4YTFA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune diseases
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
289
structure length
283
Chain Sequence
TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 283
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytfA01
1SNUA 4GT5A 4H3PA 4YHJA 3VBWA 5EKNA 5HNIX 3QFVA 5AAGA 2Z02A 1JAMA 2J5FA 2R9SA 3ELJA 4RIYA 4XV2A 3CTQA 3VUMA 3ALOA 2CGXA 5EDRA 2QNJA 2XNEA 4FV5A 5CEMA 3F2RA 2X39A 3WZJA 4G17A 5AAFA 3R7OA 4DN5A 1YKRA 5HBJA 2ETKA 3MA6A 3MB6A 2ZOQA 1YWVA 2JIIA 3D83A 3P7CA 2XNNA 3PWYA 2QODA 4JR3A 1O6LA 4ZEGA 3P1AA 3COKA 5HVKA 2ZJWA 4FIEA 1WBSA 4F7LA 3FMKA 4I5PA 4BL1A 3KXNA 5ANEA 5C8MA 4AZEA 2C3JA 4FT9A 4EH7A 1YOLA 3NCZA 3DBCA 3GXLA 1Q8ZA 3GC9A 2ZYBA 3QZGA 3JVRA 3ZRMA 4Z55A 5J87A 4G5PA 3GOPA 2XBJA 3RAIA 4TZRA 3QTSA 4EBWA 3HAVA 4FF8A 4L43A 1G5SA 2Y4IB 4A7CA 1VEBA 3GEQA 5IEXA 2QURA 3QQUA 3PJ3A 2KULA 4M3QA 5HU3A 4IFCA 4QMPA 4RJ5A 2GNHA 4XNEA 4LOQA 4EHZA 4UXQA 5KMKA 3R1NA 1CMKE 5TKDA 3E5AA 4K11A 5CAOA 4UY9A 5CAUA 1Q97A 5FTQA 2OIBA 1YI3A 1PXJA 2W05A 2I0VA 4FZDB 1CKPA 3TV7A 3JUHA 1XO2B 5FEEA 3HGKA 4OTRA 1GIHA 2UZUE 5ANDA 1UNHA 2NRYA 4NTTA 1HCLA 2I0YA 2WAJA 3II5A 3RI1A 2ERZE 3LFFA 4AF3A 4RZVA 5FXRA 5I9WA 4G6NA 3TJDA 3KEXA 3I5NA 5CF5A 3VULA 4OLIA 4TYEA 4DFXE 1Q8YA 1U59A 2XYUA 1IASA 2YIWA 2V5QA 4ZSLA 4CFUA 4LRMA 3BHUA 2R5TA 2UZNA 4QMWA 3BIZA 4BIEA 3ERKA 3VVHA 2QOKA 2R3HA 3OP5A 5AR3A 5DYJA 5F9EA 3Q9YA 3V5QA 4LGGA 2OW3A 5CALA 1WBNA 4QMUA 3GC8A 3KVXA 4P90A 3ZYAA 4DG2E 4JBOA 1Q3WA 3RCDA 3TUDA 1REJA 2X1NA 4MHAA 5LCKA 1XH8A 4QP3A 3WYYA 3QLFA 2VWIA 4O38A 3WI6A 4EYMA 3E8DA 3T9IA 5EKOA 1J1CA 1JPAA 3FPMA 2C0TA 4BWPA 2C1BA 3DKFA 3AC5A 3M42A 5A6NA 1Q8TA 3PA3A 4I41A 5TO8A 3LE6A 4M67A 3FZPA 5KZIA 3VBQA 1ZOEA 2QOBA 3NMUF 4NM3A 4HZRA 4MEDA 3ATSA 2UW0A 4AGDA 2FUMA 4FSNA 3IDPA 2XIKA 4ZLOA 1YWNA 5B2MA 1NY3A 4DFBA 3IGGA 4EKKA 5HO6A 5K5XA 3G0EA 3F3VA 4A4LA 5GJFA 2HAKA 4YNEA 3VS4A 5M4UA 3VBXA 4XLVA 3UYTA 1M2PA 2VO3A 4RFMA 4B99A 3QCYA 2ZDTA 3O17A 4U7ZA 3EIDA 4UZHA 2GU8A 3ORTA 1OBDA 2GSFA 5CVHA 3PG1A 4DH3A 3QQHA 1JSTA 1PMEA 5B7VA 2OO8X 2WMSA 3PXRA 5DH3A 4HYHA 4FKRA 4BCFA 3FZ1A 4YJNA 4IWOA 5DIAA 1JWHA 4XMOA 2YIYA 4BCQA 3VNTA 3GCPA 2XK6A 3A7FA 5B2KA 5IMEA 3DLSA 3A4OX 3JPVA 3VHKA 3IG7A 4TNBA 4WHZA 3UIXA 1ZYCA 4RVKA 5HIBA 4CT2A 1FVRA 4HGTA 4FNZA 4YR8A 4O83A 4AQCA 2XNBA 3NUXA 3N9XA 3DT1A 2XIXA 3VQHA 1M14A 3BLRA 4F6WA 3BYOA 2UVXA 2ITOA 2R3GA 2WIPA 3A4PA 3DJ6A 3QQFA 3ROCA 3CSVA 2X4FA 2JDOA 4EH6A 3U55A 2R3MA 3QTRA 3UC3A 4NCTC 2XK3A 3BV3A 4B4LA 2IN6A 3RAHA 1BUHA 4CV9A 2X0GA 1KE9A 1OL7A 3C0GA 1Q3DA 3V5WA 1O6KA 2WD1A 5M08A 2HZ0A 2WTIA 1FPUA 4OTWA 4ASEA 4FKVA 3RTPA 3ZSHA 2VV9A 2VWUA 4EK5A 4W4VA 5CANA 4M13A 5M55A 2C1AA 5F94A 1QMZA 3QXOA 4I94A 5FP6A 5A9UA 1J7IA 3R63A 3E87A 2PVMA 3DTWA 4QQTA 5L6PA 3ZC5A 2ZDUA 5F20A 4EONA 4U81A 2SRCA 4BCMA 2J50A 3ATTA 2P55A 3L9PA 