5H8GA 5C8KA 3N4VA 1LR4A 4FV7A 4DEHA 4IWQA 1B39A 4AW5A 2OZAB 2VNWA 3LFCA 3QYWA 3D5XA 3KN5A 4AGDA 4CT1A 5I9UA 3E64A 2FSLX 4I6QA 1Q5KA 2EU9A 3BHVA 2NRUA 2W1HA 2WMTA 2X0GA 2PYWA 1Q41A 3A7JA 4TWCA 3PXKA 2FGIA 3LAUA 4MTAA 2QOFA 2C1BA 3EFJA 3R7OA 5FEDA 3FSFA 3I5ZA 2QODA 3KXZA 2CJMA 1G8JA 3TZMA 1OITA 2W17A 2R5TA 3CP9A 3D5WA 3QCXA 2E9OA 4KAOA 5AX3A 1IAHA 3UQGA 1GY3A 3ZZWA 3QHWA 2VO0A 4BY9E 2CKPA 2G9XA 4KKGA 4UEUA 1OI9A 3V6SA 3DB8A 3RM6A 2VTLA 3EQBA 3LJ2A 4AN3A 5IU2A 3LLAA 2LAVA 4QYHA 3MPAA 3OXZA 4IZ5A 3UOJA 4O4EA 2UVZA 5CAVA 5L2SA 2BRHA 3WF8A 2OO8X 3HVCA 4LFIA 2B54A 1ZYJA 3IW4A 4FV3A 5C8NA 4U81A 5LOHA 4IAKA 5LVNA 5J7HA 4M0ZA 5EYKA 1ZOEA 5AR4A 4F08A 3DAEA 4BZDA 4FIJA 4ALVA 1YXVA 2YISA 2JDOA 2R3KA 3CJFA 3PZEA 3VJOA 3ZDIA 1F0QA 3S00A 4GUBA 3PA3A 1OKVA 5IQIA 2JGZA 3PJ2A 2ITQA 2VO6A 4QMZA 3TTIA 5DMZA 3FI2A 1ZWSA 3BHHA 4FT9A 5H9BA 2XB7A 5AM6A 4FG9A 1CKPA 3LFFA 5C26A 1R78A 4YZDA 2WIHA 3AMAA 3O8PA 3EB0A 2H6DA 3PG1A 3ZU7A 4ENXA 2WTIA 3RVGA 1FGIA 3LFSA 3CD8A 4YBKA 4XG7A 4ACGA 2CCIA 3OEZA 3SRVA 5GZ8A 5KKRB 2GTNA 3FBVA 2CLQA 2G15A 1E1XA 4ZTLA 3U6IA 3Q52A 2Q83A 3LMIA 3VQHA 1QPEA 4UMPA 3SD0A 3BGPA 5CSXA 3HLLA 3EQDA 3R9NA 3CTJA 3GC0A 2YWPA 3VWAA 4ASXA 1R39A 2IO6A 4I4EA 4CRLA 5HD7A 5TKDA 5DT0A 1W82A 3U6JA 2OZAA 4WUAA 1AGWA 5LXMA 1PXNA 4QD6A 3LFNA 4BDBA 3DFAA 4MH7A 4QDEA 3JVRA 3HUBA 2WTDA 4FK3A 4KIPA 4QNAA 4D0WA 2GDOA 1YHSA 3FMEA 3PLAE 2VRXA 5AADA 2ERZE 4IVCA 5DH3A 4YPDA 4MXOA 4O2ZA 4O7RA 4JRNA 4IWPA 3FY2A 3FE3A 3ZSGA 5H2UA 4WNOA 1ND4A 4R78A 2VWUA 4AOJA 4R77A 3Q53A 1O6LA 3W0RA 3ORPA 4B8LA 2XUUA 5DOSA 3KVXA 5C03A 3QQUA 3WF7A 3R1YA 4LUDA 5M06A 5J87A 4IM0A 4L7FA 2X2MA 3C4ZA 1FVRA 3AC2A 1OIYA 4MNEA 3KXHA 4G6NA 4I6BA 4LDTA 3D14A 1MRYA 4QP6A 2JAVA 2W0JA 2F7ZE 2YCQA 5CT7A 5CSVA 3H0ZA 3PPZA 5BUJA 4ERKA 4CG9A 