4YTFA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune diseases
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
289
structure length
283
Chain Sequence
TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
total genus 99
structure length 283
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytfA01
4AW0A 4FOBA 4ZSAA 4MYGA 4C4IA 5AV0A 5AAGA 5I9UA 3HKOA 1HOWA 4WBOA 5FTOA 4TNDA 4IJPA 2X8EA 4O0XA 1FMOE 3LM0A 3T3VA 1YWNA 3TV7A 1UNLA 1ZYDA 4IWPA 3S1HA 4OBPA 4Y85A 4F7NA 1YI4A 4NYEA 2ITQA 3R71A 4QYYA 3OF0A 4AT5A 4PNIA 3EN4A 3GXLA 4RVTA 3VHKA 2QO9A 4ZSEA 3EKKA 4QP9A 4LM5A 3G51A 3VUDA 5IA3A 3DU8A 4GEOA 2WMQA 3TZMA 4QRCA 4RZWA 4HGEA 4ASZA 2OJIA 4DA5A 2XRUA 1H4LA 4RVKA 3FLNC 4M3QA 2V22A 4YZDA 3CGOA 3R7EA 4RIXB 2YIQA 3P5KA 3SV0A 4CT2A 4KIPA 3TV4A 2PVYA 4KAOA 2J0LA 5FXSA 4HVIA 4E4MA 3V5QA 1HCLA 2FH9A 3FYKX 3HMPA 1OI9A 2DQ7X 5E7RA 3W10A 5J1VA 1FPUA 1PXNA 3Q4ZA 3U9NA 3PVUA 1Q99A 4ASDA 3HAVA 4LL0A 2W4KA 4PL3A 3QCYA 4ZSJA 2BHHA 2R64A 3E7OA 4E6AA 5JSMA 5JQ5A 2QOHA 3LIJA 2YITA 4BCFA 3COMA 4CXAA 4O7YA 1WVWA 1JNKA 3UIBA 3SG9A 2UUEA 3BLQA 4BCHA 1IAJA 3FPMA 2OGVA 3OT3A 4XOYA 4O0UA 4FTNA 4L53A 5CU0A 4R1VA 1JAMA 1IASA 2YCSA 4IQ6A 4QP8A 5AR8A 5HTCA 1SMHA 2VO7A 3BQRA 4BDIA 3L9MA 2IZSA 5E9EA 1T46A 2PMIA 1YOMA 5BPYA 3LE6A 5C1QB 4HZSA 2LGCA 3TXOA 1OBDA 2VTMA 2ZDUA 2GNFA 4R5SA 3QTXA 4QMUA 3DTCA 3R9OA 3OEFX 4X2FA 2VWZA 4EZ3A 5L2WA 3A7FA 3AMYA 4YJUA 4CQGA 2QU5A 3NUYA 2W5AA 1KE7A 3BV2A 4NIFB 5CX9A 5HO8A 3RMFA 1PKDA 1ZY4A 4BHZA 3QZGA 5HBEA 3VN9A 5CVFA 1SVGA 4L52A 5BYYA 4YNOA 3OEZA 3WZEA 3ZXZA 3EH9A 3ODZX 4DH1A 5KMOA 1PF8A 2HWOA 3UVQA 2DYLA 1U54B 1A06A 5EQYA 1WMKA 3BELA 3FKOA 4FV0A 3CEKA 2XIKA 4MBJA 3D7TB 4AXAA 1FQ1B 1XR1A 2JFMA 4UWBA 3Q53A 2BRGA 4N57A 2XK3A 4D28A 3NMUF 4YJNA 5CZIA 3LXLA 3VJNA 1W8CA 3UMXA 5AP4A 4ANNA 5ICPA 3MI9A 3F7WA 3WZKA 3BHYA 3CBLA 3FZTA 4PRJA 5JGBA 4B9DA 3G6GA 3VF9A 4K6ZA 1SNXA 4DF3A 3E5AA 4LUDA 4L00A 4DH5A 4R7IA 3ZSIA 4FK6A 2UZVA 4CZUA 3PWYA 4I6QA 5AUYA 3DZOA 4A06A 2WOTA 4YNEA 1R78A 2ZB1A 3CPCA 3QC4A 3TNWA 2JIUA 4JG8A 5HESA 2IZUA 3BYOA 4YO4A 2C5YA 3HECA 2OWBA 3JR1A 4P4CA 1H1WA 2VO6A 3E63A 3V5LA 3PPKA 1S9IA 2QOOA 3W8LA 3R73A 2YWPA 4DGMA 2CPKE 2GU8A 1WVXA 3A61A 3GU6A 1PMEA 4DFUA 5CI7A 2ITNA 3DK3A 4F63A 1FMKA 1NW1A 2XKDA 3ZLYA 3ERKA 2XNPA 4L01A 3NUUA 4PX6A 4YJPA 3E7VA 2R7BA 2ETKA 2XNOA 4FV2A 2VNWA 4KIKB 4U41A 4C0TA 3AC1A 4BYIA 4A9SA 4BBFA 2GS2A 3ZO2A 4PP9A 5IEVA 5FP5A 3T9IA 3QWKA 4UBAA 2CGXA 4XP0A 4J98A 4QOXA 4EWQA 4FGRA 3W18A 3F3WA 3OY1A 4RC4A 4UMQA 3MY5A 3QTUA 4CD0A 3EN9A 3B8QA 2CGUA 4IAZA 4B0GA 2ITZA 2HY81 1UU8A 4I20A 2ZVAA 4DH8A 2NPQA 2F7EE 2EB2A 3ZRKA 1AGWA 5KKRB 3QQGA 4FV7A 2HWPA 4FKWA 4PMMA 4H58A 4TT7A 4EH7A 2C1BA 4O6EA 4MF0A 3HV7A 4PDYA 4A4LA 4MD7E 2C6MA 5BYZA 2EB3A 3QCXA 3C13A 4D2WA 4CG8A 4V04A 3P86A 4J71A 3ORXA 4YZNA 5J79A 1J91A 1GZOA 3K3IA 4H1MA 2O5KA 4I0SA 4OTFA 4EHVA 4F6SA 1WZYA 2YERA 4G3GA 4IZYA 2X6DA 4XP2A 4WBBB 3LZBA 4FIHA 4MCVA 4F1TA 3VWAA 4C4FA 3ROCA 4JDKA 5FXQA 4GUBA 2C0TA 3ZUTA 4CFVA 3E88A 4R7HA 3TTJA 1ZZLA 3LFAA 3OUNB 2DS1A 2W05A 4CTCA 1ZOHA 5FWKK 4OR5A 4M14A 5BVWA 1X8BA 3ORTA 5HVYA 5D10A 1Y8YA 4E6CA 1Q4LA 1OUKA 2E2BA 3Q9WA 1OIRA 1VYWA 1WBWA 2YIYA 3ORIA 4ZS0A 5F94A 4HW7A 2F9GA 3DOGA 4HYHA 4MKCA 2PZPA 4R5YA 4S2ZA 4ZTNA 3VS3A 4XOZA 5BMSA 5CEOA 1ZAOA 3CKWA 4AG8A 1H27A 4LMUA 4RJ3A 3PTGA 4FEUA 2BZKB 2C6TA 2PVJA 5DG5A 3RZBA 4QYGA 3BYMA 3UMWA 2W0JA 3HRCA 2WGJA 3R7GA 4N0SA 5JRQA 3VS0A 2EWAA 1H08A 3F9NA 3ZXTA 4C37A 1BI8A 4TY1A 3EJ1A 5CZHA 5E8ZA 2BAQA 5DT3A 2VNYA 3B2TA 5IA0A 4I94A 4LMNA 2QLUA 4BCNA 3QD3A 3D14A 1DI8A 4L46A 4MWHA 3EFLA 2J90A 4ZXTA 4KB8A 5CENA 1OKYA 3QRUA 3KXHA 4U3YA 4FI1A 2J9MA 3LXPA 5E8YA 4AA4A 3LVPA 2ZM3A 4M15A 2CKPA 4UWCA 2X39A 4PQNA 4BF2A 4CFFA 4CZYB 3VUMA 3N51A 4GG7A 4AGDA 4F70A 4DT9A 2R3JA 4WNKA 4AA5A 5AUUA 4TYIA 1P5EA 3R30A 1CSNA 2F7ZE 2WAJA 4OTDA 5EM8A 5AM6A 3TKHA 3ENMA 2IVSA 4R3CA 2KULA 3MBLA 4L43A 1UWJA 1PHKA 5D7AA 3UBDA 4DC2A 4XMOA 1URWA 3CC6A 4RIYB 4UY9A 4RFYA 4WG5A 3ORMA 5JZNA 2BMCA 5AM7A 4FEWA 4EJNA 3DQXA 4FTJA 3BHTA 4RC3A 3Q96A 3K3JA 4N6YA 3N4VA 2OO8X 2CLXA 3PYYA 4ASEA 2NNWB 2VRXA 2YISA 2P2HA 4XNEA 3KVWA 5ANEA 3VHEA 2ETMA 3IDCA 3PZHA 5AUWA 4I24A 5HD4A 3DLSA 2VO3A 4ACDA 4C62A 5DYJA 2BPMA 1STCE 3NX8A 4G6LA 1JKKA 2YIRA 4RIOA 2X8IA 4TYEA 4D2TA 3RKBA 2X2MA 3TUBA 2BRHA 2R7IA 1WBVA 2WO6A 1JKTA 2B7AA 4FZDB 4IADA 4PMPA 2YAKA 3W2PA 3LLAA 4U44A 3RHXA 3TNQB 5DHJA 4HCUA 4QTCA 5GHVA 3IS5A 4RSSA 3ALOA 3DQWA 5I4NA 4EH9A 5KZIA 2YM5A 3Q2JA 4G9CA 3QLGA 1YXTA 3VQHA 4F0IA 1JSTA 3IKAA 5KX8A 2UZWE 3NW6A 3C0GA 2QOIA 4M66A 5DR9A 1JSVA 1Q5KA 4D2SA 5BVFA 2O65A 3ETAA 4FIIA 5D11A 5TKDA 3Q5ZA 3GENA 2OH0E 2VU3A 1GIIA 3MPAA 4HPUE 1YI6A 4J95A 4IH8A 3SRVB 3IW5A 5C9CA 3A7JA 3G90X 5IA5A 2WMVA 5I9VA 5E8WA 5HLPA 3TTIA 3VVHA 5AAEA 4X6RA 3IECA 4QYFA 5C8KA 3R8LA 4D2VA 5HO6A 3ZDIA 4XJ0A 2YM3A 3MY1A 4JDHA 5AA8A 4FTOA 4XV2A 5KMJA 4F65A 5H3QA 1OVEA 5HBHA 3SAYA 3QTRA 3UIXA 4CFXA 1E9HA 3FXZA 3OP5A 4QQTA 4YJQA 5A9UA 4JBQA 2JKKA 3OWLA 5DEWA 4ZZMA 3VJOA 4I23A 2JDTA 2JAVA 2YM4A 3QL8A 5EYMA 4CCBA 4YMJA 4CG9A 5HOAA 2BRBA 