4C38A 4QP2A 5CZIA 4KD1A 4S33A 4O1OA 3OFMA 4RJ7A 2QLUA 5FWKK 5L3AA 2XKEA 2X8EA 4O82A 3R02A 4PNKA 2JFLA 4OAUC 4RJ8A 3TZ8A 2BAKA 5C01A 4XJ0A 3GUBA 4C8BA 4DG0E 3DXQA 2ITYA 4I24A 5JGBA 4MQ1A 4J7BA 4K9YA 4IXPA 3QQKA 3TWJA 1T46A 4AOJA 4FG8A 2C5XA 5A4LA 1IA9A 4J52A 4TYIA 4DINA 4O7YA 2A0CX 5D41A 2RG5A 2R3OA 1NVSA 4R8QA 5AP5A 4A9TA 1MP8A 3LFQA 3OS3A 3HA6A 3OWJA 5ANOA 3LXPA 2CCIA 5LWNA 5I9YA 5AMNA 3AT4A 3F3ZA 4IVCA 5AR5A 4TRLA 1NXKA 5KZ0A 3QUDA 5A4QA 2VN9A 3ZEPA 5CEPA 4KIPA 2YLFA 4MCVA 3C4WA 1XJDA 2R7IA 5DVRA 2VO6A 3EKKA 4C62A 3S4QA 2R3IA 1CSNA 3F88A 3UOKA 1P4FA 4I1ZA 3IS5A 2F57A 3OZ6A 2ETRA 3G5DA 5LMAA 3RINA 2QG7A 3ZRLA 1OMWA 2HW7A 1SM2A 4KKEA 3I6UA 2QLQA 3O23A 5GZ8A 3D7TA 3LMGA 5KKRB 2O64A 3AC1A 2FB8A 4E6QA 2W17A 1OVEA 1XH9A 3IOPA 4FMQA 4IACA 4TL0A 5AUVA 5DHJA 5HG9A 4DH8A 3VWAA 4YZCA 3TV4A 2YAKA 4OBQA 4GSBA 2WMXA 1QPEA 4JT3A 4D1ZA 3UIBA 4IHPA 3POOA 4C35A 2I40A 2Y9QA 3EMGA 2JDSA 3R7UA 4ZAUA 5AP0A 3FXWA 4BTJA 3IK3A 4A9UA 3JR1A 4RMZA 4QP6A 2UZLA 2GHGA 3NUUA 4W4YA 2BDFA 3DAKA 3ANQA 2PL0A 4WNOA 5EI6A 3ZRKA 1IAJA 5F95A 3RPVA 1BI8A 4EK8A 3R8MA 4EH5A 2C3IB 1YXTA 3PIYA 2GTNA 2FYSA 4I6QA 2JKQA 1WBWA 4IAZA 5AV3A 3TTJA 4BWXA 4ZJVA 5IU2A 4DFYA 1XWSA 1ZYJA 5AUUA 3W2RA 3MVHA 5KMLA 2X9FA 2YLEA 2HOGA 1RE8A 3DZOA 3F7ZA 3EN7A 5CTPA 3TZ7A 4GMYA 5C8KA 4Z3VA 3PE2A 2B4SB 1ZAOA 3UOJA 4HVIA 5EI8A 3R1QA 3LQ3A 3L9NA 5AFVA 4N57A 2ERKA 3C50A 4C4EA 3O71A 4R7IA 2JDRA 4RC4A 2A4LA 3MIYA 2YISA 3HVCA 2WQOA 3ZDUA 5HBHA 4BYIA 4F09A 3TUBA 3MS9A 2VTNA 5DRBA 3C4XA 4QNYA 3BV2A 1YOJA 2ITZA 4L42A 4O0WA 1H0VA 2QHMA 4E8AA 5DT0A 3NGAA 4RJ3A 3BHVA 3PXZA 5BYZA 2ITXA 3ZS5A 4ASDA 3ULZA 4CMUA 4CRSA 4EK6A 4M84A 4Q9SA 3WOWA 2YFXA 1WVWA 3C1XA 3DQXA 4FTTA 4EOOA 1W83A 1UV5A 2BZIB 4DEBA 2HCKA 5IQAA 4D9TA 4NEUA 4HCTA 3GFEA 5HVYA 2BFYA 4DC2A 4FIFA 2B9FA 2R3NA 3D7ZA 2EB3A 3SRVB 3P5KA 3WARA 5AADA 5FDPA 5IQGA 3AC2A 3QALE 5T68A 1H8FA 4IMYA 5BVOA 4FKUA 5G1XA 5HCYA 3MESA 3VF8A 4L9IA 4I3ZA 5AUWA 4AT4A 2R3QA 5LMKC 4DTBA 2C6EA 1JQHA 4J53A 4O7NA 3QRUA 2JGZA 4GU9A 4IE9A 4CD0A 4A9YA 4ITJA 3N4UA 5AUTA 4MXAA 3ZO3A 2R3PA 3UQGA 2B52A 3GCSA 3E62A 4ASZA 4I5MA 4GJ2A 4FK3A 5AIRA 5EW3A 3F2AA 2R2PA 3PE1A 1WFCA 3S2PA 1SYKA 2UW4A 4FSTA 5KMOA 3DK7A 3MB7A 1VZOA 1PXNA 1PXOA 2XJ2A 3QX4A 3QYZA 1Q61A 1ZMUA 3TIZA 3UMXA 3ORMA 5TR6A 3WE4A 4UN0C 4M0ZA 3Q52A 1J91A 4WA9A 4FOBA 5KUPA 4BCOA 2F49A 2F2UA 3CTJA 4OTHA 2WMWA 3R22A 3LQ8A 4EYJA 4F1OA 4Y85A 1P14A 2BRMA 3QC9A 5A14A 1IR3A 4JVGA 5LJJA 4U9AA 3ZLWA 4E6DA 4BDAA 2QO9A 5DBXA 1XH7A 2IVUA 4MXZA 3ACKA 4ZS4A 3O2MA 3UVRA 2WO6A 4IZ7A 3TACA 4AW1A 3BKBA 3ORKA 3Q9XA 4WSQA 1UKIA 3IW4A 4IWDA 3BBTB 5L2IA 1KE8A 3DS6A 4XP0A 5BUIA 3ZHPC 3UNKA 2QHNA 3MW1A 1XR1A 5CXZA 3EQGA 4KNBA 2GQSA 2Y4IC 1URCA 4JBPA 3UMWA 4EK3A 3QD2B 4OTDA 3DU8A 3PYYA 3BU6A 3IOKA 4PMTA 3QZHA 4I93A 4BZNA 4TYHB 4JDIA 4GUEA 4DLJA 2ONLC 1W8CA 1ZYLA 3NSZA 1PXLA 1BMKA 3VS0A 