3BV3A

Morpholino pyrrolotriazine p38 alpha map kinase inhibitor compound 2
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
338
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Synthesis and SAR of new pyrrolo[2,1-f][1,2,4]triazines as potent p38 alpha MAP kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 338
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bv3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bv3A01
4C33A 2Z8CA 1BL6A 2JD5A 3TDVA 4FKUA 3O51A 4F08A 3BIZA 4TYJA 1RW8A 4CEGA 2Z02A 2EXMA 2HYYA 2HWOA 2I1MA 3SXSA 5IZFA 5LVPA 3WF6A 4GIHA 5J1WA 5IA3A 3QYZA 4PTGA 1WBPA 4G31A 4IMYA 3FL4A 3ORNA 4WBBB 4IXPA 1U46A 5IEVA 1FMKA 3GNIB 5HG9A 3BCEA 5BNJA 2KTYA 5IPJA 3ATSA 3R0TA 4WG5A 2IWIA 2WMTA 4FT7A 3R9OA 5BVDA 3UZRA 1PXLA 2Y8OA 3BYUA 3OF0A 4D0WA 4Z7HA 5A4QA 4JT3A 2IVTA 4PP9A 3C13A 2V7OA 3H0ZA 3ZO1A 2C3IB 2VD5A 4MWIA 5AA8A 2R3PA 5AV4A 4ZJIA 3QTRA 1H4LA 3ZLSA 4LUEA 3F3UA 4AFJA 3AMYA 5GINE 5L8LA 4FV2A 2YLFA 3FXWA 4R6VA 4N70A 5EW8A 4RFYA 5HX8A 5IUGA 4IADA 4S2ZA 3OZ6A 3P78A 1YI4A 4IAYA 4L46A 3EN4A 4FF8A 1ZYCA 4IAFA 3W2QA 1M2QA 1YXVA 2B9JA 4PMTA 3HZTA 2FSTX 4L52A 4A4XA 2BR1A 4MF1A 2B55A 3HMMA 4O7WA 3RK5A 4CT2A 4GFGA 3GU7A 4H1MA 4JDJA 4MXAA 5AV3A 5LARA 4NKSA 3QRTA 5EG3A 3K3IA 2QONA 5AP2A 3RTPA 4MD8E 3EHAA 1V1KA 4W8DA 1IG1A 3WF7A 1GY3A 2YA9A 1KUTA 5AWMA 4AG8A 1WVYA 3RK9A 1WZYA 4S34A 3BQRA 4IANA 4E4NA 3PP1A 3NW6A 3PYYA 4MBJA 5LXMA 4IAIA 2YERA 4QQ5A 4BTKA 4ACMA 4IDVA 3EOCA 4LRJA 2RF9A 4MBLA 4Z3VA 3ORPA 2YIRA 4C35A 2UVZA 3E3BX 3VNTA 5KCVA 5K0KA 4GKHA 2ZAZA 4C02A 4O7ZA 3OXZA 4FV5A 3AGLA 1SNXA 4FKGA 5L6PA 4FIHA 5AUXA 3ITZA 4FIGA 4OAVB 5B2KA 2ZYBA 3ET7A 2E9PA 3VUHA 3R02A 3ENMA 1WBVA 1X8BA 4TWCA 4CRSA 5KMIA 5L2TA 4GYGA 1J1BA 2JDOA 2BHHA 3VUIA 5AP7A 3CLYA 4N6ZA 1M14A 3FLZA 3SOCA 4HVSA 3RPYA 4M66A 4J71A 3UMWA 3DB8A 2XBJA 4PQNA 4YJUA 5H8BA 3OP5A 1KSWA 3DK7A 4Q2AA 3LIJA 4ZY6A 4PDYA 3LXNA 1Q24A 5DBXA 4E8AA 5HCZA 3P9JA 4FG9A 4JRVA 2WMBA 5DWRA 4XV9A 4Y95A 3QX2A 4YR8A 3GCPA 1QMZA 2YAAA 2Y9QA 3DBQA 3OG7A 3PA5A 5F95A 4WNKA 4CXAA 2UZEA 5A4TA 5M53A 4X2KA 3W18A 4Y5HA 3WBLA 5FTQA 3BE9A 2WEVA 1H01A 4EH2A 5CEOA 4OBQA 3L9MA 3EZVA 4MXOA 3W33A 4USFA 3LHJA 3TUDA 2UW5A 3RHXA 2X4FA 3HRBA 4EOIA 5K5NA 4YJNA 3QA0A 4LRKA 1W82A 4DG3E 3OS3A 4FVPA 5A9UA 4F1OA 2C6MA 3NIEA 2QCSA 3BE2A 4O81A 3T3UA 3KXHA 1NXKA 1QPEA 4EOOA 5IQDA 1VZOA 4BCJA 2QLUA 3W10A 4DLIA 4MXYA 2I0HA 3QYWA 4WSYA 1DS5A 2X7GA 5EYMA 3HUCA 2BCJA 3LFSA 3Q60A 3RNIA 4AOJA 2CNVA 2BTRA 1R0PA 4CG8A 2HXQA 4UYNA 5EW9A 5AR2A 2EB3A 3MH3A 4QYFA 4IC8A 3UQFA 4OTRA 4FBXA 4Z7GA 4XEYA 4YHJA 5CQWA 3ZC6A 2ZB0A 3NCZA 4XG6A 3ZFYA 4U81A 3EFJA 5C9CA 2I6LA 3C4ZA 3NNUA 3KXMA 3RWPA 2BILB 2YJSA 3HDNA 3R2YA 4FTAA 3D5XA 3HL7A 4NUSA 4C2WA 3OVVA 4AW0A 4DFYA 4X7QA 5AMNA 5GZ8A 4X0MA 3MGYA 2YCSA 4IDTA 4KSQA 3R8VA 5HORA 3DTWA 2PZPA 1NW1A 2WKMA 1KE9A 4FV7A 4JQEA 3VQUA 3R2BA 4I6FA 3C50A 4O2ZA 4UY9A 4ZSEA 1KE5A 1EH4A 4YZBA 3V8WA 5H2UA 3WOWA 5A6OA 5F9EA 4IIRA 1IA8A 3AQVA 4EH4A 2QR8A 3QWKA 4ENXA 4YMJA 2XM9A 4MNEA 2OFVA 2WMWA 4OLIA 3R73A 5JFWA 3LCOA 4JBVA 3WIGA 4GT5A 1PXPA 4QMSA 5CQUA 4U3ZA 2J0KA 4YLKA 3C5IA 4QMUA 5EI6A 3DJ5A 2E9UA 3HRFA 3PJ3A 3WZKA 4CMTA 3PXFA 2JKOA 4PMSA 2XIKA 3H9FA 3K5VA 4OR5A 4RIWA 4EBWA 5C03A 3FEGA 2C47A 3MFRA 5JZNA 4BCMA 4OBPA 1GOLA 2VWVA 5CF4A 1QPCA 4B4LA 4JG7A 3UJGA 5AP4A 5IF1A 5F94A 5E8YA 2XKFA 3FZOA 3TV7A 4ZJVA 1JOWB 5DRDA 3R9DA 1PMVA 4M12A 4D1ZA 3LJ2A 5HVJA 4EOMA 4UZHA 4C38A 2YM6A 4O0RA 4RX9A 3PZEA 4X2NA 2XNNA 4ITJA 3VUKA 2ZVAA 4EOJA 1LUFA 5AEPA 4BRXA 4QQJA 1BYGA 1PXKA 2RKUA 3FMEA 3DA6A 2J50A 3OY1A 2PE0A 4DG2E 3LOKA 1OMWA 4HPTE 4HCTA 2YN8A 3V6SA 5J8IA 5FXRA 2BPMA 2RFDA 1OL2A 2ITVA 1S9JA 3BU6A 1BX6A 5HNGA 4M69A 1H24A 3MA6A 5A4CA 3RJCA 5IA2A 2ITNA 4M15A 4DEAA 4NEUA 4EOPA 3FHIA 4DT9A 4ANLA 4BWKA 5CAQA 5EI2A 3NWWA 5EFQA 3BWJA 1UWHA 3MH1A 4EK6A 3MYGA 4G5JA 1KV1A 4PDPA 3FYJX 1U5RA 4O83A 2V22A 2HZ4A 2Y0AA 4EH7A 3CY3A 5HKMA 3S2PA 4PV0A 3VBYA 2JIVA 3NGAA 3P7BA 4NJDA 3U6IA 2NRUA 4QTBA 3ZRMA 2F4JA 3EQFA 1O6KA 1DAYA 3COHA 3E88A 3SQQA 3ULZA 2R64A 4YLLA 3R83A 3MVJA 3FQSA 3FLQA 4EHEA 4U9AA 2CLQA 2YFXA 4QP7A 2FO0A 1PKGA 4FG7A 3DQWA 1ZRZA 1SYKA 2EU9A 3LM0A 2OICA 4QTDA 2FYSA 4USDA 2VZ6A 2B9IA 1BMKA 5G6VA 5DHJA 1P4OA 3VUMA 4C59A 4E5BA 4RWIA 4WRSA 2PE2A 2DQ7X 3FLYA 3CBLA 1U54A 1URWA 2YM5A 4RIYB 4QYYA 4F0FA 3LQ8A 5B7VA 4DEGA 5ITAA 5BMMA 3W2SA 3R04A 4IHPA 2OH0E 2OZAA 2VTJA 5GJDA 3W2OA 3FLSA 3TG1A 4C8BA 1JSTA 2YM3A 3CP9A 2W9ZB 4ZSLA 3MSSA 5HU9A 3EJ1A 4Y5QA 5GJGA 1W83A 3KXZA 3QRUA 4IAAA 4DF3A 2HCKA 4F99A 1M2PA 3PG1A 4R1VA 5TT7A 5BVEA 2GQSA 2GNFA 3TKHA 3H10A 4TT7A 1OM1A 2HZIA 2XKCA 3PJ2A 2FA2A 3GB2A 4LGDA 4HVHA 5I0BA 2RFNA 1Z9XA 3CIKA 4DH3A 1YOLA 2QR7A 4L00A 5DVRA 5HG7A 3KK8A 4IM2A 5JMSA 4BCGA 2UVYA 3BYVA 2OU7A 3R22A 5A14A 2XYNA 4D4SA 3KY2A 5FUTA 3E62A 5HHWA 3VW8A 4L43A 1FGKA 1WAKA 1OL7A 2ITUA 2VTNA 4FSRA 4KIQA 4EH3A 3A4PA 4YGAA 2QI8A 4C0TA 3DY7A 2XF0A 4H1JA 3NNWA 2UZTA 1YDSE 3KULA 2QC6A 3U4WA 4MH7A 1CKJA 1FOTA 3VS4A 5EKNA 4EH6A 3FPQA 2OJ9A 2F49A 4BWXA 3C51A 4S33A 5M44A 4BGHA 3R8LA 2WU7A 2J2IB 2YLEA 2HELA 3ANRA 