4G3CA 4BDHA 4CV8A 4R8QA 3PPKA 1J91A 2IVSA 2XA4A 4F7LA 1KOAA 1Y6BA 4QMPA 4A4OA 4O82A 2WMXA 5FBNC 1XBCA 3S2PA 3FMDA 4X2KA 3TKHA 3TZ7A 3SVVA 4Y85A 4USDA 3RAHA 4YSJA 4KS7A 4OAVB 1U54B 3PE1A 4KNBA 3NEWA 3RAIA 4W8DA 3QRJA 4R5SA 3FMLA 1W2DA 4FTRA 4I0TA 5HHWA 5HKMA 5JGDA 5KMNA 1O6YA 1PKGA 3MSSA 3E5AA 4WRSA 2R0IA 5DR6A 4AGUA 5L4QA 4GUEA 5TT7A 1J7IA 3L8VA 4JI9A 1H1RA 1R3CA 4KIOA 5IH6A 4PPAA 1OKZA 4D2SA 1NA7A 2VZ6A 4JBQA 5A6OA 3QD0A 5HX8A 1KV2A 5DT4A 4E6QA 4DH5A 4EOLA 3C0IA 3MH2A 4KABA 3QLGA 2A27A 5HG8A 3RWQA 1HCLA 5FBOA 4AS0A 1H0VA 4EOQA 3DZOA 2IWIA 2WHBA 3CBLA 1ST0A 3U54A 1OPLA 4O1PA 2XANA 2VX3A 3CIKA 4N0SA 4CQGA 4CMOA 4XOYA 3PJ3A 5KZIA 3ZMMA 4L67A 1H24A 2XKDA 3NLBA 4O2PA 3RPSA 3FYJX 4BIEA 3CR0A 1JKLA 2WELA 1H08A 3GUBA 4IEBA 3PJ1A 1M17A 3KCFA 3IDCA 3R28A 4ALUA 4RIXA 4DG0E 3BYOA 5E4HA 2JBOA 3HNGA 5IA0A 3ZEWA 4KD1A 4BCHA 3TNWA 3R7IA 3TZ9A 5BYYA 5DR9A 4RLKA 1SMHA 1URWA 5BVNA 1FGKA 3PWDA 4NWMA 4LGDA 4FTQA 4IAFA 4OTIA 4ZK5A 1E1VA 3E7OA 3FXWA 4BKZA 4FTAA 1ZMUA 3IO7A 3S4QA 4BBFA 4AT5A 4BF2A 4JQ8A 4YZ9A 3FXZA 3A61A 3TJDA 4AAAA 4DBNA 3PE2A 3RNYA 5EQEA 3JXWA 3N9XA 3UYTA 4FC0A 4F9BA 4DEEA 3GU6A 4XP3A 4A06A 2V22A 1ZZ2A 1ZZLA 4QTAA 3QTWA 4RJ7A 1LUFA 5F1ZA 4ANOA 2C3LA 4YJNA 2XBJA 4EWHA 4ZMEA 4ZY4A 4UBAA 4EUTA 3ZO4A 4K6ZA 3VF9A 4AW1A 3V5JA 4O0YA 3NUYA 3TMOA 3PY1A 3PXFA 4IB1A 3T3VA 4FKJA 2PUUA 4NM3A 3ZUVA 3DAKA 1RQQA 5CTPA 4A07A 4L7SA 3QTQA 3DQWA 3QWJA 3VHEA 4F9CA 3W18A 5IQHA 5HORA 2OLCA 2CKOA 3DQXA 3ZBXA 1QPCA 1OVEA 2F7EE 3R2BA 2FA2A 3CGFA 3RINA 2HWPA 3R02A 1W98A 4R3RA 4YJRA 4MVFA 4FT0A 2DYLA 4NYEA 2ZAZA 4JDHA 4K18A 2VTRA 4FSWA 2B0QA 2GNJA 2F7XE 3DOGA 4XP2A 1XH4A 1G8KA 3G6HA 4PPBA 1RDQE 2PVHA 2X6EA 3FL4A 4AWIA 3COIA 3M11A 3I79A 3R21A 4IVDA 2B52A 1R0PA 1J7UA 3E8NA 3ZO2A 3NW5A 3QCSA 4A9UA 1OPKA 3PJCA 