4I6HA 3UC4A 4IVDA 2BPMA 1MRVA 2H9VA 4L52A 4CG9A 2C69A 4YZ9A 2CSNA 3MVJA 2RFNA 3GENA 3F5PA 3QD3A 4B8MA 4BKJA 2A1AB 4JIAA 3PZHA 2CKEA 2WU6A 4U3YA 4IDTA 3T3UA 5I0BA 4ZZOA 4WBBB 5DFPA 4K18A 3CD3A 3ZFYA 2GNFA 3NYNA 1OITA 2Y8OA 1QPJA 3V3VA 2VRXA 1W98A 2X7OA 5CNNA 4UWBA 2EXCX 2J2IB 3O8PA 4DH1A 3IW8A 4O7LA 4J8MA 3R83A 1RDQE 2HZNA 2W96B 3OWLA 2FVDA 4BDGA 3E3PA 3S00A 3AC4A 2JC6A 4XCUA 1J7LA 4DA5A 5L2QA 1QPCA 1M7QA 2ETMA 2BR1A 2GHMA 4S30A 3LQ5A 4F70A 4NIFA 4DHFA 2QKRA 4FG9A 3R7VA 1V1KA 3OC1A 5CEQA 3U9NA 4PDPA 3V5TA 4BYJA 4O0RA 4CRLA 4QTAA 4YHTA 2VTQA 4FTMA 3ZSIA 2Z7RA 4RX8A 2B9HA 4FTCA 3RP9A 4IWPA 4EUUA 4PF4A 2OJ9A 3CPBA 4BC6A 1XBAA 3COHA 4UBAA 3LLAA 4DYMA 1Q4LA 5H3QA 5CT7A 3RPYA 2PVKA 5ACBC 2IG7A 4FTRA 4L6QA 3QUEA 4B9DA 1OIYA 3W2CA 3PWDA 4CKRA 5M4CA 3TNWA 3C0HA 3BYVA 4P2KA 3FMMA 3NAYA 4LG4A 4N6YA 2VTHA 2A27A 3FHIA 1E9HA 3O8TA 4Z16A 4KKHA 3WZUA 1QPDA 3C9WA 2BCJA 5E8YA 4CFVA 4R78A 2W1IA 5EFQA 3HRBA 2XEYA 3Q60A 5DGZA 2ZV2A 3I79A 3CKXA 3FWQA 3NVMB 4WNMA 2KTYA 4ERWA 1H1SA 4U3ZA 4ANQA 4U5JA 4WG3A 4AP7A 4EOQA 1KOBA 4NCTA 3GGFA 4R3RA 5IISA 5DPVA 5HEZA 2G2FA 3BELA 2VWXA 2B53A 3O7LB 3Q3BA 1ZZLA 4EOLA 2FSOX 4S2ZA 3R9DA 3KF4A 5HE0A 4H39A 2W99B 3PSBA 3GQLA 4FOCA 1M7NA 4IIRA 4JLCA 2RGPA 4ZY4A 3G2FA 3KKVA 4ITHA 4C57A 3SOAA 3QXPA 3RM7A 2C6IA 5FXQA 2YJSA 2WTCA 4U0IA 3RHXA 4NJ3A 2X6DA 3OUKA 1Y57A 4DG3E 5M4IA 3Q4CA 4AW2A 3MGYA 2W7XA 4AT5A 3D5WA 2VTPA 4CFXA 2JKOA 3L9MA 4IDVA 1JKKA 2UVZA 5J9ZA 4TWNA 3DCVA 4ANNA 4PPBA 5E7RA 1XBCA 3MIAA 4I20A 2PY3A 2OSCA 4PUZA 5E8VA 3EQPA 2V7OA 5BVKA 5LQFA 2W1GA 3ORIA 4PPCA 3UGCA 2V62A 5CY3A 2GFCA 4AOTA 4FTQA 2JLDA 4FV1A 5L8LA 3QD4A 3UJGA 3NNWA 4WO5A 1STCE 3GCQA 4C36A 2PZRA 1M2RA 4FV8A 5AM6A 4EHEA 2R4BA 2BTRA 1W82A 4G16A 4JI9A 5E91A 2REIA 3ET7A 2CPKE 2XK9A 4ACHA 2C68A 4FTOA 3FYKX 2GNLA 2PZPA 5LVNA 2YHVA 2OKRA 1O9UA 2J0JA 4IH8A 4RIWB 3QTXA 4L8MA 4PMMA 4LUEA 2PULA 4E4NA 2HZIA 4JDKA 4I21A 3SX9A 3V5JA 3HV6A 2XNGA 4W8EA 3UDBA 3TKUA 5L2TA 5K4IA 3A7IA 2RIOA 2Z60A 2Z7LA 2PUNA 3TNPC 3KY2A 3TV6A 4BN1A 5KNJA 5CQUA 4YLKA 2B54A 4RQVA 1H1PA 3FLWA 3KK8A 3PY0A 4PTEA 3G15A 1WVXA 4PPAA 2O65A 1K2PA 5LWMA 2WEIA 3NX8A 3HDMA 2R3FA 2EVAA 4ALUA 3PXQA 4Q2AA 5HE3A 3EHAA 4PV0A 3NIZA 3VBVA 5T3QA 2Q0BA 3EKNA 2P2IA 4I0TA 5IQEA 4GUBA 4S32A 2XJ0A 4OW8A 4RZWA 3TXOA 1CKIA 3UBDA 4I6FA 1FBNA 4WBOA 1WBVA 1BI7A 3G9NA 3MY0A 5AV1A 2UW9A 3RNIA 4ORKA 4HZSA 4J95A 4QYYA 3EYGA 4KSQA 4C4FA 2QOCA 3GU8A 4BBFA 4IX3A 3BYMA 5CAPA 4WUNA 5DI1A 2QOFA 2XK7A 4PRJA 2XP2A 4DITA 3GNIB 3UOHA 5J8IA 3LIJA 2OZAB 4ZSAA 3S1HA 3R30A 4BHZA 2QOQA 3F82A 3CP9A 4DGLC 4I0SA 4Z7GA 1EH4A 2F7EE 3OOMA 5KKRC 4V04A 3HV5A 3EB0A 2WMQA 2P4IA 4EOJA 2VTMA 3GP0A 4X2NA 2IJMA 2J90A 3PIZA 3HKOA 3OVVA 2UZEA 5ANIA 4EL9A 4IB0A 4V0GA 3RM6A 4IX5A 5FXSA 2C0IA 3D4QA 5A3XA 5CF4A 4FKSA 3A99A 2G15A 1Q99A 3H0YA 2QR8A 4AZSA 4J98A 4DFNA 3NNXA 3GC7A 3PVBA 5HO7A 4IW0A 