3EL7A 4GU9A 3UC3A 4BTFA 2IVVA 3AC1A 3D2IA 3FE3A 3P79A 4JDHA 4EK4A 1SVHA 4GK2A 2FSOX 2YZAA 4IJPA 3T8OA 2RL5A 5ANJA 5FDXA 3S3IA 5BX0A 4HCVA 3TJDA 2ZDUA 1WBOA 1A06A 2C3KA 3DV3A 3F3VA 3LLTA 3QUPA 5L6OA 3CEKA 2Z2WA 3FV8A 3EQDA 4ARKA 4YZMA 2R3IA 2GMXA 3L8PA 1W0XC 2VGOA 3C9WA 2V7AA 2PUNA 2C6LA 2R3RA 4MVFA 1FPUA 5HU3A 4EH5A 4RJ7A 2XK3A 4J95A 1IR3A 4BI2A 2J7TA 4NIFB 5ETFA 4F9CA 3PE2A 4C62A 5ANKA 2VX0A 5DR6A 4AP7A 5DA3A 3KEXA 3TEIA 4G34A 1RE8A 4ASEA 5M06A 3PJ8A 2C1BA 2QO9A 4IZAA 4E1ZA 4RWLA 2JFMA 3ETAA 5IISA 3DKOA 2GTNA 2YM7A 4N4SA 3VVHA 3R1NA 4QMOA 4R1YA 3AD5A 2YIXA 3L1SA 5D7AA 4ACDA 4D55A 3TDWA 2CCHA 3VS0A 4MYGA 3E8EA 2HAKA 1WBSA 4FEXA 5FP5A 2UW0A 4RIOA 2X81A 3VF9A 4FK3A 4P4CA 5LVMA 5ETAA 3BV3A 5KMKA 4QNAA 4PTCA 4F7JA 3MY0A 4GW8A 3HA8A 3SW4A 2BZJA 4FTOA 2AYPA 4BBMA 4ZTQA 4ZSJA 1M52A 3LKMA 1WBWA 5KE0A 3A60A 1UU9A 4BDGA 3HP2A 3NR9A 5DI1A 2ZOQA 2H96A 5M08A 1BI7A 2ITWA 3FXZA 5C4KA 3VBWA 3O0GA 2VTHA 3OWLA 3KMUA 4EJNA 4IEBA 5IA0A 3FDNA 1JKSA 1YDTE 4FKSA 4FV0A 5H8GA 5DYJA 2QG7A 3QCQA 4CZYB 5K4IA 2C68A 1ZOGA 1OPKA 3F5UA 3AGMA 3IW5A 3ZBFA 4A9TA 3UO6A 5CVGA 3PXQA 2JIIA 2E9VA 2OXDA 3FMJA 4BZNA 1YWRA 1I09A 2PK9A 3PPKA 1R3CA 3D4QA 3EN9A 4KNBA 4XG2A 4IH8A 3KCFA 4MF0A 3UOLA 3ZDIA 3ZMMA 5IQAA 1APME 3ZTXA 2CGVA 3AXWA 3FL5A 2J90A 4KS8A 4J53A 3B8QA 4IWDA 4DGGA 4M0YA 1H0VA 5TE0A 4AFEA 4XP2A 2VTRA 4NH1A 1H27A 3OW3A 3Q6WA 4F7NA 2CNQA 4LRMA 3QUEA 3QCYA 1ZOEA 4L3PA 4XLIA 3H9RA 4I92A 4TTHB 3U8WA 4YP8A 4Z55A 3TCPA 3QF9A 3RZBA 4C37A 3FLWA 5JFSA 4FTUA 5J5SA 3GFEA 2IVSA 1YXXA 3GUBA 3BLQA 3ZO4A 2ZJWA 3FMNA 4QMWA 4FNXA 4BDBA 2BDWA 2OIBA 2YACA 5CS6A 3QD0A 4F9YA 5BVNA 2JITA 4FEVA 4RG0A 4CFXA 1PXIA 4IE9A 5DR2A 4OTFA 2WIPA 3A7HA 4ANQA 5CEKA 3FJQE 5EQPA 5IQEA 3UVQA 4U45A 4M8TA 1KV2A 3L9PA 4UXLA 4X2JA 1MUOA 5ANDA 4QP2A 2C6KA 2WMVA 4JRNA 1ZZ2A 3R71A 5E90A 3LCTA 4IB3A 2X7FA 2YIYA 1UU8A 4I6HA 5K5XA 3TNIA 4K0YA 3HAMA 5M4CA 4HYSA 2R3OA 2Z7QA 3IDBA 3G6HA 3H4JA 4MXCA 3R9HA 4F6WA 4ENYA 5K4JA 2A1AB 5KHXA 4EC8A 5C27A 1K9AA 2GU8A 4EUUA 2GCDA 4ASZA 4FKQA 4JJRA 3FI4A 5CSPA 3JUHA 3VS3A 5FDPA 4FGRA 3NRMA 5L3AA 2BDJA 3KN6A 3NUYA 2O3PA 2FSLX 4FTJA 4PP7A 2W1EA 3QL8A 1XBCA 4QPAA 4B99A 3GVUA 2A2AA 3IW8A 2PVHA 5FWKK 3E64A 5I9ZA 3E8DA 4BDJA 4UMTA 4BC6A 2C1AA 3GP0A 4PRJA 1Q3WA 3LFFA 4D1SA 3TN8A 4FYNA 4O21A 2YJRA 1OL1A 1PXJA 3ATTA 2R3MA 3NYOA 3PY0A 5EH0A 5JGAA 2GQGA 3ZM9A 2C69A 4DFNA 4FTCA 5I9YA 4GJ3A 4GFMA 5H3QA 3RVGA 4EUTA 3LQ3A 4TWOA 4IBMA 4JIAA 4E6QA 2ZV7A 3QU0A 4LOQA 3P0MA 4ZTRA 3QQGA 1OKZA 4EK3A 2UW9A 4O7NA 4YTCA 4Y46A 2JDVA 2PZ5A 2G01A 3O17A 5C4LA 2ZV8A 3ZZWA 5DT0A 3TZ8A 3ZEPA 2BUJA 2WIHA 2XIZA 5HLWA 3R01A 4FKIA 2Q0BA 3HX4A 4AAAA 3A7IA 3BBTB 5AR4A 4C36A 1P2AA 1Q8TA 2XRWA 4UX9A 1JSVA 5BYLA 3ODYX 3ZOSA 4AXAA 4R78A 2BRBA 2VX1A 4B8LA 5ACBC 4D0XA 4J52A 4PUZA 5CI6A 5DFPA 5HLNA 1F0QA 3WE4A 3S1HA 3SRVB 2QOBA 4FT0A 3OOGA 4FSQA 4E26A 4A06A 4ONAA 2PZIA 3CE3A 3G9NA 3GU8A 2HOGA 2OH4A 2ETMA 4X3FB 3O96A 2VV9A 1NVRA 3R63A 4ZS0A 4ASXA 1SVGA 2J6MA 3Q4ZA 4XBRA 3H0YA 4FKTA 1J91A 2VTLA 5AJQA 3CJGA 5AR5A 5BVKA 1FMOE 4AZWA 2UZNA 5TKDA 5GZAA 3CQWA 4IB0A 5FBNC 4BKJA 4XP3A 3HLLA 3RINA 4FNWA 1ZZLA 3OWPA 4I6QA 3A8XA 3E3PA 1VYWA 4JIKA 4XRJA 3RM6A 4XMOA 1ZAOA 3TV6A 5IU2A 2EXCX 4ACGA 1WFCA 4YZDA 4II5A 3ALOA 4IFCA 5DN3A 2REIA 3QCXA 1Y8GA 1PYXA 1U5QA 4RZVA 4G5PA 2GHMA 3DCVA 4KIOA 5CASA 5LCJA 3C5UA 2OJFE 4EZ7A 2XNEA 2VO7A 2R4BA 2YITA 3NAXA 4X3FC 2QLQA 2O8YA 2XK4A 3GC7A 4D1XA 1ND4A 4BCFA 1U4DA 4TWPA 4CFUA 2C4GA 3Q52A 3QFVA 4OAUC 3FZRA 1OL5A 1FVRA 4I94A 5LWMA 3EWHA 2PUPA 2E2BA 4OUCA 3UZPA 1ZYDA 5JT2A 2WMUA 5EKOA 3UNKA 1R1WA 2YHVA 5HQ0A 4TZRA 3AC8A 2PHKA 4I1ZA 2B1PA 5AAGA 3CKWA 3VIDA 3OFMA 4LQMA 3FY0A 3QQJA 4K18A 4WUAA 1R78A 5D7VA 4KWPA 4IZ7A 2IJMA 3TNHA 5HE3A 4EHVA 2RFEA 4YC6A 3MPMA 3I5NA 4MEDA 5EI8A 1VJYA 2XKEA 3NEWA 4LMUA 1XH6A 4Z9LA 5EW3A 3ZU7A 2ITTA 5M55A 3F6XA 3UG1A 1OUKA 3TL8A 3PVBA 2VTTA 2XJ1A 4QMMA 5DRBA 3PSDA 3HMPA 4K11A 3WYYA 4AT3A 4CMOA 5EHYA 4F4PA 2HZNA 2OW3A 4D2SA 4ZZMA 4DYMA 4M68A 3RPVA 2X6DA 4IZYA 5AUZA 3CR0A 4IWOA 3QRIA 4TYIA 3SLSA 4ANBA 4Z16A 2JDTA 2QOKA 4FV9A 4FKWA 5HO7A 3EH9A 2YABA 2A0CX 3MJ1A 2PWLA 5L2IA 3E7VA 3IKAA 5J7BA 2C5OA 4ANMA 4FT9A 4BICA 4ANNA 3MBLA 4CZUA 3H30A 1JQHA 4BCOA 4MXXA 5DMZA 2I0YA 2UUEA 1GZ8A 4PPBA 3N4TA 4W9XA 4FKVA 4BCKA 3OBJA 3FMMA 4FSUA 3V6RA 1G3NA 1GZKA 5DT3A 5BUIA 5BUJA 2CGWA 2QHNA 4XOZA 3ZLYA 1Q97A 3I0OA 4WBOA 2V55A 3BPRA 3CQUA 4RJ8A 2DS1A 3MTFA 2P0CA 3ROYA 3RMFA 4EHZA 4G9RA 4WT6A 3UO4A 4BF2A 2B54A 3DKCA 4E6CA 4O7LA 3HKOA 2VAGA 2BFXA 1H08A 3TWJA 3Q32A 5ANOA 4GFOA 4EWQA 1STCE 5T3QA 5EYDA 5HI2A 3EQPA 4P7EA 1LEWA 1I44A 5JEBA 2ZMCA 4RC4A 3FZTA 3PJCA 3WZEA 3BI6A 4FK6A 4DFXE 4R3RA 3F3WA 5IQIA 3G0FA 4CSVA 4YC3A 3FZSA 1XH5A 4R5YA 5LWNA 2GS6A 3D7ZA 5M07A 4XHKB 4ERWA 2A19B 3P7CA 3SW7A 3HAVA 2WTCA 5BUEA 4FX3A 3LXPA 3NPCA 3CGFA 3GC9A 4AF3A 1PJKA 1JKKA 3MWUA 4IVDA 5KX8A 5EYKA 3PVGA 4YTFA 4DGMA 1ZLTA 3QUDA 2HIWA 4FZ6A 5GZ9A 4AE9A 2X4ZA 4APCA 1NVQA 4HNFA 3DZQA 2VGPA 4AW1A 1PW2A 1UA2A 2OZOA 4TWNA 4QP8A 3ZC5A 3ZUUA 4HGLA 5GJFA 4BWPA 1Q8WA 4RIYA 3ZUTA 3FMDA 3E5AA 3K54A 3LFNA 4YC8A 