3R63A 4G5JA 2XH5A 4WSYA 2OGVA 2XVDA 2AEGA 5M4CA 2QHNA 1WVWA 4X2GA 2XK7A 3IS5A 4QP1A 4ASDA 4HVHA 2XAMA 4M67A 3TIZA 5CEKA 4YZNA 4IADA 4EOIA 2P4IA 3S0OA 5JT2A 1YW2A 5EKOA 3QKKA 2XNPA 4ANSA 3RHKA 4DGOA 1YOLA 5IQGA 5HVYA 5BNJA 5CS6A 4AT3A 1Y6AA 3TYKA 4BHZA 3RK5A 5HVKA 4HPTE 4UMUA 5AUVA 3PIXA 5JH6A 2QKRA 5DEYA 5FEEA 5A14A 3NYVA 4JJRA 3GBZA 4FGRA 1DAYA 5HIBA 4V01A 3ERKA 3MS9A 4I5CA 2F57A 4PL5A 4XBUA 1A9UA 4EK3A 4IM2A 3V5QA 4FT3A 1Q97A 3PSBA 2CN5A 4X3FA 3JYAA 3HAMA 3NYXA 4HVDA 3OY3A 4Y8DA 2HELA 4GRBA 4C4JA 3KCKA 4FF8A 1G5SA 5A4TA 4I0RA 3ZBFA 4XCUA 5IEYA 3W0QA 5HNIX 3UMXA 3OTUA 1Q8ZA 5EM5A 3KRWA 1WBTA 1BUHA 1UWHA 2RG5A 3D9VA 4R5YA 1Y8GA 3FQEA 4C61A 3GOPA 5E1EA 4GU6A 1H1PA 2XIKA 5IA5A 3KXNA 3OT3A 3EN9A 2O63A 3ROYA 5JZJA 2C6TA 3GT8A 4M12A 4E3CA 5HICA 3H9FA 2W05A 1GIHA 4MXYA 5D41A 4AE6A 2C5YA 5JFXA 3QZGA 4IFCA 2PZ5A 4RJ3A 2UW4A 4C2WA 5EH0A 2OK1A 4WIHA 3PA4A 4U3ZA 3T3UA 3O5AA 3PXYA 4GCJA 5J9YA 1PXKA 2XRUA 2AYPA 4PDPA 4K0YA 5HNGA 4CGAA 2YITA 4FYOA 3MW1A 4YNOA 2PULA 1JLUE 4JBVA 3QQLA 4H39A 2JDRA 4HCUA 2X2KA 3KIOC 4P2KA 4A4XA 2VTJA 3NUUA 1UKIA 3C4FA 1W83A 2V5QA 5CVHA 1XR1A 4FK6A 4B4LA 1UKHA 3GQIA 4G16A 5I4NA 3SQQA 3VS4A 2PL0A 4IVBA 5T3QA 3KF7A 1VYWA 3UC3A 3ZHPC 3LM5A 5KE0A 4QYYA 4BWXA 5JKGA 1H28A 4EOKA 4B7TA 2AUHA 2HXLA 3HP2A 3R6XA 3UPZA 4BIDA 3C7QA 4ZZNA 4CFXA 4QMLA 1YI4A 3ZRLA 1XKKA 5CF5A 4IMYA 4CZUA 5CI6A 2CGUA 3R8ZA 5IA1A 4DDGA 3SG9A 3ZUTA 3WIKA 4U9AA 5C8MA 4C4HA 4FKLA 3FY0A 3PXZA 4RWKA 3UTOA 1IASA 1XQZA 5HO7A 1ZMVA 3ZC6A 2OJIA 3OWKA 3BCEA 4IAIA 4U43A 3FMNA 3OW4A 2WMUA 1MQ4A 4DC2A 4DH8A 2JIVA 4I21A 3P5JC 5AUWA 5HBHA 3R9HA 4AZEA 3NNVA 5KHWA 3N51A 3VBWA 5K4JA 4D1ZA 1Q99A 4Y5QA 3FLSA 4FBXA 5CALA 1BI7A 4GIIA 5FQDC 3DU8A 3IONA 4EYJA 4YC3A 2XAOA 4DHZA 5EW9A 4AGCA 5FM2A 3Q9WA 2UZEA 4M13A 3R9DA 