3LCDA 3GU5A 2CDZA 3TNIA 3WIKA 1PW2A 4NUSA 5FRIA 4GT3A 3WE8A 5DRDA 4GU6A 5CU2A 5H2UA 3OCBA 3DDPA 3OD6X 4MF0A 4KIKB 3SHEA 1GOLA 1KE5A 3QL8A 4U97A 2W06A 2IZTA 5CNOA 3FI2A 5DR2A 5HQ0A 3PLSA 4L46A 3D0EA 4A4XA 4AAAA 4GKHA 2HY81 4FNXA 4RIYB 5HLPA 2ITNA 2OH4A 2VX3A 5HG5A 3P0MA 4IAYA 5IA0A 1AQ1A 1OIRA 3PXKA 3F61A 3LMHA 3H9OA 4O2ZA 4D2WA 3IONA 4JJRA 5IKWA 4KBKA 3ZFXA 2NO3A 3BX5A 5IH4A 3VBTA 5HORA 3PY3A 5JZNA 1YQJA 2I6LA 2PVHA 3AQVA 4AA0A 4EQMA 1LP4A 3CQWA 4BGQA 4F99A 3R71A 2WIHA 5ANJA 3CCNA 3SXSA 5AR4A 3QC4A 5LXMA 3IKAA 4R1YA 3T9TA 4LGHA 4K33A 3AG9A 4PQNA 4LMNA 1E1XA 5C26A 5IPJA 4BDJA 4HW7A 2P2HA 4JG8A 2F4JA 4HCVA 2Z7SA 1JBPE 5E8TA 4OTIA 5J9LA 4JQ7A 4QO9A 3BGPA 4JQEA 3LPBA 5FDXA 4X2GA 3BWFA 2ZM1A 3MTFA 5CU3A 1UWJA 5HLNA 4O6EA 2ZV7A 3BGZA 4PDSA 3NWWA 2EU9A 4FX3A 4NWMA 5CSXA 5HESA 2XKDA 4GFOA 3KXMA 3QQLA 4YJSA 4ZZMA 3P78A 3WF5A 4C33A 2XB7A 3Q2MA 1L8TA 4K0YA 3Q04A 4BCPA 1DAWA 2PZ5A 4EBVA 3FUPA 5FD2A 4BDEA 4BIBA 5CSPA 4Q9ZA 5D1JA 1YXVA 3PSDA 4QMYA 1SVGA 1I44A 5EM7A 5JFSA 3VS7A 4FEUA 3IPHA 4UALA 5CVFA 5AM7A 2R0UA 4PP9A 4RWIA 1PYXA 1GZOA 4EEVA 3NNVA 3QQGA 2RL5A 3FBVA 5EDQA 4IC8A 2OFVA 3ORNA 3QD0A 3QRJA 4N0SA 5ANGA 4C4HA 2CNVA 3PSCA 2O2UA 3F7WA 4RGJA 4ZZNA 1H24A 3BHYA 3EQRA 4NFNA 3VS6A 3QCXA 4JXFA 1WBTA 3OY3A 4X2FA 4X3FA 5BVWA 3H4JA 3VUHA 5BX0A 2RG6A 5HNGA 4FTJA 4HGEA 3QF9A 3LVPA 2BUJA 4FV7A 3CJGA 5L6OA 4U79A 5JSMA 2XZSA 4AG8A 2ONLA 3CTHA 2ITVA 4JR7A 2PWLA 4MD8E 3ALNA 1WBPA 1XH6A 2NPQA 3ETAA 4RVTA 2YAAA 2QCSA 2P3GX 4O7WA 4C3FA 3ZM9A 4HVHA 4FUXA 3D15A 2J6MA 1T45A 2C4GA 4BDCA 3VO3A 3LXLA 4RX9A 5I9UA 3FJQE 1PMUA 3D9VA 1OPKA 3A8XA 1L3RE 2C5YA 3GB2A 1PJKA 3L8SA 3SXRA 2QG5A 3OTVA 1XH4A 3DKOA 3LCSA 4V05A 5D9HA 3GBZA 4M12A 2X6EA 3TZ9A 3VRZA 4F0FA 4FT7A 5BPYA 3LFNA 3FI4A 3CY3A 4N6ZA 2HELA 4CQGA 3WF9A 4FL1A 4DTKA 3FLQA 4C61A 3KCKA 3DBQA 4ZTMA 1U54A 3QQJA 5EYCA 2BMCA 4G3DA 1GNGA 4AT3A 4HVGA 4E5WA 3F9NA 4GK4A 2XYNA 5HD4A 3ZXTA 4C37A 2BVAA 5JZJA 1APME 4ZSGA 2OWBA 1PMNA 1M2QA 4R1VA 3KB7A 1Q62A 4YU2A 4RX7A 3MTLA 1ZXEA 2V55A 5D10A 4AFJA 1H26A 4JG6A 3MI9A 5LVPA 2JDTA 4X21A 2OI4X 4E5BA 2EUFB 3FY0A 4FKJA 4I5CA 4CZTA 4CVAA 4OT6A 3QHWA 3DXPA 3NW7A 2HYYA 2P33A 3GVUA 5CXHA 4FTLA 1VJYA 4TT7A 4QMNA 4EOMA 4R3CA 3VC4A 1OIQA 1G8AA 3AT2A 3D94A 4QTEA 4MXCA 3U87A 3NW6A 1YVJA 4R77A 5EYMA 5KMMA 4NSTA 5FP5A 5E1SA 2UZOA 3FMDA 3CJFA 4M15A 4A4OA 1E1VA 3KF7A 4AW5A 4X2KA 2VWWA 2WU7A 2YERA 1Y6AA 4ANLA 4PMPA 1R39A 5HICA 2RF9A 3QRTA 1PRYA 4MNEB 3AD6A 4LM5A 3FHRA 3OWKA 3ZZWA 4F0GA 1Q41A 4QD6A 4ALWA 1PYEA 3IO7A 4MF1A 2EXMA 4GW8A 3UQFA 5LVLA 2WMUA 1TVOA 2O63A 2WQBA 2XNPA 3CY2A 3EQCA 5JT2A 4FSZA 2VAGA 2WMRA 4FKWA 5H8EA 4XRJA 3GC0A 3HYHA 5HG7A 2WB8A 2XF0A 4FSWA 3M2WA 3QCQA 2ITPA 3L1SA 1MQ4A 1SNXA 3KRRA 2UZDA 4YURA 4AGUA 3TKIA 4CKIA 4JDHA 3QTZA 4H1JA 5IQBA 5EQEA 3DBDA 4FEQA 1YHSA 2WXVA 3PJ1A 3OG7A 1KWPA 2OIDA 1CTPE 4GEOA 3Q53A 3SDJA 4XLIA 