3F3TA 4IAZA 4C4GA 4W4VA 2Z7SA 4I20A 3VS7A 2NNWB 1GZNA 4XBUA 3DS6A 3BEGA 4FL2A 3L9NA 5FXSA 2J51A 3DJ7A 4ZLOA 4TRLA 4V01A 3QZIA 2YM8A 3PIYA 4F65A 1NVSA 4W8EA 3F3ZA 3MDYA 4UWCA 4W9WA 3VS2A 1UWJA 5T68A 4C4FA 4G16A 2YCQA 3NX8A 5LMAA 2PVJA 4F9WA 5JKGA 4NU1A 1PYEA 1MP8A 1GAGA 1OITA 2QVSE 3HA6A 4ZTHA 3LMGA 4NM3A 3C1XA 2CGXA 4BCNA 5LVOA 2F2UA 3BWFA 5CAOA 3U6JA 2ONLA 5LMKC 1PF8A 1H1WA 2P4IA 1KE6A 4R7IA 3V5PA 2AC5A 3A2CA 4K1BA 4RWKA 4ZY4A 4KABA 3LFBA 3Q9ZA 4DEDA 5CU0A 4OW8A 3LLAA 3C4EA 4M97A 2VTMA 3SV0A 2XIYA 3FI2A 2EWAA 4CNHA 3QCSA 2JKKA 4NM7A 2OJJA 1Y8YA 3OCSA 1YWVA 2H6DA 3EQCA 3KRWA 3O50A 2YISA 5HX6A 1XQZA 5GIPE 3MY5A 4O1OA 1E9HA 2QOHA 4NK9A 4D2VA 5AIKA 3OT8A 1IAHA 3MH0A 2RSVA 4RX8A 5D10A 2NO3A 5IQHA 4EI4A 2RG6A 4FNZA 5K0XA 5IG1A 1H1QA 1OIYA 3UOJA 4YZCA 2C0OA 4FIEA 4QP3A 4KINA 5IUIA 3POOA 4PWNA 4A9UA 2ETRA 2XIXA 4U79A 4WOVA 3SKCA 3UOKA 5JQ5A 5I5ZA 2BRNA 4FV8A 3RGFA 2X1NA 4R3PA 5KUPA 3OTVA 2JGZA 4R5SA 4DGNA 3VHKA 2J0LA 1YVJA 3LE6A 5M4UA 2EVAA 3FC1X 4FE2A 4D2WA 3SG9A 3TXOA 2BROA 4ITHA 2BIYA 3DKFA 4IB1A 4RVKA 5C8MA 2OBJA 2OKRA 5LCKA 2R5TA 4AGWA 5E8XA 5HTIA 1K3AA 4D9UA 2PYWA 5CTPA 4O84A 5IH5A 3HGKA 4BGQA 3AC4A 3OD6X 4FKPA 3UNJA 2XBAA 4U3YA 1JSUA 4GG7A 3LQ5A 4IWPA 5FQDC 3R30A 3PDTA 2B9HA 2BAQA 3NYXA 4X2FA 3ZCLA 2JBPA 3AOXA 4Y73A 4HVDA 1UU3A 4H3QA 3DAJA 3HV4A 3Q2MA 1H28A 2JIUA 1JKLA 3BELA 1Q3DA 4AE6A 1BKXA 4EBVA 3LMHA 4PX6A 1YHWA 2WHBA 4FTIA 4QPSA 3ACJA 5KNJA 1RJBA 5E92A 3DZOA 4NTSA 4RC2A 3QLFA 5DGZA 3TNPC 1ERKA 3PPZA 1ZYSA 2XM8A 5HLPA 1W7HA 2JDSA 2X2KA 4M0ZA 2CKEA 2VNWA 2JLDA 1CMKE 3QQLA 5AP1A 4BHNA 4IVCA 2VX3A 4YU2A 4UMRA 3KU2A 2IZTA 4LOOA 3DLZA 3QC9A 5KMOA 4DEEA 4FZAB 2J5EA 3GI3A 3TT0A 3QHWA 3EB0A 4GIIA 3R7GA 2PZRA 2XYUA 4XH6A 4C4IA 3VHEA 2X2MA 4YTHA 3C4FA 5GHVA 3RPSA 4FODA 2WPAA 2XB7A 3FXXA 4OTDA 3VW6A 1O6LA 4XOYA 1YDRE 2GS2A 3QA8A 5LOHA 3W16A 5IDNA 3ANQA 3FKNA 3KC3A 2OK1A 2BAKA 2WAJA 1E1XA 3QC4A 4IZ5A 4KBCA 4MCVA 4ALWA 3MW1A 1XH9A 2OXXA 4FOCA 1E1VA 4G6LA 4H3PA 4RMZA 3QGYA 4WNPA 1PXOA 4UWYA 2RFSA 5GIOE 4U97A 2I40A 3LFQA 4CV9A 2VU3A 2W1DA 4JBQA 2UZOA 5FM2A 4TXCA 5EM7A 4BCPA 1NT2A 4HYHA 5BVWA 2W4KA 4WKQA 1Q5KA 4BDAA 1W98A 2VWXA 3A62A 4IX5A 4WG4A 4EQUA 5B2LA 2DYLA 3FY2A 5HE2A 4NM5A 5HCYA 3S4QA 4DITA 4L44A 4OT6A 5M4FA 3QD3A 3R6XA 4Q9ZA 4B8MA 4C3PA 4FR4A 3II5A 3A8WA 3W1FA 4HCUA 4EZ5A 3COIA 4KSPA 3F5PA 4QMZA 3TZ7A 5IKWA 3U55A 4K6ZA 4YJQA 5ANIA 3BHTA 4AS0A 4FYOA 4X3JA 4BN1A 3KF4A 4NZWB 5CAVA 4AZFA 3VBXA 1OKWA 1XH7A 2W06A 1WCCA 3O7LD 4RIXA 5HBJA 4BI0A 2C5XA 3OBGA 5CEQA 4NJ3A 1PHKA 3RNYA 5J95A 3HMOA 4LYNA 4TYHB 5F4NA 5KZ0A 3GU6A 3F2RA 4FEWA 3UQGA 4O7YA 5IQGA 4FT3A 3O2MA 4IW0A 3TKIA 3KXXA 2XNMA 4CV8A 4ZJJA 3CTQA 3UIXA 3D5WA 1AQ1A 3R1SA 5CAPA 4EKKA 5JRSA 4L68A 3IDPA 4PY1A 3RALA 3QTIA 2XZSA 4FTQA 4YJPA 3VQHA 3WIKA 3HECA 4LG4A 2PPQA 2W9FB 1J7IA 3TNWA 4KA3A 4AN3A 2IZUA 5HESA 3HVCA 4CFWA 3HMIA 1CKIA 3O8UA 4J8MA 2RIOA 4O0TA 1H07A 4I6BA 3U4UA 4BGGA 4L42A 3NZ0A 2PVYA 1LPUA 1Q8UA 1Y6BA 4EONA 5HTCA 1CKPA 4ITIA 5F1ZA 1DI9A 3F9NA 4UMUA 2XNOA 4H3BA 4AW2A 4B6LA 4C4HA 3NVMB 4JAIA 4A4LA 4M84A 5JQ8A 2I0EA 1H1PA 2WQOA 4JG6A 5HNBA 4CCBA 3RHKA 5DNRA 5LQFA 4DBNA 3GT8A 4J97A 5A46A 1KE7A 2X6EA 2OJGA 1CDKA 3KXNA 3OEFX 4MHAA 4NFMA 4J7BA 2PE1A 2GDOA 4WRGA 5FXQA 3P7AA 3ZDUA 4LI5A 5DIAA 5T6KA 4A9YA 4L53A 4TYGA 1KOAA 3I7BA 4ACCA 2GPHA 4KRDA 4QO9A 5AP3A 4DCEA 2Z60A 4CD0A 4PMPA 3EQHA 2IVUA 3C0HA 4U40A 2BKZA 2R3KA 2W05A 4RX7A 3QALE 4GK3A 1SVEA 2G9XA 4QYHA 3I4BA 3SRVA 2WTVA 5EM5A 2PVNA 2JBOA 5HIBA 5A3XA 2C6IA 4CTBA 5CANA 3CS9A 4FI1A 4E93A 1CSNA 4X3FA 4ALVA 4NM0A 4YURA 1PRYA 4AX8A 4B9DA 2WTIA 4X21A 2V5QA 3DBDA 3DT1A 3BHVA 2KULA 2YDJA 4AT4A 2HY81 4JXFA 2HW7A 4KBAA 4FTKA 4TW9A 5CY3A 5HBHA 2OLCA 2QOOA 3DDQA 4DG0E 4RA5A 3HYHA 3AT3A 3MI9A 3MN3A 4LGHA 5DR9A 5AUYA 4JBOA 1YI6A 1BLXA 4IX3A 4GG5A 5HGIA 5JGDA 3F5XA 4QMXA 4WNMA 3Q9YA 4RC3A 4QYGA 1YKRA 3ZS5A 4OT5A 2C6TA 3FZ1A 1GJOA 4D2TA 2R3FA 4HGSA 1ZMUA 2BDFA 3KMWA 4RBLA 4QQTA 3TTJA 3L9LA 5IUHA 1UNHA 3IW7A 1TKIA 2H8HA 4DINA 4LV5A 4CQEA 2HWPA 3GENA 3R1QA 4ERKA 4AQCA 4A9RA 4YUQA 4KBKA 3FC2A 2YDKA 2UZVA 1B38A 3NDMA 5CT0A 4DEBA 2PULA 5I9VA 2ERKA 2PMIA 2CKOA 3IK3A 3I7CA 3HP5A 4CLIA 1YXTA 3ZLWA 4ZTMA 2IZRA 3KA0A 4G2FA 3IDCA 5E1SA 4CFNA 3H3CA 5CALA 3AMAA 3OT3A 2GNJA 4U44A 1ZMWA 4IC7A 5HICA 5LMBA 3GC8A 4OBOA 3NS9A 3C0GA 4XUFA 3DNEA 3NUSA 3T3VA 4EH8A 4EOKA 3R7YA 3OXTA 4BTMA 4QMLA 3SXRA 5HCXA 5EQYA 3BZ3A 3OROA 4O0UA 4ZP5A 3RI1A 5KBQA 5C8KA 4NSTA 2VWWA 3I5ZA 2PMNX 2EUFB 2JDRA 3GOKA 4JDKA 4PDSA 5TO8A 4RQKA 3RAIA 3UTOA 4BCQA 3UGCA 3Q2JA 4EC9A 3KN5A 4G9CA 4O6EA 3RCDA 2A27A 2XVDA 4M7IA 4AGDA 4I5PA 2H34A 5KMMA 5M57A 1GZOA 3WZJA 1OKYA 2C30A 3F66A 4O0XA 4BDKA 5B2MA 3PSCA 1YWNA 3PWDA 4QYEA 4DFBA 4O0VA 3DFAA 4O0YA 1WVXA 2CPKE 3HEGA 4TNDA 4AACA 5J9LA 2F57A 4V0GB 3AG9A 5EM8A 4PTEA 5HG5A 5TR6A 4O7SA 2ZM1A 4XYFA 1OPJA 3N9XA 2XP2A 4YO4A 3JS2A 4P90A 3RWQA 3FKLA 1FVTA 2BVAA 2R3JA 4F6UA 4TKSA 2OI4X 4Q5HA 5A4LA 2Y6OA 3DLSA 4EOQA 4JDIA 3GU5A 5CLPA 1ZMVA 5M51A 2F7XE 2IZSA 2R9SA 1ZYJA 3AT2A 5CU4A 2WMAA 3GCUA 4YJOA 4XG7A 2CDZA 3IOPA 2WNTA 3CGOA 4CYIA 4KIKB 