3BV3A

Morpholino pyrrolotriazine p38 alpha map kinase inhibitor compound 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
338
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Synthesis and SAR of new pyrrolo[2,1-f][1,2,4]triazines as potent p38 alpha MAP kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 338
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bv3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bv3A01
3FSFA 4BI1A 5J7HA 4E4NA 4C3RA 1REJA 4BDCA 1LEWA 3R01A 4LRKA 4MKCA 3IW5A 4XG9A 5E4HA 1CKJA 2W4KA 4YO4A 1Z9XA 4FZFB 4ASEA 1BYGA 4Z55A 4ALWA 2VTRA 4J95A 1AD5A 5CQWA 4JIAA 1FQ1B 1WZYA 3UPXA 2BZJA 2I0VA 4EYMA 4UMTA 4WIHA 4D2SA 2F7EE 2X9EA 4IH8A 5TR6A 1H24A 3RTPA 2GQSA 4HVGA 1VEBA 4LMUA 2W1CA 5HE0A 1Q3WA 4DYMA 1JSUA 5T6KA 3K54A 1YW2A 4YJVA 2YCRA 1Z57A 2WOUA 4QQCA 4EK8A 3EN4A 4C57A 3MI9A 3HV4A 4FTQA 4O27B 4XCUA 3IW4A 4FV9A 3QQFA 5CY3A 5BYYA 2OXXA 1IA9A 4LV5A 3BPRA 2VO7A 3RCJA 1Q99A 1PXNA 3PA5A 1VZOA 4Y73A 4RIWB 5LMKC 2CNVA 2ESMA 4FKJA 5T3QA 4S33A 4CKJA 2G2HA 4FICA 5ANJA 3W2CA 5EI2A 4WT6A 4ZMEA 3ZZEA 4IFGA 1YI6A 2JBPA 1WBOA 2P55A 2YCSA 3Q4UA 4IE9A 4EWHA 3U51A 2JBOA 3GEQA 5M07A 3L9MA 4X2JA 5AUYA 1ZYLA 3E88A 3WILA 1TQIA 1XWSA 4FNXA 5H9BA 3WZEA 2ERZE 4O86A 2W06A 3C4FA 2PYWA 2JDVA 2W1EA 4PDPA 2VTOA 3HV3A 3E8EA 4DTBA 2F7XE 3ZO1A 4RIYB 3QC9A 3HKOA 1ZOGA 2GS7A 4AFEA 3W32A 1PW2A 3FC1X 3KF7A 3HMOA 4FKWA 3RWQA 5K4JA 2XF0A 3DLZA 3DS6A 3HECA 2XKCA 4BWKA 3AC2A 3PJ2A 3QRUA 3TZMA 4CV8A 5I9YA 3REPA 4EK6A 1SM2A 4OAVB 5I9WA 4L7FA 2XKFA 3G6HA 3N4VA 2Z7LA 1BMKA 3DV3A 3O7LD 1ZRZA 5FLFA 3QX4A 2WEVA 4HZRA 3CQUA 5DR2A 2I6LA 5I9ZA 4AQCA 4KINA 3CR0A 4GG7A 3O96A 3HA6A 3MTFA 4O1PA 1FMOE 5AV0A 5HD4A 4UALA 2BIYA 3TL8A 3UZRA 2UVYA 3I1AA 2IVTA 4XUFA 1O9UA 1PJKA 2GCDA 3OTUA 1LP4A 3LZBA 5LJJA 1Q8UA 2AC3A 4CFUA 2QD9A 5DEWA 1WVXA 3RAIA 3BHYA 3GUBA 3R7OA 3ZTXA 1W84A 5A4QA 4BTMA 1Q41A 3NYXA 2SRCA 4I4EA 3I4BA 3HZTA 2ERKA 4HGLA 4TW9A 3WF9A 4NU1A 4BGQA 2QU5A 3EQCA 3SXSA 4UMUA 3O7LB 2VTJA 2WEIA 3K3JA 4I3ZA 4F09A 4J53A 3NDMA 5B2KA 1RJBA 1JKSA 3KY2A 1YHVA 1G3NA 3A4OX 4ARKA 3ITZA 3OMVA 4UWCA 4BI2A 3U87A 5HEZA 2GNJA 2PSQA 4YTHA 3F9NA 4RIOA 4W8DA 5LXMA 4KIKA 4C7TA 3D94A 2XJ1A 4DTAA 1PY5A 3OXIA 3IKAA 4QP7A 1YDSE 3ZMMA 4BRXA 4F1MA 5ETIA 5DT0A 3NZ0A 1CTPE 4FV7A 3WYXA 3ZLSA 4EBVA 2BFXA 4YSJA 4X2FA 4F6UA 5IQHA 4AOIA 2C4GA 2QO7A 2WMAA 3GU7A 3NAXA 4JS8A 5AR3A 1KWPA 3KVWA 3Q9WA 5IEXA 4NM3A 3DAJA 4XP0A 3FMDA 2ZV8A 1E1XA 4ZS0A 4IANA 4AGUA 4BCQA 5HGIA 4D1XA 2R5TA 3F66A 2UW4A 2VUWA 4GG5A 2DQ7X 3MBLA 5D12A 4ZZNA 2H6DA 3BRBA 3PP0A 2R3HA 2VO6A 3VW8A 5TF9A 3UMWA 2LGCA 2ONLA 3HEGA 3EMGA 3O0GA 4K18A 3G0FA 1OL1A 2OU7A 2YDJA 4RGJA 2UV2A 3RZBA 3ZC6A 1YOJA 3QKMA 4YLJA 3QX2A 4QP4A 4CSVA 4E6CA 4RC3A 1OB3A 4FZ7A 4I1ZA 5DEYA 4GJ3A 4XLVA 4YHFA 3KRRA 2GQGA 2A27A 4RQVA 3S3IA 3SC1A 4QMZA 4MXAA 2IZSA 3OCSA 4TY1A 3GQLA 3ORKA 4KBCA 5FG8A 3EZRA 1NVQA 1W83A 5JZJA 4I6HA 3ZEWA 5LWNA 1M7NA 3KULA 3NUPA 2I1MA 3DOGA 3E7VA 5H8EA 1HCLA 1IA8A 3PPKA 3CKXA 3PG1A 3RCDA 2Y0AA 4KIOA 2W1IA 4PMPA 4CFNA 2WU7A 3U6JA 1IRKA 2W96B 4ZMFA 3QWJA 3SDJA 3FQHA 3Q53A 4E5AX 4ZTMA 2XRWA 2CGVA 3MY1A 3V6RA 4GJ2A 3UPZA 3W8LA 2OIBA 4MAOA 4WUNA 3GVUA 3TCPA 4FEWA 4OT5A 5BMMA 4V01A 3OWJA 4MHAA 4CYIA 2QURA 5EKOA 2PZIA 5KBQA 4ANNA 4RBLA 4QMWA 4ANSA 5JKGA 4S2ZA 3AC5A 2PVKA 3KXXA 4M66A 3FKNA 1ZAOA 4G34A 2IWIA 2XNGA 3B8RA 4O7NA 3NYVA 4B4LA 5LMAA 4U97A 4CCUA 5HZNA 4JG8A 2GFCA 3R21A 1UWHA 3DDQA 5CXHA 2XCHA 3JVRA 4I20A 2ITYA 5CNNA 4AZWA 4UZDA 5AP1A 4DH8A 3F2RA 2BDJA 1ZY5A 5IUIA 5F9EA 2WMRA 2H8HA 4YU2A 2JKQA 3MGYA 3QTZA 4FUYA 5LARA 4B6LA 1SVHA 3ORMA 5EM5A 4MXZA 2WTDA 1OZ1A 3FXXA 3PTGA 4CZTA 3U55A 4YNEA 3OWKA 2KULA 2UW5A 2XH5A 3PPJA 4MNEA 4PDYA 3F61A 3NCZA 3KMWA 5CXZA 3UP2A 2C0TA 4TWOA 4NWMA 1ZZLA 4F9AA 5H2UA 4MWIA 3P9JA 4IAKA 4AACA 5CAOA 2ITQA 3E3BX 4FSMA 2QOCA 4HCVA 4O81A 2ITUA 5E90A 4AWIA 2ETMA 3AC4A 1U46A 4DCEA 3WE8A 5AM6A 3UNKA 3MFRA 4DHFA 2QCSA 2QNJA 2YJRA 5LVOA 3EFWA 4PNKA 4ASXA 2C3LA 4DLJA 4FBXA 3POZA 2Z8CA 3ALNA 4CLIA 2CNUA 4FKIA 4CTBA 2RG5A 5C03A 4WO5A 1ZOHA 4LRJA 2WB8A 2WOTA 4JBVA 5FP6A 3CBLA 5I9XA 2VRXA 2XM9A 4C2WA 4FF8A 4F9BA 1QPEA 3LJ1A 5LQFA 4BCOA 1P4FA 4QMPA 3ORXA 4OGRA 3UTOA 3QWKA 5HNGA 1JNKA 4KUJA 5BYLA 3B2WA 1PHKA 3D7TB 4Z7GA 5I4NA 4YHTA 2J0JA 3EQFA 1MRVA 3MVMA 4BB4A 2WIHA 2R9SA 4JBOA 1URWA 2J0LA 3ZEPA 3C4WA 4IWQA 4D4RA 5KMOA 3E3PA 2QI8A 2QOKA 3HX4A 4UXLA 2QC6A 5HO6A 4FIFA 4CXAA 4CFWA 4KNBA 4ZTLA 4BVUA 5HIEA 5CU3A 3QYWA 1OPLA 1OI9A 1UKIA 3CQEA 4GFGA 4I24A 3OEZA 3Q9XA 5E91A 1P4OA 4W9WA 4IX5A 5CAUA 5ANEA 4O83A 5EM7A 2PVHA 2QONA 4JJRA 5AR2A 4AAAA 4B0GA 3UQCA 2PE1A 4BCGA 5E8UA 4JIKA 4EWQA 3QCSA 4FSZA 3PJCA 2WU6A 2X4FA 2QO9A 5HVKA 5IMEA 4QP3A 5HO8A 4GMYA 4O0VA 3PY0A 5A4TA 5CT0A 4NL0A 5EM8A 2RIOA 4RX5A 3H9OA 4BCKA 5DVRA 4WOVA 5EDRA 2BCJA 3WZKA 4LUEA 3QFVA 4I21A 4WRGA 3V8TA 5A4LA 5L4QA 3PE2A 1W0XC 4FNZA 3RM7A 4EH4A 5CALA 1F3MC 2PK9A 5ACBC 3RJCA 1OKWA 5A14A 2ITOA 4QNAA 4PMTA 3ORZA 4OBPA 4RVKA 3LOKA 4G16A 5BQ0A 2RSVA 4KKEA 2Y9QA 5IEYA 2C6IA 2IN6A 3MA3A 5E1SA 2PUUA 4GH2A 5DH3A 3C0IA 5HORA 2EWAA 2C5YA 2ZB0A 