1PKDA 2QOLA 3ZM4A 4RJ6A 4FNWA 4OUCA 5HIDA 4IAAA 5HKMA 4XV9A 4YNOA 2OK1A 2XCHA 4KIQA 4A06A 4F6SA 3HMNA 3COIA 5AV4A 2GMXA 2C6LA 4QMVA 4RWLA 2WZJA 3GFWA 3NUSA 4BZDA 3HP5A 5CEKA 3PJ2A 2Q0NA 4GK3A 4GH2A 3PXFA 4RWKA 4KIOA 4AZWA 3TCPA 3D7TB 4ZP5A 5H9BA 4QP4A 2OJGA 3DQWA 1FMOE 3KN5A 3MWUA 4ANSA 4YZMA 5IDNA 3OMVA 5JKGA 3DDQA 3VW6A 4GYGA 4QYEA 5AP2A 1S9IA 4UMTA 3I1AA 3CE3A 3KL8A 4NW5A 4F9CA 3SA0A 5E9EA 1H25A 2C3LA 3LFBA 3C4CA 4HYUA 3LCKA 4X6RA 4D4SA 4ZMEA 2G2IA 4YC6A 2GFSA 3F3TA 4UB7A 3FI3A 3VS2A 2WQEA 3FXXA 1TQIA 4Y8DA 1ERKA 4AOIA 5DN3A 4MXXA 3NIEA 4QPAA 5AP4A 2HXLA 1WAKA 4FZAB 3DK6A 3H0ZA 2WQNA 5F4NA 3I7BA 4IM3A 4F64A 3FLSA 4Z7HA 5E8XA 4IAFA 5JFVA 2AC3A 3ZSGA 4IJPA 2BILB 1ZYDA 2E2BA 3EN9A 3RK9A 3P7BA 1UU9A 2XRWA 1ZOGA 4XG8A 5LARA 4CKJA 3KCFA 4NYEA 4FKIA 3TDWA 3IW6A 1IRKA 4JRVA 4O2PA 4EHVA 5M4FA 1BL6A 4CGAA 1DM2A 2PZYA 1OL1A 3L8VA 2OZOA 4RSSA 3F5XA 5FM2A 4C3PA 1ZYSA 3EQDA 3Q32A 3Q9WA 4ACMA 1WZYA 2VWYA 2QC6A 2W5AA 3FQEA 4BICA 3BHTA 4DCAA 4BKZA 4Z9LA 3S0OA 5IA2A 4U42A 2XJ1A 4II5A 3V8WA 3TNHA 1WMKA 5AR2A 4XG4A 2OLCA 3PJCA 4NW6A 4YTIA 3CBLA 4TKSA 4M7IA 3O96A 1H4LA 4FNYA 4M69B 2FSLX 1YXXA 1IG1A 2CJMA 4UXLA 4CZYB 3E88A 4G3GA 5HIEA 4LUDA 2BIKB 2J9MA 2JD5A 3OWPA 4X0MA 5FEDA 5HG8A 3WYXA 2J5EA 4EK4A 1W0XC 4MBJA 4UWYA 3UO5A 4QP8A 2P0CA 4U80A 4MNFA 2PUIA 3P23A 2E9VA 4KBAA 5L8JA 4E20A 4F7NA 4HJOA 4YJTA 2PVLA 3HUBA 4FVQA 2V0DA 4E4MA 3W10A 2IW8A 5BMMA 5I9ZA 1BLXA 3ZO4A 4IANA 4FTUA 2R7BA 1ZWSA 4GIHA 3FZRA 3R04A 3VAPA 2WMTA 2IPXA 3E7VA 5AP1A 3VUDA 3U54A 3MYGA 2BTSA 3KXHA 4CFNA 1UU3A 4YP8A 5ETIA 3EOCA 3R8ZA 4KABA 1OI9A 2YWPA 4GFGA 4FZ7A 3WZDA 5FEQA 4IB1A 4QTCA 1OL5A 3HL7A 3IW5A 2HY0A 3R6XA 4WKQA 3F5GA 3HV7A 4USFA 4D4VA 5M56A 4O81A 4BY9E 2B9IA 4MXOA 4ZIMA 5E8WA 1GIJA 4AN9A 2X2LA 4GG5A 2XKCA 1RJBA 5CSWA 2A2AA 4ZTQA 3BYUA 3B8RA 3ORPA 5JN2A 4EQUA 4GKIA 1Z9XA 4J1RA 2BFXA 3U51A 4IBMA 3KMUA 1MRYA 3BE2A 3QRIA 5AUZA 4JRNA 4NT4A 2JBPA 1OGUA 2VTLA 4U45A 4IWQA 4TW9A 3R9NA 1P5EA 3SRVA 4XG6A 4C4GA 3ODZX 4EZ5A 4G3CA 4E3CA 3EH9A 3EQIA 3MVMA 5M53A 4EC9A 4Y5QA 3LXNA 4F7SA 2DUVA 2WMVA 4ID7A 3U9CA 2J0MB 4JIKA 4BI0A 2QO2A 5BVFA 3BBWA 3P9JA 1H07A 5CAQA 2BZHB 5K0KA 4G6LA 4E1ZA 4F9YA 5D7AA 1PF8A 3CEKA 2WOTA 2ZV8A 1JOWB 1IA8A 3HAMA 3KMMA 3MPTA 3A61A 4R5SA 4D0XA 3AC3A 4EORA 2PU8A 2PMNX 1GAGA 1PXKA 3JY0A 3RPRA 3SW4A 3PA4A 5IA5A 5CSVA 4FL3A 1WBOA 2BRNA 4L01A 2X7FA 3FSFA 5IF1A 2GPHA 3Q4TA 4G9CA 4IEBA 2PVNA 5E92A 3HZTA 5F1ZA 3WBLA 3R8VA 4AZTA 2X4ZA 2BZKB 3C4ZA 4M0YA 4D28A 1H1QA 3O50A 5IQIA 1ZZ2A 2CLXA 4IZYA 4KKGA 2C30A 1PXPA 4QRCA 5L4QA 4HNFA 1H27A 3W18A 3FMEA 4EZ3A 4K6ZA 4FV9A 3LKMA 2YIRA 5A4CA 4RA4A 3BGQA 4XP3A 4X7QA 4Y95A 4DGNA 2OF2A 2YITA 3Q6WA 4X6QC 1SVHA 4FBXA 3E3BX 5IA4A 4J8NA 4ZTRA 4ALVA 3D5XA 5E1EA 5EM5A 3SG9A 1R3CA 3ENMA 1FVTA 2WTKB 3D5VA 4GIIA 1LEZA 4QPMA 5CSHA 3QCSA 3LAUA 3DBFA 4AW0A 2IZUA 2VTIA 4OTFA 4A07A 3KRJA 