4FTOA 3Q6WA 3ALNA 3TV7A 1H25A 5CF8A 2PVYA 4NM7A 2C6LA 5AM7A 3BLRA 4GYIA 1CMKE 3ATTA 2Z7QA 4EHEA 3D7TB 4AAYA 5A9UA 4PMMA 4OTDA 1IR3A 3D0EA 4K8AA 4V04A 4YJTA 5BVWA 5ETFA 5JGAA 3DDPA 2C68A 3MIAA 5J9LA 3HV5A 2W1DA 3R2YA 2VNYA 4BFMA 3BV2A 3NWWA 4I0SA 3RMFA 4D5KA 3NMUF 2ITPA 3OZ6A 1YXUA 4JDIA 1KE5A 3I5NA 2VTNA 2RFNA 3MH3A 5KNJA 2ITNA 2J50A 4YSMA 2PTKA 1ZYSA 3F88A 3GU7A 3W1FA 4BGQA 2PVJA 4U45A 5AJQA 4JQEA 3RI1A 3UDTA 3ZRMA 5DLSA 3HL7A 2C3IB 5D10A 3QQKA 3ZXTA 2PZPA 5K3YA 4JR3A 2PVLA 1GZNA 4U41A 2C1AA 2W4KA 4BC6A 3II5A 4J96A 2R3GA 4QTDA 5ANJA 4YJUA 4UWBA 3OY1A 4DAWA 4C3FA 3BKBA 4Z9LA 4JT3A 1AQ1A 2BKZA 1L8TA 3FKOA 5AP1A 3V6RA 3W32A 4CCBA 4E4XA 2G2FA 2BRMA 5AAFA 3UVRA 4EEVA 5LARA 3ULIA 2ITWA 3ORLA 3QRKA 5CZIA 3UNJA 3RM7A 3OC1A 2X0PA 4UYAA 4FTTA 4UX9A 2Z02A 3FMHA 4BGHA 4C38A 3N4TA 3C4XA 3PG3A 2ZDUA 3ORNA 3Q9ZA 3QTUA 4PWNA 3VC4A 3ML1A 3C0GA 4FKTA 4RVMA 5E8UA 4AXAA 4PL4A 3LVPA 3LKMA 3QUPA 4KB8A 5DFPA 3BEAA 4HNFA 3BWFA 4E6DA 2I7QA 2ONLC 4GV1A 1ZARA 4CCUA 4BDDA 3ZC5A 4DHIB 4EOMA 2PVFA 4QPSA 5BUEA 3QD3A 3GP0A 3F2RA 5HCXA 3UG1A 5JFVA 3FL5A 4KIKB 4ZXTA 4FEUA 4YLJA 3EHAA 4M8TA 3DK3A 4BIBA 5EKNA 4IIRA 4NW5A 3R30A 3PRIA 1J1BA 4I4FA 5JK3A 2C69A 4F78A 5K5NA 4W9WA 3LJ0A 5HESA 4C36A 5FXQA 3MA6A 2W5HA 4FZAB 4U97A 4K77A 5I9VA 3FSKA 4G31A 4TW9A 3BE9A 4XMOA 2OU7A 5DHJA 5EYDA 4USEA 2JKMA 3C51A 2X4ZA 4L6QA 3QALE 4QTCA 3U9CA 4F4PA 5J5TA 2BKKA 2XYUA 5M07A 2X9FA 4HYSA 4OTWA 3PVWA 4AZFA 2JDSA 5EM7A 5ICPA 2OZOA 3FJQE 1YHVA 3EQIA 1YWRA 4C57A 4O7TA 4FL2A 4DEIA 2R3PA 4K9YA 5LVLA 5AV3A 2ETMA 4BCQA 1XHAA 3EQPA 3PXQA 2IF8A 2UZTA 3QD4A 4MD9E 4E4MA 5HGIA 4BDJA 3VBVA 5E8YA 4NCTC 4J7BA 2ITYA 3LFQA 4YTIA 4CLIA 1H4LA 1GZKA 4FTJA 4O4DA 3WF9A 3GFWA 3ZFXA 4EHVA 4BB4A 4QMWA 4IVAA 3MFSA 4HVGA 3K2LA 4R7IA 2OXXA 4YZMA 3R8LA 