4XRLA 2R3MA 3OC1A 3MY0A 4IAFA 4C4GA 2ZV2A 4XV2A 5AP2A 3NSZA 2JIVA 4RJ5A 4DFLA 3MH1A 3RBWA 4U3ZA 2GU8A 3C4EA 3GC0A 3UBDA 3R1QA 3UOLA 4L42A 1H0VA 3FMKA 2OFVA 1ZARA 2X81A 3F82A 1AQ1A 3R0TA 2PL0A 4UY9A 2X8EA 4LGHA 2OSCA 1U59A 4C33A 2X2KA 1XJDA 3NS9A 4XMOA 1OL7A 4UN0C 2GQRA 4PUZA 2R3NA 4YLKA 5DHJA 2ZMDA 3UVRA 4UX9A 4Q5EA 1KV1A 4EZ3A 4M14A 4G3DA 1O6YA 3VF8A 2GHLA 5AV4A 2PUIA 1OM1A 1P2AA 5L2QA 3W8QA 4GVAA 3LCSA 5H8BA 1EH4A 5J9YA 3G0EA 3VHKA 5CT7A 4G31A 1Y6BA 3PSCA 4FV5A 4G6LA 4XV3A 4KBKA 5FUTA 1XH7A 2OXDA 4ALUA 4OBQA 5HTBA 3K3IA 3R73A 3I81A 3PJ1A 4FV8A 4JXFA 2B9JA 4YZNA 4AN3A 4K6ZA 2C5XA 1H26A 4Q5HA 2QKRA 4WA9A 3UQGA 4BWXA 3EHAA 3PY3A 4BZOA 2YWVA 1WBNA 4KWPA 3C4CA 2C6TA 3BBWA 4ZZOA 5JFSA 5A54A 3BGPA 3HUCA 2Q0NA 4IVDA 4DINA 5EM6A 2FYSA 2PZYA 4HW7A 4FKOA 1XBAA 3F3WA 2X7FA 4NCTA 1DM2A 3EL8A 3FYKX 4AE6A 1TVOA 5BVDA 1PF8A 2ITXA 4PL3A 3KN5A 5HCYA 2JIIA 3KEXA 3CTJA 4RC4A 2X4ZA 2FUMA 5DMZA 3QLGA 4G5PA 4TZRA 4GK2A 3QF9A 2QOIA 4XH6A 3DKCA 4QTCA 3CJFA 4O0TA 2XIXA 4ZTHA 4ZOGA 4MNFA 2BKZA 3TNHA 3NW6A 3PXRA 4OTWA 4AN2A 3LFSA 4R7HA 4EI4A 2GS2A 2ZM4A 5BVOA 2HYYA 1M2RA 4YPSA 3ZH8A 4RVLA 3EQHA 4KRCA 4BZNA 3R00A 1XHAA 5EQPA 4J97A 3VULA 3K5VA 1Z5MA 2C69A 3FEGA 3FV8A 5TE0A 4IB3A 5EHYA 3ZLYA 2RG6A 2XVDA 4QMVA 4AGDA 5K9IA 3C5IA 5C01A 3GNIB 1AGWA 3OXZA 3POOA 3RVGA 5M53A 5HIDA 2XBJA 3DXNA 3TZ7A 2B4SB 2YJSA 5CF6A 1CSNA 2QO2A 4EQCA 3LMIA 3GCVA 1CMKE 4GVJA 2CGWA 4AW5A 3GT8A 5HX8A 4M69A 3DK7A 4WUAA 2WQOA 2UZEA 3L9NA 3AC8A 4NM5A 2WD1A 4QTBA 3A62A 3QUPA 4IC7A 1FGKA 1WBTA 1YI4A 1H1RA 3EL7A 1L8TA 3VRYA 2IPXA 1PXJA 4P5ZA 4C36A 3CD3A 3DNEA 4HYHA 4U5JA 3D83A 4RG0A 2EVAA 4I5HA 2ONLC 3A8WA 5CYIA 4DEIA 4U9AA 4D2PA 2V5QA 4EL9A 3ZXTA 1XH9A 3TNIA 3VUDA 2PPQA 4ZTRA 1LR4A 5AR7A 4FG7A 3PG3A 4KA3A 4IVAA 3HNGA 2OO8X 5F94A 1PMNA 3AXWA 2WMSA 3OT3A 4XG7A 3CIKA 3QU0A 2W5AA 3M2WA 2VWUA 3CPBA 4J7BA 3TKUA 4EHZA 4ZSGA 2WMTA 3D5UA 4ID7A 4DH7A 1JVPP 2F2CB 2YIRA 3DK3A 3PXZA 4J99A 1PMEA 5M57A 2UZLA 3FI8A 3FE3A 2IG7A 4TTHB 3O71A 5JGAA 3VUTA 3A61A 3MVHA 4K9YA 3E64A 3NLBA 4ZK5A 3ZFMA 2RKUA 5L3AA 5CSHA 4O82A 4PMMA 4D2RA 2V62A 3BGZA 3H3CA 5HVYA 4NM0A 5I5ZA 4MCVA 4EJNA 3FBVA 4FEQA 3UGCA 3VBTA 4YTFA 4O7RA 4ITIA 4E4XA 3OW3A 3HV6A 4IM3A 4I22A 1G5SA 5BVNA 2OZOA 2W1ZA 1TQPA 1YHWA 3CXWA 4JG6A 4BKJA 1WBVA 3R9RA 5E8TA 2G9XA 4E1ZA 5GZ8A 5KMNA 2Z7QA 2BFYA 2RL5A 3QRTA 3MH0A 4ZSJA 5FD2A 1J3HA 3VW6A 5IQIA 4IZYA 2XNPA 3C5UA 5AP3A 5K3YA 3KXMA 2E9VA 3KN6A 4RT7A 4ZJJA 1Y6AA 2X8IA 3H0YA 4HPTE 1YWNA 4BKZA 3O2MA 1NT2A 5K0KA 3WF5A 4M0ZA 3KL8A 3MH3A 4FOCA 2W4OA 4XOZA 4ZIMA 4MQ2A 4RX8A 4EOMA 4C8BA 2QKWB 5AUTA 3FMMA 5AWMA 4WG3A 4EZ7A 3C9WA 1ND4A 5DRDA 1H1SA 5FRIA 3UMXA 1JLUE 3FC2A 5EHLA 5I0BA 3NW5A 2VWZA 3E63A 4AOJA 4RFYA 1H8FA 4DN5A 3UZTA 4R3PA 4FODA 1KUTA 4FK6A 1BLXA 3BHVA 5C8MA 4ZP5A 2XYNA 4RIXB 2R2PA 4MBLA 4DEDA 5A6OA 4FC0A 4USDA 2GNHA 3C4ZA 3TZ9A 5CASA 3MWUA 3BV3A 2YFXA 2I40A 3FI2A 2J5EA 1OVEA 2WMWA 4TYJA 4C4HA 1RQQA 4YC3A 5C9CA 4K2RA 4P7EA 1P5EA 3QTRA 3N4TA 1JKTA 4MQ1A 3DBEA 5DPVA 5DGZA 4CYJA 2Y4IB 4D2TA 1GZOA 3I0OA 3OFMA 1BI8A 3QC4A 4YZDA 3DTWA 4FKTA 4LV8A 2ZM3A 4GIHA 2GS6A 2HXQA 4FVQA 3ZXZA 5HBEA 3UC3A 2YIQA 4C58A 3EIDA 1ZYDA 2C6EA 2B0QA 3ZRLA 2FSTX 1GIIA 2JKMA 1NXKA 4I0SA 2GPHA 3QGYA 2RFSA 2W1FA 3A2CA 3OD6X 4FKRA 4FV6A 4G6NA 4AS0A 1X8BA 3WE4A 1UNLA 1ZMWA 2G1TA 2DUVA 4NJDA 1MQ4A 5C1QB 4OAUC 3R9HA 2PVJA 1Q8WA 2X39A 1J1BA 4RIWA 5GZ9A 4ANBA 4C4FA 4RFMA 4EOQA 4U8ZA 3F2NA 2XK7A 2WNTA 2BALA 4F0FA 3DDPA 2CGUA 3I5NA 2X6DA 3QHRA 4I5CA 2LAVA 2NPQA 3EN7A 1R0PA 2O65A 3G9LX 4ASDA 3IDBA 2OBJA 4L44A 2P3GX 3V5PA 1SVEA 2JDRA 4XOYA 4D1ZA 4ZY6A 3DXPA 4IB0A 3UP7A 2FSMX 3PXKA 4JQ8A 4A06A 4C4IA 4H1JA 5AAEA 4X21A 4F7NA 2OG8A 5CVGA 3IOPA 5E92A 2AC5A 2R3JA 4S31A 5A3XA 4AF3A 4AG8A 2YIYA 4QYYA 3BHUA 3DFAA 1A48A 3A99A 3NYOA 4FZ6A 2WTVA 3BX5A 4FNWA 3KMUA 3D15A 2G01A 3GQIA 1W8CA 5ETFA 2Y4PA 3F5XA 3I0QA 4A4XA 4C62A 2YM3A 1W82A 4EH6A 4FKVA 3PWDA 4FKUA 2GSFA 2OH4A 5GIOE 5JGBA 3GCSA 2A19B 3TM0A 2E9PA 5AJQA 4PTGA 2HENA 3LCTA 2C0IA 4FTKA 1HCKA 4XYFA 4FZDB 3DT1A 5LVLA 4OTFA 2ZDUA 3VQHA 3ERKA 4FKSA 4JR3A 1FMKA 1KV2A 4YSMA 4EKLA 5BVKA 5HLNA 3QQKA 4FTMA 4RJ7A 1V0BA 2HK5A 3SXFA 2C3KA 5BYZA 5HE1A 4OTRA 5HBHA 5K5XA 3ALOA 4TYGA 4ENXA 3OWLA 3PUPA 2WKMA 2E9NA 2WMQA 3KRWA 4EEVA 4IZAA 2QLUA 2EB3A 4O0YA 4KB8A 4JOAA 4I5MA 2OK1A 4BYIA 4Z9LA 2QOFA 4HYUA 4ZY5A 1YQJA 5K0XA 3NMUF 2C30A 4C0TA 1U5QA 2BVAA 2J6MA 4FV2A 4YJSA 3LAUA 1ZYCA 4PPAA 4D55A 2WELA 4MXYA 4R8QA 2PTKA 4BHZA 4BCPA 2EXMA 5CF4A 3R04A 1NVRA 1UA2A 4AW1A 3PDTA 3COMA 3IPHA 4I6BA 4RZVA 4HPUE 4NK9A 1DI9A 1XO2B 2VWVA 4FV3A 5J95A 4FTOA 4XG8A 3PZHA 3BLHA 2XIZA 4P4CA 4ZXTA 4DT9A 4RZWA 4GK4A 2W1DA 5CQUA 4L3PA 2WPAA 1FBNA 1SVGA 2VTPA 4U43A 3TV7A 2G2IA 4BL1A 3OVVA 5AP5A 3BELA 3ORPA 3VWAA 3MFSA 3DGKA 3GOKA 1SZMA 4J71A 3SHEA 3MESA 5GINE 1W7HA 3GFEA 4XHKB 5ETCA 3UIUA 2HAKA 3F5UA 3CS9A 4E8AA 1DAWA 4F70A 3B8QA 3I79A 3PSBA 2FVDA 3QTIA 3QAME 3QD3A 4F99A 5L8LA 3K5UA 2WFYA 2YDIA 4FIGA 3HMNA 2OIQA 3FKOA 3NVKI 4ZTSA 3FMEA 4M12A 4EUUA 3A7IA 3MY5A 1WVYA 5IA3A 2XIRA 5IUHA 3LPBA 4AA5A 4E6AA 2XNNA 4EQMA 3VUGA 3WARA 