3FE3A 3QA0A 5D7VA 4ANBA 5JGDA 5C9CA 5E8UA 4CXAA 4F6UA 5IEVA 3RKBA 4FA2A 4PL5A 4RC3A 3UPXA 4NIFB 4LOPA 3ZUTA 5M06A 3CS9A 5KBQA 3MFUA 4MBIA 3QTQA 1JKSA 5EOBA 3LFEA 5IUIA 4BRXA 3C13A 3UODA 4AN3A 3IECA 5HTBA 4D2PA 4RFYA 1UA2A 4KUJA 4MWIA 1OB3A 1ZRZA 5DR6A 2W4JA 4FV2A 4I92A 4GVAA 4DT9A 3NYVA 4TWOA 5CU4A 5J95A 2UUEA 3OW4A 4QT1A 3WF8A 5CEOA 4EOSA 5A46A 1OPLA 4GT4A 4KRDA 2YDJA 3U6HA 3P4KA 4W4XA 3QRKA 1G3NA 3HUCA 1PKGA 3LFAA 5FUTA 3ORXA 4JL9A 1W7HA 3I60A 1LR4A 2C6OA 1Q5KA 5AV2A 3PRFA 4D0WA 4PDYA 3O8UA 4BDBA 4AACA 4CCUA 4G2FA 2WTDA 4KAOA 3CXWA 4ZLYA 5HX6A 4A9SA 5HX8A 1F3MC 3R73A 4B7TA 3V5PA 4OR5A 3RHKA 2CNQA 3UTOA 4BBEA 2OU7A 2YN8A 4KSPA 2E9OA 5CAVA 3EL8A 3HA8A 4G31A 3PPKA 4QMXA 5TT7A 3HNGA 3THBA 2B0QA 4QQ5A 2J0KA 3AD4A 3KXXA 3MN3A 3RBWA 1YW2A 4IVBA 5CEIA 1H00A 4BCKA 4YTFA 1OL2A 4USEA 3VUKA 3F5UA 3RAKA 3ZUUA 3COMA 3NVKI 1YWRA 4IFGA 3OXZA 4MD9E 3NDMA 4CYIA 2YCRA 3KQ7A 4DEHA 2H6DA 3SLSA 3BWJA 4ASXA 3HLLA 4R7HA 4CCBA 3FMLA 3PVUA 4ITIA 2GS7A 5FGKA 4QYHA 2W1CA 3F69A 4L45A 3MY5A 4WRSA 4AS0A 5CF6A 3VUGA 2AC5A 1ZY4A 3NRMA 5ACKA 4C3RA 2A19B 2C6KA 2DWBA 4DEIA 3KGAA 1M17A 5JRSA 4O0UA 3DNDA 3ENHA 3K5UA 4YPDA 4DFLA 3BE9A 3HMMA 2UVYA 5EM6A 2CGUA 2R3JA 4MK0A 5FM3A 4HYSA 4L00A 4L3PA 3MV5A 3R8UA 1R78A 4IVAA 5JQ5A 1O6YA 4M66A 2BDJA 3KMWA 3SQQA 2XK8A 3GOKA 2IVVA 3B2WA 4J99A 4JX7A 3D2IA 2YCQA 4MYGA 4PX6A 4FGRA 3KXZA 1JSVA 3K2LA 5I3OA 4PY1A 3UO6A 3PA5A 3I5ZA 3IW7A 4DEGA 5EH0A 4FIJA 4O7ZA 2Z7QA 2BHEA 1GIIA 2G9XA 4EOKA 5AA9A 5C27A 4G6OA 2V7AA 2WGJA 4CQEA 3QTIA 4ZTNA 1XBBA 2WQMA 2ITUA 5HZNA 3NUAA 4LV5A 3IGOA 3MPMA 3TI1A 4AE9A 1UNGA 4ZTLA 1OKWA 1ZMWA 4KS7A 4E26A 5EQPA 2UZVA 3KREA 4BDIA 2R3LA 1SZMA 4TN6A 5H8GA 3LJ1A 2JFMA 1ZMVA 3LFDA 4DGGA 4OBPA 4EH9A 2F7ZE 5A4TA 5IDPA 1TKIA 3N4TA 3W1FA 5IG1A 3QGWA 4Y46A 1YI4A 4YC3A 4LFIA 4AUAA 4EJ7A 4UX9A 2YJRA 4OTPA 3D14A 3C4EA 4UEUA 4AZVA 3DOGA 3BEAA 3C51A 3RK7A 1QCFA 2ZM3A 4YJOA 3WZEA 3ZBXA 4I23A 3N4VA 4P4CA 3WIGA 2W1FA 1RQQA 4RVLA 3TJCA 5K5NA 3HRFA 5HNBA 3TL8A 3DPKA 2AYPA 4FKGA 4FTNA 3OCSA 3R01A 3D5UA 3V51A 3SKCA 5IA3A 4EKLA 4RQKA 5G6VA 5H8BA 4Y5HA 3JY9A 2G01A 4F4PA 1B6CB 5ETAA 4GK2A 5L6WL 1PHKA 3R7EA 4G9RA 2J0IA 3A60A 5AX9A 2E9PA 3UZPA 3EN5A 4C02A 2GCDA 4TTHB 4ZXTA 2GNGA 3P08A 1YHVA 3FKNA 3W2PA 2CCHA 5FG8A 3FI8A 3Q9ZA 5EHOA 4EH4A 2YABA 3OEFX 3UZRA 4CMOA 4WNPA 4TWCA 3MDYA 2B55A 4JQ8A 1P2AA 4FIGA 2F2CB 3HV4A 4V0GB 4W4WA 5CWZA 3W8QA 4E5AX 1XQZA 4RRVA 2BZJA 4N70A 3O0GA 5EHYA 1ZLTA 3HMOA 2PMOX 2OF4A 2R64A 5DT3A 1TQPA 3C0IA 4BZOA 4KBCA 3ZUVA 4MAOA 1OM1A 2YEXA 4O1PA 1Q8UA 2J7TA 3EN4A 2X8IA 2QKWB 4O84A 4Y83A 2YCSA 3RGFA 4CYJA 4RIXB 3ZO2A 2X2MA 3SW7A 4WG5A 5AUXA 4D9UA 2XNOA 3F3WA 3R8PA 1NA7A 2C5VA 2HWPA 2NP8A 1YDTE 3LLTA 2H34A 4NM0A 5E8SA 3K3IA 3NYOA 2VO7A 2PZIA 4IC7A 4UYNA 3ZLYA 3R9RA 2LAVA 4FV4A 3SC1A 2JAVA 1U5RA 4USDA 1GY3A 2EXEA 3QBNA 4IB3A 4O86A 2YZLA 1FMKA 3CLYA 3OTUA 