2WMAA 4PRJA 5IEVA 1Y57A 4FG7A 4A9SA 3NVKI 2VTOA 3BL7A 3W2PA 5BVEA 5C27A 1J3HA 4OBPA 2FB8A 2XIZA 1XH9A 5GZAA 3G90X 4FMQA 3KXGA 4RX7A 4RMZA 2QOIA 5DIAA 4BTFA 2W9FB 4BCIA 2PHKA 3TKUA 1S9JA 2W5AA 4G3EA 4I41A 5B2KA 4F64A 2G2IA 4RQKA 3ZSHA 3QUDA 4QP7A 1E9HA 4O7NA 4BYJA 3LFEA 1GIIA 2X8EA 3KRLA 2PE1A 3O2MA 4KA3A 4ITJA 2W1IA 2YZLA 4C33A 5HG9A 1WCCA 2YACA 4C58A 5CT0A 4II5A 2JKOA 1OUKA 2UW8A 1U5QA 2AC3A 3CKWA 4FR4A 4XG4A 4YBJA 4IANA 4BI2A 3BGZA 5IG1A 4DE4A 3KGAA 1V0PA 3JVSA 4U7ZA 4YP8A 1H27A 5ACBC 4D4RA 4OW8A 1MRUA 4AN2A 4C3PA 4AXFA 4EZ7A 4A9RA 3NNUA 5AIKA 2ITZA 4DG3E 4FSYA 2WMRA 4NSTA 5ANDA 2XF0A 3LW0A 4XOZA 2VGPA 4TYGA 5EHOA 3ZLWA 4BBEA 1PXOA 4EKLA 3VUIA 5AFVA 2F2UA 2JAMA 3JS2A 3ORXA 4FZ6A 5DRBA 1IEPA 3RBWA 3HV4A 3EWHA 2HIWA 3NCGA 4QRCA 4DA5A 1SVEA 2UW3A 4QYEA 5ANIA 4RFZA 5CENA 3VS2A 5AV4A 5E8XA 1REKA 3ZTXA 2Y4PA 3DKCA 4RIOA 2IG7A 3GU8A 3C5IA 3QKLA 5KMIA 3TUCA 2BROA 1FBNA 4O6LA 2WTWA 5DE2A 5GIPE 4RVLA 4CLJA 5CU6A 3K5VA 4DGGA 4LL0A 4OAUC 2NRYA 4CKJA 4MXCA 1Q24A 4OBOA 4OGRA 4DN5A 3FC2A 2WXVA 4MK0A 5FDXA 3TI1A 4FTMA 2ZM4A 1NT2A 1CTPE 5IQBA 3IW6A 4I6LA 3MYGA 4ID7A 3IOPA 5EM8A 4CMUA 2AC5A 3Q4ZA 2YABA 4MAOA 4DH7A 4M14A 2QR7A 3FQSA 4QMVA 5CEIA 3ZUUA 2SRCA 5CU0A 4FTNA 3ZLXA 1YDSE 2BTRA 2GNLA 4HGLA 4QPAA 2YCFA 3EKKA 3V5TA 3OOGA 1QCFA 1BX6A 1OIQA 2CGVA 2RFSA 3FMMA 3QLFA 5M4UA 3UO4A 2HW7A 4F0FA 2H8HA 5I3RA 2OI4X 2PVKA 3CKXA 3CXWA 3QBNA 3HMIA 4FKPA 1UU7A 3DDQA 3CPBA 4GK2A 3EYGA 3HMPA 4X2JA 4HGSA 1LP4A 4S2ZA 5EDRA 4QMXA 4XG6A 2CKQA 4ZMFA 4C62A 2RKUA 5EI8A 4RFMA 4H36A 4IHPA 5T6KA 3O7LB 2XMYA 4LOPA 4B0GA 4UZHA 1UU9A 2WMBA 2HXQA 4YZBA 1KE9A 3ODYX 2YDIA 2KULA 4I5HA 4TWNA 2BVAA 1PMUA 3HMMA 2J0MB 4GFOA 3VS0A 5F9EA 5BV3A 4FKSA 4O4BB 4FV4A 2GPHA 3MVHA 5DN3A 5IDNA 3W0PA 3EQCA 3ZLSA 4KKEA 2HZ0A 1M14A 1VLRA 3K