4BBMA 4J96A 3H9FA 3MB7A 3GCPA 5HVJA 4O91A 4ZLYA 4CZYB 4IM2A 3AGMA 1T46A 4NCTC 5EYDA 2PVLA 3U4UA 2YABA 2IW9A 5KZ0A 3BYOA 4FSRA 2XCKA 3R8UA 4B99A 2UZWE 2G15A 1KE8A 2PHKA 4AGWA 3ORIA 4R5SA 1H01A 3TIZA 3R8MA 5L2TA 3QYZA 4I5PA 1B6CB 4FTIA 4AP7A 1UNHA 3PJ3A 3ZO3A 4FTTA 3OHTA 5JQ8A 5JSMA 3TEIA 1OGUA 2E9OA 2C3IB 4O0WA 4CFXA 3L8PA 2HOGA 5HESA 3ZRKA 2UW6A 2B53A 3OP5A 1KE5A 4F7LA 2IJMA 3EQIA 3UIXA 3ET7A 1KSWA 5CZHA 5HI2A 4FEXA 3NUSA 4C4EA 3QUEA 4WSYA 2O63A 1Q8YA 3ZSIA 5KE0A 4O96A 3MFTA 4QYEA 2WGJA 4JNWA 1I09A 5EDQA 2Y6OA 4Y5HA 5I9VA 5CF8A 5LCJA 3BYUA 3EQGA 4DA5A 5IUGA 3HDMA 3E5AA 5B7VA 1FVRA 4USFA 3ODYX 5KUPA 5KKRC 4GT3A 1KOAA 1DI8A 1GZKA 3DBQA 2BR1A 4ITJA 1YOLA 4L43A 2V7AA 2R3IA 3IGOA 4QMXA 2PE0A 3A7GA 3KXHA 3DKFA 4ANOA 5H8GA 1OL5A 4M67A 4PQNA 2YLFA 4A9TA 4HVHA 2ZMCA 5LMBA 3LQ3A 4W4YA 2YITA 1OKVA 2OH0E 4MWHA 4LL5A 3KK9A 2QG5A 3CY3A 3IK3A 4TYHB 5ANIA 2FB8A 3ACJA 3BCEA 2GFSA 5H3QA 2WMUA 4EHVA 5CVFA 5GZAA 5DNRA 1I44A 4GL9A 1ERKA 4L52A 4KS8A 4RWIA 3UNZA 4GKHA 3DJ5A 3KVXA 3RK5A 3ID6C 2A1AB 5HE2A 4UXQA 5GJFA 3PXYA 2R3LA 4WBBB 3VQUA 2PE2A 2GHGA 4MD8E 3GI3A 4LGDA 5KZIA 5CF5A 3PLAE 2XKDA 3BKBA 3KGAA 1UVRA 3QRIA 4TNBA 3FL4A 4U7ZA 1BL7A 5HTIA 2B9IA 4L8MA 3F2AA 4X2KA 1PXIA 4RJ8A 2BHEA 4LMNA 4RWJA 1Q62A 2BZKB 4RC2A 3V04A 4FKPA 2BZIB 2VGPA 2ZV7A 4IAIA 4QYFA 4TYEA 2XM8A 5AX9A 5A6NA 4GKIA 3HDNA 2PMIA 1YXTA 1NVSA 4R77A 4BTKA 4EH7A 3FLWA 5KCVA 4DH3A 4AW2A 4YJNA 3M11A 4E93A 2F4JA 2B9FA 3VS0A 5HLWA 2F57A 3NUYA 2CCHA 4J98A 2NRUA 4IWOA 5HCZA 5LVNA 3S1HA 3NUNA 3QA0A 4JQ7A 2XYUA 5G1XA 5JRQA 2XEYA 4FNYA 3LXLA 4W9XA 2BRGA 4B7TA 4YJOA 5AP4A 2IVVA 3R7VA 3TUDA 4G3GA 5AIRA 4QNYA 1CKIA 3AQVA 3NIZA 4BCIA 4JBPA 2BZHB 3PSDA 4FL2A 3D7TA 1KE7A 4M7IA 4IB5A 3U9NA 2X7GA 4L7SA 3QRJA 3ATTA 5EYCA 3NRMA 3D0EA 4OR5A 3RNIA 1H00A 4OTGA 4R7IA 1R1WA 4YZMA 1SMHA 3U6IA 2JD5A 4FTRA 5CAQA 3LM0A 1OUYA 4ERKA 4X3FB 3AGLA 4F64A 4E6QA 4PMSA 4AA0A 2VWIA 4I4FA 3ORLA 4JDHA 4NTSA 3ZSHA 5CS6A 4BTJA 4MF0A 1BX6A 4UZHA 5IA2A 5K4IA 3BE9A 4IWDA 3I7CA 3UYTA 1UV5A 4PTCA 3FWQA 4JLCA 1M14A 5CWZA 2XZSA 4FEUA 3JXWA 2XK9A 4UWBA 2XIKA 2XKEA 2PVFA 3DA6A 3KK8A 5HBJA 3JUHA 4NEUA 4OBOA 4TT7A 4MEDA 5BVWA 5I3OA 4R1VA 2FA2A 3TTJA 5HKMA 4YBKA 3DKGA 1KE9A 4GSBA 4KKHA 3Q6UA 4XLIA 3SD0A 4PPBA 4ACGA 3QTUA 4EOJA 3QZFA 1YI3A 3VBWA 3DQWA 3Q04A 4FE2A 3KXGA 2CNQA 3ZZWA 3COKA 2Y6MA 3FQEA 1GOLA 4IAAA 3W33A 3W18A 3TDVA 4IHPA 2W4JA 4RWLA 4U41A 1V0OA 1OKYA 4G3EA 4PP7A 2XNMA 4BDDA 5CENA 3C51A 4DH5A 4DFXE 4D4SA 2OXYA 4O7VA 4A9UA 2Z7RA 3U6HA 1YVJA 4Y46A 5FWKK 4P2KA 4IZ7A 3DAEA 5T68A 4EORA 5JN2A 3WF8A 4DBXA 4U3YA 2O5KA 2R7IA 3FZTA 2UW7A 3QZHA 5DA3A 5EOLA 2ZAZA 3WF6A 4CV9A 4DITA 3VS2A 3V5TA 4CVAA 2R3QA 3RKBA 3BQRA 3FMHA 3RAHA 3HYHA 1VYWA 4PF4A 4I23A 4MK0A 4FTUA 4YJPA 5M4CA 2HY81 2QOBA 3FDNA 3R9NA 2O64A 2X2MA 4NIFB 4TWNA 4G9CA 3R8PA 2QHMA 4BDHA 3BE2A 5CEMA 4A9SA 1J7IA 2R64A 4A9YA 2CN5A 3R30A 2YCQA 4FIJA 4PRJA 4ASZA 1UU3A 4U42A 3EYGA 2R3OA 5I3RA 3BU3A 2C1AA 3DZOA 3A4PA 3WZUA 4D4VA 5L2WA 2W0JA 3E62A 3JS2A 4GK3A 2CCIA 2B7AA 5M56A 5M06A 4CRLA 4NTTA 2OWBA 3LCOA 1JSTA 3BYSA 4C61A 5CU4A 4CFMA 2OJJA 2V55A 4X3JA 3FZPA 4DEEA 3DBFA 3U54A 1DS5A 2C5VA 4DGOA 4PY1A 3S0OA 3DFCB 4MXCA 5AA8A 3IG7A 2IZTA 1ATPE 5AADA 1WBPA 2W1GA 3EFKA 3AMYA 2NP8A 2C68A 3BEAA 2C6DA 3GC7A 2J0KA 5TKDA 4DT8A 5EW8A 1M17A 1GNGA 2I0YA 3EWHA 3GXLA 4EC9A 5G6VA 4IZ5A 4V05A 4GW8A 2C5NA 4XEYA 2WAJA 2FH9A 5DR9A 4IVBA 4XJ0A 3ZC5A 1WFCA 4OTPA 3WIKA 4GT4A 2J2IB 4WNMA 5DLSA 1JOWB 4DLIA 5FTOA 3DU8A 1JWHA 3WZJA 4RRVA 3P0MA 1PYEA 2XS0A 5BUJA 4CZUA 5L8KA 1Y91A 3LFBA 2REIA 2UZBA 5ACKA 4GFMA 3LM5A 3TACA 2GNLA 2RGPA 2BHHA 2VV9A 3W2QA 1Q8ZA 4NW6A 2I7QA 4UB7A 3W16A 3RK7A 3EH9A 4JDKA 3UO4A 4BZDA 1BL6A 4FYOA 4YHJA 5GHVA 1P14A 3EQDA 3CP9A 3LQ5A 3G5DA 4ACDA 3PP1A 1XQZA 4PPCA 3TUBA 2PZ5A 5EW3A 4O7YA 3HVCA 1H1WA 4K0YA 3PPZA 5C8NA 4AX8A 3FJQE 4FT5A 2X0GA 4V0GB 4MH7A 3CC6A 3VS7A 3PVWA 4RLLA 2BDFA 2HZ4A 4EQUA 4EUTA 4H05A 3PXFA 4G9RA 4C38A 2CKQA 3EN5A 3AT4A 2PVNA 1YKRA 2P4IA 1LUFA 2PZRA 2XNBA 4A07A 1QPDA 3BQCA 3OF0A 4FYNA 3KRXA 2CKOA 5CZIA 4JX7A 2YN8A 4G17A 3BHHA 3ROCA 3WYYA 3JR1A 4DFBA 3ORTA 4RSSA 5FXSA 4O38A 2BRBA 4ZEGA 3VS4A 4RMZA 5BUEA 3ZONA 4YTIA 2YM6A 3OT8A 5CU2A 3QKLA 4GYGA 2WMXA 4AA4A 5LVMA 3W55A 2P2IA 3SVVA 4RA5A 4HZSA 5BUIA 3UQFA 4TXCA 3BLQA 2PVYA 5KMLA 4CLJA 3FLQA 3FZSA 4UEUA 2BAJA 3FL5A 3M42A 4FI1A 4QMMA 3QXPA 2ZM1A 4UMRA 2P0CA 4F7JA 4BY9E 3SAYA 3ZM4A 4TN6A 4QO9A 3R8ZA 5E8ZA 2ITWA 3TNQB 3JY9A 4BHNA 2BRHA 3UVPA 4EH3A 3NX8A 3ZDIA 5E9EA 1IR3A 5KHWA 1XH5A 1U5RA 2HZNA 3BI6A 3GFWA 3D5VA 4K8AA 3WIGA 4I6FA 4WG4A 4ZJIA 2XK8A 1YXUA 2AYPA 3F88A 2YACA 3ACKA 3PFQA 3FMNA 1M52A 3QQUA 1A06A 2RFEA 3FZRA 3NGAA 3OCBA 5M4FA 2Y7JA 2OZAB 3T3UA 3FPQA 3G6GA 4II5A 4AGCA 5D7VA 3OEFX 4APCA 3GU5A 3IOKA 4FEVA 3VBYA 3BHTA 4FSTA 4F7SA 2WO6A 3VF9A 2BKKA 1H1PA 4BCJA 1JSVA 4U79A 3WI6A 4BDAA 4F65A 3R2YA 5AA9A 3DKOA 2VO3A 3HAMA 4D58A 1H28A 2ETRA 4NW5A 2C3JA 3A7JA 4DFYA 1H25A 3QQLA 5HG8A 5CU0A 3D14A 5IQEA 4IWPA 4GV1A 3LXKA 5HNIX 3GB2A 2CDZA 2OIDA 2IO6A 4OTIA 4NM7A 3RNYA 2WQNA 3A8XA 5JFWA 3CLYA 5GJDA 4TPTA 4A4OA 4QTEA 4RJ4A 