4H3BA 4S34A 5EYKA 3UNZA 3ZFMA 3W55A 5M44A 3ITZA 4NK9A 3MVLA 4L3LA 4FVPA 3Q4UA 3UE4A 4APCA 2JBOA 3QU0A 3TUCA 3OXIA 3OCTA 4YPSA 3KULA 4IM0A 4PNIA 4FV6A 4CT1A 3MPAA 5M57A 2UZBA 1R0EA 4EUTA 3R0TA 5KX8A 4LV8A 1AD5A 2QU5A 2XIYA 5IQHA 2Z2WA 1DAYA 2XH5A 3DZQA 4HGSA 5IUHA 3HMIA 4C2VA 2B7AA 4GS6A 2BRBA 5C4LA 2RKUA 4EQCA 4G34A 3JYAA 2WEVA 3PXYA 4KWPA 4NTSA 4G5JA 4PMSA 5LMKA 4NM5A 4B0GA 2QU6A 4C59A 2YM5A 3PPZA 3EN6A 4P5QA 4F9AA 4KIKA 2VTRA 4FE2A 5AUYA 3KFAA 1JVPP 2BIYA 4WIHA 3QTWA 4E7WA 2YM7A 2QR7A 4MWHA 2GTMA 5ETCA 2ZVAA 3UPZA 2ITWA 2JAMA 4FIIA 3R2BA 4AZFA 1OECA 2QONA 4JDJA 5BVEA 3FC2A 3CPCA 4CG8A 2WOUA 2HENA 2XM8A 4OT5A 4W9XA 2BRHA 3FYJX 2NRUA 1OKYA 4GG7A 4NJDA 3PLAE 4AA4A 5DWRA 4FSRA 4J96A 3DB8A 2AUHA 5J9YA 4ZK5A 5LMBA 5IH6A 3C7QA 4MX9A 4XRLA 4LL0A 2UZWE 4F7JA 4KB8A 4RVMA 3OT3A 4R7BA 5JQ8A 4ZJJA 5A4EA 1MUOA 3QLGA 4XS2A 2QD9A 5KE0A 3BU5A 5TE0A 4L53A 4QTDA 5HBEA 2IW6A 3DTCA 1BL7A 3SD0A 4FI1A 5HD7A 3Q5ZA 4BVUA 4AGWA 3DNEA 4HGLA 2CKPA 3BRBA 4W8DA 4HCUA 4FC0A 3B8QA 4FZFB 4X3FB 3DFCB 4FSUA 4C34A 5FBOA 2C6MA 1V0BA 5BUJA 5K3YA 5C03A 4R6VA 4TXCA 5GJGA 3GU4A 1REKA 4D55A 1Y8YA 4E73A 1W84A 3PP0A 3LM0A 2ZB1A 1ND4A 2OIQA 5KMIA 3TIYA 5L2WA 2E9NA 2B1PA 3AOXA 5FQDC 3NR9A 4ONAA 5AEPA 3KVWA 4ZSEA 2BDWA 3HP2A 4WRGA 3OW3A 2GNJA 2C5NA 3DJ7A 3SG8A 3FXZA 4L44A 4O91A 4DH5A 3A8WA 4H3QA 3SXFA 2XNMA 2IVSA 5AR7A 2R0IA 2O8YA 2JKMA 2PVYA 3DKCA 4CMTA 3W2SA 5DT4A 5EG3A 4E4LA 2YM8A 3UZTA 1V0OA 3HECA 3VBYA 4I5HA 3AT3A 1OUYA 5FLFA 3ZZEA 3ZMMA 3NCGA 1U54B 1BYGA 2UZTA 3AD5A 4MBLA 3V01A 4KA3A 1CDKA 5IH5A 1J3HA 4KS8A 5M09A 4IM2A 4ZY5A 4FYNA 1YRPA 3NW5A 4YBKA 4CSVA 3FLZA 2Q83A 3LHJA 3FC1X 1DI9A 1HCKA 2W0JA 4O0VA 3NYXA 5CX9A 3R9OA 4EJNA 5BMSA 2PPQA 5GINE 4YGAA 2QO7A 3ORLA 2G1TA 4FEVA 1R0PA 4XG2A 4GYIA 3W8LA 4FIHA 2PK9A 4GRBA 2B9JA 1A06A 3K54A 1I09A 4X3JA 4ZY6A 4H05A 2QVSE 2X2KA 3EQHA 4LOOA 5E8ZA 3VF9A 2OJJA 3ZTXA 4HNIA 3FEGA 3GCUA 3FMHA 3OOGA 5M07A 3GCVA 4QQJA 2X9EA 2W4OA 2WTKC 5DEWA 4FSMA 5LVOA 4FR4A 4K77A 5GZAA 4U8ZA 4I22A 4BWKA 3ZOSA 5DA3A 3RPSA 2XA4A 3MH2A 4BF2A 4IX4A 3PP1A 4LYNA 4WG4A 1KUTA 2UW3A 3ROYA 5I9XA 3BLQA 5AV0A 4YHFA 2I1MA 1WCCA 4YSJA 2OXYA 1MRUA 4XP2A 4BDFA 5IA1A 1FQ1B 3A62A 4EWHA 5KMNA 2OICA 2BHHA 4QP7A 4YJPA 4YO6A 5EI2A 3R8LA 3LOKA 2IWIA 3A7GA 4YJUA 3ZH8A 3UIUA 5KBRA 4DE4A 3QKMA 4DFZE 3H9FA 3REPA 4NH1A 4NKAA 3BCEA 3HMPA 5TOZA 4RBLA 2BAJA 3QZIA 4BTMA 4CLIA 5HTCA 3NUYA 4GL9A 2E9UA 5JRQA 3OHTA 4M68A 4BCIA 4P5ZA 5BNJA 5GZ9A 5BYLA 4CTBA 5HE2A 4FEWA 2ITQA 3N51A 3Q5IA 5L8KA 2JIVA 3PVGA 3U4UA 4YTCA 3I81A 3OBGA 3OF0A 3VUTA 2H8HA 2O5KA 4CFMA 2F9GA 4XBUA 3DAJA 2HXQA 4IZ5A 2CKQA 2GQGA 2W1DA 2I0HA 3CGOA 3ODYX 5E4HA 5DE2A 3CIKA 3G33A 2IZSA 4UWCA 3HX4A 4D1SA 2XRUA 2W5BA 2G2HA 2F7XE 1AGWA 3R2YA 2X7GA 1U4DA 2ESMA 5CQWA 4U40A 5DMZA 1J7UA 2ACXA 3LJ2A 4EZ7A 1ATPE 3BQCA 3FZSA 1B39A 3R28A 3VIDA 3UP2A 2VX0A 2YIQA 4FTIA 4MNEA 