3UNZA 3R1YA 3TNQB 4ZS4A 4DH7A 4U7ZA 4FIIA 2BRGA 2E9NA 5CXZA 3RM7A 2DWBA 3QX4A 1QPDA 3NUNA 3DU8A 3IECA 2X8DA 5AAEA 1H1SA 4C57A 2YDIA 3QQHA 5J1VA 1R39A 4MNEB 2YIQA 3D7TB 2WQEA 2W1CA 2YCFA 3Q53A 4HYUA 4N6YA 2PVKA 4MQ2A 4YHTA 3CD3A 4K9YA 4YJSA 3WE8A 5IA1A 5HG8A 3DNDA 4QOXA 3T9TA 2G15A 1ZY5A 1JPAA 5JZJA 4D9TA 2JKQA 2PTKA 3NUXA 4YJTA 4YJVA 4P2KA 3WF8A 2NPQA 4RFZA 2UW6A 4U5JA 2YIWA 1J1CA 5E8TA 5JRQA 5LMKA 3G33A 4OTIA 2J5FA 4MBIA 4RJ3A 3UMXA 5KO1A 3VULA 4C4EA 3R7VA 4E73A 3PXZA 3MVHA 2WMSA 1OPLA 1OKVA 4RVTA 2CNUA 4IB5A 3B8RA 4BI1A 4GS6A 3VBVA 4F7LA 4GVJA 4CGAA 3PSBA 1JBPE 4DA5A 2ERZE 4IVBA 3ZHPC 4D58A 2WD1A 2X8IA 4JAJA 5L2SA 3ULIA 3PPJA 3OOMA 2V62A 3B2WA 4AZSA 1OIUA 3DGKA 3LPBA 3N51A 5ANGA 3V51A 5C1QB 3TUCA 3E93A 3DXNA 1REJA 3UPZA 3UP7A 4I5CA 2QO7A 2XRUA 2UZWE 5AR8A 5AIRA 3AMBA 5AX9A 5GNKA 4E4XA 3UVPA 1OECA 4YNOA 1KOBA 3Q4UA 5HO6A 4A07A 4RX5A 2FGIA 3UODA 2Z7LA 4NT4A 1XWSA 3MFTA 2BHEA 3QXOA 3NUPA 3R28A 2ACXA 2R3HA 4QQCA 3U9NA 4D4RA 4DH1A 4E5AX 4QPMA 3M42A 1BL7A 1LR4A 3ZYAA 4XV1A 1UV5A 4O2PA 4DH8A 4ZLZA 5B0XA 1V0BA 3THBA 4ZTNA 4DTAA 3QKKA 1REKA 2ITPA 4BIBA 3R8ZA 5FEQA 4FTRA 3BGZA 4ZXTA 5CU3A 3CCNA 2ZV9A 5L6WL 3PY3A 4GMYA 3LFAA 3TV4A 2ZM4A 4MXZA 4V04A 5DT4A 4I0SA 3PXKA 4MQ1A 2VWYA 4Y83A 3FZPA 2IG7A 5AFVA 4XS2A 2F9GA 3CXWA 5HNIX 2XK6A 2OGVA 5EDQA 4RA4A 1UKIA 3G6GA 4F09A 4JX7A 4L7SA 1GIHA 2ESMA 3QRJA 3OCBA 4YO6A 3EL8A 5IDPA 4N0SA 2W5AA 2YAKA 2R3GA 3Q96A 3SHEA 4A9SA 3Q5IA 3CPCA 4BCIA 4OGRA 4FSMA 3ZO2A 5E7RA 5J9YA 1OUYA 4ZMEA 4FICA 4FTLA 2O64A 4XV3A 2O63A 2ZDTA 3OY3A 5IEYA 4MD9E 4KS7A 1V0OA 3VJNA 3IW4A 2WOTA 4RT7A 4YZ9A 4GKIA 2QG5A 3ZLXA 4UYAA 4UALA 4J96A 4L9IA 3WZUA 5IQCA 2OZAB 4TNBA 3QTUA 2XUUA 2C3JA 4U43A 2JAVA 1J7UA 1JNKA 3OEZA 4M13A 4CLJA 3F82A 1TQMA 3GCQA 3MTLA 4KKEA 2A4LA 3EQBA 4RJ5A 4CFFA 3RZFA 1W84A 1T45A 3DJ6A 4NCTC 3R8UA 5E9EA 4ASDA 2CKPA 1OZ1A 3BRBA 4FC0A 1YHVA 4FKRA 3VS6A 3IGGA 4JX3A 4RZWA 3I6UA 5CENA 4WUNA 3LVPA 4F70A 3VN9A 3U6HA 2BALA 2UV2A 1VR2A 3QTZA 3LXLA 4GJ2A 3W2CA 5I3RA 3TZ9A 3R8MA 3Q4TA 4CKJA 4FNYA 4QMPA 2G1TA 3GBZA 4DFZE 4DCAA 3QTXA 1P14A 4FSZA 4C4JA 2VTAA 2WTDA 4APPA 5KMJA 5IMXA 2ZM3A 3HV6A 4L8MA 5AP6A 5CWZA 3ZM4A 3EFKA 4IM3A 4QT1A 5CF6A 5E8WA 4BBFA 2QOLA 3LCDA 5IA4A 3MS9A 1PMEA 2X2LA 2XK9A 5ACKA 4O7RA 3JXWA 3DTCA 4F9AA 4K2RA 2BAJA 2BZHB 2XK8A 4F9BA 2XA4A 3BBWA 4KB8A 4LV8A 4KRCA 3DPKA 2VTOA 4QTEA 2QHMA 5DLSA 3UIUA 2W4OA 3RAWA 3MVMA 3NVKI 4WG3A 2QO2A 4G3FA 1PMNA 4MAOA 4NWMA 3GQLA 4ZTLA 3HV7A 3QGWA 2BTSA 4Y85A 4AA0A 5JFVA 2HK5A 5E1EA 4TPTA 3IPHA 3KRXA 1TVOA 5AV1A 3KGAA 5D11A 3U51A 4O22A 4AW5A 3KKVA 4DEHA 5C8NA 4AGCA 4IQ6A 3DDPA 1G8AA 1Q62A 2WTJA 5AP5A 2QU6A 2VO0A 4K33A 2I0VA 1OL6A 4KAOA 4LM5A 1MRUA 3QTWA 4E6AA 3AC5A 5CVHA 3MA3A 2WEIA 3CTHA 3UO5A 5AX3A 1VYZA 5HE0A 2VWUA 1LEZA 2W1HA 3G9LX 1YXUA 1SM2A 4JG8A 4GU6A 2PY3A 4RWJA 4BTJA 3EZRA 2Y4IB 3VBQA 4XRLA 1DI8A 4WD5A 3QQFA 4AT5A 4Q5EA 4W4XA 4YHFA 2PL0A 3CTJA 5I9UA 4TY1A 4FMQA 5FG8A 3W8QA 2PVLA 3V8SA 4G6OA 4GH2A 2CCIA 2WO6A 4IACA 1U59A 2PSQA 4FG8A 1IAJA 5FM3A 4F0IA 1YXSA 1UVRA 4G17A 2GFCA 3E63A 5FTOA 2R0IA 4TYHA 4AA4A 5KKRB 5ANEA 4ZLYA 3TUBA 4OTPA 1GIJA 4YPDA 3PY1A 2X0GA 3W55A 1OB3A 3MB6A 1H00A 2WQBA 3ZO3A 1J3HA 3OMVA 5LVNA 3R7IA 2ITQA 5A54A 2OO8X 5EHLA 2OF4A 3TIYA 3E87A 2ZB1A 4YNEA 4D28A 3TKUA 2Y4IC 3G0EA 3ZXZA 4ALUA 3DXPA 2XEYA 2JEDA 3GXLA 1RQQA 3ALNA 3NYVA 3NW5A 3AC3A 4NFNA 3WF5A 1QPJA 4XLVA 2PMLX 1M7NA 1FGIA 3BU5A 4Q9SA 3JYAA 1XH8A 2CHLA 2R3QA 4YJRA 4AU8A 2QNJA 3EN6A 2W1FA 3KL8A 4PDOA 4BDIA 4BY9E 4GUEA 2J0JA 3Q3BA 1H8FA 5DPVA 5KKRC 3HV5A 2F7EE 2XK7A 3ORTA 4U80A 3WF9A 1SMHA 4FV3A 4BYJA 5IQBA 3PLSA 2BIKB 4PL5A 2QURA 5C26A 4CMUA 3DBFA 3O23A 2G2HA 3PP0A 4U42A 4IX6A 3IG7A 5K3YA 2B4SB 3QQKA 4JOAA 4GT4A 2WELA 2GTMA 4KKGA 1WMKA 3Q6UA 3VUGA 3O8TA 1HCKA 4EZ3A 3D83A 4G3DA 4OTHA 4DH5A 4FSYA 4GYIA 2YZLA 4QP1A 3LXKA 3SX9A 5DEWA 4K77A 1FBNA 2VO6A 1YHSA 4ZAUA 3BX5A 2UW3A 4DTBA 2VO3A 3B2TA 4QP4A 4J8NA 3ZBXA 2VUWA 3EFWA 3V01A 4ZEGA 4C3FA 4OTGA 2Y7JA 4E20A 4XG4A 2R2PA 5HVYA 3SGCA 1Q61A 4BKZA 3HUBA 1TQIA 2BZIB 2QD9A 5E91A 5AR7A 5H9BA 4D2RA 1O9UA 1O6YA 4HJOA 2B52A 2CMWA 4JQ7A 4QTAA 2OXYA 4L67A 2WMXA 4HVIA 3N4VA 4YLJA 3I81A 5AAFA 1Q99A 4HZRA 3UP2A 3IS5A 4FSTA 4PPAA 3G51A 4IAKA 3MFUA 4WIHA 2RGPA 2UW4A 5I4NA 5EDPA 5E8ZA 2W1IA 3VS5A 3ZFXA 3C4WA 4LGGA 1XO2B 4MWHA 3H9OA 2VWBA 1MQBA 5BMSA 4E5WA 2UZBA 3JVRA 4G6NA 3ZONA 3HMNA 3ZFMA 1Y91A 3LFEA 4ANSA 4BDEA 1KWPA 4ORKA 5EOBA 2FSMX 4K8AA 3IGOA 3V5TA 3PLAE 3BHHA 4UXQA 3E8CA 5CEIA 4EWHA 5BVOA 5CXHA 4ZMFA 4ZTSA 2UZUE 4RGJA 1BI8A 4LUDA 2QQ7A 4HW7A 3V5QA 4JVGA 2IW6A 3W32A 3A99A 3ELJA 4L7FA 3W2RA 5L4QA 3D2KA 4NIFA 5HOAA 3UDBA 1PXMA 4QTCA 3D15A 2VTSA 3PRFA 3ORKA 2QOQA 3NNXA 2BRHA 4FUYA 3EFLA 3ORZA 4I0RA 1B39A 3LM5A 3KCKA 4GVAA 3NLBA 2R7IA 3PXYA 2HXLA 2IPXA 3BLHA 3SC1A 4FL3A 4EOLA 4ZSAA 4QRCA 5CZHA 5LVLA 4HOKA 5KMNA 3EQGA 2LGCA 3V3VA 3ZSGA 3F7ZA 3P1AA 2CGUA 2Y6MA 4I24A 3CY2A 4FSWA 2J0IA 2YWVA 4P5QA 3FI8A 4J98A 5KHWA 3KMMA 3MPTA 3QD2B 4RSSA 2XKDA 3F88A 2B53A 2FUMA 3I6WA 3BGQA 3DBCA 4WA9A 3QXPA 2OF2A 2C6DA 1ZXEA 5HD7A 3WARA 2CKQA 4GK4A 1OBGA 3KFAA 4PL4A 