2B1PA 5D10A 3NIEA 3Q5ZA 3BV2A 3HP2A 5M4IA 3DTCA 3GCUA 4IAZA 4ANQA 4CNHA 4Z3VA 3V5QA 1O6KA 4AW0A 5BPYA 4O0RA 3CGOA 3O51A 3R2BA 1CKPA 4FV0A 2V7OA 5IDNA 2EUFB 4BDFA 3H4JA 2IVSA 5L2SA 4XRJA 2E2BA 4PNIA 2VNYA 5CEIA 5AUVA 1OIQA 4O0SA 4M97A 5FGKA 3LFNA 3OS3A 4L46A 4YZBA 3RP9A 3V8SA 3Q3BA 3Q9YA 4M68A 5AM7A 4ACCA 3HAVA 4DH1A 3UG2A 5AP6A 3O8TA 4BIDA 4LRMA 2FSLX 4UYNA 3VO3A 3SG8A 4BCHA 4FV1A 3FQSA 4NYEA 4M3QA 3U8WA 2E9UA 3KCFA 4BCNA 1R3CA 3CPCA 4AT4A 2EB2A 3NNUA 1OUKA 2QR8A 3HP5A 4K11A 2IZUA 5AR8A 3MDYA 3QTWA 4FR4A 5C26A 5KMMA 3MN3A 2GTNA 5HE3A 2HWPA 3AC3A 3ODZX 3TNPC 2W17A 4KIQA 3OCGA 4WG5A 4YNOA 3ZCLA 4O1OA 4RIXA 2YM5A 5B0XA 3CSVA 2YDKA 1LPUA 4X2GA 2J0IA 3UC4A 1K3AA 3TJCA 4CD0A 5CSVA 2UW8A 4YTCA 4L01A 4PWNA 5BMSA 4FK3A 3JVSA 3F3UA 3WF7A 5FEEA 3PA4A 4LYNA 4BDGA 3A7FA 4H3BA 2UZDA 4HCTA 4F1TA 3OBJA 4BDEA 5ICPA 3R9DA 5CX9A 2W5BA 5GJGA 2QOOA 4L9IA 2YIXA 4RX9A 4E4MA 5A4CA 4XG3A 5EYKA 4DG3E 3DK6A 4XG4A 5EOBA 4CT1A 3RI1A 3D9VA 3OG7A 5IF1A 3HRBA 2O2UA 5A46A 2O8YA 4DGLC 2CPKE 2HZIA 2XB7A 2UVZA 2WTKC 3C0HA 4JRNA 3SRVB 5IQDA 1PMUA 2ZVAA 1IG1A 1ZXEA 3F7WA 2QODA 4MD9E 4NUSA 5JK3A 2VTTA 2QOHA 4I92A 4MX9A 4W4XA 2V0DA 3L9PA 1YHSA 4LL0A 4BCMA 3MFUA 2QOLA 5J5SA 4P5QA 2YLEA 1QPJA 4QMUA 1OMWA 1ZMVA 4LG4A 4BIEA 5DRBA 4HGEA 4QTDA 4FG8A 4OT6A 4M69B 1J91A 4L53A 3RWPA 2PUPA 4FTJA 3VS1A 3QL8A 5M4UA 3QA8A 5C27A 1YOMA 2R0IA 3NNVA 5C8KA 2XNEA 4I6QA 2VTNA 4P90A 1FGIA 3LQ8A 4G1WA 5K5NA 3RPSA 4DG2E 4RPVA 1U4DA 2PMLX 3KRLA 3LXNA 2J9MA 2UW3A 3BWJA 3ENHA 4EK4A 1U54B 1NA7A 1FINA 4O6LA 3DLSA 2XRUA 4S30A 3F7ZA 4LOQA 3SG9A 4AN9A 1RW8A 5AUZA 4DFUA 5EHOA 3I6UA 4Z16A 3GOPA 2R7BA 1KE6A 3UO6A 4LQMA 2JITA 3DB8A 3MJ1A 2EXCX 3QQJA 4MBJA 5AP7A 5EH0A 5AR5A 4A7CA 4USEA 4QPMA 2VNWA 5AUXA 2B55A 3BGQA 3QZIA 4N4SA 2JAMA 3MPMA 1YWRA 1URCA 1JPAA 4HYIA 4QP1A 3EQRA 3RINA 3ZLXA 1H07A 4MD7E 3G15A 5DN3A 4FX3A 1BI7A 4PDSA 3D2KA 5CI7A 4EKKA 5IISA 3FLSA 4LGGA 2VGOA 2IW6A 2VWXA 4QMYA 3W2OA 3FY2A 4Z7HA 2CKPA 3IGGA 4E7WA 5IU2A 4BFMA 2UZVA 4J1RA 1YWVA 5HD7A 4B9DA 1OL2A 4W8EA 4DGMA 2VWYA 5DIAA 3BIZA 3VN9A 2I0HA 3OY1A 3HMMA 3UO5A 4ALVA 3SV0A 3QCQA 3GU8A 3PVBA 1R0EA 3R1NA 4MVFA 4ENYA 4IEBA 1Q97A 3R22A 3S4QA 5IH4A 3EKNA 5JQ5A 4JI9A 1M2PA 1PKDA 2OICA 3TKHA 5HU9A 4IQ6A 2DYLA 1G8SA 3O8PA 3JPVA 3ZFYA 3FXWA 4ORKA 3LW0A 4GRBA 4GUEA 2Q83A 3HV5A 5FDPA 3TI1A 3BU6A 2WIPA 4D0WA 3NNWA 3F3TA 5AIKA 4F9CA 1J7LA 3MV5A 3UIBA 3L8XA 4RIYA 3E92A 4DGGA 5FM3A 4FIHA 3DXQA 4BGHA 1XBCA 2J5FA 1L3RE 2P33A 3KC3A 4IFCA 4DE4A 3JY0A 3OXTA 3IDCA 4L3JA 3OBGA 1Q4LA 1V0PA 3C0GA 2J0MB 4KBAA 2PMOX 4ZTNA 1G8AA 4CG9A 2XIYA 3CTHA 1FVTA 3B2TA 3S95A 3ELJA 3ZOSA 1Q61A 3E8CA 4ZTQA 4E5WA 4X6RA 4YBJA 4CT2A 4HGSA 3NCGA 3FLNC 1QL6A 4QQTA 3PY1A 4Q9SA 3E87A 3TN8A 3VUMA 4PX6A 2PULA 3L8SA 4U6RA 3QLFA 4EONA 5J9ZA 3LMGA 2A2AA 4BICA 4UMPA 5FBOA 3KKVA 4JDJA 4L68A 4CMTA 4IADA 5AFVA 3FYJX 2QVSE 3CGFA 4FOBA 2Q0BA 1IEPA 1JKKA 3P78A 4YURA 5IG1A 5KNJA 5CVHA 4O0UA 2JFMA 2VO0A 5IKWA 2XBAA 3QD2B 3WOWA 4ONAA 3UYSA 1MRUA 2XEZA 5EK7A 5M08A 5E1EA 3UJGA 3KREA 4YP8A 3TKIA 5IA0A 4DEHA 3VS5A 1Y8GA 3O17A 3DJ7A 3GGFA 2W99B 5I9UA 4BTFA 2CHLA 2WHBA 3O8UA 3KXNA 4YJQA 5EI8A 3G2FA 5EYMA 3W10A 3T8OA 3ZBXA 1S9IA 4AZEA 4BF2A 3PXQA 5J8IA 2V22A 2UVXA 2JAVA 3EQBA 3FY0A 4DF3A 3HV7A 1K9AA 2O3PA 4FG9A 3EQPA 3VC4A 2F7ZE 4IIRA 4E26A 1E1VA 1T45A 3R9OA 4O84A 3DNDA 2ITTA 1W98A 2XK4A 3TUCA 4R78A 4WNKA 3WZDA 5B2LA 2VZ6A 4TKSA 3QD0A 4GYIA 5AEPA 1YDTE 4JVGA 5DG5A 4E4LA 4ZSAA 4WSQA 1BKXA 4K1BA 2BTSA 3DAKA 2J4ZA 1YXXA 2JEDA 5CNOA 2XUUA 4XNEA 5KBRA 4ZS4A 2WTCA 1Y57A 2A0CX 4FVRA 5IQAA 5EI6A 3QCYA 3DPKA 4LM5A 3H30A 1UWJA 2R4BA 5J9LA 4GIIA 5J7BA 1F5QA 5F95A 1OL6A 4TYHA 4YLLA 1NY3A 5BX0A 3I5ZA 1J7UA 4HGTA 5HICA 4XV1A 3LCDA 2VTLA 4UYAA 3FKLA 4QQ5A 1TKIA 2X9FA 4TRLA 3V6SA 4BBFA 5CAVA 1Y8YA 5IA5A 4EZ5A 3C7QA 4FSYA 4IMYA 4EOPA 3SOAA 3UIMA 2UZUE 2GNGA 5E8XA 4U44A 4QPAA 4CQGA 2VD5A 5F1ZA 2R3GA 4F6SA 4TL0A 2VN9A 4KSQA 4QP9A 5FDXA 3NEWA 4XV9A 4EHGA 5L6WL 1ZYSA 4O0XA 4ANLA 1XR1A 3DBCA 4U40A 3ZS5A 1PXOA 5CI6A 5CEKA 3VS3A 4HVIA 1JBPE 2BDWA 3GBZA 5LVPA 2OJIA 1CM8A 2VTHA 4EC8A 3O50A 4M15A 4F6WA 2B9HA 1YDRE 4W4WA 4H36A 3FPMA 3BEGA 3NUUA 4NSTA 3W1FA 2XA4A 1OBDA 3OUNB 5AP0A 3QHWA 3PVGA 3EN9A 4GFOA 2YM7A 4PL4A 3RPRA 3QQGA 3VBVA 4ACMA 3TJDA 3Q5IA 2VAGA 4G3CA 2JKOA 4OLIA 4CCBA 2ZYBA 3FMLA 2J51A 4FKGA 5FM2A 5DWRA 3ZU7A 3E8NA 5J79A 3Q96A 4C4JA 5BVEA 4DCAA 3HUBA 4NJ3A 1PYXA 3V5WA 4M0YA 4QP2A 4AOTA 3LMHA 4BIBA 3V01A 1YXSA 1GJOA 4H3QA 4R1YA 4BR3A 4ANMA 1FOTA 1VR2A 1UU9A 2JDSA 4FTCA 2ZV9A 5IMXA 5JFVA 1QPCA 4FV4A 1WBWA 1ZZ2A 4F9WA 4BGGA 4Y83A 2F9GA 4LFIA 3FI3A 3TTIA 3SQQA 4BDBA 2NNWB 4O7WA 3NYNA 4BI0A 4AUAA 1R39A 4IX4A 4O22A 3ZUVA 4BN1A 3SLSA 5EQYA 1APME 2C5OA 4JRVA 2XK6A 2OW3A 5M55A 3R7EA 4L6QA 4KSPA 2WMVA 2YHVA 2F2UA 4X3FA 3OOGA 4EH9A 3EFLA 4IVCA 3AMAA 4RJ3A 4UWYA 5EW9A 4N6YA 4H1MA 3PRFA 3ZSGA 4M13A 3SX9A 3LLTA 2RF9A 5EQEA 4DEGA 4LUDA 3MVJA 3OY3A 4YPDA 2BAQA 1Q8TA 2XK3A 3CY2A 4E5BA 3VJNA 3QUDA 3SXRA 4F63A 4HCUA 3ETAA 3MS9A 3II5A 2VTIA 2VTQA 1UU8A 2BPMA 4EH2A 1M7QA 3MW1A 2WQBA 3FZOA 4QOXA 3AOXA 3D7ZA 3LLAA 4BWPA 3SGCA 