4O84A 4C36A 3PP0A 4FIGA 2QG5A 3OD6X 2B55A 5F95A 3RPVA 3MA3A 1KE5A 3FEGA 2BDJA 5KMKA 2CKEA 4FOCA 3PY0A 3CQEA 4EOKA 2GTNA 2VTOA 5ETFA 1K2PA 4C33A 4RWJA 4RWKA 4QTBA 4D9UA 4MNFA 3VS7A 2UZEA 3CLYA 3FV8A 3I6WA 4FZAB 1KE8A 4Q9SA 2YWVA 4FTQA 4FZFB 5H2UA 4H39A 4M13A 3TZ8A 4AN3A 4QQJA 4XP3A 1BL7A 1YDSE 4ZJIA 3TJDA 4DGGA 4FKPA 2HZNA 2OIQA 3A7IA 3LQ8A 4O0VA 4X6QC 1OECA 1QPEA 4ZLZA 3BPRA 2C6IA 2XNBA 4FV5A 3MTFA 4YTIA 4NCTA 4L67A 1G8SA 1JVPP 3GC7A 5AP2A 3C9WA 3QXPA 4OTRA 5I9ZA 2PYWA 1FOTA 3ODYX 3P0MA 4FF8A 2UV2A 2O2UA 3RM7A 3SW7A 4O0WA 4G31A 2UW9A 3IDPA 4L3PA 5IPJA 5K9IA 4QP3A 5FDPA 5JGAA 5LMBA 3H30A 1AQ1A 2WEVA 4PTEA 5F9EA 3EYHA 5BVNA 2WTKB 5CEIA 4CQEA 2W96B 3IGOA 4FVQA 5CWZA 3RVGA 3S00A 2OI4X 5HU9A 3MESA 2BTSA 2BCJA 4USDA 1PXJA 2V62A 4QP6A 4XS2A 3NVMB 5A14A 4R77A 1XKKA 3D94A 4KRCA 4LRJA 3D5WA 4MX9A 4WHZA 4FV9A 3QZFA 5LVLA 3NYOA 3RWQA 2PVNA 4QMLA 3TN8A 3PJ2A 3RCJA 4LGHA 4U8ZA 2Y6MA 3ZU7A 4DTKA 3MFRA 5HICA 4NM5A 4DGNA 5ANKA 5A6NA 2WMRA 3MV5A 3COHA 4C61A 2GNHA 2VN9A 4BB4A 4C34A 2Z7SA 2PZYA 2RFSA 3F5UA 4HYUA 5DNRA 3VRZA 2JBPA 3MIAA 1YXSA 3Q9YA 3EQPA 4EH2A 2VGOA 4IX6A 3LCKA 2ZAZA 3DB6A 3OCGA 5JKGA 3E8CA 2H34A 4CRLA 2OU7A 2GHGA 5EDRA 4DHFA 4UYNA 4WOVA 3DNEA 5HG9A 3CIKA 5IQGA 4MQ2A 1W7HA 3ZUVA 4EOSA 2R3LA 5L8JA 4TRLA 2FUMA 3BU3A 3O50A 3SOCA 1M2RA 2ZM4A 3WE4A 4AOJA 3BIZA 3P4KA 2YFXA 4MD8E 5EYCA 2OIBA 3IK3A 3OHTA 4YGAA 3GB2A 4U3ZA 1NVRA 4KS7A 2RG5A 4I6HA 3COKA 5IDPA 2B0QA 2W1ZA 3CJFA 3NW5A 4TZRA 5AUTA 4ZMEA 4KINA 4MVFA 1XBBA 4PF4A 3KA0A 3ACKA 2QO2A 3QU0A 5FBNC 4B6LA 4O7RA 3UZTA 3R00A 5B0XA 3RTPA 3VBYA 5IZFA 2Q83A 3V51A 1JQHA 4WUNA 2QOCA 1PMUA 1A48A 3VO3A 2PUNA 4G3DA 4AN2A 3TKIA 5EK7A 4KS8A 3FPQA 2YAAA 1ZRZA 4E4LA 4RVMA 3RJCA 4KSPA 3AGLA 4KA3A 4QMPA 4TWCA 4EC8A 4FSZA 2X4ZA 4M12A 1FBNA 3S95A 2W5BA 2Y4IC 2BDWA 3TDVA 3EQFA 3PJ1A 4WO5A 3KRXA 3ELJA 1BYGA 3D15A 4D4VA 3LFBA 4TYJA 3S4QA 3IONA 4G3FA 3CSVA 3KXXA 3HMMA 1UVRA 1L3RE 3TDWA 4YZCA 4AS0A 4O2PA 5IQAA 4GKHA 1ZMWA 1LP4A 2FO0A 3E87A 3IO7A 3UIUA 4EJ7A 3M42A 4BTKA 4O7WA 5EM6A 4PNKA 3MVHA 3OW3A 4FSQA 4EH8A 4BZOA 3KULB 3QCQA 3LFCA 5HVJA 2JGZA 2P4IA 4PDPA 5EI6A 4A9TA 5K0XA 2ZOQA 2O63A 4XH6A 1PXLA 1GZNA 4FSRA 3QX4A 4V0GB 3UIMA 4I3ZA 3FQEA 4BTMA 4EONA 5BUEA 4CYJA 2ERKA 2VTHA 3GEQA 4JRVA 3SDJA 5J1WA 4G5JA 4FBXA 1WBTA 3O7LB 3PUPA 2OXXA 4YC8A 2HOGA 4ZK5A 5DRBA 3QX2A 2FA2A 4BFMA 5KMLA 5HE1A 2B9IA 4HVDA 4YHTA 4Z3VA 3RPRA 5M09A 2QR7A 1J7IA 5EHLA 5ETAA 5IA4A 3PA5A 3IW4A 3R28A 1R1WA 3UO5A 5FP6A 4L9IA 4FZ7A 4NL0A 2VTIA 2VTNA 3UOLA 3BHVA 4QO9A 5E1SA 4IBMA 1TQMA 3QGWA 5KBQA 5AWMA 3N4UA 3LCOA 3NNWA 3QAME 2X1NA 2DUVA 2J0KA 4Y8DA 2WHBA 4RJ7A 3BGZA 4BIBA 3O51A 4FKQA 3SX9A 5CVHA 1XH5A 3ID6C 4AWIA 3VBWA 4ID7A 2BALA 1REKA 1ZY5A 4ZJJA 4W4WA 4PTGA 3UNJA 3DKCA 2WQBA 3NUNA 3MN3A 2H9VA 3I7CA 2UZDA 3L8PA 4I41A 5CY3A 4JLCA 3UJGA 2CMWA 2XCHA 3QZHA 4RJ6A 4CNHA 4AT3A 1ZYCA 5AFVA 4F9CA 2W9ZB 3FMLA 5E8VA 2G2FA 3HZTA 3NYXA 3UOJA 1R39A 3HNGA 4MD9E 4QMTA 5IH6A 3GC0A 4IM0A 4FK3A 4IC8A 1RQQA 3FY2A 5AIRA 4ZJVA 4XG8A 5BNJA 4CFMA 2C5NA 3OCTA 2ZJWA 2X6EA 4PY1A 3ZSHA 4LOOA 2B9FA 4PUZA 5ETIA 3MPTA 4JQ7A 3RALA 4A4OA 5HI2A 3RINA 4EKKA 5HE3A 2HW6A 3NNVA 5CXHA 4D4YA 4IE9A 4YJTA 4APPA 4D55A 4DFLA 2HZ0A 5EDQA 4M69B 5ITAA 4AX8A 4RC2A 5BUIA 2C30A 3OBGA 4L8MA 4NFMA 4ZOGA 5AMNA 2A27A 4P2KA 5LQFA 4FNWA 2GPHA 4ZY4A 3H4JA 2CCHA 2BROA 3FMEA 5LMKC 4J96A 5FGKA 3CQWA 3KFAA 3OTVA 3QYZA 4NZWB 5EW8A 4R8QA 3UO4A 4BDEA 2AYPA 5DT4A 5GIPE 5DOSA 2Y7JA 3A4PA 3AMAA 3TUCA 3GCSA 5BYLA 1FVTA 3HV3A 3VUKA 5ANOA 3ZFMA 2W1FA 2C6KA 3VS5A 5M07A 3EFKA 2J4ZA 4L6QA 2RIOA 4A4XA 5L2IA 4IZ5A 3SLSA 4TL0A 2X0GA 4EHZA 4W8EA 4QNYA 1YHWA 5E91A 4BWKA 2EUFB 3HYHA 4JQ8A 3ZEPA 5CQUA 1ZYSA 2OIDA 2UW0A 4YLJA 2RF9A 4IZAA 3UPZA 4DEGA 2VTRA 3KN6A 4G16A 4C38A 4DG3E 2ETRA 4G1WA 5CU4A 4XUFA 4IVDA 4O1PA 4AOTA 1K3AA 1J7UA 1B6CB 3P1AA 2XM8A 3I81A 4HVGA 2CSNA 4I4EA 4MF1A 4TKSA 3WBLA 3ZLXA 5GIOE 3BGPA 3W2CA 5FEEA 3SRVA 5M53A 4UMTA 4IHPA 4JG6A 4BGHA 3F5GA 3ZC6A 4EQUA 3FQHA 4FKTA 1OKZA 4LGDA 5GJFA 4U40A 5HEZA 2QD9A 4MXAA 4J97A 1MP8A 4FKUA 4FKRA 3R9HA 3ZO3A 3Q2MA 4NW6A 5HG5A 3D2IA 5AUVA 4D58A 3II5A 3PJ3A 3P7AA 4GYGA 4UMPA 4LL5A 2XM9A 5ACKA 5LVOA 3R9RA 3EMGA 4HYIA 3A7GA 2VWYA 3PRFA 4IJ9A 4C4EA 5CAOA 1Y8GA 4KKHA 4BZDA 5AV1A 3Q5IA 4ANOA 4Z7HA 3ACJA 1BKXA 3R0TA 4GCJA 4DITA 1XH7A 5T3QA 4O7ZA 1IRKA 5CI6A 4DEEA 4JOAA 3C4ZA 3PPZA 3WF8A 1PYEA 4TXCA 4ZY5A 5DMZA 4HGLA 3VBXA 2PU8A 3C4WA 3MFTA 4AE6A 5M4CA 1GY3A 5IUGA 2QNJA 2W1EA 4YPDA 2RFDA 4HVHA 3RPYA 4RA5A 4LUEA 3ZFXA 4O6LA 2R3QA 2WMAA 4Y5QA 4FT7A 4MH7A 2Z7QA 2GS7A 3NZ0A 3QQFA 3RAWA 2X2LA 2IPXA 3Q6UA 4BDHA 5D1JA 2YHVA 3E62A 4UZHA 3GGFA 4YTHA 3NGAA 3I79A 1OUYA 3JUHA 2VWWA 3D5UA 3KGAA 3SXFA 4YHFA 2WMTA 4DEBA 4AZEA 3CS9A 5CLPA 3LFNA 3QTWA 2YIXA 2A4LA 2R0IA 3UYSA 2I7QA 4AQCA 2RG6A 2VGPA 5DA3A 3O0GA 4MEDA 4IM3A 4DCEA 2QG7A 5DEYA 4BY9E 4D2RA 4GG5A 4WUAA 4EK6A 5JRSA 3GCVA 3HEGA 4DFBA 2Z60A 1GZ8A 2VWIA 1LR4A 2VWUA 2Y4IB 1NA7A 1CDKA 2YLEA 4D1SA 2AC3A 3BQCA 4GYIA 4EOPA 2WD1A 4U5JA 1U59A 5E90A 5BVKA 1YKRA 4TNBA 3DV3A 2WKMA 4X2KA 5EOLA 4NEUA 3COIA 3O23A 2HZIA 4WRSA 