3DXQA 2XCKA 4I0TA 3ZZEA 1QL6A 3FKOA 5CSWA 2ITZA 4V0GA 3TTIA 1LP4A 3OWKA 2JFLA 3FYKX 2BRMA 3EN7A 3CJFA 3D5UA 2SRCA 2QKRA 3GCSA 4FT5A 5LJJA 1IEPA 1F3MC 1B6CB 1P4FA 3KRJA 3FWQA 3TACA 3TIZA 3NMUF 2QOIA 4GRBA 3EYHA 3VRYA 1R0EA 3ZUVA 3F5GA 3UOHA 3FSKA 3NSZA 2XCHA 2OIDA 5ETCA 2O5KA 5HO8A 5EDRA 4EQMA 2C3LA 3MESA 2XNBA 3D14A 4HZSA 2Y4PA 3BU3A 5CU6A 5JH6A 3FAAA 1JAMA 3RPRA 2WTWA 3QAME 3U9CA 4KIKA 5I3OA 3V5WA 1UNLA 3I1AA 3OHTA 5FEEA 4F6SA 3UIMA 3LFDA 4FIFA 4O6LA 4C3RA 4X2GA 1V0PA 4QMQA 1W8CA 3K2LA 4XG3A 5AR3A 4EYMA 2QOFA 3MJ2A 4U41A 3PZHA 2LAVA 3NW7A 3R7OA 1YRPA 2PVRA 3GOPA 4I93A 3QTQA 3QZGA 3R7UA 2B9FA 3D7TA 2VTQA 1JVPP 4FEUA 4H05A 3SAYA 3I0QA 4NW6A 3NUAA 3TM0A 4RPVA 5J87A 3ZSHA 2WFYA 3DBEA 4AUAA 4M14A 3UZTA 3EYGA 4QMVA 3ENHA 4MX9A 4UV0A 3LFCA 1XBBA 3CPBA 3LCKA 4CKIA 4YTIA 1Y6AA 4JR7A 4PF4A 4CG9A 3G90X 4X6QC 3VC4A 1GIIA 3VAPA 2C0IA 3ODZX 4F64A 2PUUA 2P33A 4RLKA 4AZEA 3SVVA 2HZ0A 3DOGA 2P2HA 4GV1A 5HEZA 1S9IA 5D1JA 2PZYA 5M09A 2OWBA 4MTAA 4M67A 3F69A 1HCLA 3PIXA 4QMTA 4DHFA 4FZ7A 5FP6A 4D2PA 3ZH8A 2YEXA 1ATPE 5L2QA 4I3ZA 4BHZA 3C7QA 4XG9A 5IA5A 3D0EA 1IRKA 3S00A 4E4MA 4ANOA 3E92A 2WTKB 2J4ZA 3FI3A 4DT8A 5CF5A 3SDJA 3R8PA 4F1MA 3EKKA 3V8TA 3QBNA 2G2FA 1FINA 3QHRA 4WSQA 3V5JA 4EOSA 3ZXTA 2WGJA 4HNIA 5JN2A 3MIYA 4MNFA 1RDQE 3OC1A 3IOKA 4ACHA 5JFXA 2XMYA 5CEMA 2C5VA 4U6RA 5EYCA 4H39A 3A61A 4JQ8A 4JBPA 2BKKA 2PUIA 3Q9WA 4GT3A 3BV2A 5CI7A 1BUHA 4PNKA 4UB7A 3VUTA 2NP8A 1OGUA 2W96B 5E8SA 3DQXA 1FQ1B 2XNGA 4O96A 4FKJA 4IX4A 1YOJA 3BEAA 3PE1A 2WTKC 2HW6A 1P5EA 1XKKA 3EIDA 3GEQA 1Z5MA 4RJ6A 2OJIA 4O82A 3GQIA 3VBTA 4NCTA 2ITYA 4O7TA 1ZYLA 5DE2A 3DAKA 5CT7A 4GL9A 5A4EA 1WVWA 1XHAA 5CEPA 4I41A 3PXRA 2XH5A 4D4VA 1H25A 2UW8A 3EMGA 3TI1A 3CQEA 2BZKB 3C0IA 3UG2A 4F1TA 5AUUA 1T46A 5H8EA 2XJ0A 2VN9A 4CZTA 3QD4A 2DUVA 4RRVA 4BDCA 1IA9A 3F2AA 3D5VA 4BCHA 4NL0A 3HDMA 4JS8A 4KD1A 3RKBA 1JLUE 2ITOA 4BDFA 3RAKA 5AA9A 4M3QA 1URCA 2CSNA 2WMRA 5HTBA 3SOAA 3V04A 1OBDA 2GFSA 5IEXA 5D41A 5J9ZA 3OXIA 3M2WA 2ITXA 4DGLC 4UMPA 2R3LA 4PPCA 2WB8A 3L8VA 4O91A 5A6NA 2PVMA 1DAWA 3OW4A 3QTSA 4PNIA 5AP0A 3QWJA 3KRLA 2Z7RA 1MRVA 5E8VA 2RG5A 1YQJA 4DE4A 3MFSA 4BDDA 4FA2A 3ZEWA 2P55A 5CSHA 3DK6A 3V5LA 3OCTA 3JR1A 5JGBA 4H36A 4PMMA 3JVSA 4CT1A 2P2IA 4G3GA 4LFIA 4AZVA 4BIEA 3W8LA 2E9OA 3P5KA 4FL1A 3KF7A 2GNIA 5D9HA 5BPYA 4EQCA 5E4HA 5BYYA 1Y57A 2HY0A 4O38A 5AM7A 4NW5A 3UVRA 3KRRA 4JR3A 5FRIA 5CAUA 3F7WA 3OUKA 3ROCA 4QP9A 2R7BA 1M7QA 4BZDA 2J9MA 4FTMA 5TF9A 5D12A 2VNYA 2BFYA 3KREA 4ID7A 4UMQA 3NAYA 4JI9A 1TQPA 3FPMA 5C01A 2ONLC 3A7GA 4O0SA 4XG8A 4EYJA 5CSVA 1F5QA 3UYTA 4EK5A 4HGEA 4KIPA 5JSMA 2GQRA 4DFUA 1QCFA 1JWHA 3KXGA 4GCJA 4J99A 3R7EA 1Q8ZA 2X8EA 4BYIA 1UKHA 2FB8A 5AUVA 3S95A 3QKMA 4DTKA 2QKWB 3JY9A 1XR1A 2BMCA 4I4EA 2O2UA 2HENA 4NKAA 1L3RE 4DFLA 4EHGA 1G8SA 3Q9XA 2PU8A 2R0UA 3BYSA 3EN5A 4RVLA 3L8XA 1AD5A 2C5NA 4CTCA 1KE8A 2YCRA 2GHLA 4O1PA 2CN5A 4XCUA 3WZDA 4BB4A 2W1GA 4C7TA 4ZZOA 5BQ0A 2I7QA 3M11A 3VRZA 4BVUA 3DFCB 4IM0A 4DAWA 3MIAA 4J1RA 5HVKA 2UW7A 1WBTA 4W4YA 2YWPA 4F7SA 4CKRA 4F0GA 4ZY5A 1WBNA 3DK3A 4UZDA 3FMHA 4FOBA 4L3JA 5AUWA 3M1SA 4EEVA 4QMYA 5DH3A 3OWJA 3SD0A 4C61A 2VWZA 4MK0A 4BKYA 3QLGA 3SA0A 4QP6A 4XX9A 5L2WA 4UN0C 4E3CA 5L8KA 5AUTA 4D5KA 3LAUA 4W4WA 4DN5A 1OI9A 2JC6A 5HIDA 4FUXA 3PVUA 5HBEA 4HVGA 5I9WA 3GC0A 4S31A 4F63A 2AUHA 5E8UA 5J79A 1VEBA 1XJDA 3F2NA 3VF8A 5KZIA 4DGOA 3O7LB 2GNLA 3WYXA 2XEZA 4ZOGA 4YBKA 3PA3A 3RK7A 3ORXA 4DBXA 1ZWSA 3KVXA 3PUPA 4WHZA 2W0JA 1XH4A 2R3NA 3IQ7A 2XS0A 3REPA 5ETIA 1G5SA 2H9VA 3W2PA 4N57A 3BKBA 2VTPA 2WOUA 2IW9A 2CLXA 4EORA 4S32A 1YI3A 4G1WA 5DOSA 1ZARA 4USEA 4TYEA 1Q4LA 5FBOA 4AOIA 3IO7A 4FIJA 1MQ4A 1PMUA 1XBAA 4R3CA 3OCGA 2W99B 4O7VA 5L8JA 3QZFA 4Y8DA 4QMNA 3VS1A 2XNPA 1GNGA 2UZLA 2W7XA 4FKLA 3P4KA 4G3CA 4WNOA 5IH6A 5IQFA 3RPOA 4FZDB 3C4CA 3FUPA 4FZFB 4U8ZA 3ID6C 3P23A 4AGUA 3KB7A 3JPVA 4BL1A 3G2FA 3PWYA 4GUBA 5CZIA 4RIWB 5KBRA 4AN2A 4R77A 5HE1A 2QU5A 2JAMA 2V0DA 4NTTA 3QRKA 2W5BA 5AM6A 1UU7A 4D5HA 4I5HA 3LZBA 4LL0A 4YZNA 4B0GA 3FLNC 2W1ZA 4CCUA 3R21A 1H0WA 3F61A 2C5YA 3RAHA 3RCJA 3PTGA 5IH4A 4FSNA 3FHRA 3MH2A 3VUDA 4GEOA 4RQVA 3K5UA 3UIBA 3GU4A 3PIZA 4NYEA 1M2RA 4XJ0A 3PRIA 3UE4A 2C6OA 1OVEA 5AV2A 3BGPA 4E6DA 4FEQA 3TJCA 4AWIA 3UBDA 4FTTA 4UWBA 2J0MB 4Y72A 2JKMA 4YBJA 3EKNA 5HD4A 3DKGA 2W5HA 4RVMA 4LOPA 4O86A 2XIRA 5BVFA 2WMQA 2Q83A 2EXEA 3ORLA 2PMOX 2X39A 3MV5A 4P5ZA 4RIXB 4OTQA 1NY3A 4O27B 2FVDA 2GNGA 2OSCA 4M69B 4OTWA 5DG5A 3ZRLA 2F7ZE 2GHGA 2C6EA 4BR3A 4C34A 4L01A 3JY0A 2ZMDA 4CFMA 5I9XA 4FV6A 2C0TA 2X9FA 3AD4A 2AC3A 3A7JA 3BYOA 1CM8A 1OIQA 3A7FA 3Q5ZA 4GSBA 4ZIMA 4IJ9A 3TZMA 4CQGA 4A7CA 2GSFA 4IWQA 3UYSA 4FVRA 4XP0A 5CSXA 3UC4A 4KUJA 3U54A 3Q04A 3DAEA 2OIQA 1PKDA 3G5DA 3R9RA 3RP9A 3NIZA 4R8QA 4RJ4A 3OTUA 2OG8A 3G15A 3AT4A 4XV2A 4RLLA 5FEDA 3L8SA 3AC2A 1IASA 3NUUA 3EQRA 1Q8YA 3LJ0A 4RFMA 3IONA 1JKTA 4O0WA 3A4OX 4I5MA 2G2IA 4H58A 5DEYA 4BDHA 3FMLA 5CVFA 3GGFA 3KK9A 3PJ1A 4MD7E 2ETKA 4AZTA 4FVQA 3FQEA 2Q0NA 1U54B 4FV1A 3ACKA 3NCGA 2O0UA 3RBWA 3HRCA 5AADA 3KVWA 3BYMA 2CJMA 3COMA 1NA7A 1HOWA 2WQNA 2WZJA 4G3EA 4HYIA 