5EG3A 2H96A 5CEPA 5L2IA 1ZYJA 4GU6A 2BILB 3BYMA 3TV6A 4I41A 4FZAB 4W4VA 4N6ZA 5BNJA 5ETAA 1H1QA 3FXZA 4KS7A 3R8LA 1XKKA 2R3RA 4EK5A 4G3FA 5HNBA 2CN8A 2JFLA 3LFCA 3OTVA 3EFJA 3SW4A 4YMJA 2C0OA 2XP2A 5F20A 4NFMA 3NAYA 3D2IA 1JAMA 1H08A 3FZ1A 2GTMA 2Y4IC 3P5KA 3OWPA 1FVVA 1MP8A 2H34A 4DTKA 5ANKA 2VWWA 4YZ9A 1OECA 4IACA 2WQMA 4K33A 3QTQA 2W9FB 4IB1A 3P86A 5IA4A 4DC2A 2HW7A 3QZGA 4C02A 4LI5A 3NNXA 5DFPA 4FSWA 1FPUA 2BIKB 2YEXA 1A9UA 4FMQA 4KIKB 5KMIA 4BKYA 4E3CA 3GC8A 3NUXA 4NIFA 3RZFA 4E6DA 2PWLA 5ANGA 2VX1A 4FT7A 5J1VA 3QGWA 4XG2A 2BTRA 3RAWA 4AZTA 3LE6A 1ZLTA 3TWJA 2ZJWA 3FAAA 3H10A 4H3PA 4I93A 3M1SA 4IXPA 4RLKA 3U4WA 5IQFA 1ZMUA 2JDTA 4AZFA 4D9TA 5FTGA 4S34A 3LFAA 2JC6A 4LOPA 3OUKA 2CLXA 2J50A 4EHEA 3KXZA 3LHJA 5E8SA 4F9YA 2PZPA 4V04A 4DAWA 4JR7A 5HU3A 2QG7A 3HA8A 3ZBFA 3ENMA 4X6QC 5D41A 4O2PA 5HQ0A 4E20A 3P08A 3RPYA 3O23A 4QD6A 3HMIA 3L9LA 2IZRA 2BUJA 4G6OA 4U81A 4DG0E 3LVPA 4HNIA 3CD8A 4M84A 4HVSA 3TG1A 4D5HA 5JT2A 3KF4A 4GS6A 3AD5A 3SW7A 4I0RA 5GNKA 1WMKA 2GMXA 4MXXA 3Q2MA 4WRSA 3NUAA 5FTQA 3F6XA 3TT0A 2OFUA 3OW4A 3QCXA 3JYAA 3V3VA 2HY0A 5DBXA 1K2PA 4CEGA 1PXKA 2P2HA 3F3ZA 3BYVA 2WTJA 4OTHA 5AUWA 4Y95A 4XG6A 2OJ9A 4PTEA 3CTQA 4H58A 4PDOA 4DEAA 3LFEA 3KULB 1O6LA 4S32A 4GU9A 4QT1A 5AX3A 3VRZA 1PRYA 4O7LA 4EJ7A 4CTCA 5J87A 2R3KA 3RPVA 4FSNA 3RAKA 3CCNA 3AT2A 4JBQA 3Q4CA 3PWYA 4U80A 3UE4A 4KRDA 5IEVA 4C2VA 4H39A 3COHA 2VWBA 4AT3A 3QD4A 4NKAA 1IAJA 4HVDA 4DBNA 3CJGA 3MPAA 3F5PA 3Q32A 3Q4TA 3TDWA 3MA6A 1M2QA 4FSUA 1GY3A 4I0TA 4PL5A 3PIZA 3V51A 1MRYA 3DB6A 3EZVA 3MB6A 3ZRMA 4FA2A 4FKLA 3C13A 2FGIA 4X2NA 4X7QA 4CGAA 1Q5KA 4BBEA 2WTKB 4AE9A 1UU7A 3R1SA 3Q60A 3BLRA 1SYKA 3H0ZA 3I7BA 4V0GA 3C4XA 4EBWA 5BVFA 5CTPA 4EH8A 3F3VA 4D4YA 3F69A 4EOSA 4WNPA 3UODA 3W2SA 1OITA 3R7UA 5DT3A 1VYZA 5D1JA 1WVWA 3LIJA 3D5WA 2BMCA 3Q9ZA 3FSKA 4RQKA 4O2ZA 2NRYA 3ZFXA 3UOKA 1ZY4A 2W1HA 3DZQA 4HNFA 3TIYA 5KHXA 4ZSEA 2YZAA 2AUHA 2QHNA 4YGAA 5JH6A 2OF2A 3OCTA 4Y8DA 4L00A 3VUKA 4IC8A 2PVRA 4E73A 1B38A 4YC6A 3Q4ZA 4XBUA 5GIPE 4MNEB 4QP6A 1REKA 3I60A 5AAFA 2W5HA 5FEQA 4ZJVA 3LKMA 3G51A 4QRCA 2BRMA 4GEOA 3VHEA 3R28A 3R02A 5JZNA 2ITNA 3G33A 2YM8A 2Z7SA 2OGVA 5IZFA 3HMPA 4CKIA 2C47A 4NZWB 2H9VA 1PMVA 5E8WA 5CU6A 3IW7A 3KB7A 3A7HA 2UW0A 1OIYA 3ANQA 3PZEA 3TXOA 2OZAA 4BYJA 2I0EA 3S2PA 3QXOA 3QALE 2UW9A 5D9HA 2CKEA 3Q6WA 4OTDA 2GDOA 5CANA 2YIWA 3HRCA 2GNIA 4AZSA 3UDBA 4AFJA 5CSPA 2HW6A 4DGNA 3GENA 4G2FA 4HJOA 3UNJA 2BROA 3RMFA 4D2WA 4QMNA 2B52A 4CG8A 5B2MA 3ZYAA 5LMKA 1WCCA 5DOSA 1GZ8A 1XH6A 5IA1A 3NWWA 2Y8OA 2EXEA 2HXLA 3COIA 4C3PA 2WXVA 5TOZA 3AD4A 2ITZA 2KTYA 2BRNA 2HIWA 3FLZA 4OW8A 3NR9A 4HYSA 3ZUUA 3MH2A 4WBOA 5DR6A 3SA0A 1YXVA 3DCVA 1DAYA 1OKZA 3CKWA 4KAOA 2QU6A 3PE1A 4MTAA 2R3FA 5HLPA 4CMOA 5AAGA 5KMKA 3F5GA 5TO8A 5DYJA 2OF4A 3AMBA 4TWCA 3E8DA 4LOOA 4XP2A 2ZB1A 5EDPA 3C50A 4WHZA 2ACXA 4HOKA 4PP9A 4XBRA 3CEKA 4UBAA 4O7SA 3C1XA 4R7BA 3EKKA 1IAHA 4ZSLA 3QTXA 4KD1A 3KA0A 3MSSA 3OZ6A 4FUXA 1Q3DA 1GIHA 3IDPA 3RM6A 3R71A 5HCXA 3EYHA 1WBSA 4DEBA 3A60A 2JIUA 3IONA 5HG9A 4IJPA 3MVLA 1Q24A 4KKGA 4ZZMA 3NW7A 4A9RA 4F0IA 2O0UA 5HO7A 2XJ2A 4FTNA 3CE3A 2OJGA 4UMQA 4JT3A 5TT7A 4JAIA 2ITVA 5HHWA 4O7ZA 5LWMA 3W2PA 3T9TA 2VTSA 5L6PA 3QBNA 1R78A 4FGRA 4BC6A 5DI1A 1UNGA 3NVMB 4R5YA 3N51A 5ITAA 2HZ0A 5FQDC 3PA3A 4JG7A 4ITHA 3UVQA 4BDIA 4GUBA 5CSXA 5C4KA 4AT5A 4UV0A 2WQEA 4D9UA 3FHIA 4QMTA 4F0GA 2PY3A 5A4EA 3Q2JA 1F0QA 3PVUA 2PVMA 4NH1A 3VVHA 1YRPA 3ZO4A 4FTAA 3Q52A 4FTLA 3R6XA 4YUQA 2C6LA 4JDIA 3D4QA 4N57A 2R3PA 3VS6A 3UOJA 3ULIA 1TQMA 5FP5A 2UZTA 2UZOA 2CJMA 4QP8A 2Z60A 4D1SA 3KRJA 4L67A 4O7TA 2QQ7A 4YJRA 4XP3A 1E9HA 5IQGA 5HX6A 1VJYA 5IPJA 2J7TA 3MTLA 5JRSA 5FXRA 3R8VA 4NKSA 1MQBA 2ETKA 3SOCA 3LJ0A 3LFFA 4C59A 2VU3A 3T9IA 1ZOEA 4F08A 5L6OA 3RHXA 4F4PA 1NW1A 2QR7A 3R7IA 4EOIA 5ANDA 4GCJA 4I94A 3SRVA 4DFZE 3PLSA 4FIEA 5FXQA 4XX9A 4GT5A 2YERA 4D28A 4ZY4A 5M44A 4YJUA 2RFDA 4L45A 4MXOA 3ORNA 3MIAA 3OOMA 4APPA 1QCFA 5JEBA 2UUEA 2ZDTA 4RVTA 4JQEA 5AMNA 3SKCA 4CRSA 4R6VA 4RWKA 2X1NA 4QMSA 2CLQA 2VTAA 5A9UA 2HELA 5AV1A 2GHMA 3FUPA 4FT9A 4QPSA 4QQJA 5IQBA 4X3FC 4BCFA 2YCFA 3LXPA 4RA4A 4U0IA 5FBNC 4QTAA 1JQHA 3ROYA 3UG1A 4AU8A 1PXLA 3DY7A 5CEOA 4FT0A 4EK3A 5JMSA 3NPCA 2QLQA 3E7OA 2JKKA 3AC1A 3BZ3A 4MYGA 1U54A 2YAKA 2VX0A 3G90X 3ZUTA 2W05A 3UZPA 3KQ7A 3VBXA 3P23A 4N0SA 1ZWSA 2YZLA 4FL1A 3ATSA 5C4LA 5E8VA 3KU2A 5AR4A 4MF1A 4RFZA 4KIPA 4ZLZA 2BAKA 3KFAA 4ZLOA 3FHRA 1UKHA 2XJ0A 3P1AA 2ITPA 4IDTA 2JDOA 2W9ZB 1HOWA 2CSNA 5HG7A 3E93A 1XBBA 2VTMA 3MIYA 4RVMA 2X8DA 5M51A 3THBA 3GU6A 4IAYA 3EB0A 4TYIA 3WBLA 1WAKA 4C37A 5IDPA 3IW6A 5DE2A 4O6EA 4KABA 1GIJA 5JFXA 3P7CA 4J52A 4RX7A 5AV2A 4IM0A 3EJ1A 4FL3A 4EOLA 3AD6A 3BBTB 3MPTA 5AV3A 1H0WA 1SNUA 5J5TA 3LFQA 3FI4A 5E7RA 3QRKA 4FGBA 4Q2AA 2A4LA 2CGXA 3T3VA 1H4LA 2FO0A 3TNWA 2PUNA 2JLDA 3H9RA 1OIUA 3GU4A 4X0MA 4ACHA 4D2VA 4CFVA 5KKRB 1OPKA 2OKRA 4A4LA 5M09A 4C35A 4JAJA 4AZVA 4FIIA 4FKQA 1CDKA 4D0XA 2IW8A 3GP0A 3I6WA 4QMOA 4Y85A 1KOBA 4JX3A 2HWOA 3QTSA 3VNTA 2X6EA 2WMBA 2HCKA 4CMUA 5JGDA 5IQCA 2B54A 2C6KA 1XH8A 1XH4A 3QQHA 3N4UA 2UZNA 4CKRA 