4FTMA 4GJ2A 4KIKA 2QKWB 4DBNA 4DG2E 3F3VA 4F0FA 5LVNA 2OG8A 1VJYA 4AUAA 5JFSA 4DN5A 4CV9A 4H3PA 3R8UA 3HAMA 4ACMA 4AU8A 3Q6WA 1OPJA 2CLQA 2PVRA 3FZ1A 2WQMA 4JRNA 2GQSA 4K2RA 2JDOA 3BRBA 3FKLA 4APCA 5M44A 3F3ZA 2JD5A 2ITYA 2VD5A 3OWJA 4D1XA 5HKMA 2JDRA 4NTTA 1PXKA 1YXUA 3ZBFA 2UW8A 4EOMA 4USEA 2UVYA 1ERKA 1M52A 5EQPA 3UQGA 1I44A 3ZH8A 4QNAA 5M4IA 4I1ZA 4AE9A 4MXXA 3F5PA 4CLJA 3KMMA 3ORZA 3OVVA 1LUFA 4O7NA 2PVFA 2XK7A 3LFEA 4GH2A 5A54A 3NIEA 3REPA 4X3FA 5HCZA 3ZZEA 4CKRA 5J9LA 2WZJA 4BN1A 1XH9A 2PE0A 5ANGA 2XNNA 4IXPA 5AP0A 4L68A 4O86A 4A07A 2QCSA 3EHAA 4EZ7A 3EN6A 2B1PA 4S33A 1R0PA 3MFSA 3HP5A 2XZSA 3RK5A 2BKKA 3OG7A 1ATPE 2E9OA 2X4FA 2F57A 3R1QA 3S3IA 4GRBA 3T3UA 3UVRA 5A4TA 3MH2A 2J7TA 5J5TA 5CANA 3VQUA 3WIGA 5IA1A 1H28A 3HRBA 4BDFA 1V0BA 5CT7A 4E6DA 5HG8A 1WCCA 1PKGA 1H8FA 3WZDA 1CKJA 4S34A 3FLYA 5EI2A 5LVPA 3PVWA 5HCYA 1REJA 4WIHA 3KRLA 3GC9A 3UODA 1QCFA 3V5JA 4ANMA 2X8DA 3GU5A 4U6RA 4ZAUA 4RIWB 2Z7RA 3W55A 1DAWA 5K5XA 3PXKA 3R7OA 5AUXA 2PZRA 5IU2A 4IAKA 1Y91A 3ANQA 5HORA 3FMJA 1OBGA 4GK3A 2YJSA 3F69A 4R1YA 5EH0A 1V0PA 4JIKA 5KBRA 3UZPA 5CASA 4BDBA 2O3PA 3NR9A 3OXTA 5L2SA 4K8AA 3R8PA 3PJCA 2XYNA 4PMTA 4GFGA 3QD0A 3HL7A 3R01A 3S2PA 4WNOA 2B4SB 2QR8A 3FZRA 3GCUA 4W9WA 4X0MA 5CAQA 4X2GA 4EUTA 3NUXA 4EUUA 2OICA 1CTPE 3JVSA 1CKIA 5CS6A 3DBDA 2RFNA 3SVVA 3DB8A 4QP4A 4FTUA 3ZZWA 3A2CA 3D9VA 2BVAA 3FYJX 3NDMA 3IOKA 1DM2A 3FMDA 3VS2A 4CFUA 2XIXA 4YC6A 3LW0A 2VO0A 3FXWA 3KVXA 3EL8A 4HZRA 4QYHA 4GUEA 4RT7A 4EOJA 4KABA 3HMNA 4WKQA 4AW2A 3OUKA 4FIFA 3ZHPC 5HNBA 4O7VA 2WIPA 3LCTA 1GNGA 4FKLA 3QXOA 4FKSA 1QPCA 4RIYA 2W99B 1O6LA 2QODA 5T68A 4FE2A 3KQ7A 3POZA 3WIKA 3ZRMA 2BKZA 4LOPA 4QP1A 1YXXA 4QMYA 3LPBA 2PTKA 3PE2A 4YR8A 4UMRA 3R1SA 4RJ5A 4P7EA 2ZM1A 4YURA 4IACA 3GT8A 1JPAA 4XYFA 4RX9A 3NRMA 1QPJA 2F4JA 2GNIA 4KKGA 2V7OA 3MFUA 4MBLA 3EFWA 4PV0A 4ZS4A 2W1HA 3R8VA 2ZYBA 4F4PA 2R3NA 4BC6A 3DAEA 4I92A 3GCPA 4DE4A 5BQ0A 3UC3A 3UZRA 5CYIA 1KOAA 1Z9XA 1T45A 3R7UA 3PA4A 5FEDA 1M2QA 3EWHA 4KBKA 4E3CA 3KCFA 3GFWA 5EOBA 4ZTSA 4ZP5A 2HYYA 5J87A 2I1MA 5J8IA 2XF0A 4IWOA 5K4JA 3KN5A 2A0CX 4MXYA 4GK2A 4U79A 2YIWA 1ZMUA 5EYKA 5H8BA 2A2AA 3I5ZA 3ULIA 3ZDUA 4H1JA 4ZIMA 3C0IA 3C5UA 2OZOA 4EI4A 3DKGA 4FNYA 3UP2A 5K0KA 4OTHA 1ZOEA 4CLIA 4W4XA 3RAKA 3PP1A 3JY9A 4QPMA 3AG9A 5HNIX 5FXRA 4ZTHA 3EB0A 3BLRA 1U54A 5CF5A 4O82A 1M7NA 4ZTQA 5IUIA 1YVJA 5TT7A 5KE0A 3THBA 2JIIA 1ND4A 5FUTA 5IG1A 4XEYA 4FSYA 2WOUA 1NT2A 3WOWA 4D0WA 4FIJA 2P0CA 4IVBA 1OIUA 2GQGA 1OKWA 3FAAA 4FGBA 5H8GA 1E1VA 3BKBA 4BCMA 4EC9A 3R02A 4MBIA 3AC5A 2R4BA 1H07A 2VWBA 3ZUUA 3TG1A 4IVAA 4YZMA 2UZLA 4B99A 4F9BA 3PY3A 5KZ0A 3AD6A 3EN7A 2GNLA 4XRLA 4LYNA 5IH5A 1XH4A 2WMUA 3FHIA 5HU3A 3ZC5A 3DDQA 4FKJA 4FSTA 4UZDA 3RZFA 2ITTA 3ZM4A 1NVSA 4E93A 4A7CA 2HK5A 4YJSA 4DGLC 3LQ3A 4Y83A 4IFGA 5HTBA 4GK4A 2I0VA 4ZSLA 4F08A 2OFUA 1Z57A 5HZNA 3BBTB 1O6KA 2XK9A 5HBJA 5IQFA 4EK8A 1Y6AA 4NU1A 2B53A 4O7SA 2QONA 4FV3A 3MGYA 4FVPA 4TWOA 1K9AA 3NNXA 3QC9A 5LARA 2XB7A 3WE8A 3Q32A 2XRWA 3H9FA 5EFQA 3W33A 1XJDA 5HLWA 1S9JA 5HE0A 5HD7A 4WRGA 2ZV9A 4FODA 3NUSA 5B7VA 2VTPA 3A4OX 2RFEA 4LV5A 1TVOA 1ZOGA 4F9AA 2J2IB 3AT4A 3NYNA 3PA3A 4D1ZA 4L45A 2VV9A 4QPSA 4G6OA 3OW4A 2CGWA 3HX4A 3BHUA 2HW7A 4FEXA 5KMMA 2R3MA 4IMYA 3BCEA 1APME 1B38A 3FC1X 4I5PA 4IX4A 4JR3A 3SA0A 2HAKA 4GU9A 4WD5A 5E8SA 3L9NA 3QRIA 4KBAA 3W32A 5KCVA 2PVHA 4OT6A 4QYEA 4AAAA 1FINA 2FSOX 2OXDA 3LM5A 5AP3A 3I7BA 4BKZA 5AUZA 2IVTA 4BVUA 3DK7A 4KBCA 1UKHA 4HNIA 4LQMA 5EHYA 4ACCA 2W1GA 5J7HA 3F3UA 4I22A 4FYNA 3U8WA 3QYWA 4ENXA 4F7JA 4ANSA 2Z2WA 2C0OA 4EOQA 2JFLA 2R9SA 1OPKA 2WMWA 3AC4A 2OK1A 4IANA 4IZ7A 5GZ8A 4C02A 1PMNA 4OTGA 4BDDA 3DFCB 1VEBA 1Q8UA 3CTHA 4XG4A 3IW6A 5FBOA 2IN6A 4GS6A 4F64A 2F7XE 5KKRC 4AP7A 4QMOA 4GFOA 4QMQA 5K5NA 3V6RA 2CJMA 1PRYA 3TCPA 2W17A 4GT4A 4IC7A 5G6VA 3FI8A 2YACA 2GNJA 3HV4A 1Z5MA 5BMMA 2G9XA 1H1RA 5CEKA 5H8EA 3ZM9A 3V04A 4ARKA 5HG7A 4IDVA 5FD2A 2BUJA 2IW6A 5KMNA 3DT1A 3FI4A 4ZLYA 2QURA 3DBFA 2I0YA 3FI2A 4J52A 4NSTA 4BCJA 4TW9A 4ALWA 3AC2A 3MY0A 1JSUA 3H9OA 3QTZA 4P5ZA 1GIJA 3MSSA 4EOOA 5I3OA 5IH4A 4XG9A 4AZFA 3FHRA 1URCA 2CNUA 3CPBA 4YTFA 1U5QA 3CD8A 3AOXA 3QKLA 4QMXA 2W1CA 5DR2A 4ALUA 5JH6A 3F2RA 5EQEA 5B2KA 5M57A 2PPQA 2ZMDA 4BCGA 4W9XA 4YZBA 3SHEA 1CMKE 1Q97A 3I0OA 2CNVA 3SOAA 4I4FA 4FUYA 2XK6A 3SD0A 4DYMA 5B2MA 1BUHA 2QVSE 4X21A 1IA8A 1YHVA 4FZ6A 1KSWA 5CU3A 4JDIA 2ZV2A 2XK4A 3ULZA 2IJMA 4JG7A 1O9UA 3ZBXA 3G5DA 3MA6A 3HGKA 2UZBA 3GU4A 1KV1A 4X3FB 4F1MA 3N9XA 2GDOA 3H0ZA 3WZUA 4RQKA 3A8WA 4C4JA 1BI7A 5IEYA 2PHKA 1UNHA 3G0FA 3QKMA 4Z9LA 1Q24A 2XKCA 5DR6A 3BHHA 2W1IA 1G5SA 4XBUA 4O83A 4AW1A 2VTQA 4KWPA 2VUWA 5F20A 2QKRA 3LXKA 4OLIA 4CFWA 2YDJA 3CXWA 3QLFA 3Q4CA 3MJ1A 4BDKA 5ANIA 4RVLA 1PXIA 3OT8A 2BZIB 3FLQA 3Q60A 3U55A 4JAIA 3RHKA 3QD4A 4FTLA 3R9NA 4BWXA 5M08A 4XX9A 1AD5A 3VUTA 1FGIA 2PK9A 2PY3A 4J1RA 3TIZA 2REIA 3RBWA 1OPLA 1OL6A 3LJ0A 4CZTA 2Y8OA 3BWJA 3KL8A 4EH6A 4CMUA 3DBQA 2XVDA 4N70A 3RK9A 1Q41A 3A60A 5L6WL 3ZMMA 4BCIA 5J7BA 5LWNA 2PVKA 4C4GA 3HMOA 1WBSA 4JNWA 2OJ9A 3G33A 4IX5A 5CSHA 3P7BA 4YLLA 1PXPA 1Q8YA 3L8VA 