3MVLA 3NNVA 1YOMA 4IFGA 4YSJA 4CVAA 5CYIA 5J5TA 2NRYA 5M56A 3N4UA 5EQEA 4TL0A 5J7HA 3LMIA 2ZV2A 3ORMA 4IVAA 4L6QA 3CD8A 5CX9A 4DEIA 3FMKA 4WO5A 4ZSGA 3FSFA 3I79A 3BLRA 2W4JA 1OIRA 2FH9A 2VWIA 5EOLA 1M17A 3CC6A 3FQHA 5F20A 4I22A 1ZY4A 3KQ7A 1K2PA 4HGTA 5M4IA 3GFWA 4BZOA 1ZOHA 4HPUE 4EL9A 4LL5A 3SXFA 5CNNA 4X6RA 3BHYA 4UEUA 3ORIA 3T9IA 5ICPA 4V05A 3LCSA 4XNEA 4CRLA 4E4LA 4I21A 2OFUA 4AA5A 3HNGA 3E8NA 3S0OA 4QNYA 3ZSIA 3HV3A 3MY1A 5HIEA 3MB7A 4E7WA 3KULB 3POZA 4JLCA 4L45A 5CNOA 3CKXA 2VTIA 5FLFA 4EK8A 3LJ1A 3E7OA 3ERKA 3IW6A 4ZZNA 1A9UA 4ZK5A 4EH9A 3NYNA 5JK3A 4KKHA 5KMLA 4C58A 4R7HA 3PA4A 4EJ7A 4DC2A 1Q41A 4FTNA 3O8PA 3Q4CA 1MRYA 3ZRKA 2GS7A 2GNHA 4BFMA 2B7AA 4PL3A 1H1RA 4JNWA 3QQUA 5K9IA 4A4OA 3UQCA 3AD6A 4EKLA 4DLJA 3R9NA 2F2CB 3COKA 3PVWA 1UNGA 4YSMA 5EM6A 3MPAA 4I4FA 5AV0A 3D94A 2CN8A 2UZDA 3P86A 3GCVA 2B0QA 3WILA 2X9EA 2UVXA 5TOZA 4AN9A 3QZHA 4MKCA 3VO3A 3WI6A 2WXVA 2WU6A 3EQIA 2QOCA 4AOTA 1SZMA 4FKOA 2WQMA 2EB2A 4C2VA 5CU2A 4FGBA 1A48A 3I60A 3U87A 5IMEA 1PY5A 2XJ2A 2IW8A 5EHOA 3OUNB 3R00A 4TN6A 4I23A 4YPSA 4JL9A 2IN6A 1CTPE 3D9VA 5HZNA 5FTGA 4UBAA 3LW0A 3K3JA 1PXNA 4R7BA 3CSVA 2QODA 4FV4A 5EK7A 2PVFA 1DM2A 3O71A 4U0IA 4QD6A 4B7TA 2YM4A 3QKLA 3UPXA 4BBEA 4CFVA 2VRXA 1H26A 3BHUA 1FVVA 2P3GX 5CF8A 1AGWA 2IO6A 4L3LA 1YW2A 1Z57A 5BYZA 3PFQA 5FD2A 4D4YA 3SG8A 3VWAA 3C4XA 3VJOA 3DB6A 5G1XA 2X7OA 4LMNA 5FGKA 1J7LA 2W17A 3FBVA 4CYJA 4S30A 3BQCA 4BIDA 1SNUA 1L8TA 2O65A 3PG3A 3P08A
chains in the Genus database with same CATH superfamily
4C33A 2Z8CA 1BL6A 2JD5A 3TDVA 4FKUA 3O51A 4F08A 3BIZA 4TYJA 1RW8A 4CEGA 2Z02A 2EXMA 2HYYA 2HWOA 2I1MA 3SXSA 5IZFA 5LVPA 3WF6A 4GIHA 5J1WA 5IA3A 3QYZA 4PTGA 1WBPA 4G31A 4IMYA 3FL4A 3ORNA 4WBBB 4IXPA 1U46A 5IEVA 3P5JC 1FMKA 3GNIB 5HG9A 3BCEA 5BNJA 2KTYA 5IPJA 3ATSA 3R0TA 4WG5A 2IWIA 2WMTA 4FT7A 3R9OA 5BVDA 3UZRA 1PXLA 2Y8OA 3BYUA 3OF0A 4D0WA 4Z7HA 5A4QA 4JT3A 2IVTA 4PP9A 3C13A 2V7OA 3H0ZA 3ZO1A 2C3IB 2VD5A 4MWIA 4O4BB 5AA8A 2R3PA 5AV4A 4ZJIA 3QTRA 1H4LA 3ZLSA 4LUEA 3F3UA 4AFJA 3AMYA 5GINE 5L8LA 4F78A 4FV2A 2YLFA 3FXWA 4R6VA 4N70A 5EW8A 4RFYA 5HX8A 5IUGA 4IADA 4S2ZA 3OZ6A 3P78A 1YI4A 4IAYA 4L46A 3EN4A 4FF8A 1ZYCA 4IAFA 3W2QA 1M2QA 1YXVA 2B9JA 4PMTA 3HZTA 2FSTX 4L52A 4A4XA 2BR1A 4MF1A 2B55A 3HMMA 4O7WA 3RK5A 4CT2A 4GFGA 3GU7A 4H1MA 4JDJA 4MXAA 5AV3A 5LARA 4NKSA 3QRTA 5EG3A 3K3IA 2QONA 5AP2A 3RTPA 4MD8E 3EHAA 1V1KA 4W8DA 1IG1A 3WF7A 1GY3A 2YA9A 4DHJA 1KUTA 5AWMA 4AG8A 1WVYA 3RK9A 3W0NA 1WZYA 4S34A 3BQRA 4IANA 4E4NA 3PP1A 3NW6A 3PYYA 4MBJA 5LXMA 4IAIA 2YERA 4QQ5A 4BTKA 4ACMA 4IDVA 3EOCA 4LRJA 2RF9A 4MBLA 4Z3VA 3ORPA 2YIRA 4C35A 2UVZA 3E3BX 3VNTA 5KCVA 5K0KA 4GKHA 2ZAZA 4C02A 4O7ZA 3OXZA 4FV5A 3AGLA 1SNXA 4FKGA 5L6PA 4FIHA 5AUXA 3ITZA 4FIGA 4OAVB 5B2KA 2ZYBA 3ET7A 2E9PA 3VUHA 3R02A 3ENMA 1WBVA 1X8BA 4TWCA 4CRSA 5KMIA 5L2TA 4GYGA 1J1BA 2JDOA 2BHHA 3VUIA 5AP7A 3CLYA 4N6ZA 1M14A 3FLZA 3SOCA 4HVSA 3RPYA 4M66A 4J71A 3UMWA 3DB8A 2XBJA 4PQNA 4YJUA 5H8BA 3OP5A 1KSWA 3DK7A 4Q2AA 3LIJA 4ZY6A 4PDYA 3LXNA 1Q24A 5DBXA 4E8AA 5HCZA 3P9JA 4FG9A 4JRVA 2WMBA 5DWRA 4XV9A 4Y95A 3QX2A 4YR8A 3GCPA 1QMZA 2YAAA 2Y9QA 3DBQA 3OG7A 3PA5A 5F95A 4WNKA 4CXAA 2UZEA 5A4TA 5M53A 4X2KA 3W18A 4Y5HA 3WBLA 5FTQA 3BE9A 2WEVA 1H01A 4EH2A 1G8JA 5CEOA 4OBQA 3L9MA 3EZVA 4MXOA 3W33A 4USFA 3LHJA 3TUDA 2UW5A 3RHXA 2X4FA 3HRBA 4EOIA 5K5NA 4YJNA 3QA0A 4LRKA 1W82A 4DG3E 3OS3A 4FVPA 5A9UA 4F1OA 2C6MA 3NIEA 2QCSA 3BE2A 4O81A 3T3UA 3KXHA 1NXKA 1QPEA 4EOOA 2XANA 5IQDA 1VZOA 4BCJA 2QLUA 3W10A 4DLIA 4MXYA 2I0HA 3QYWA 4WSYA 1DS5A 2X7GA 5EYMA 3HUCA 2BCJA 3LFSA 3Q60A 3RNIA 4AOJA 2CNVA 2BTRA 1R0PA 4CG8A 2HXQA 4UYNA 5EW9A 5AR2A 2EB3A 3MH3A 4QYFA 4IC8A 3UQFA 4OTRA 4FBXA 4Z7GA 4XEYA 4YHJA 5CQWA 3ZC6A 2ZB0A 3NCZA 4XG6A 3ZFYA 4U81A 3EFJA 5C9CA 2I6LA 3C4ZA 3NNUA 4BJJB 3KXMA 1XMMA 3RWPA 2BILB 2YJSA 3HDNA 3R2YA 4FTAA 3D5XA 3HL7A 4NUSA 4C2WA 3OVVA 4AW0A 4DFYA 4X7QA 5AMNA 5GZ8A 4X0MA 3MGYA 2YCSA 4IDTA 4KSQA 3R8VA 5HORA 3DTWA 2PZPA 1NW1A 2WKMA 1KE9A 4FV7A 4JQEA 3VQUA 3R2BA 4I6FA 3C50A 4O2ZA 4UY9A 4ZSEA 1KE5A 1EH4A 4YZBA 3V8WA 5H2UA 3WOWA 5A6OA 5F9EA 4IIRA 1IA8A 3AQVA 4EH4A 2QR8A 3QWKA 4ENXA 4YMJA 2XM9A 4MNEA 2OFVA 2WMWA 4OLIA 3R73A 5JFWA 3LCOA 4DHZA 4JBVA 3WIGA 4GT5A 1PXPA 4QMSA 5CQUA 4U3ZA 2J0KA 4YLKA 3C5IA 4QMUA 5EI6A 3DJ5A 2E9UA 3HRFA 3PJ3A 3WZKA 4CMTA 3PXFA 2JKOA 4PMSA 2XIKA 3H9FA 3K5VA 4OR5A 4RIWA 4EBWA 5C03A 3FEGA 2C47A 3MFRA 5JZNA 4BCMA 4OBPA 1GOLA 2VWVA 5CF4A 1QPCA 4B4LA 4JG7A 3UJGA 5AP4A 5IF1A 5F94A 5E8YA 2XKFA 3FZOA 3TV7A 4ZJVA 1JOWB 5DRDA 3R9DA 1PMVA 4M12A 4D1ZA 3LJ2A 5HVJA 4EOMA 4UZHA 4C38A 2YM6A 4O0RA 4RX9A 3PZEA 4X2NA 2XNNA 4ITJA 3VUKA 2ZVAA 4EOJA 1LUFA 5AEPA 4BRXA 4QQJA 1BYGA 1PXKA 2RKUA 3FMEA 3DA6A 2J50A 3OY1A 2PE0A 4DG2E 3LOKA 1OMWA 4HPTE 4HCTA 2YN8A 3V6SA 5J8IA 5FXRA 2BPMA 2RFDA 1OL2A 2ITVA 1S9JA 3BU6A 1BX6A 5HNGA 4M69A 1H24A 3MA6A 5A4CA 3RJCA 5IA2A 2ITNA 4M15A 4DEAA 4NEUA 4EOPA 3FHIA 4DT9A 4ANLA 4BWKA 5CAQA 5EI2A 3NWWA 5EFQA 4DDIA 3BWJA 1UWHA 3MH1A 4EK6A 3MYGA 4G5JA 1KV1A 4PDPA 3FYJX 1U5RA 4O83A 2V22A 2HZ4A 2Y0AA 4EH7A 3CY3A 5HKMA 3S2PA 4PV0A 