4TWPA 2OJFE 3P79A 3TZ8A 2EU9A 1OBGA 4ERWA 4YJTA 5IH5A 4ZAUA 5D11A 4EOKA 1V1KA 3GCQA 3EOCA 4IW0A 2DWBA 2C6OA 3PIXA 1GAGA 5E8YA 2PMNX 4EYJA 3PYYA 3KCKA 2J90A 4M8TA 4PV0A 3ZO2A 1PXMA 4MBIA 2X2LA 4NFNA 3GC9A 3RHKA 4O21A 1PXPA 2WZJA 4NT4A 5CLPA 4IJ9A 4U45A 4Q9ZA 3RALA 4J8NA 4IDVA 1RDQE 4FSQA 2DS1A 2YWPA 3VUHA 1IASA 3DQXA 3ZHPC 2OI4X 2YM4A 3IS5A 4QMLA 4CFFA 3L1SA 4Y72A 2JGZA 4C34A 5IH6A 4YO6A 2W7XA 3V8WA 4AXAA 3P7BA 4QYGA 5EFQA 5CAPA 2G2FA 2YISA 3ZM9A 3BU5A 3R1YA 3RPOA 1OIRA 2VX3A 2X7OA 5D7AA 1PKGA 4OTQA 1H27A 3N9XA 3ZLWA 1RE8A 3BWFA 3AG9A 3TV4A 4B8LA 4RJ6A 3VIDA 2C1BA 2WTWA 4R3CA 2OLCA 3L8VA 3MJ2A 3W2RA 3VUIA 4CQEA 2QOQA 5KO1A 4D5KA 3KMMA 2YAAA 4OUCA 5HOAA 4K77A 2XNOA 3QKKA 4J8MA 5L8JA 4QYHA 2XMYA 4XS2A 3U9CA 3V5LA 5HTCA 3P7AA 4IX3A 4WNOA 3R63A 4IX6A 4FVPA 3AT3A 4EOOA 1BUHA 4WD5A 2WTIA 5ANOA 2CMWA 2NO3A 3HLLA 4C3FA 3VJOA 3IQ7A 5J1WA 3IO7A 1MUOA 3S00A 3V5JA 1B39A 2YA9A 3FMJA 3VAPA 5AUUA 4R3RA 1QMZA 3R7GA 3CQWA 2Z2WA 3MYGA 4N70A 2PU8A 3P4KA 4YC8A 5LOHA 2ZOQA 4WKQA 2RFNA 1GZNA 4FT3A 1LEZA 3LFDA 4YZCA 5HG5A 4YR8A 3DBDA 4Y5QA 2IVUA 3DJ6A 3IECA 3ANRA 3IW8A 5DT4A 5CEQA 2Z02A 4L3LA 4DFNA 2R0UA 3G9NA 4F1OA 3PRIA 4QMQA 5KMJA 4TNDA 4BDJA 3R7YA 4BDKA 3K2LA 3UOHA 4G5JA 5LCKA 4JL9A 3FLYA 3LCKA 1J1CA 1SNXA 5F4NA 1STCE 2F49A 2FSOX 4B8MA 3EN6A 3RK9A 2C6MA 3HRFA 2GNFA 3R83A 3ULZA 3ZDUA 5KX8A 5HIBA 4EH5A 3VBQA 3HGKA 4IBMA 3LJ2A 3D5XA 3HL7A 5CSWA 3RGFA 3OROA 3PIYA 1OPJA 5EKNA 3PJ8A 1JKLA 1S9JA 5FEDA
chains in the Genus database with same CATH superfamily
1W2DA 3FSFA 4BI1A 5J7HA 4E4NA 4C3RA 1REJA 4BDCA 1LEWA 3R01A 4LRKA 4MKCA 3IW5A 4XG9A 5E4HA 5BV3A 1CKJA 2W4KA 4YO4A 1Z9XA 4FZFB 4ASEA 1BYGA 4Z55A 4ALWA 2VTRA 4J95A 1AD5A 5CQWA 4BJJA 4JIAA 1FQ1B 1WZYA 3UPXA 2BZJA 2I0VA 4EYMA 3P5JC 4UMTA 4WIHA 4D2SA 2F7EE 2X9EA 4IH8A 5TR6A 1H24A 3RTPA 2GQSA 4HVGA 1VEBA 4LMUA 2W1CA 5HE0A 1Q3WA 4DYMA 1JSUA 5T6KA 3K54A 1YW2A 4YJVA 2YCRA 1Z57A 2WOUA 4QQCA 4EK8A 3EN4A 4C57A 3MI9A 3HV4A 4FTQA 4O27B 4XCUA 3IW4A 4FV9A 3QQFA 5CY3A 5BYYA 2OXXA 1IA9A 4LV5A 3BPRA 2VO7A 3RCJA 1Q99A 1PXNA 3PA5A 1VZOA 4Y73A 4RIWB 5LMKC 2CNVA 2ESMA 4FKJA 5T3QA 4S33A 4CKJA 3PFYA 2G2HA 4FICA 5ANJA 3W2CA 5EI2A 4WT6A 4ZMEA 3ZZEA 4IFGA 1YI6A 2JBPA 1WBOA 2P55A 2YCSA 3Q4UA 4IE9A 4EWHA 3U51A 2JBOA 3GEQA 5M07A 3L9MA 4X2JA 5AUYA 3W0NA 1ZYLA 3E88A 3WILA 1TQIA 1XWSA 4FNXA 5H9BA 3WZEA 2ERZE 4O86A 2W06A 3C4FA 2PYWA 2JDVA 2W1EA 4PDPA 2VTOA 3HV3A 3E8EA 4DTBA 2F7XE 3ZO1A 4RIYB 3QC9A 3HKOA 1ZOGA 2GS7A 4AFEA 3W32A 1PW2A 3FC1X 3KF7A 3HMOA 4FKWA 3RWQA 5K4JA 2XF0A 3DLZA 3DS6A 3HECA 2XKCA 4BWKA 3AC2A 3PJ2A 3QRUA 3TZMA 4CV8A 5I9YA 3REPA 4EK6A 1SM2A 4OAVB 5I9WA 4L7FA 2XKFA 3G6HA 3N4VA 2Z7LA 1BMKA 3DV3A 4AQKA 3O7LD 1ZRZA 5FLFA 3QX4A 2WEVA 4HZRA 3CQUA 5DR2A 2I6LA 5I9ZA 4AQCA 4KINA 3CR0A 4GG7A 3O96A 3HA6A 3MTFA 4O1PA 1FMOE 5AV0A 5HD4A 4UALA 2BIYA 3TL8A 3UZRA 2UVYA 3I1AA 2IVTA 4XUFA 1O9UA 1PJKA 2GCDA 3OTUA 1LP4A 3LZBA 5LJJA 1Q8UA 2AC3A 4CFUA 2QD9A 5DEWA 1WVXA 3RAIA 3BHYA 3GUBA 3R7OA 3ZTXA 1W84A 5A4QA 4BTMA 1Q41A 3NYXA 2SRCA 4I4EA 3I4BA 3HZTA 2ERKA 4HGLA 4TW9A 3WF9A 4NU1A 4BGQA 2QU5A 3EQCA 3SXSA 4UMUA 3O7LB 2VTJA 2WEIA 3K3JA 4I3ZA 4F09A 4J53A 3NDMA 5B2KA 1RJBA 1JKSA 3KY2A 1YHVA 1G3NA 3A4OX 4ARKA 3ITZA 3OMVA 4UWCA 4BI2A 3U87A 5HEZA 2GNJA 2PSQA 4YTHA 3F9NA 4RIOA 4W8DA 5LXMA 4KIKA 4C7TA 3D94A 2XJ1A 4DTAA 1PY5A 3OXIA 3IKAA 4QP7A 1YDSE 3ZMMA 4BRXA 4F1MA 5ETIA 5DT0A 3NZ0A 1CTPE 4FV7A 3WYXA 3ZLSA 4EBVA 2BFXA 4YSJA 4X2FA 4F6UA 5IQHA 4AOIA 2C4GA 2QO7A 2WMAA 3GU7A 3NAXA 4JS8A 5AR3A 1KWPA 3KVWA 3Q9WA 5IEXA 4NM3A 3DAJA 4XP0A 3FMDA 2ZV8A 1E1XA 4ZS0A 4IANA 4AGUA 4BCQA 5HGIA 4D1XA 3O5AA 2R5TA 3F66A 2UW4A 2VUWA 4GG5A 2DQ7X 3MBLA 5D12A 4ZZNA 2H6DA 3BRBA 3PP0A 2R3HA 2VO6A 3VW8A 5TF9A 3UMWA 2LGCA 2ONLA 3HEGA 3EMGA 3O0GA 4K18A 3G0FA 1OL1A 2OU7A 2YDJA 4RGJA 2UV2A 3RZBA 3ZC6A 1YOJA 3QKMA 4YLJA 3QX2A 4QP4A 4CSVA 4E6CA 4RC3A 1OB3A 4FZ7A 4I1ZA 5DEYA 4GJ3A 4XLVA 4YHFA 3KRRA 2GQGA 2A27A 4RQVA 3S3IA 2X0QA 3SC1A 4QMZA 4MXAA 2IZSA 3OCSA 4TY1A 3GQLA 3ORKA 4KBCA 5FG8A 3EZRA 1NVQA 1W83A 5JZJA 4I6HA 3ZEWA 5LWNA 1M7NA 3KULA 3NUPA 2I1MA 3DOGA 3E7VA 5H8EA 1HCLA 1IA8A 3PPKA 3CKXA 3PG1A 3RCDA 2Y0AA 4KIOA 2W1IA 4PMPA 4CFNA 2WU7A 3U6JA 1IRKA 2W96B 4ZMFA 3QWJA 3SDJA 2XANA 3FQHA 3Q53A 4E5AX 4ZTMA 2XRWA 2CGVA 3MY1A 3V6RA 4GJ2A 3UPZA 3W8LA 2OIBA 4MAOA 4WUNA 3GVUA 3TCPA 4FEWA 4OT5A 5BMMA 4V01A 3OWJA 4MHAA 4CYIA 2QURA 5EKOA 2PZIA 5KBQA 4ANNA 4RBLA 4QMWA 4ANSA 5JKGA 4S2ZA 3AC5A 2PVKA 3KXXA 4M66A 3FKNA 1ZAOA 4G34A 2IWIA 2XNGA 3B8RA 4O7NA 4FJVA 1ST4A 3NYVA 4B4LA 5LMAA 4U97A 4CCUA 5HZNA 4JG8A 2GFCA 3R21A 1UWHA 3DDQA 5CXHA 2XCHA 3JVRA 4I20A 2ITYA 5CNNA 4AZWA 4UZDA 5AP1A 4DH8A 3F2RA 2BDJA 1ZY5A 5IUIA 5F9EA 2WMRA 2H8HA 4YU2A 2JKQA 3MGYA 3QTZA 4FUYA 5LARA 4B6LA 1SVHA 3ORMA 2XALA 5EM5A 4MXZA 2WTDA 1OZ1A 3FXXA 3PTGA 4CZTA 3U55A 4YNEA 3OWKA 2KULA 2UW5A 2XH5A 3PPJA 4MNEA 2NYAA 4PDYA 3F61A 3NCZA 3KMWA 5CXZA 3UP2A 2C0TA 4TWOA 4NWMA 1ZZLA 4F9AA 5H2UA 4MWIA 3P9JA 4IAKA 4AACA 5CAOA 2ITQA 3E3BX 4FSMA 2QOCA 4HCVA 4O81A 2ITUA 5E90A 4AWIA 2ETMA 3AC4A 1U46A 4DCEA 3WE8A 5AM6A 3UNKA 3MFRA 