4QP7A 1H1QA 1JBPE 4LFIA 4IM2A 5M4UA 4XG7A 3QQJA 4BR3A 4M67A 2G01A 5CVGA 5C27A 1H26A 4F0GA 4G17A 2PZ5A 1TKIA 3KXNA 4D4RA 3RGFA 2J0MB 3LMHA 2BIKB 2NO3A 4EYMA 2PWLA 4V05A 2R2PA 3RAIA 4EBVA 5CF8A 5L8LA 4O0RA 1Q62A 5BVEA 3KKVA 2GFCA 3UTOA 4FC0A 4MXZA 3FLWA 4CKIA 4D0XA 3M1SA 3NSZA 3VRYA 4F1OA 4F9YA 4EQMA 4XLVA 4FMQA 4DH7A 3SC1A 3E3BX 4FL3A 4WSYA 3TEIA 4I6FA 4GVJA 5A46A 5DIAA 4TWNA 4FKVA 2C5VA 4NTSA 4EORA 2C47A 1CKPA 2IVVA 3QUEA 4HCTA 4U81A 3ZONA 4F99A 2PE2A 1F3MC 3D5XA 3OWPA 3D83A 4FX3A 3TT0A 4BWPA 2KTYA 3R7YA 1E1XA 4CKJA 5G1XA 2A19B 3PXYA 4XLIA 4LRMA 2ZDTA 5AP7A 3MH0A 3BV3A 4WNPA 3UPXA 5B2LA 5C26A 3NYVA 3UNKA 2OLCA 2WELA 3GQIA 3FMHA 4M69A 2JDSA 4PDOA 2H96A 2J5EA 3GNIB 3D7ZA 4TTHB 1BX6A 5AP1A 4RLKA 2XIZA 3EQHA 1H0WA 3OTUA 2RKUA 3EN5A 3N4TA 2G15A 4RIXA 1DI9A 4RJ8A 5DLSA 2YEXA 5EDPA 4TYHA 2X9EA 4EOIA 4XRJA 3PLSA 4TWPA 5LMAA 4Z16A 3VUGA 2BZHB 3NAYA 4NUSA 4X7QA 3UP7A 3PSBA 3QQKA 4GT5A 1GZKA 1UV5A 2WQEA 3ROYA 3FSFA 5IQDA 3RAHA 1V0OA 1U5RA 3DFAA 3T8OA 4JX3A 2ZV7A 3LMIA 2C3JA 2C5XA 3C51A 1XH6A 5D7VA 4F9WA 4PPCA 3Q04A 2IO6A 4YHJA 3FL4A 4FUXA 5CXZA 3RK7A 3TNHA 4EHGA 4EQCA 2I0EA 1OB3A 2B9HA 4JBPA 2CN8A 4GIIA 4RFMA 3SGCA 4RQVA 2QQ7A 3UDBA 1BL6A 2IZRA 5LMKA 4MWIA 5C4LA 2OH4A 4EK5A 3RPOA 3G15A 1YWVA 2WQNA 1IEPA 2XH5A 4MXCA 2CCIA 5T6KA 4QMSA 4ZZOA 2PULA 2CN5A 5CU6A 4JIAA 1KWPA 3P79A 1OL5A 4NM7A 4AZSA 3HA6A 3UOKA 2YCRA 3E8DA 2A1AB 4FT3A 5CAVA 4S31A 4BDAA 2WXVA 2BILB 4U43A 3UG2A 4AACA 1XHAA 2EVAA 4NIFA 3GQLA 4ANLA 4BDGA 4C7TA 5BUJA 3R7VA 3QCSA 5L2QA 1JWHA 5I0BA 3EQRA 3FMMA 3SG8A 5GZAA 4UXQA 1MQ4A 1FVVA 1KE9A 1VZOA 1UA2A 2WMBA 3LAUA 4WA9A 3KRWA 4JL9A 4AT4A 4H3BA 2UZUE 3PSCA 4RX5A 4FKGA 3LCDA 1JLUE 1G8AA 2XEYA 3K5UA 3ORKA 4JXFA 3KXMA 4YPSA 5JMSA 5IMEA 5CSPA 3L9LA 1WBNA 1OL7A 2XKEA 3SW4A 2RSVA 5EM7A 3I6UA 3WF9A 4FNXA 4K1BA 2VX3A 4UYAA 1DAYA 5FTQA 2Y9QA 3E8EA 3HV6A 2LAVA 3G0EA 2YM6A 5IQCA 5AJQA 4WG4A 5ACBC 4YO6A 2I6LA 3K2LA 3MPMA 5CAUA 2XNEA 4O0YA 4NT4A 3NUAA 2WPAA 1F0QA 4GFMA 4MQ1A 3QRJA 4G5PA 4QQ5A 4JQEA 4LV8A 2G2HA 3IOPA 4R3PA 5IMXA 5AR3A 3QKKA 4U0IA 4M7IA 4I21A 3D5VA 5E1EA 3TIYA 2OFVA 4CFNA 3U6JA 3CP9A 3FLSA 3D2KA 2J51A 3JXWA 5AV2A 5FQDC 4O1OA 3WF7A 5EG3A 5FM2A 2ITWA 4QMVA 4XBRA 1PYXA 5L8KA 3CKXA 3KRRA 4GKIA 3OC1A 2R3HA 5LXMA 3OXZA 4FKIA 3OBJA 4FT9A 1ZMVA 2WU6A 4OT5A 3QHWA 2Y0AA 4MTAA 5AP6A 3G6HA 4O0TA 3IGGA 2VWXA 2FYSA 4DLIA 3CCNA 4ENYA 3PVBA 3P78A 2VZ6A 4WG3A 4ZEGA 5KUPA 3F82A 2XBJA 3PRIA 3HA8A 4UALA 1OZ1A 3LJ1A 2VX1A 4NK9A 4C3FA 5DPVA 4JT3A 4QD6A 1ZYLA 2Z7LA 2X81A 4OTPA 3CTQA 3QA8A 2EXMA 2UW7A 3OS3A 3W2QA 4EOLA 2QOBA 4IAYA 5CSWA 1F5QA 2PUUA 4MHAA 5GNKA 1P14A 3PSDA 3KF4A 3P23A 4IB5A 4C59A 2R0UA 2UVZA 2Q0BA 1SZMA 2BIYA 4ASXA 4F7LA 3FZSA 1WFCA 5AEPA 4EKLA 1H1SA 1ZWSA 3NLBA 2YZLA 3NCGA 3QTIA 4U42A 3KULA 2W9FB 2XBAA 2VWVA 3QWJA 3S0OA 2HY0A 4PPAA 2C5OA 2FSMX 3DGKA 3R04A 3F61A 3ORLA 3VS6A 3RP9A 4V0GA 4ALVA 3LQ5A 2R3IA 5FTGA 2WTDA 3LXNA 5C8NA 1YDRE 4CGAA 3QQHA 2YM7A 1BLXA 4I93A 2ITUA 3FBVA 4M68A 4DFXE 5IISA 3PXZA 3AXWA 3V3VA 3KF7A 4OTIA 3DBEA 4OUCA 4DH3A 2XIRA 4NH1A 3O8UA 4MXOA 4P5QA 4QPAA 2Y6OA 3G9LX 3EQIA 2XKFA 1P2AA 4O22A 3VAPA 4OAUC 4BYJA 2C6DA 1OKVA 4NJ3A 3TV6A 3DPKA 4G9RA 4CYIA 5EM5A 1W98A 1LPUA 3F7ZA 3IQ7A 5IQBA 2J0JA 5DE2A 5DVRA 3TI1A 5HIEA 4FL1A 4NJDA 2ITOA 5KMIA 5CSXA 5A4CA 3VS4A 3MIYA 4KIQA 1SNUA 4XV9A 3TNPC 3QALE 3VBVA 3FLZA 5JFXA 3UC4A 3PIYA 4D4SA 5M4FA 4N6ZA 5FM3A 2AUHA 3R8ZA 3LMGA 3QTSA 5E92A 4KNBA 2UZTA 3PXRA 4XV3A 4F6WA 1MRVA 4QTAA 1UNGA 1YQJA 4PDSA 3V01A 1YRPA 4BDCA 1Y6BA 2GHLA 2ONLC 2JBOA 3HRFA 2C3KA 4JVGA 5A4LA 4DT8A 5EI8A 5E8TA 5EKNA 1R0EA 3A8XA 5EHOA 3TZ9A 3B8RA 5LCKA 4NCTC 4ANQA 3C4XA 4HVSA 4L42A 4FTIA 1V1KA 4C4HA 5HO7A 4S30A 3TM0A 2V55A 3P7CA 1H1PA 2WTKC 4FV4A 4A9YA 2WIHA 4X2NA 3RPSA 1SVEA 3V6SA 2P55A 4K9YA 1U46A 3KREA 4FICA 2HXLA 5IQIA 3V5TA 2WNTA 3O17A 4E5BA 3I60A 4HCVA 4KIOA 2OZAA 3BYSA 1DS5A 4BTFA 3ORPA 1OITA 1RJBA 3FUPA 4GT3A 4O21A 5GJGA 4BGGA 2VX0A 2Y4PA 3U6HA 4E73A 4Q5HA 4UN0C 3DS6A 3LFSA 3E92A 2XNMA 2J0IA 1NY3A 3AD5A 3LOKA 4FVRA 3T9TA 4UMUA 3GBZA 3WILA 2C4GA 2C68A 2GNGA 2J5FA 3ATSA 2YCQA 2Z8CA 5DH3A 5LJJA 3ZEWA 4UWYA 5JK3A 3C5IA 4RWLA 5AR7A 3ENHA 5F4NA 5IDNA 5CEMA 2YABA 3JS2A 4M0ZA 5AAFA 3VNTA 2NRUA 4QMMA 3BE9A 4TN6A 1CM8A 4PMSA 3WARA 4HGTA 2FSLX 2R3PA 5IF1A 2PVLA 2X7OA 3KMWA 3ZOSA 5JZJA 4TYHB 3B2WA 3HUCA 3QQUA 1RDQE 4UB7A 2XK8A 4KD1A 5LOHA 1W83A 3ITZA 4ITIA 4IWQA 5DFPA 5EYDA 2ITPA 5C01A 4BBMA 2R3OA 2JDVA 3P9JA 3C1XA 2W7XA 4R7BA 4ZTMA 3TWJA 2XEZA 3SXRA 1Q8WA 1XBCA 4GSBA 3F2AA 3F66A 5I9XA 3UVPA 3ZS5A 3GU7A 3GVUA 2C3IB 3V8TA 2J6MA 3QGYA 3A7HA 1YOLA 2QU6A 4PL5A 2UZNA 2QLQA 4Q2AA 1SVHA 4BCOA 2P33A 4F09A 1OGUA 3CQUA 5EW3A 2WTWA 4I5CA 1WBOA 4HYSA 3UGCA 3LKMA 4RA4A 2VTAA 3MVMA 5AX9A 1JOWB 1JKSA 4Q5EA 3LFDA 3PDTA 3A62A 2IVUA 2JKQA 2P3GX 2XIYA 5FLFA 4W4YA 5TF9A 3R6XA 1UKIA 4IB1A 3VBQA 4IB0A 4EZ5A 4Y5HA 2BFXA 3OOGA 4J53A 4U45A 3FZOA 3VIDA 3PVGA 3BZ3A 3D7TA 4J8MA 3MYGA 4MAOA 5DN3A 3VBTA 2XYUA 3QUDA 5KNJA 1OL2A 2QI8A 4O91A 3QA0A 2R3FA 1U4DA 2G1TA 3QBNA 4M84A 2IW8A 5L6OA 3HUBA 4OBQA 2XP2A 1TQPA 3H9RA 3FXXA 4GU6A 