3VBYA 2JIVA 3NGAA 3P7BA 4NJDA 3U6IA 2NRUA 4QTBA 3ZRMA 2F4JA 3EQFA 1O6KA 1DAYA 3COHA 3E88A 3SQQA 3ULZA 2R64A 4YLLA 3R83A 3MVJA 3FQSA 3FLQA 4EHEA 4U9AA 2CLQA 2YFXA 4QP7A 2FO0A 1PKGA 4FG7A 3DQWA 1ZRZA 1SYKA 2EU9A 3LM0A 2OICA 4QTDA 2FYSA 4USDA 2VZ6A 2B9IA 1BMKA 5G6VA 5DHJA 1P4OA 3VUMA 4C59A 4E5BA 4RWIA 4WRSA 2PE2A 2DQ7X 3FLYA 3CBLA 1U54A 1URWA 2YM5A 4RIYB 4QYYA 4F0FA 3LQ8A 5B7VA 4DEGA 5ITAA 5BMMA 3W2SA 3R04A 4IHPA 2OH0E 2OZAA 2VTJA 5GJDA 3W2OA 2IF8A 3FLSA 3TG1A 4C8BA 1JSTA 2YM3A 3CP9A 2W9ZB 4ZSLA 3MSSA 5HU9A 3EJ1A 4Y5QA 5GJGA 1W83A 3KXZA 3QRUA 4IAAA 4DF3A 2HCKA 4F99A 1M2PA 3PG1A 4R1VA 5TT7A 4I6LA 5BVEA 2GQSA 2GNFA 3TKHA 3H10A 4TT7A 1OM1A 2HZIA 2XKCA 3PJ2A 2FA2A 3GB2A 4LGDA 4BYIA 4HVHA 5I0BA 2RFNA 1Z9XA 3CIKA 4DH3A 1YOLA 2QR7A 4L00A 5DVRA 5HG7A 3KK8A 4IM2A 5JMSA 4BCGA 2UVYA 3BYVA 2OU7A 3R22A 5A14A 2XYNA 4D4SA 3KY2A 5FUTA 3E62A 5HHWA 3VW8A 4L43A 1FGKA 1WAKA 1OL7A 2ITUA 2VTNA 4FSRA 4KIQA 4EH3A 3A4PA 2AEGA 4YGAA 2QI8A 4C0TA 3DY7A 2XF0A 4H1JA 3NNWA 2UZTA 1YDSE 3KULA 2QC6A 3U4WA 4MH7A 1CKJA 1FOTA 3VS4A 5EKNA 4EH6A 3FPQA 2OJ9A 2F49A 4BWXA 3C51A 4S33A 5M44A 4AXFA 4BGHA 3R8LA 2WU7A 2J2IB 2YLEA 2HELA 3ANRA 3EL7A 4GU9A 3UC3A 4BTFA 2IVVA 3AC1A 3D2IA 3FE3A 3P79A 4JDHA 4EK4A 1SVHA 4GK2A 2FSOX 2YZAA 4IJPA 3T8OA 2RL5A 5ANJA 5FDXA 3S3IA 5BX0A 4HCVA 3TJDA 2ZDUA 1WBOA 1A06A 2C3KA 3DV3A 3F3VA 3LLTA 3QUPA 5L6OA 3CEKA 2Z2WA 3FV8A 3EQDA 4ARKA 4YZMA 2R3IA 2GMXA 3L8PA 1W0XC 2VGOA 3C9WA 2V7AA 2PUNA 2C6LA 2R3RA 4MVFA 1FPUA 5HU3A 4EH5A 4RJ7A 2XK3A 4J95A 1IR3A 4BI2A 2J7TA 4NIFB 5ETFA 4F9CA 3PE2A 4C62A 5ANKA 2VX0A 5DR6A 4AP7A 5DA3A 3KEXA 3TEIA 4G34A 1RE8A 4ASEA 5M06A 3PJ8A 2C1BA 2QO9A 4IZAA 4E1ZA 4RWLA 2JFMA 3ETAA 5IISA 3DKOA 2GTNA 2YM7A 4N4SA 3VVHA 3R1NA 4QMOA 4R1YA 3AD5A 2YIXA 3L1SA 5D7AA 4ACDA 4D55A 3TDWA 2CCHA 3VS0A 4MYGA 3E8EA 2HAKA 1WBSA 4FEXA 5FP5A 2UW0A 4RIOA 2X81A 3VF9A 4FK3A 4P4CA 5LVMA 5ETAA 3BV3A 5KMKA 4QNAA 4PTCA 4F7JA 3MY0A 4GW8A 3HA8A 3SW4A 2BZJA 4FTOA 2AYPA 4BBMA 4ZTQA 3BLAA 4ZSJA 1M52A 3LKMA 1WBWA 5KE0A 3A60A 1UU9A 4BDGA 3HP2A 3NR9A 5DI1A 2ZOQA 2H96A 5M08A 1BI7A 2ITWA 3FXZA 5C4KA 3VBWA 3O0GA 2VTHA 3OWLA 3KMUA 4EJNA 4IEBA 5IA0A 3FDNA 1JKSA 1YDTE 4FKSA 4FV0A 5H8GA 5DYJA 2QG7A 3QCQA 4CZYB 5K4IA 2C68A 1ZOGA 1OPKA 3F5UA 3AGMA 3IW5A 3ZBFA 4A9TA 3UO6A 5CVGA 3PXQA 2JIIA 2E9VA 2OXDA 3FMJA 4BZNA 1YWRA 1I09A 2PK9A 3PPKA 1R3CA 3D4QA 3EN9A 4KNBA 4XG2A 4IH8A 3KCFA 4MF0A 3UOLA 3ZDIA 3ZMMA 5IQAA 1APME 3ZTXA 2CGVA 3AXWA 3FL5A 2J90A 4KS8A 4J53A 3B8QA 4IWDA 4DGGA 4M0YA 1H0VA 5TE0A 4AFEA 4XP2A 2VTRA 4NH1A 1H27A 3OW3A 3Q6WA 4F7NA 4AAYA 2CNQA 4LRMA 3QUEA 3QCYA 1ZOEA 4L3PA 3AKLA 4XLIA 3H9RA 4I92A 4TTHB 3U8WA 4YP8A 4Z55A 3TCPA 3QF9A 3RZBA 4C37A 3FLWA 5JFSA 4FTUA 5J5SA 3GFEA 2IVSA 1YXXA 3GUBA 3BLQA 3ZO4A 3BL9A 2ZJWA 3FMNA 4QMWA 4FNXA 4BDBA 2BDWA 2OIBA 2YACA 5CS6A 3QD0A 4F9YA 5BVNA 2JITA 4FEVA 4RG0A 4CFXA 1PXIA 4IE9A 5DR2A 4OTFA 2WIPA 3A7HA 4ANQA 5CEKA 3FJQE 5EQPA 5IQEA 3UVQA 4U45A 4M8TA 1KV2A 3L9PA 4UXLA 4X2JA 1MUOA 5ANDA 4QP2A 2C6KA 2WMVA 4JRNA 1ZZ2A 3R71A 5E90A 3LCTA 4IB3A 2X7FA 2YIYA 1UU8A 4I6HA 5K5XA 3TNIA 4K0YA 3HAMA 5M4CA 4HYSA 2R3OA 2Z7QA 3IDBA 3G6HA 3H4JA 4MXCA 3R9HA 4F6WA 4ENYA 5K4JA 2A1AB 5KHXA 4EC8A 5C27A 1K9AA 2GU8A 4EUUA 1W2FA 2GCDA 4ASZA 4FKQA 4JJRA 3FI4A 5CSPA 3JUHA 3VS3A 5FDPA 4FGRA 3NRMA 5L3AA 2BDJA 3KN6A 3NUYA 2O3PA 2FSLX 4FTJA 4PP7A 2W1EA 3QL8A 1XBCA 4QPAA 4B99A 3GVUA 2A2AA 3IW8A 2PVHA 5FWKK 3E64A 5I9ZA 3E8DA 4BDJA 4UMTA 4BC6A 2C1AA 3GP0A 4PRJA 1Q3WA 3LFFA 4D1SA 3TN8A 4FYNA 4O21A 2YJRA 1OL1A 1PXJA 3ATTA 2R3MA 3NYOA 3PY0A 5EH0A 5JGAA 2GQGA 3ZM9A 2C69A 4DFNA 4FTCA 5I9YA 4GJ3A 4GFMA 5H3QA 3RVGA 4EUTA 3LQ3A 4TWOA 4IBMA 4JIAA 4E6QA 2ZV7A 3QU0A 4LOQA 3P0MA 4ZTRA 3W0SA 3QQGA 1OKZA 4EK3A 2UW9A 4O7NA 4YTCA 4Y46A 2JDVA 2PZ5A 2G01A 3O17A 5C4LA 2ZV8A 3ZZWA 5DT0A 3TZ8A 3ZEPA 2BUJA 2WIHA 2XIZA 5HLWA 3R01A 4FKIA 2Q0BA 3HX4A 4AAAA 3A7IA 3BBTB 5AR4A 4C36A 1P2AA 1Q8TA 2XRWA 4UX9A 1JSVA 5BYLA 3ODYX 3ZOSA 4AXAA 4R78A 2BRBA 2VX1A 4B8LA 5ACBC 4D0XA 4J52A 4PUZA 3W0MA 5CI6A 5DFPA 5HLNA 1F0QA 3WE4A 3S1HA 3SRVB 2QOBA 4FT0A 3OOGA 4FSQA 4E26A 4A06A 4ONAA 2PZIA 3CE3A 3G9NA 3GU8A 2HOGA 2OH4A 2ETMA 4X3FB 3O96A 2VV9A 1NVRA 3R63A 4ZS0A 4ASXA 1SVGA 2J6MA 3Q4ZA 4XBRA 3H0YA 4FKTA 1J91A 2VTLA 5AJQA 3CJGA 5AR5A 5BVKA 1FMOE 4AZWA 2UZNA 5TKDA 5GZAA 3CQWA 4IB0A 5FBNC 4BKJA 4XP3A 3HLLA 3RINA 4FNWA 1ZZLA 3OWPA 4I6QA 3A8XA 3E3PA 1VYWA 4JIKA 4XRJA 3RM6A 4XMOA 1ZAOA 3TV6A 5IU2A 2EXCX 4ACGA 1WFCA 3O5AA 4YZDA 4II5A 3ALOA 4IFCA 5DN3A 2REIA 3QCXA 1Y8GA 1PYXA 1U5QA 4RZVA 4G5PA 2GHMA 3DCVA 4KIOA 5CASA 5LCJA 3C5UA 2OJFE 4EZ7A 2XAMA 2XNEA 2VO7A 2R4BA 2YITA 3NAXA 4X3FC 2QLQA 2O8YA 2XK4A 3GC7A 4D1XA 1ND4A 4BCFA 4BJJA 1U4DA 4TWPA 3KIOC 4CFUA 2C4GA 3Q52A 3QFVA 4OAUC 3FZRA 1OL5A 3AKKA 1FVRA 4I94A 5LWMA 3EWHA 2PUPA 2E2BA 4OUCA 3UZPA 1ZYDA 5JT2A 2WMUA 5EKOA 3UNKA 1R1WA 2YHVA 5HQ0A 4TZRA 3AC8A 2PHKA 4I1ZA 4LDTA 2B1PA 5AAGA 3CKWA 3VIDA 3OFMA 4LQMA 3FY0A 3QQJA 4K18A 4WUAA 1R78A 5D7VA 4KWPA 4IZ7A 2IJMA 3TNHA 5HE3A 4EHVA 2RFEA 4YC6A 3MPMA 3I5NA 4MEDA 5EI8A 1VJYA 2XKEA 3NEWA 4LMUA 1XH6A 4Z9LA 5EW3A 