4DHFA 2QCSA 2QNJA 2YJRA 5LVOA 3EFWA 4PNKA 4ASXA 2C3LA 4DLJA 4FBXA 3POZA 2Z8CA 3ALNA 4CLIA 2CNUA 4FKIA 4CTBA 2RG5A 5C03A 4WO5A 1ZOHA 4LRJA 2WB8A 2WOTA 4JBVA 5FP6A 3CBLA 5I9XA 2VRXA 3W0RA 2XM9A 4C2WA 4FF8A 4F9BA 1QPEA 3LJ1A 5LQFA 4BCOA 1P4FA 4QMPA 3ORXA 4OGRA 3UTOA 3QWKA 5HNGA 1JNKA 4KUJA 5BYLA 3B2WA 1PHKA 3D7TB 4Z7GA 5I4NA 4YHTA 2J0JA 3EQFA 1MRVA 3MVMA 4BB4A 2WIHA 2R9SA 4JBOA 1URWA 2J0LA 3ZEPA 3C4WA 4IWQA 4D4RA 5KMOA 3E3PA 2QI8A 2QOKA 3HX4A 4UXLA 2QC6A 5HO6A 4FIFA 4CXAA 4CFWA 4KNBA 4ZTLA 4BVUA 5HIEA 5CU3A 3QYWA 1OPLA 1OI9A 1UKIA 3CQEA 4GFGA 4I24A 3OEZA 3Q9XA 5E91A 1P4OA 4W9WA 4IX5A 5CAUA 5ANEA 4O83A 5EM7A 2PVHA 2QONA 4JJRA 5AR2A 4AAAA 4B0GA 3UQCA 2PE1A 4BCGA 5E8UA 4JIKA 4EWQA 3QCSA 4FSZA 3PJCA 2WU6A 2X4FA 2QO9A 5HVKA 5IMEA 4QP3A 5HO8A 4GMYA 4O0VA 3PY0A 5A4TA 5CT0A 4NL0A 5EM8A 2RIOA 4RX5A 3H9OA 4BCKA 5DVRA 4WOVA 5EDRA 2BCJA 3WZKA 4LUEA 4O4EA 3QFVA 4I21A 4WRGA 3V8TA 5A4LA 5L4QA 3PE2A 1W0XC 4FNZA 3RM7A 4EH4A 5CALA 1F3MC 2PK9A 5ACBC 3RJCA 1OKWA 5A14A 2ITOA 4QNAA 4PMTA 3ORZA 4OBPA 4RVKA 3LOKA 4G16A 5BQ0A 2RSVA 4KKEA 2Y9QA 5IEYA 2C6IA 2IN6A 3MA3A 5E1SA 2PUUA 4GH2A 5DH3A 3C0IA 5HORA 2EWAA 2C5YA 2ZB0A 4XRLA 2R3MA 3OC1A 3MY0A 4IAFA 4C4GA 2ZV2A 4XV2A 5AP2A 3NSZA 2JIVA 4RJ5A 4DFLA 3MH1A 3RBWA 4U3ZA 2GU8A 3C4EA 3GC0A 3UBDA 3R1QA 3UOLA 4L42A 1H0VA 3FMKA 2OFVA 1ZARA 2X81A 3F82A 1AQ1A 3R0TA 2PL0A 4UY9A 2X8EA 4LGHA 2OSCA 1U59A 4C33A 2X2KA 1XJDA 3NS9A 4XMOA 1OL7A 4UN0C 2GQRA 4PUZA 2R3NA 4YLKA 5DHJA 2ZMDA 3UVRA 4UX9A 4Q5EA 1KV1A 4EZ3A 4M14A 3BLAA 4G3DA 1O6YA 3VF8A 2GHLA 5AV4A 2PUIA 1OM1A 1P2AA 5L2QA 3W8QA 4GVAA 3LCSA 5H8BA 1EH4A 5J9YA 3G0EA 3VHKA 5CT7A 4G31A 1Y6BA 3PSCA 4FV5A 4G6LA 4XV3A 4KBKA 5FUTA 1XH7A 2OXDA 4ALUA 4OBQA 4LV7A 5HTBA 3K3IA 3R73A 3I81A 3PJ1A 4FV8A 4JXFA 2B9JA 4YZNA 4AN3A 4K6ZA 2C5XA 1H26A 4Q5HA 2QKRA 4WA9A 3UQGA 4BWXA 3EHAA 3PY3A 4BZOA 2YWVA 1WBNA 4KWPA 3C4CA 2C6TA 3BBWA 4ZZOA 5JFSA 5A54A 3BGPA 3HUCA 2Q0NA 4IVDA 2A98A 4DINA 5EM6A 2FYSA 2PZYA 4HW7A 4FKOA 1XBAA 3F3WA 2X7FA 4NCTA 1DM2A 3EL8A 3FYKX 4AE6A 1TVOA 5BVDA 1PF8A 2ITXA 4PL3A 3KN5A 5HCYA 2JIIA 1G8JA 3KEXA 3CTJA 4RC4A 2X4ZA 2FUMA 5DMZA 3QLGA 4G5PA 4TZRA 4GK2A 3QF9A 2QOIA 4XH6A 3DKCA 4QTCA 3CJFA 4O0TA 2XIXA 4ZTHA 4ZOGA 4MNFA 2BKZA 3TNHA 3NW6A 3PXRA 4OTWA 4AN2A 3LFSA 4R7HA 4EI4A 2GS2A 2ZM4A 5BVOA 2HYYA 1M2RA 4YPSA 3ZH8A 4RVLA 3EQHA 4KRCA 4BZNA 3R00A 1XHAA 5EQPA 4J97A 3VULA 3K5VA 1Z5MA 2C69A 3FEGA 3FV8A 5TE0A 4IB3A 5EHYA 3ZLYA 2RG6A 2XVDA 4QMVA 4AGDA 5K9IA 3C5IA 5C01A 3GNIB 1AGWA 3OXZA 3POOA 3RVGA 5M53A 5HIDA 2XBJA 3DXNA 3TZ7A 2B4SB 2YJSA 5CF6A 1CSNA 2QO2A 3BL9A 4EQCA 3LMIA 3GCVA 1CMKE 4GVJA 2CGWA 4AW5A 4DDIA 3AKJA 3GT8A 5HX8A 4M69A 3DK7A 4WUAA 2WQOA 2UZEA 3L9NA 3AC8A 4NM5A 2WD1A 4QTBA 3A62A 3QUPA 4IC7A 1FGKA 1WBTA 1YI4A 1H1RA 3EL7A 1L8TA 3PUFC 3VRYA 2IPXA 1PXJA 4P5ZA 4C36A 3CD3A 3DNEA 4HYHA 4U5JA 3D83A 4RG0A 2EVAA 4I5HA 2ONLC 3A8WA 5CYIA 4DEIA 4U9AA 4D2PA 2V5QA 4EL9A 3ZXTA 1XH9A 3TNIA 3VUDA 4LDTA 2PPQA 4ZTRA 1LR4A 5AR7A 4FG7A 3PG3A 4KA3A 4IVAA 3HNGA 2OO8X 5F94A 1PMNA 3AXWA 2WMSA 3OT3A 4XG7A 3CIKA 3QU0A 2W5AA 3M2WA 2VWUA 3CPBA 4J7BA 3TKUA 4EHZA 1ST0A 4ZSGA 2WMTA 3D5UA 4ID7A 4DH7A 1JVPP 2F2CB 2YIRA 3DK3A 3PXZA 4J99A 1PMEA 5M57A 2UZLA 3FI8A 3FE3A 2IG7A 4TTHB 3O71A 5JGAA 3VUTA 3A61A 3MVHA 4K9YA 3E64A 3NLBA 4ZK5A 3ZFMA 2RKUA 5L3AA 5CSHA 4O82A 4PMMA 4D2RA 2V62A 3BGZA 3H3CA 5HVYA 4NM0A 5I5ZA 4MCVA 4EJNA 3FBVA 4FEQA 3UGCA 3VBTA 4YTFA 4O7RA 4ITIA 4E4XA 3OW3A 3HV6A 4IM3A 4I22A 1G5SA 5BVNA 2OZOA 2W1ZA 1TQPA 1YHWA 3CXWA 4JG6A 4BKJA 1WBVA 3R9RA 5E8TA 2G9XA 3VONA 4E1ZA 5GZ8A 5KMNA 2Z7QA 1W2CA 2BFYA 2RL5A 3QRTA 3MH0A 4ZSJA 5FD2A 1J3HA 3VW6A 5IQIA 4IZYA 2XNPA 3C5UA 5AP3A 5K3YA 3KXMA 2E9VA 3KN6A 4RT7A 4ZJJA 1Y6AA 2X8IA 3H0YA 4HPTE 1YWNA 4BKZA 3O2MA 1NT2A 5K0KA 3WF5A 4M0ZA 3KL8A 3MH3A 4FOCA 2W4OA 4XOZA 4ZIMA 4MQ2A 4RX8A 4EOMA 4C8BA 2QKWB 5AUTA 3FMMA 5AWMA 4WG3A 4EZ7A 3C9WA 1ND4A 5DRDA 1H1SA 5FRIA 3UMXA 1JLUE 3FC2A 5EHLA 5I0BA 3NW5A 2VWZA 3E63A 4AOJA 4RFYA 1H8FA 4DN5A 3UZTA 4R3PA 4FODA 1KUTA 4FK6A 1BLXA 3BHVA 5C8MA 4ZP5A 2XYNA 4RIXB 2R2PA 4MBLA 4DEDA 5A6OA 4FC0A 4USDA 2GNHA 3C4ZA 3TZ9A 5CASA 3MWUA 3BV3A 2YFXA 2I40A 3FI2A 2J5EA 1OVEA 2WMWA 4TYJA 4C4HA 1RQQA 4YC3A 5C9CA 3AKLA 4K2RA 4P7EA 1P5EA 3QTRA 3N4TA 1JKTA 4MQ1A 3DBEA 5DPVA 5DGZA 4CYJA 2XARA 2Y4IB 4D2TA 1GZOA 3I0OA 3OFMA 1BI8A 3QC4A 4YZDA 3DTWA 4FKTA 4LV8A 2ZM3A 4GIHA 2GS6A 2HXQA 4FVQA 3ZXZA 5HBEA 3UC3A 2YIQA 4C58A 3EIDA 1ZYDA 2C6EA 2B0QA 3ML1A 3ZRLA 2FSTX 1GIIA 2JKMA 1NXKA 4I0SA 2GPHA 3QGYA 2RFSA 2W1FA 3A2CA 3OD6X 4FKRA 4FV6A 4G6NA 4AS0A 1X8BA 3WE4A 1UNLA 1ZMWA 2G1TA 2DUVA 4NJDA 1MQ4A 5C1QB 4OAUC 3R9HA 2PVJA 1Q8WA 2X39A 1J1BA 4RIWA 5GZ9A 4ANBA 4C4FA 4RFMA 4EOQA 4U8ZA 3F2NA 2XK7A 2WNTA 2BALA 4F0FA 3DDPA 2CGUA 3I5NA 2X6DA 3QHRA 4I5CA 2LAVA 2NPQA 3EN7A 1R0PA 2O65A 3G9LX 4ASDA 3IDBA 2OBJA 4L44A 2P3GX 3V5PA 1SVEA 2JDRA 4XOYA 4D1ZA 4ZY6A 3DXPA 4IB0A 3UP7A 2FSMX 3PXKA 4JQ8A 4A06A 4C4IA 4H1JA 5AAEA 4X21A 4F7NA 2OG8A 5CVGA 3IOPA 5E92A 2AC5A 2R3JA 4S31A 5A3XA 4AF3A 4AG8A 2YIYA 4QYYA 3BHUA 3DFAA 1A48A 3A99A 3NYOA 4FZ6A 2WTVA 3BX5A 4FNWA 1XMLA 