3R83A 3P08A 1IA9A 3VUIA 2ZMCA 3F5XA 2ITXA 4DTAA 2QHNA 3D4QA 3ET7A 2X9FA 4AGWA 4DGOA 4ZTRA 2PE1A 5JFVA 4JS8A 4G2FA 4GIHA 4DFNA 4ZMFA 2J50A 1J3HA 3PY1A 3UO6A 2GCDA 3H0YA 3QQLA 3R22A 3K54A 5DT0A 4L7SA 5CSVA 3QTQA 4C3PA 3EQDA 4QQCA 4XG2A 3CR0A 3H10A 4DTBA 4FTCA 5AA9A 2JC6A 2JITA 4Z55A 3D0EA 4YSMA 5C4KA 1G3NA 2ZV8A 3ZCLA 4E20A 2VTSA 2NRYA 3E64A 4NKAA 4WNMA 4USFA 4YP8A 4F6UA 4FTTA 3C7QA 3OOMA 5CAPA 4E4NA 5HTIA 4NM0A 1MRUA 3VS1A 3V8SA 3MJ2A 4FT5A 5LVMA 4I6BA 2Z02A 5ANDA 3CY2A 4U80A 3PXQA 2ZB0A 4D5KA 1I09A 4FSUA 1EH4A 4JI9A 3UG1A 4ACGA 4G3EA 3DY7A 4O2ZA 4DFZE 2O0UA 4BIDA 3OFMA 4CTBA 3I0QA 3RI1A 2O64A 2AC5A 4AZWA 4IAFA 3MDYA 2JKMA 5JFWA 5HHWA 5L2TA 4V01A 3O7LD 4L3LA 3GP0A 5FRIA 4K0YA 3ZTXA 3TKUA 2E9UA 3TNIA 4KRDA 4YTCA 2WB8A 4IFCA 3ZLSA 4H3QA 1IG1A 3PIZA 3ZRLA 4W4VA 4EK4A 3G9NA 4GJ3A 5BVDA 3M2WA 5FG8A 4B8LA 2PUPA 4E5AX 3HP2A 3FJQE 2C6OA 3PG1A 1FVRA 3RNIA 3BX5A 3F88A 4GMYA 2E9PA 3QFVA 5DRDA 5TE0A 1IAHA 4B8MA 5IA2A 3KMUA 5EW9A 4NM3A 1OM1A 1TQIA 4BKYA 5DWRA 3CE3A 3TJCA 4ZZNA 2PMLX 3W16A 4BDJA 5HNGA 3BYVA 4HJOA 3JY0A 4A9UA 4CSVA 2GMXA 3L9PA 4YZ9A 1SM2A 4FTRA 4C3RA 3DJ6A 4ZY6A 4AW5A 4IAAA 3CY3A 5K4IA 4J99A 2RL5A 3NS9A 2QC6A 3KB7A 5I5ZA 2GHMA 3Q9ZA 4AFEA 4R6VA 4Y46A 3DXPA 4YJRA 1M14A 1M7QA 4BI1A 3E93A 2JEDA 5L3AA 1H24A 1PW2A 5F1ZA 3NAXA 2HXQA 3L8XA 3DKFA 1PMVA 4DINA 3CTJA 5A4QA 4WSQA 4FTKA 2WQOA 3R63A 2EXEA 5H9BA 4QMNA 4E1ZA 4L44A 1W84A 4CCUA 2QOLA 4GVAA 3MVJA 4UV0A 1OIQA 2PUIA 2BAJA 3RNYA 1IR3A 3DAJA 2XS0A 3OCBA 3V5WA 4BICA 5M51A 3FDNA 4O7LA 1GJOA 1SYKA 3EZVA 3O8TA 4RFZA 4O7TA 1ZXEA 3Q52A 4FIEA 2OBJA 5A4EA 2CGVA 2PZIA 3EOCA 3HDMA 4IIRA 4QTDA 2JIVA 3BBWA 3I1AA 4NFNA 4DFYA 4RRVA 4FSWA 2GS6A 1JKLA 2OW3A 4BZNA 4FG8A 3HDNA 3RCDA 4AZTA 3LHJA 3WF5A 3LCSA 4H36A 2OJFE 2YA9A 4LI5A 1A9UA 2G2IA 2GTMA 2IZTA 4GV1A 4XV1A 3NCZA 1H25A 3R2YA 3OXIA 4FSNA 4XG6A 4FYOA 3PXFA 4BCQA 2UW5A 4DG0E 3RWPA 4B4LA 1NXKA 5HX8A 1MQBA 2OJJA 3BU5A 3MWUA 2XJ1A 3CD3A 2BDFA 2R3KA 2B54A 2WU7A 4RPVA 4OW8A 2BAKA 3SQQA 4BRXA 4AF3A 1Q8ZA 1W82A 5DI1A 2ERZE 4AN9A 4UEUA 1GAGA 1LEZA 4O0SA 4OBOA 4BI0A 4EL9A 1Y57A 4AFJA 5KHXA 4FTAA 4PWNA 3DLZA 5LCJA 2B52A 4EH4A 4EH3A 3DXQA 5IUHA 2WTIA 4M97A 4AOIA 4RG0A 3LJ2A 4DAWA 4CVAA 5L6PA 4ZTLA 5JQ8A 4YU2A 5ANJA 3TZ7A 5BVOA 1L8TA 2CKOA 3FMKA 3BEAA 1W0XC 5HIBA 4J7BA 4FR4A 2B9JA 5AR4A 4M8TA 3FQSA 4Y73A 5CEPA 2HELA 4LGGA 3POOA 4S32A 2OZAB 3QF9A 5L4QA 4UX9A 2RGPA 3LFFA 4XCUA 4BHNA 1Q61A 1QPDA 3R8MA 4ITJA 4BGQA 3IW8A 3HV5A 3BYUA 5CF6A 2YM8A 3OCSA 4P90A 4L7FA 3VW8A 3KRJA 1MRYA 3MTLA 3AC8A 4NKSA 3IG7A 3C4FA 5A6OA 3EKNA 3W8QA 4BKJA 2HCKA 3DA6A 2UVXA 1H0VA 2SRCA 3MS9A 5IQEA 4IW0A 2C3LA 1YW2A 4KKEA 4BTJA 4CMOA 4FV1A 1UWHA 4OTWA 4RMZA 3WZJA 2PL0A 3DXNA 3QRKA 4N4SA 3R2BA 4GW8A 3NW7A 2DWBA 3U9CA 4C57A 4M0YA 4D2PA 5HCXA 2ONLA 1M17A 3KU2A 4FKOA 4E4XA 4OGRA 1UU9A 3DNDA 3JYAA 2F2CB 3BEGA 4BCKA 2V5QA 3KC3A 4JBVA 3MW1A 2OXYA 2YN8A 3PG3A 5E4HA 3JVRA 1ZZ2A 2IWIA 4MNEA 3NEWA 1GOLA 5I3RA 1PJKA 1XH8A 2QO7A 3TL8A 3W2RA 5AP5A 3EQBA 4X3FC 4OAVB 3AD4A 2PMOX 5C8MA 4B7TA 4F7SA 1KUTA 1OMWA 4E7WA 5M06A 4JAJA 1P4OA 4U9AA 1WAKA 1HCKA 3DAKA 3Q4TA 4IB3A 2QHMA 2W06A 4Y72A 4DBXA 2ESMA 1M2PA 3FMNA 2WTCA 3EZRA 4EK3A 5HLNA 5I9WA 2CKQA 4ORKA 3Q4UA 5A3XA 3W2OA 1KOBA 3QUPA 3FWQA 3V5PA 5K3YA 4O81A 2OF4A 4FT0A 2PSQA 4EH5A 2Q0NA 5J95A 3EQGA 3BI6A 4FV8A 3UOHA 4AGCA 3BE2A 3H3CA 3L8SA 4ACHA 3AMBA 5JN2A 3NNUA 2CDZA 5IEXA 2UW6A 3AT3A 3FZPA 2H6DA 3MH1A 3QD2B 4O38A 4RJ4A 4RWIA 3DDPA 5HGIA 5AR2A 3C4CA 2O8YA 3O96A 3M11A 1VYZA 4EWHA 5I9YA 3EFJA 2WTJA 4DLJA 4E5WA 4CV8A 2X2KA 2YCFA 2OSCA 5TOZA 3DJ5A 1VR2A 3UQCA 1YI3A 4E6QA 3OZ6A 1PXOA 4X3JA 1Q3DA 5FDXA 3U51A 2HENA 2JLDA 1J1BA 5E8XA 3GC8A 3R9DA 4DEHA 3PWDA 4TPTA 4FEQA 5BX0A 4NW5A 4RBLA 4II5A 1UU7A 2VTJA 2XUUA 5HIDA 4YSJA 4IX3A 3MH3A 4ERKA 4X2JA 2R5TA 3ATTA 1GIHA 5M55A 3E3PA 4ERWA 2GFSA 4QMZA 2F49A 4RGJA 4LG4A 4RX7A 4BBEA 5AX3A 5CALA 5IQHA 3C4EA 4H05A 3GUBA 3SXSA 4QMWA 3BU6A 3F2NA 4YBKA 3RM6A 3V8WA 1O6YA 3HVCA 2YLFA 2WMSA 2BRMA 4LRKA 3EQCA 2R3GA 4NWMA 3OWKA 3WYYA 1J7LA 5E8UA 2C6LA 3KY2A 2IW9A 3VULA 4Q9ZA 4FL2A 2F2UA 3WF6A 3GOPA 5KO1A 4K11A 2UZOA 3IPHA 3AC3A 1KE6A 4D5HA 4GL9A 4U7ZA 4BCPA 4ANBA 2YDIA 4FG9A 1YXVA 2X7FA 3NVKI 4FEVA 1XBAA 4HGSA 5AIKA 4YLKA 4XHKB 2I40A 2BFYA 2WTVA 3FE3A 3NUPA 4L3JA 2XA4A 4MK0A 5GINE 4RLLA 2R3RA 2BRNA 4PPBA 4IVCA 3UNZA 3KEXA 1RW8A 4K77A 4AZVA 2YZAA 5TR6A 2H8HA 4G3CA 3MB7A 4JBOA 5AR5A 3PLAE 2YDKA 3DBCA 4FV6A 3ZFYA 4IWDA 2XMYA 5IKWA 3VUHA 5AADA 3FI3A 3UYTA 1OIYA 3R21A 3OY3A 4JX7A 4JDJA 3EYGA 4A9RA 3PZEA 3U87A 2NP8A 3PIXA 4PTCA 3DZQA 3BLHA 4DEAA 3DJ7A 5HQ0A 3JPVA 4ONAA 4K18A 4OTQA 1Q8TA 2BTRA 3PE1A 2BZJA 4KSQA 2ITVA 4DEIA 3DKOA 2VTTA 4O27B 2W1DA 3AT2A 4I5HA 4FNZA 4YUQA 4FG7A 1ZARA 2P2IA 5GJDA 4PP7A 5CT0A 2PMNX 1PY5A 4K33A 3TUDA 2FGIA 1XQZA 1R3CA 3KK9A 3CJGA 4HPTE 4C58A 5J9ZA 2BR1A 1XWSA 3ALNA 4ITHA 4Y95A 5HE2A 3WI6A 3IW7A 2V0DA 2GQRA 4AGUA 2FVDA 4G6NA 3U4UA 5D9HA 3U54A 3KXZA 3QZIA 2E9VA 3ZLWA 1H01A 3NIZA 4YC3A 4FA2A 2C1AA 5C03A 1RE8A 1QL6A 4RX8A 2OF2A 2W4OA 1MUOA 3KXGA 3VC4A 2UW4A 2WMXA 3LLTA 4O96A 3SKCA 4CRSA 2C69A 4C8BA 