3ZU7A 2ITTA 5M55A 3F6XA 3UG1A 1OUKA 3TL8A 3PVBA 2VTTA 2XJ1A 4QMMA 5DRBA 3PSDA 3HMPA 4K11A 3WYYA 4AT3A 4CMOA 5EHYA 4F4PA 2HZNA 2OW3A 4D2SA 4ZZMA 4DYMA 4M68A 3RPVA 2X6DA 4IZYA 5AUZA 3CR0A 4IWOA 3QRIA 4TYIA 3SLSA 4ANBA 4Z16A 2JDTA 2QOKA 4FV9A 4FKWA 5HO7A 3EH9A 2YABA 2A0CX 3MJ1A 2PWLA 5L2IA 3E7VA 3IKAA 5J7BA 2C5OA 4ANMA 4FT9A 4BICA 4ANNA 3MBLA 4CZUA 3H30A 1JQHA 4BCOA 4MXXA 5DMZA 2I0YA 2UUEA 1GZ8A 4PPBA 3N4TA 4W9XA 4FKVA 4BCKA 3OBJA 3FMMA 4FSUA 3V6RA 1G3NA 1GZKA 5DT3A 5BUIA 5BUJA 2CGWA 2QHNA 4XOZA 3ZLYA 1Q97A 3I0OA 4WBOA 2V55A 3BPRA 3CQUA 4RJ8A 2DS1A 3MTFA 2P0CA 3ROYA 3RMFA 4EHZA 4G9RA 4WT6A 3UO4A 4BF2A 2B54A 3DKCA 4E6CA 4O7LA 3HKOA 2VAGA 2BFXA 1H08A 3TWJA 3Q32A 5ANOA 4GFOA 4EWQA 1STCE 5T3QA 5EYDA 5HI2A 3EQPA 4P7EA 1LEWA 1I44A 5JEBA 2ZMCA 4RC4A 3FZTA 3PFYA 3PJCA 3WZEA 3BI6A 4FK6A 4DFXE 4R3RA 3F3WA 5IQIA 3G0FA 4CSVA 4YC3A 3FZSA 1XH5A 4R5YA 5LWNA 2GS6A 3D7ZA 5M07A 4XHKB 4ERWA 2A19B 3P7CA 3SW7A 3HAVA 2WTCA 5BUEA 4FX3A 3LXPA 3NPCA 1ST0A 3CGFA 3GC9A 4AF3A 1PJKA 1JKKA 3MWUA 4IVDA 5KX8A 5EYKA 3PVGA 4YTFA 4DGMA 1ZLTA 3QUDA 2HIWA 4FZ6A 5GZ9A 4AE9A 2AQXA 2X4ZA 4APCA 1NVQA 4HNFA 3DZQA 2VGPA 4AW1A 1PW2A 1UA2A 2OZOA 4TWNA 4QP8A 3ZC5A 3ZUUA 4HGLA 5GJFA 4QDEA 4BWPA 1Q8WA 4RIYA 3ZUTA 3FMDA 3E5AA 3K54A 3LFNA 4YC8A 3F3TA 4IAZA 4C4GA 4W4VA 2Z7SA 4I20A 3VS7A 2NNWB 1GZNA 4XBUA 3DS6A 3BEGA 4FL2A 3L9NA 5FXSA 2J51A 3DJ7A 4ZLOA 4TRLA 4V01A 3QZIA 2YM8A 3PIYA 4F65A 1NVSA 4W8EA 3F3ZA 3MDYA 4UWCA 4W9WA 3VS2A 1UWJA 5T68A 4C4FA 4G16A 2YCQA 3NX8A 5LMAA 2PVJA 4F9WA 5JKGA 4NU1A 1PYEA 1MP8A 1GAGA 1OITA 2QVSE 3HA6A 4ZTHA 3LMGA 4NM3A 3C1XA 2CGXA 4BCNA 5LVOA 2F2UA 3BWFA 5CAOA 3U6JA 2ONLA 5LMKC 1PF8A 1H1WA 2P4IA 1KE6A 4R7IA 3V5PA 2AC5A 3A2CA 4K1BA 4RWKA 4ZY4A 4KABA 3LFBA 3Q9ZA 4DEDA 5CU0A 4OW8A 3LLAA 3C4EA 4M97A 2VTMA 3SV0A 2XIYA 3FI2A 2EWAA 4CNHA 3QCSA 2JKKA 4NM7A 2OJJA 1Y8YA 3OCSA 1YWVA 2H6DA 3EQCA 3KRWA 3O50A 2YISA 5HX6A 1XQZA 5GIPE 3MY5A 4O1OA 1E9HA 2QOHA 4NK9A 4D2VA 5AIKA 3OT8A 1IAHA 3MH0A 2RSVA 4RX8A 5D10A 2NO3A 5IQHA 4EI4A 2RG6A 4FNZA 5K0XA 5IG1A 1H1QA 1OIYA 3UOJA 4YZCA 2C0OA 4FIEA 4QP3A 4KINA 5IUIA 3POOA 4PWNA 4A9UA 2ETRA 2XIXA 4U79A 4WOVA 3SKCA 3UOKA 5JQ5A 5I5ZA 2BRNA 4FV8A 3RGFA 2X1NA 4R3PA 5KUPA 3OTVA 2JGZA 4R5SA 4DGNA 3VHKA 2J0LA 1YVJA 3LE6A 5M4UA 2EVAA 3FC1X 4FE2A 4D2WA 3SG9A 3TXOA 2BROA 4ITHA 2BIYA 3DKFA 4IB1A 4RVKA 5C8MA 2OBJA 2OKRA 5LCKA 2R5TA 4AGWA 5E8XA 5HTIA 1K3AA 4D9UA 2PYWA 5CTPA 4O84A 5IH5A 3HGKA 4BGQA 3AC4A 3OD6X 4FKPA 3UNJA 2XBAA 4U3YA 1JSUA 4GG7A 3LQ5A 4IWPA 5FQDC 3R30A 3PDTA 2B9HA 2BAQA 3NYXA 4X2FA 3ZCLA 2JBPA 3AOXA 4Y73A 4HVDA 1UU3A 4H3QA 3DAJA 3HV4A 3Q2MA 1H28A 2JIUA 1JKLA 3BELA 1Q3DA 4AE6A 1BKXA 4EBVA 3LMHA 4PX6A 1YHWA 2WHBA 4FTIA 4QPSA 3ACJA 5KNJA 1RJBA 5E92A 3DZOA 4NTSA 4RC2A 3QLFA 5DGZA 3TNPC 1ERKA 3PPZA 1ZYSA 2XM8A 5HLPA 1W7HA 2JDSA 2X2KA 4M0ZA 2CKEA 2VNWA 2JLDA 1CMKE 3QQLA 5AP1A 4BHNA 4IVCA 2VX3A 4YU2A 4UMRA 4JMQA 3KU2A 2IZTA 4LOOA 3DLZA 3QC9A 5KMOA 4DEEA 4FZAB 2J5EA 3GI3A 3TT0A 3QHWA 3EB0A 4GIIA 3R7GA 2PZRA 2XYUA 4XH6A 4C4IA 3VHEA 2X2MA 4YTHA 3C4FA 5GHVA 3RPSA 4FODA 2WPAA 2XB7A 3FXXA 4OTDA 3VW6A 1O6LA 4XOYA 1YDRE 2GS2A 1W2DA 3QA8A 5LOHA 3W16A 5IDNA 3ANQA 3FKNA 3KC3A 2OK1A 2BAKA 2WAJA 1E1XA 3QC4A 4IZ5A 4KBCA 4MCVA 4ALWA 3MW1A 1XH9A 2OXXA 4FOCA 1E1VA 4G6LA 4H3PA 4RMZA 3QGYA 4WNPA 1PXOA 4UWYA 2RFSA 5GIOE 4U97A 2I40A 3LFQA 4FRFA 2VU3A 4CV9A 2W1DA 4JBQA 2UZOA 5FM2A 4TXCA 5EM7A 4BCPA 1NT2A 4HYHA 5BVWA 2W4KA 4WKQA 1Q5KA 4BDAA 1W98A 2VWXA 3A62A 4IX5A 4WG4A 4EQUA 5B2LA 2DYLA 3FY2A 5HE2A 4NM5A 5HCYA 3S4QA 4DITA 4L44A 4OT6A 5M4FA 3QD3A 3R6XA 4Q9ZA 4B8MA 4C3PA 4FR4A 3II5A 3A8WA 3W1FA 4HCUA 4EZ5A 3COIA 4KSPA 3F5PA 4QMZA 3TZ7A 5IKWA 3U55A 4K6ZA 4YJQA 5ANIA 3BHTA 2XARA 4AS0A 4FYOA 4X3JA 4BN1A 3KF4A 4NZWB 5CAVA 4AZFA 3VBXA 1OKWA 1XH7A 2W06A 1WCCA 3O7LD 4RIXA 5HBJA 4BI0A 2C5XA 3OBGA 5CEQA 4NJ3A 1PHKA 3RNYA 5J95A 3HMOA 4LYNA 4TYHB 5F4NA 5KZ0A 3GU6A 3F2RA 4FEWA 3UQGA 4O7YA 5IQGA 4FT3A 3O2MA 4IW0A 3TKIA 3KXXA 2XNMA 4CV8A 4ZJJA 3CTQA 3UIXA 3D5WA 1AQ1A 3R1SA 5CAPA 4EKKA 5JRSA 3NFGB 4L68A 3IDPA 4PY1A 3RALA 3QTIA 2XZSA 4FTQA 4YJPA 3VQHA 3WIKA 3HECA 4LG4A 2PPQA 2W9FB 1J7IA 3TNWA 4KA3A 4AN3A 2IZUA 5HESA 3HVCA 4CFWA 3HMIA 1CKIA 3O8UA 4J8MA 2RIOA 4O0TA 1H07A 4I6BA 3U4UA 4BGGA 4L42A 3NZ0A 2PVYA 1LPUA 1Q8UA 1Y6BA 4EONA 5HTCA 1CKPA 4ITIA 5F1ZA 1DI9A 3F9NA 4UMUA 2XNOA 4H3BA 4AW2A 4B6LA 4C4HA 3NVMB 3W0RA 4JAIA 4A4LA 4M84A 5JQ8A 2I0EA 1H1PA 2WQOA 4JG6A 5HNBA 4CCBA 3RHKA 3TYKA 5DNRA 5LQFA 4DBNA 3GT8A 4J97A 5A46A 4MUQA 3VONA 1KE7A 2X6EA 2OJGA 1CDKA 3KXNA 3OEFX 4MHAA 4NFMA 3ML1A 4J7BA 2PE1A 2GDOA 4WRGA 5FXQA 3P7AA 3ZDUA 4LI5A 5DIAA 5T6KA 4A9YA 4L53A 4TYGA 1KOAA 3I7BA 4QEBA 4ACCA 2GPHA 4KRDA 4QO9A 5AP3A 4DCEA 2Z60A 4CD0A 4DHIB 4PMPA 3EQHA 2IVUA 3C0HA 4U40A 2BKZA 2R3KA 2W05A 4RX7A 3QALE 4GK3A 1SVEA 2G9XA 4QYHA 3I4BA 3SRVA 2WTVA 5EM5A 2X0OA 2PVNA 2JBOA 5HIBA 5A3XA 2C6IA 4CTBA 5CANA 3CS9A 4FI1A 4E93A 1CSNA 4X3FA 4ALVA 4NM0A 4YURA 1PRYA 4AX8A 4B9DA 2WTIA 4X21A 2V5QA 3DBDA 3DT1A 3BHVA 2KULA 2YDJA 4AT4A 2HY81 4JXFA 2HW7A 4KBAA 4FTKA 4TW9A 5CY3A 5HBHA 2OLCA 2QOOA 3DDQA