3KMUA 3D15A 2G01A 3GQIA 1W8CA 5ETFA 2Y4PA 3F5XA 3I0QA 4A4XA 4C62A 2YM3A 1W82A 4EH6A 4FKVA 3PWDA 4FKUA 2GSFA 2OH4A 5GIOE 5JGBA 3GCSA 2A19B 3TM0A 2E9PA 5AJQA 4PTGA 2HENA 3LCTA 2C0IA 4FTKA 1HCKA 4XYFA 4FZDB 3DT1A 5LVLA 4OTFA 2ZDUA 3VQHA 3ERKA 4FKSA 4JR3A 1FMKA 1KV2A 4YSMA 4EKLA 5BVKA 5HLNA 3QQKA 4FTMA 4RJ7A 1V0BA 2HK5A 3SXFA 2C3KA 5BYZA 5HE1A 4OTRA 5HBHA 5K5XA 3ALOA 4TYGA 4ENXA 3OWLA 3PUPA 2WKMA 2E9NA 2WMQA 3KRWA 4EEVA 4IZAA 2QLUA 2EB3A 4O0YA 4KB8A 4JOAA 4I5MA 2OK1A 4BYIA 4Z9LA 2QOFA 4HYUA 4ZY5A 1YQJA 5K0XA 3NMUF 2C30A 4C0TA 1U5QA 2BVAA 2J6MA 4FV2A 4YJSA 3LAUA 1ZYCA 4PPAA 4D55A 2WELA 4MXYA 4R8QA 2PTKA 4BHZA 4BCPA 1W2FA 2EXMA 5CF4A 3R04A 1NVRA 1UA2A 4AW1A 3PDTA 3COMA 3IPHA 4I6BA 4RZVA 4HPUE 4NK9A 1DI9A 1XO2B 2VWVA 4FV3A 5J95A 4FTOA 4XG8A 3PZHA 3BLHA 2XIZA 4P4CA 4ZXTA 4DT9A 4RZWA 4GK4A 2W1DA 5CQUA 4L3PA 2WPAA 1FBNA 1SVGA 2VTPA 4U43A 3TV7A 2G2IA 4BL1A 3OVVA 5AP5A 3BELA 3ORPA 3VWAA 3MFSA 3DGKA 3GOKA 1SZMA 4J71A 3SHEA 3MESA 5GINE 1W7HA 3GFEA 4XHKB 5ETCA 3UIUA 2HAKA 3F5UA 3CS9A 4E8AA 1DAWA 4F70A 3B8QA 3I79A 3PSBA 2FVDA 3QTIA 3QAME 3QD3A 4F99A 5L8LA 3K5UA 2WFYA 2YDIA 4FIGA 3HMNA 2OIQA 3FKOA 3NVKI 4ZTSA 3FMEA 4M12A 4EUUA 3A7IA 3MY5A 1WVYA 5IA3A 2XIRA 5IUHA 3LPBA 4AA5A 4E6AA 2XNNA 4EQMA 3VUGA 3WARA 1VLRA 4BBMA 4J96A 3H9FA 3MB7A 3GCPA 5HVJA 4O91A 4ZLYA 4CZYB 3UDZA 4IM2A 3AGMA 1T46A 4NCTC 5EYDA 2PVLA 3U4UA 2YABA 2IW9A 5KZ0A 3BYOA 4FSRA 2XCKA 3R8UA 4B99A 2UZWE 2G15A 1KE8A 2PHKA 4AGWA 3ORIA 4R5SA 1H01A 3TIZA 3R8MA 5L2TA 3QYZA 4I5PA 1B6CB 4FTIA 4AP7A 1UNHA 3PJ3A 3ZO3A 4FTTA 3OHTA 5JQ8A 5JSMA 3TEIA 1OGUA 2E9OA 2C3IB 4O0WA 4CFXA 3L8PA 2HOGA 5HESA 3ZRKA 2UW6A 2B53A 3OP5A 1KE5A 4F7LA 2IJMA 3EQIA 3UIXA 3ET7A 1KSWA 5CZHA 5HI2A 4FEXA 3NUSA 4C4EA 3QUEA 4WSYA 2O63A 1Q8YA 3ZSIA 5KE0A 4O96A 3MFTA 4QYEA 2WGJA 4JNWA 1I09A 5EDQA 2Y6OA 4Y5HA 5I9VA 5CF8A 5LCJA 3BYUA 3EQGA 4DA5A 5IUGA 3HDMA 3E5AA 5B7VA 1FVRA 4USFA 3ODYX 5KUPA 5KKRC 4GT3A 1KOAA 1DI8A 1GZKA 3DBQA 2BR1A 4ITJA 1YOLA 4L43A 2V7AA 2R3IA 3IGOA 4QMXA 2PE0A 3A7GA 3KXHA 3DKFA 4ANOA 5H8GA 1OL5A 4M67A 4PQNA 2YLFA 4A9TA 4HVHA 2ZMCA 5LMBA 3LQ3A 4W4YA 2YITA 1OKVA 2OH0E 4MWHA 4LL5A 3KK9A 2QG5A 3CY3A 3IK3A 4TYHB 5ANIA 2FB8A 3ACJA 3BCEA 2GFSA 5H3QA 2WMUA 4EHVA 5CVFA 5GZAA 5DNRA 1I44A 4GL9A 1ERKA 4L52A 4KS8A 4RWIA 3UNZA 4GKHA 3DJ5A 3KVXA 3RK5A 3ID6C 2A1AB 5HE2A 4UXQA 5GJFA 3PXYA 2R3LA 4QEBA 4WBBB 3VQUA 2PE2A 2GHGA 4MD8E 3GI3A 4LGDA 5KZIA 5CF5A 3PLAE 2XKDA 3BKBA 3KGAA 1UVRA 3QRIA 4TNBA 3FL4A 4U7ZA 1BL7A 5HTIA 2B9IA 4L8MA 3F2AA 4X2KA 1PXIA 4RJ8A 2BHEA 4LMNA 4RWJA 1Q62A 2BZKB 4RC2A 3W0SA 3V04A 4FKPA 2BZIB 2VGPA 2ZV7A 4IAIA 4QYFA 4TYEA 2XM8A 5AX9A 5A6NA 4GKIA 3HDNA 2PMIA 1YXTA 1NVSA 4R77A 4BTKA 4EH7A 3FLWA 5KCVA 4DH3A 4AW2A 4YJNA 3M11A 4E93A 2F4JA 2B9FA 3VS0A 5HLWA 2F57A 3NUYA 2CCHA 4J98A 2NRUA 4IWOA 5HCZA 5LVNA 3S1HA 3NUNA 3QA0A 4JQ7A 2XYUA 5G1XA 5JRQA 2XEYA 4FNYA 3LXLA 4W9XA 2BRGA 4B7TA 4YJOA 5AP4A 2IVVA 3R7VA 3TUDA 4G3GA 5AIRA 4QNYA 1CKIA 3AQVA 3NIZA 4BCIA 4JBPA 2BZHB 3PSDA 4FL2A 3D7TA 1KE7A 4M7IA 4IB5A 3U9NA 2X7GA 4L7SA 3QRJA 3ATTA 5EYCA 3NRMA 3D0EA 4OR5A 3RNIA 1H00A 4OTGA 4R7IA 1R1WA 4YZMA 1SMHA 3U6IA 2JD5A 4FTRA 5CAQA 3LM0A 1OUYA 4ERKA 4X3FB 3AGLA 4F64A 4E6QA 4PMSA 4AA0A 2VWIA 4I4FA 3ORLA 4JDHA 4NTSA 3ZSHA 5CS6A 4BTJA 4MF0A 1BX6A 4UZHA 5IA2A 5K4IA 3BL7A 3BE9A 4IWDA 3I7CA 3UYTA 1UV5A 4PTCA 3FWQA 4JLCA 1M14A 5CWZA 2XZSA 4FEUA 3JXWA 2XK9A 4UWBA 2XIKA 2XKEA 2PVFA 3DA6A 3KK8A 5HBJA 3JUHA 4NEUA 4OBOA 4TT7A 4MEDA 5BVWA 5I3OA 4R1VA 2FA2A 3TTJA 5HKMA 4YBKA 3DKGA 1KE9A 4GSBA 4KKHA 3Q6UA 4XLIA 3SD0A 4PPBA 4ACGA 3QTUA 4EOJA 3QZFA 1YI3A 3VBWA 3DQWA 3Q04A 3NFFB 4FE2A 3KXGA 2CNQA 3ZZWA 3COKA 2Y6MA 3FQEA 1GOLA 4IAAA 3W33A 3W18A 3TDVA 4IHPA 2W4JA 4RWLA 4U41A 1V0OA 1OKYA 4G3EA 4PP7A 2XNMA 4BDDA 5CENA 3C51A 4DH5A 4DFXE 4D4SA 2OXYA 4O7VA 4A9UA 2Z7RA 3U6HA 1YVJA 4Y46A 5FWKK 4P2KA 1TZDA 4IZ7A 3DAEA 5T68A 4EORA 5JN2A 3WF8A 4DBXA 4U3YA 2O5KA 2R7IA 3FZTA 2UW7A 3QZHA 5DA3A 5EOLA 2ZAZA 3WF6A 4CV9A 4DITA 3VS2A 3V5TA 4CVAA 2R3QA 3RKBA 3BQRA 3FMHA 3RAHA 3HYHA 1VYWA 2ZFYA 4PF4A 4I23A 4MK0A 4FTUA 4YJPA 5M4CA 2HY81 2QOBA 3FDNA 3R9NA 2O64A 2X2MA 4NIFB 4TWNA 4G9CA 3R8PA 2QHMA 4BDHA 3BE2A 5CEMA 4A9SA 1J7IA 2R64A 4A9YA 2CN5A 3R30A 2YCQA 4FIJA 4PRJA 4ASZA 1UU3A 4U42A 3EYGA 2R3OA 5I3RA 3BU3A 2C1AA 3DZOA 3A4PA 3WZUA 4D4VA 5L2WA 2W0JA 3E62A 3JS2A 4GK3A 2CCIA 2B7AA 5M56A 5M06A 4CRLA 4NTTA 2OWBA 3LCOA 1JSTA 3BYSA 4C61A 5CU4A 4CFMA 2OJJA 2V55A 4X3JA 3FZPA 4DEEA 3DBFA 3U54A 1DS5A 2C5VA 4DGOA 4PY1A 3S0OA 3DFCB 4MXCA 5AA8A 3IG7A 2IZTA 1ATPE 5AADA 4AXFA 2X0PA 1WBPA 2W1GA 3EFKA 3AMYA 2NP8A 2C68A 3BEAA 2C6DA 3GC7A 2J0KA 5TKDA 4DT8A 5EW8A 1M17A 1GNGA 2I0YA 3EWHA 3GXLA 3NFGB 4EC9A 5G6VA 4IZ5A 4V05A 4GW8A 2C5NA 4XEYA 2WAJA 2FH9A 5DR9A 4IVBA 4XJ0A 3ZC5A 1WFCA 4OTPA 3WIKA 4GT4A 2J2IB 4WNMA 5DLSA 1JOWB 4DLIA 5FTOA 3DU8A 1JWHA 3WZJA 4RRVA 3P0MA 1PYEA 2XS0A 5BUJA 4CZUA 5L8KA 1Y91A 3LFBA 2REIA 2UZBA 5ACKA 4GFMA 3LM5A 3TACA 2GNLA 2RGPA 2BHHA 2VV9A 3W2QA 1Q8ZA 4NW6A 2I7QA 4UB7A 3W16A 3RK7A 3EH9A 4JDKA 3UO4A 4BZDA 1BL6A 4FYOA 4YHJA 5GHVA 1P14A 3EQDA 3CP9A