3DTWA 2VAGA 1XO2B 2I0HA 4I0TA 2JAMA 2YJRA 1WBPA 3CGFA 5J9YA 2CNQA 4RZVA 2WFYA 3L1SA 3F6XA 4G34A 3FSKA 5CNNA 1H00A 3UE4A 3NWWA 4EEVA 5KHWA 4ZSGA 4KUJA 3FKNA 5JEBA 2W5HA 1P4FA 3G2FA 4C2WA 3U6IA 4IAIA 3OMVA 3U4WA 4TYGA 3MB6A 4XG3A 4BI2A 3DCVA 1YHSA 4YJVA 4QT1A 4YJOA 4EHEA 3GCQA 5D41A 4C35A 5CQWA 2FB8A 5HVKA 3OROA 3K5VA 3O71A 2FSTX 3DK6A 3F3TA 4QP2A 4E26A 3EL7A 4U97A 3ZO4A 3R1NA 4UXLA 2CHLA 4W8DA 4DEDA 4C2VA 1LEWA 4BL1A 3BWFA 4I0RA 2W4JA 2OKRA 5J5SA 5EKOA 1ZLTA 5DGZA 3O8PA 2GSFA 5CNOA 4ZLOA 3VF8A 2C6EA 3GU8A 3KK8A 5AV4A 1J1CA 3C50A 5ETCA 4QTEA 1Q3WA 4HNFA 4CEGA 3NPCA 2HZ4A 4R78A 3PPJA 1WVYA 1NVQA 1UU3A 2C0IA 4CMTA 4IDTA 5TO8A 4CT1A 2PVMA 4PL4A 3PFQA 2ACXA 5CEQA 3Q9XA 5CTPA 3HLLA 4JJRA 5M56A 4HOKA 3C0HA 3FC2A 4Z7GA 1YOJA 2UW3A 3VW6A 3R1YA 4E8AA 3ZO1A 4EBWA 3A99A 2EU9A 5AV3A 3ZSGA 3E8NA 5FEQA 1YWRA 2XJ0A 4J8NA 1PXMA 1BMKA 3I5NA 2HIWA 4D9TA 3AQVA 3GI3A 1FGKA 3QHRA 2XNGA 2EXCX 4I5MA 4WT6A 4BIEA 4FSMA 4JR7A 5CU2A 2IG7A 2QOQA 3KCKA 3Q3BA 3IDBA 2XCKA 5D12A 3GOKA 1OL1A 3I4BA 1B39A 4LOQA 3FL5A 2XJ2A 4RIWA 3ORNA 3W1FA 5DBXA 3R7IA 5LWMA 4IEBA 3MVLA 3TACA 5JGDA 2OJGA 4EYJA 2VTLA 3LFQA 3W2SA 3UQFA 5HX6A 5GZ9A 3ANRA 4DCAA 4R3RA 5JT2A 3PJ8A 3FY0A 3QRTA 5CF4A 2BHEA 2V7AA 1KV2A 3O2MA 3AGMA 3WYXA 3EIDA 1QMZA 2E9NA 2QOFA 2WEIA 2QOKA 4YBJA 4MNEB 3BGQA 1ZYJA 3GFEA 1YDTE 3HMIA 4AA0A 2JKOA 2X7GA 3ZYAA
chains in the Genus database with same CATH superfamily
4AW0A 4FOBA 4ZSAA 4MYGA 4C4IA 5AV0A 5AAGA 5I9UA 3HKOA 1HOWA 5BV3A 4WBOA 5FTOA 4TNDA 4IJPA 2X8EA 4O0XA 1FMOE 3LM0A 3T3VA 1YWNA 3TV7A 1UNLA 1ZYDA 4IWPA 3S1HA 3TYKA 4OBPA 4Y85A 4F7NA 1YI4A 4NYEA 2ITQA 3R71A 4QYYA 3OF0A 4AT5A 4PNIA 3EN4A 3GXLA 4RVTA 3VHKA 2QO9A 4ZSEA 3EKKA 4QP9A 4LM5A 3G51A 3VUDA 4AXCA 5IA3A 3DU8A 4GEOA 2WMQA 3TZMA 4QRCA 4RZWA 4HGEA 4ASZA 2OJIA 4DA5A 2XRUA 1H4LA 4RVKA 3FLNC 4M3QA 2V22A 4YZDA 3CGOA 3R7EA 4RIXB 2YIQA 3P5KA 3SV0A 4CT2A 4KIPA 3TV4A 2PVYA 4KAOA 2J0LA 5FXSA 4HVIA 4E4MA 3V5QA 1HCLA 2FH9A 3FYKX 3HMPA 1OI9A 2DQ7X 5E7RA 3W10A 5J1VA 1FPUA 1PXNA 3Q4ZA 3U9NA 3PVUA 1Q99A 4ASDA 3HAVA 4LL0A 2W4KA 4PL3A 3QCYA 4ZSJA 2BHHA 2R64A 3E7OA 4E6AA 5JSMA 5JQ5A 2QOHA 3LIJA 2YITA 4BCFA 3COMA 4CXAA 4O7YA 1WVWA 1JNKA 3UIBA 3SG9A 2UUEA 3BLQA 4BCHA 1IAJA 3FPMA 2OGVA 3OT3A 4XOYA 4O0UA 4FTNA 4L53A 5CU0A 4R1VA 1JAMA 1IASA 2YCSA 4IQ6A 4QP8A 5AR8A 5HTCA 1SMHA 2VO7A 3BQRA 4BDIA 3L9MA 2IZSA 5E9EA 1T46A 2PMIA 3BLAA 1YOMA 5BPYA 3LE6A 5C1QB 4HZSA 2LGCA 3TXOA 1OBDA 2VTMA 2ZDUA 2GNFA 4R5SA 3QTXA 4QMUA 3DTCA 3R9OA 3OEFX 4X2FA 2VWZA 4EZ3A 5L2WA 3A7FA 3AMYA 4YJUA 4CQGA 4DHZA 2QU5A 3NUYA 2W5AA 1KE7A 3BV2A 4NIFB 5CX9A 5HO8A 3RMFA 1PKDA 1ZY4A 4BHZA 3QZGA 5HBEA 3VN9A 5CVFA 1SVGA 4L52A 5BYYA 4YNOA 3OEZA 3WZEA 3ZXZA 3EH9A 3ODZX 4DH1A 5KMOA 1PF8A 2HWOA 3UVQA 2DYLA 1U54B 1A06A 5EQYA 1WMKA 3BELA 3FKOA 4FV0A 3CEKA 2XIKA 4MBJA 3D7TB 4AXAA 1FQ1B 1XR1A 2JFMA 4UWBA 3Q53A 2BRGA 4N57A 2XK3A 4D28A 3NMUF 4YJNA 5CZIA 3LXLA 3VJNA 1W8CA 3UMXA 5AP4A 4ANNA 5ICPA 3MI9A 3F7WA 3WZKA 3BHYA 3CBLA 3FZTA 4PRJA 5JGBA 4B9DA 3G6GA 3VF9A 4K6ZA 1SNXA 3NFGB 4DF3A 3E5AA 4LUDA 4L00A 4DH5A 4R7IA 3ZSIA 4FK6A 2UZVA 4CZUA 3PWYA 4I6QA 5AUYA 3DZOA 4A06A 2WOTA 4YNEA 1R78A 2ZB1A 3CPCA 3QC4A 3TNWA 4ZMFA 2JIUA 4JG8A 5HESA 2IZUA 3BYOA 4YO4A 2C5YA 3HECA 2OWBA 3W0SA 3JR1A 4P4CA 1H1WA 2VO6A 3E63A 3V5LA 3PPKA 1S9IA 2QOOA 3W8LA 3R73A 2YWPA 4DGMA 2CPKE 2GU8A 1WVXA 3A61A 3GU6A 4QDEA 1PMEA 4DFUA 5CI7A 2ITNA 3DK3A 4F63A 1FMKA 1NW1A 2XKDA 3ZLYA 3ERKA 2XNPA 4L01A 3NUUA 4PX6A 4YJPA 3E7VA 2R7BA 2ETKA 2XNOA 4FV2A 2VNWA 4KIKB 4U41A 4C0TA 3AC1A 4BYIA 4A9SA 4BBFA 2GS2A 3ZO2A 4PP9A 5IEVA 5FP5A 3T9IA 3QWKA 4UBAA 2CGXA 4XP0A 4J98A 4QOXA 4EWQA 4FGRA 3W18A 3F3WA 3OY1A 4RC4A 4UMQA 3MY5A 4O4CA 3QTUA 4CD0A 3EN9A 3B8QA 2CGUA 4IAZA 4B0GA 2ITZA 2HY81 1UU8A 4I20A 2ZVAA 4DH8A 2NPQA 2F7EE 2EB2A 3ZRKA 1AGWA 5KKRB 3QQGA 4FV7A 2HWPA 4FKWA 4PMMA 4H58A 4TT7A 4EH7A 2C1BA 4O6EA 4MF0A 3HV7A 4PDYA 4A4LA 4MD7E 2C6MA 5BYZA 2EB3A 3QCXA 3C13A 4D2WA 4FJVA 4CG8A 4V04A 3P86A 4J71A 3ORXA 4YZNA 5J79A 1J91A 1GZOA 3K3IA 4H1MA 2O5KA 4I0SA 4OTFA 4EHVA 4F6SA 1WZYA 2YERA 4G3GA 4IZYA 2X6DA 4XP2A 4WBBB 3LZBA 4FIHA 4MCVA 4F1TA 3VWAA 4C4FA 3ROCA 4JDKA 5FXQA 4GUBA 2C0TA 4AXDA 3ZUTA 4CFVA 3E88A 4R7HA 3TTJA 1ZZLA 3LFAA 3OUNB 2DS1A 2W05A 4CTCA 1ZOHA 5FWKK 4OR5A 4M14A 5BVWA 1X8BA 3ORTA 5HVYA 5D10A 1Y8YA 4E6CA 1Q4LA 1OUKA 2E2BA 3Q9WA 1OIRA 1VYWA 1WBWA 2YIYA 3ORIA 4ZS0A 5F94A 4HW7A 2F9GA 3DOGA 4HYHA 4MKCA 2PZPA 4R5YA 4S2ZA 4ZTNA 3VS3A 4XOZA 5BMSA 5CEOA 1ZAOA 3CKWA 4AG8A 1H27A 4LMUA 4RJ3A 3PTGA 4FEUA 2BZKB 2C6TA 2PVJA 5DG5A 3RZBA 4QYGA 3BYMA 3UMWA 2W0JA 3HRCA 2WGJA 3R7GA 4N0SA 5JRQA 4LV7A 3VS0A 2EWAA 1H08A 4F78A 3F9NA 3ZXTA 4C37A 1BI8A 4TY1A 3EJ1A 5CZHA 5E8ZA 2BAQA 5DT3A 2VNYA 3B2TA 5IA0A 4I94A 4LMNA 2QLUA 4BCNA 3QD3A 3D14A 1DI8A 4L46A 4MWHA 3EFLA 2J90A 4ZXTA 4KB8A 5CENA 1OKYA 3QRUA 3KXHA 4U3YA 4FI1A 2J9MA 3LXPA 5E8YA 4AA4A 3LVPA 2ZM3A 4M15A 2CKPA 4UWCA 2X39A 4PQNA 4BF2A 4CFFA 4CZYB 3VUMA 3N51A 4GG7A 4AGDA 4F70A 4DT9A 2R3JA 4WNKA 4AA5A 5AUUA 4TYIA 1P5EA 3R30A 1CSNA 2F7ZE 2WAJA 4OTDA 5EM8A 5AM6A 3TKHA 3ENMA 2IVSA 4R3CA 2KULA 3MBLA 4L43A 1UWJA 1PHKA 5D7AA 3UBDA 4DC2A 4XMOA 1URWA 3CC6A 4RIYB 4UY9A 4RFYA 4WG5A 3ORMA 5JZNA 2BMCA 5AM7A 4FEWA 4EJNA 3DQXA 4FTJA 3BHTA 4RC3A 3Q96A 3K3JA 4N6YA 3N4VA 2OO8X 2CLXA 3PYYA 4ASEA 2NNWB 2VRXA 2YISA 2P2HA 4XNEA 3KVWA 5ANEA 3VHEA 2ETMA 3IDCA 3PZHA 5AUWA 4I24A 5HD4A 3DLSA 2VO3A 4ACDA 4C62A 5DYJA 2BPMA 1STCE 3NX8A 4G6LA 1JKKA 2YIRA 4RIOA 2X8IA 4TYEA 4D2TA 3RKBA 2X2MA 3TUBA 2BRHA 2R7IA 1WBVA 2WO6A 1JKTA 2B7AA 4FZDB 4IADA 4PMPA 2YAKA 3W2PA 3LLAA 4U44A 3RHXA 3TNQB 5DHJA 4HCUA 4QTCA 5GHVA 3IS5A 4RSSA 3ALOA 3DQWA 5I4NA 4EH9A 5KZIA 2YM5A 3Q2JA 4G9CA 3QLGA 1G8JA 1YXTA 3VQHA 4F0IA 1JSTA 3IKAA 5KX8A 2UZWE 3NW6A 3C0GA 2QOIA 4M66A 5DR9A 1JSVA 1Q5KA 4D2SA 5BVFA 2O65A 3ETAA 4FIIA 5D11A 5TKDA 3Q5ZA 3GENA 2OH0E 2VU3A 1GIIA 3MPAA 4HPUE 1YI6A 4J95A 4IH8A 3SRVB 3IW5A 5C9CA 3A7JA 3G90X 5IA5A 2WMVA 5I9VA 5E8WA 5HLPA 3TTIA 3VVHA 5AAEA 4X6RA 3IECA 4QYFA 5C8KA 3R8LA 4D2VA 5HO6A 3ZDIA 4XJ0A 2YM3A 3MY1A 4JDHA 5AA8A 4FTOA 4XV2A 5KMJA 4F65A 5H3QA 1OVEA 5HBHA 3SAYA 3QTRA 3UIXA 4CFXA 1E9HA 3FXZA 3OP5A 4QQTA 4YJQA 5A9UA 4JBQA 2JKKA 3OWLA 5DEWA 4ZZMA 3VJOA 4I23A 2JDTA 2JAVA 2YM4A 3QL8A 5EYMA 4CCBA 4YMJA 4CG9A 5HOAA 2BRBA 4O84A 4C36A 3PP0A 4FIGA 3AKJA 2QG5A 4O4EA 3OD6X 2B55A 5F95A 3RPVA 3MA3A 1KE5A 3FEGA 2BDJA 5KMKA 2CKEA 4FOCA 3PY0A 3CQEA 4EOKA 2GTNA 2VTOA 4O4DA 1K2PA 5ETFA 4RWJA 4RWKA 4QTBA 4C33A 4MNFA 4D9UA 3VS7A 2UZEA 3CLYA 3FV8A 2IF8A 3I6WA 1KE8A 4FZAB 4Q9SA 2YWVA 4FTQA 4FZFB 5H2UA 4H39A 4M13A 3TZ8A 4AN3A 4QQJA 4XP3A 1BL7A 1YDSE 4ZJIA 3TJDA 4DGGA 4FKPA 2HZNA 2OIQA 3A7IA 3LQ8A 4O0VA 4X6QC 1OECA 1QPEA 4ZLZA 3BPRA 2C6IA 2XNBA 4FV5A 3MTFA 4YTIA 4NCTA 4LDTA 4L67A 1G8SA 1JVPP 3GC7A 5AP2A 3C9WA 3QXPA 4OTRA 5I9ZA 2PYWA 1FOTA 3ODYX 3P0MA 4FF8A 2UV2A 2O2UA 3RM7A 3SW7A 4O0WA 4G31A 2UW9A 3IDPA 4L3PA 5IPJA 5K9IA 4QP3A 5FDPA 5JGAA 5LMBA 3H30A 1AQ1A 2WEVA 4PTEA 5F9EA 3EYHA 5BVNA 2WTKB 5CEIA 4CQEA 2W96B 3IGOA 4FVQA 5CWZA 3RVGA 3S00A 2OI4X 5HU9A 3MESA 2BTSA 2BCJA 4USDA 1PXJA 2V62A 4QP6A 4XS2A 3NVMB 5A14A 4R77A 1XKKA 3D94A 4KRCA 4LRJA 3D5WA 4MX9A 4WHZA 4FV9A 3QZFA 5LVLA 3NYOA 3RWQA 2PVNA 4QMLA 3TN8A 3PJ2A 3RCJA 4LGHA 4U8ZA 2Y6MA 3ZU7A 4DTKA 3MFRA 5HICA 4NM5A 4DGNA 5ANKA 5A6NA 2WMRA 3MV5A 3COHA 4C61A 2GNHA 2VN9A 4BB4A 4C34A 2Z7SA 2PZYA 2RFSA 3F5UA 4HYUA 5DNRA 3VRZA 2JBPA 3MIAA 1YXSA 3Q9YA 3EQPA 4EH2A 2VGOA 4IX6A 3LCKA 2ZAZA 3DB6A 3OCGA 5JKGA 3E8CA 2H34A 4CRLA 2OU7A 2GHGA 5EDRA 4DHFA 4UYNA 4WOVA 3DNEA 5HG9A 3CIKA 5IQGA 4MQ2A 1W7HA 3ZUVA 4EOSA 2R3LA 5L8JA 4TRLA 2FUMA 3BU3A 3O50A 3SOCA 1M2RA 2ZM4A 3WE4A 4AOJA 3BIZA 3P4KA 2YFXA 4MD8E 5EYCA 2OIBA 3IK3A 3OHTA 4YGAA 3GB2A 4U3ZA 1NVRA 4KS7A 2RG5A 4I6HA 3COKA 5IDPA 2B0QA 2W1ZA 3TMOA 3CJFA 3NW5A 4TZRA 5AUTA 4ZMEA 4KINA 4MVFA 1XBBA 4PF4A 3KA0A 3ACKA 2QO2A 3QU0A 5FBNC 4B6LA 4O7RA 3UZTA 3R00A 5B0XA 3RTPA 3VBYA 5IZFA 2Q83A 3V51A 1JQHA 4WUNA 2QOCA 1PMUA 1A48A 3VO3A 2PUNA 4G3DA 4AN2A 3TKIA 5EK7A 4KS8A 3FPQA 2YAAA 1ZRZA 4E4LA 4RVMA 3RJCA 4KSPA 3AGLA 4KA3A 4QMPA 4TWCA 4EC8A 4FSZA 2X4ZA 4M12A 1FBNA 3S95A 2W5BA 2Y4IC 2BDWA 3TDVA 3EQFA 3PJ1A 4WO5A 3KRXA 3ELJA 1BYGA 3D15A 4D4VA 3LFBA 3W0OA 4TYJA 3S4QA 3IONA 4G3FA 3CSVA 3KXXA 3HMMA 1UVRA 2X0OA 1L3RE 3TDWA 4YZCA 4AS0A 4O2PA 5IQAA 4GKHA 1ZMWA 1LP4A 2FO0A 3E87A 3IO7A 3UIUA 4EJ7A 3M42A 4BTKA 4O7WA 5EM6A 4PNKA 3MVHA 3OW3A 4FSQA 4EH8A 4BZOA 4DDGA 3KULB 3QCQA 3LFCA 5HVJA 2JGZA 2P4IA 4PDPA 5EI6A 4A9TA 5K0XA 2ZOQA 2O63A 4XH6A 1PXLA 1GZNA 4FSRA 3QX4A 4V0GB 3UIMA 4I3ZA 3FQEA 4BTMA 4EONA 5BUEA 4CYJA 2ERKA 2VTHA 3GEQA 4JRVA 3SDJA 5J1WA 4G5JA 4FBXA 1WBTA 3O7LB 3PUPA 2OXXA 4YC8A 2HOGA 4ZK5A 5DRBA 3QX2A 2FA2A 4BFMA 5KMLA 5HE1A 2B9IA 4HVDA 4YHTA 4Z3VA 3RPRA 5M09A 2QR7A 1J7IA 5EHLA 5ETAA 5IA4A 3PA5A 3IW4A 3R28A 1ST0A 1R1WA 3UO5A 5FP6A 4L9IA 4FZ7A 4NL0A 2VTIA 2VTNA 3UOLA 3BHVA 4QO9A 5E1SA 4IBMA 1TQMA 3QGWA 5KBQA 5AWMA 3N4UA 3LCOA 3NNWA 3QAME 2X1NA 2DUVA 2J0KA 4Y8DA 2WHBA 4RJ7A 3BGZA 4BIBA 3O51A 4FKQA 3SX9A 5CVHA 1XH5A 3ID6C 4AWIA 3VBWA 4ID7A 2BALA 1REKA 1ZY5A 4ZJJA 4MUQA 3UDZA 4W4WA 4PTGA 3UNJA 3DKCA 2WQBA 3NUNA 3MN3A 2H9VA 3I7CA 2UZDA 3L8PA 4I41A 5CY3A 4JLCA 3UJGA 2CMWA 2XCHA 3QZHA 4RJ6A 4CNHA 1XMMA 4AT3A 1ZYCA 5AFVA 4F9CA 2W9ZB 3FMLA 5E8VA 2G2FA 3HZTA 3NYXA 3UOJA 1R39A 1OGYA 3HNGA 4MD9E 4QMTA 5IH6A 3GC0A 4IM0A 4FK3A 4IC8A 1RQQA 3FY2A 5AIRA 4ZJVA 4XG8A 5BNJA 4CFMA 2C5NA 3OCTA 2ZJWA 2X6EA 4PY1A 3ZSHA 4LOOA 2B9FA 4PUZA 5ETIA 3MPTA 4JQ7A 3RALA 4A4OA 5HI2A 3RINA 4EKKA 5HE3A 2HW6A 3NNVA 5CXHA 4D4YA 4IE9A 4YJTA 4APPA 4D55A 4DFLA 3NFFB 2HZ0A 5EDQA 4M69B 5ITAA 4AX8A 4RC2A 5BUIA 2C30A 3OBGA 4L8MA 4NFMA 4ZOGA 5AMNA 2A27A 4P2KA 5LQFA 4FNWA 2GPHA 4ZY4A 3H4JA 2CCHA 2BROA 3FMEA 5LMKC 4J96A 5FGKA 3CQWA 3KFAA 3OTVA 3QYZA 4NZWB 5EW8A 4R8QA 3UO4A 4BDEA 2AYPA 5DT4A 5GIPE 5DOSA 2Y7JA 3A4PA 3AMAA 3TUCA 3GCSA 5BYLA 1FVTA 3HV3A 3VUKA 5ANOA 3ZFMA 2W1FA 2C6KA 3VS5A 5M07A 3EFKA 2J4ZA 4L6QA 2RIOA 4A4XA 5L2IA 4IZ5A 3SLSA 4TL0A 2X0GA 4EHZA 4W8EA 4QNYA 1YHWA 5E91A 4BWKA 2EUFB 3HYHA 4JQ8A 3ZEPA 5CQUA 1ZYSA 2OIDA 2UW0A 4YLJA 2RF9A 4IZAA 3UPZA 4DEGA 2VTRA 3KN6A 4G16A 4C38A 4DG3E 2ETRA 4G1WA 5CU4A 4XUFA 4IVDA 4O1PA 4AOTA 1K3AA 1J7UA 1B6CB 3P1AA 2XM8A 3I81A 4HVGA 2CSNA 4I4EA 4MF1A 4TKSA 3WBLA 3ZLXA 5GIOE 3BGPA 3W2CA 5FEEA 3SRVA 5M53A 4UMTA 4IHPA 4JG6A 4BGHA 3F5GA 3ZC6A 4EQUA 3FQHA 4FKTA 1OKZA 4LGDA 5GJFA 4U40A 5HEZA 2QD9A 4MXAA 4J97A 1MP8A 4FKUA 4FKRA 3R9HA 3ZO3A 3Q2MA 4NW6A 5HG5A 3D2IA 5AUVA 4D58A 3II5A 3PJ3A 3P7AA 4GYGA 4UMPA 4LL5A 2XM9A 5ACKA 5LVOA 3R9RA 3EMGA 4HYIA 4BJJA 3A7GA 2VWYA 3PRFA 4IJ9A 4C4EA 5CAOA 1Y8GA 4KKHA 4BZDA 5AV1A 3Q5IA 4ANOA 4Z7HA 3ACJA 1BKXA 3R0TA 4GCJA 4DITA 1XH7A 5T3QA 4O7ZA 1IRKA 5CI6A 4DEEA 4JOAA 3C4ZA 3PPZA 3WF8A 1PYEA 4TXCA 4ZY5A 5DMZA 4HGLA 3VBXA 2PU8A 3C4WA 3MFTA 4AE6A 5M4CA 1GY3A 5IUGA 2QNJA 2W1EA 4YPDA 2RFDA 4HVHA 3RPYA 4RA5A 4LUEA 3ZFXA 4O6LA 2R3QA 2WMAA 4Y5QA 4FT7A 4MH7A 2Z7QA 2GS7A 3NZ0A 3QQFA 3PFYA 3RAWA 2X2LA 2IPXA 3Q6UA 4BDHA 5D1JA 2YHVA 3E62A 4UZHA 3GGFA 4YTHA 3NGAA 3I79A 1OUYA 3JUHA 2VWWA 3D5UA 3KGAA 4DHJA 3SXFA 4YHFA 2WMTA 4DEBA 4AZEA 3CS9A 5CLPA 3LFNA 3QTWA 2YIXA 2A4LA 2R0IA 3UYSA 2I7QA 4AQCA 2RG6A 2VGPA 5DA3A 3O0GA 4MEDA 4IM3A 4DCEA 2QG7A 5DEYA 4BY9E 4D2RA 4GG5A 4WUAA 4EK6A 5JRSA 3GCVA 3HEGA 4DFBA 2Z60A 1GZ8A 2VWIA 1LR4A 2VWUA 2Y4IB 1NA7A 1CDKA 2YLEA 4D1SA 2AC3A 3BQCA 4GYIA 4EOPA 2WD1A 4U5JA 1U59A 3UDSA 5E90A 5BVKA 1YKRA 4TNBA 3DV3A 2WKMA 4X2KA 5EOLA 4NEUA 3COIA 3O23A 2AQXA 2HZIA 4WRSA 4FTMA 4GJ2A 4KIKA 2QKWB 4DBNA 4DG2E 3F3VA 4F0FA 5LVNA 2OG8A 1VJYA 4AUAA 5JFSA 4DN5A 4CV9A 4H3PA 3R8UA 3HAMA 4ACMA 4AU8A 3Q6WA 1OPJA 2CLQA 2PVRA 3FZ1A 2WQMA 4JRNA 2GQSA 4K2RA 2JDOA 3BRBA 3FKLA 4APCA 5M44A 3F3ZA 2JD5A 2ITYA 2VD5A 3OWJA 4D1XA 5HKMA 2JDRA 4NTTA 1PXKA 1YXUA 3ZBFA 2UW8A 4EOMA 3AKLA 4USEA 2UVYA 1ERKA 1M52A 5EQPA 3UQGA 1I44A 3ZH8A 4QNAA 5M4IA 4I1ZA 4AE9A 4MXXA 3F5PA 4CLJA 3KMMA 3ORZA 3OVVA 1LUFA 4O7NA 2PVFA 2XK7A 3LFEA 4GH2A 5A54A 3NIEA 3REPA 4X3FA 5HCZA 3ZZEA 4CKRA 5J9LA 2WZJA 4BN1A 4QEBA 1XH9A 2PE0A 5ANGA 2XNNA 4IXPA 5AP0A 4L68A 4O86A 4A07A 2QCSA 3EHAA 4EZ7A 3EN6A 2B1PA 4S33A 1R0PA 3MFSA 3HP5A 2XZSA 3RK5A 2BKKA 3OG7A 1ATPE 2E9OA 2X4FA 2F57A 3R1QA 3S3IA 4GRBA 3T3UA 3UVRA 5A4TA 3MH2A 2J7TA 5J5TA 5CANA 3VQUA 3WIGA 5IA1A 1H28A 3HRBA 4BDFA 1V0BA 5CT7A 4E6DA 5HG8A 1WCCA 1PKGA 1H8FA 3WZDA 2AEGA 1CKJA 4S34A 3FLYA 5EI2A 5LVPA 3PVWA 5HCYA 1REJA 4WIHA 3KRLA 3GC9A 3UODA 1QCFA 3V5JA 4ANMA 2X8DA 3GU5A 4U6RA 4ZAUA 4RIWB 2Z7RA 3W55A 1DAWA 5K5XA 3PXKA 3R7OA 5AUXA 2PZRA 5IU2A 4IAKA 1Y91A 3ANQA 5HORA 3FMJA 1OBGA 4GK3A 2YJSA 3F69A 4R1YA 5EH0A 1V0PA 4JIKA 5KBRA 3UZPA 2ZFYA 5CASA 4BDBA 3VONA 2O3PA 3NR9A 3OXTA 5L2SA 4K8AA 3R8PA 3PJCA 2XYNA 4PMTA 4GFGA 3QD0A 3HL7A 3R01A 3S2PA 4WNOA 2B4SB 2QR8A 3FZRA 3GCUA 4W9WA 4X0MA 5CAQA 4X2GA 4EUTA 3NUXA 4EUUA 2OICA 1CTPE 3JVSA 1CKIA 5CS6A 3DBDA 2RFNA 3SVVA 3DB8A 4QP4A 4FTUA 3ZZWA 3A2CA 3D9VA 2BVAA 3FYJX 3NDMA 3IOKA 1DM2A 3FMDA 3VS2A 4CFUA 2XIXA 4YC6A 3LW0A 2VO0A 3FXWA 3KVXA 3EL8A 4HZRA 4QYHA 4GUEA 4RT7A 4EOJA 4KABA 3HMNA 4WKQA 4AW2A 3OUKA 4FIFA 3ZHPC 5HNBA 4O7VA 2WIPA 3LCTA 1GNGA 4FKLA 3QXOA 4FKSA 1QPCA 4RIYA 2W99B 1O6LA 2QODA 5T68A 4FE2A 3KQ7A 3POZA 3WIKA 3ZRMA 2BKZA 4LOPA 4QP1A 1YXXA 4QMYA 3LPBA 2PTKA 3PE2A 4YR8A 4UMRA 3R1SA 4RJ5A 4P7EA 2ZM1A 4YURA 4IACA 3GT8A 1JPAA 4XYFA 4RX9A 3NRMA 1QPJA 2F4JA 2GNIA 4KKGA 2XAMA 2V7OA 3MFUA 4MBLA 3EFWA 4PV0A 4ZS4A 2W1HA 3R8VA 2ZYBA 4F4PA 2R3NA 4BC6A 3DAEA 4I92A 3GCPA 4DE4A 5BQ0A 3UC3A 3UZRA 5CYIA 1KOAA 1Z9XA 1T45A 3R7UA 3PA4A 5FEDA 1M2QA 3EWHA 4KBKA 2X0PA 4E3CA 3KCFA 3GFWA 5EOBA 4ZTSA 4ZP5A 2HYYA 5J87A 2I1MA 5J8IA 2XF0A 4IWOA 5K4JA 3KN5A 2A0CX 4MXYA 4GK2A 4U79A 2YIWA 1ZMUA 5EYKA 5H8BA 2A2AA 3I5ZA 3ULIA 3ZDUA 4H1JA 4ZIMA 3C0IA 3C5UA 2OZOA 4EI4A 3DKGA 4FNYA 3UP2A 5K0KA 4OTHA 1ZOEA 4CLIA 4W4XA 3RAKA 3PP1A 3JY9A 4BJJB 4QPMA 3AG9A 5HNIX 5FXRA 4ZTHA 3EB0A 3BLRA 1TZDA 1U54A 5CF5A 4O82A 1M7NA 4ZTQA 5IUIA 1YVJA 5TT7A 5KE0A 3THBA 2JIIA 1ND4A 5FUTA 5IG1A 4XEYA 4FSYA 2WOUA 1NT2A 3WOWA 4D0WA 4FIJA 2P0CA 4IVBA 1OIUA 2GQGA 1OKWA 3FAAA 4FGBA 5H8GA 1E1VA 3BKBA 4BCMA 4EC9A 3R02A 4MBIA 3AC5A 2R4BA 1H07A 2VWBA 3ZUUA 3TG1A 4IVAA 4YZMA 2UZLA 4B99A 4F9BA 3PY3A 5KZ0A 3AD6A 3EN7A 2GNLA 4XRLA 4LYNA 5IH5A 1XH4A 2WMUA 3FHIA 5HU3A 3ZC5A 3DDQA 4FKJA 4FSTA 4UZDA 3RZFA 2ITTA 3ZM4A 4AAYA 1NVSA 4E93A 4A7CA 2HK5A 4YJSA 4DGLC 3LQ3A 4Y83A 4IFGA 5HTBA 4GK4A 2I0VA 4ZSLA 4F08A 2OFUA 1Z57A 5HZNA 3BBTB 1O6KA 2XK9A 5HBJA 5IQFA 4EK8A 1Y6AA 4NU1A 2B53A 4O7SA 2QONA 4FV3A 3MGYA 4FVPA 4TWOA 1K9AA 3NNXA 3QC9A 5LARA 2XAOA 2XB7A 3WE8A 3Q32A 2XRWA 3H9FA 5EFQA 3W33A 1XJDA 5HLWA 1S9JA 5HE0A 5HD7A 4WRGA 2ZV9A 4FODA 3NUSA 5B7VA 2VTPA 3A4OX 2RFEA 4LV5A 1TVOA 1ZOGA 4F9AA 2J2IB 3AT4A 3NYNA 3PA3A 4D1ZA 4L45A 2VV9A 4QPSA 4G6OA 3OW4A 2CGWA 3HX4A 3BHUA 2HW7A 4FEXA 5KMMA 2R3MA 4IMYA 3BCEA 1APME 1B38A 3FC1X 4I5PA 4IX4A 4JR3A 3SA0A 2HAKA 4GU9A 4WD5A 5E8SA 4JMQA 3L9NA 3QRIA 4KBAA 3W32A 5KCVA 2PVHA 4OT6A 4QYEA 4AAAA 1FINA 2FSOX 2OXDA 3LM5A 5AP3A 3I7BA 4BKZA 5AUZA 2IVTA 4BVUA 3DK7A 4KBCA 1UKHA 4HNIA 4LQMA 5EHYA 4ACCA 2W1GA 5J7HA 3W0QA 3F3UA 4I22A 4FYNA 3U8WA 3QYWA 4ENXA 4F7JA 4ANSA 2Z2WA 2C0OA 4EOQA 2JFLA 2R9SA 1OPKA 2WMWA 3AC4A 2OK1A 4IANA 4IZ7A 5GZ8A 4C02A 1PMNA 4OTGA 4BDDA 3DFCB 1VEBA 1Q8U