4YZDA 3POZA 3W2QA 3BHHA 3KN6A 1KV1A 4FEXA 3DB6A 3ULIA 3VS1A 1FGKA 3DLZA 3FMJA 4LRJA 2XVDA 3GU7A 4D4YA 2VNWA 3LFSA 4MD7E 2YDIA 4K8AA 5CLPA 5AJQA 4G3FA 1RW8A 2EWAA 2WELA 3BLHA 2QOIA 3FMNA 4NFMA 4QNAA 1VYWA 4XG9A 2R3KA 3IDBA 4I4FA 3WZKA 4M14A 3WF7A 4LL5A 3E63A 3LW0A 2XEZA 3PG3A 4UYAA 4ZTHA 4EOIA 5IQDA 3H3CA 2XIRA 3NUPA 3CQEA 2IZRA 1TQMA 3BI6A 3CGFA 3MFSA 5ANKA 4D2VA 2GDOA 3V8TA 2PVJA 2RSVA 5EK7A 2WTJA 4IADA 4A9RA 2I7QA 4XG7A 4ENXA 4BTKA 5CS6A 4U6RA 4TYJA 3ZEWA 5K0XA 2BRGA 3Q96A 1OBGA 3TDVA 3OT8A 5CT0A 3G6GA 5EW8A 2OFUA 2OG8A 3PIXA 2W1EA 1HOWA 2PTKA 3ZONA 3W32A 3NEWA 3PPJA 4FV3A 3NS9A 5HCZA 3ORZA 2Y7JA 4IZAA 5HI2A 3QKKA 4HOKA 4K2RA 3KRWA 2CN5A 5LOHA 3QUPA 3VS3A 4PWNA 4JNWA 3UP7A 3FKOA 4QMSA 3AXWA 1XH5A 3WF6A 3GT8A 4BCJA 2QOHA 3OXTA 5KMJA 3FLNC 2ITTA 5D12A 2FGIA 2R3RA 5I5ZA 4EI4A 4IX6A 2YWVA 4BDKA 4W9WA 1SVEA 3ACJA 2J4ZA 1S9JA 1IEPA 2XIZA 4RLLA 4U44A 4PP7A 3H30A 3AGMA 4AWIA 4DEDA 4D2TA 3AMAA 4F0IA 1H01A 4XOZA 1H28A 5DNRA 2Y6MA 4FKOA 2VTAA 4QTBA 4OAVB 2VD5A 3P86A 3A7JA 4UV0A 5AP7A 3QWKA 5JH6A 2VTSA 3R00A 2CKOA 5B0XA 3SV0A 1LPUA 3FZOA 4FG7A 5DEYA 4UMQA 4BTFA 4EH2A 4DAWA 5ETFA 4XHKB 3R7YA 4HPTE 4C4IA 5CZHA 1DI8A 5EM8A 4D1XA 2UW7A 2VZ6A 5AR8A 3U6JA 1URWA 4O7VA 2Y4PA 2IVTA 3E93A 2XS0A 3R21A 3DKGA 2VTOA 3I6WA 3MH3A 3C5UA 3G0FA 4BGGA 2J0LA 3UNJA 4MXYA 3TZMA 1A9UA 3L9LA 2ZMCA 5I3RA 4OTGA 4MH7A 2YM6A 2JKKA 3DFAA 3MH1A 3ZXZA 4BR3A 3B2TA 4FGBA 4YJRA 3CC6A 4APPA 1KOAA 4TYGA 5GIOE 4L7FA 3EFKA 5J5TA 4UMPA 1MQBA 4JS8A 3A2CA 2WMAA 5CI7A 3AC8A 4LQMA 2VNYA 3ID6C 4U43A 4O96A 2HWOA 3AMYA 2VU3A 2O3PA 3UVQA 3EQBA 4HPUE 1YXUA 3I0OA 4DGOA 5CVGA 5KO1A 5K4JA 3KU2A 5CI6A 2HW6A 4OGRA 2W9ZB 4XG3A 4KINA 4LRKA 3VHEA 1KV2A 1GZ8A 3NUNA 5JEBA 3LCOA 4LMUA 4BKYA 4F9BA 3F2NA 4DGMA 4E6AA 3NZ0A 3OEZA 3V6SA 3W2OA 1JNKA 4O7TA 4FT0A 1YI6A 4YUQA 5CU6A 3UVPA 3MH0A 3D2KA 1ZARA 2W1HA 3EQFA 3FL5A 1Y91A 2XKFA 3OROA 4M69A 5AX3A 2VGOA 4AE6A 4B6LA 4EHGA 1VR2A 4BBMA 2ZAZA 4WNKA 3LMIA 1YHWA 4BCGA 5EHLA 1Z57A 4WUAA 4AA5A 5EDPA 2C0OA 4YBJA 3TKHA 3EWHA 2PVRA 3H10A 4O7SA 1UWHA 3GU6A 3Q6UA 2WMBA 3C4FA 4JAIA 3MSSA 4PDOA 1KE7A 4D2SA 2BKKA 5IEYA 2C6TA 1PY5A 5DLSA 3ZCLA 5C1QB 4XBRA 2X8DA 3EFLA 3OBJA 2PVFA 5AIKA 4IJ9A 3RALA 4B8LA 5KHXA 3MFTA 3HDNA 2IO6A 4TNDA 2JEDA 3MJ1A 5IMXA 4DH7A 3VRYA 4H36A 3HRCA 3F6XA 5JFWA 4TWPA 5ICPA 5HCXA 5DR9A 3TM0A 4RLKA 1M52A 2CLQA 2YACA 5D11A 3FY2A 3GI3A 3V6RA 1KSWA 4I0RA 5HTIA 3VS5A 4XYFA 2QOOA 1YDRE 3Q2JA 4GFMA 1F5QA 1K3AA 2OH0E 2YDKA 2ZB0A 3QHRA 4FKPA 4M8TA 5HGIA 2Z8CA 3DK3A 4FTAA 5CYIA 4RC2A 5E90A 5AAEA 5BYYA 5GNKA 3DGKA 4QMQA 4WSYA 4FKQA 4M97A 1ZY5A 4QMOA 3U4WA 4L67A 2WHBA 2RFEA 2YM3A 3G6HA 4YMJA 2VWVA 3CD8A 5C8NA 4FODA 4HVDA 1GZKA 4ANMA 4QYFA 4F1TA 1CKJA 1FGIA 2HK5A 1LUFA 4UMRA 4FT3A 2BAQA 1U46A 4C58A 3UO4A 5FTGA 1XHAA 3L8PA 3M11A 4I4EA 3SAYA 4ARKA 1JSUA 3TTIA 3ZBFA 3RK5A 4YTHA 3MY1A 5GHVA 5HOAA 4HVSA 1GZNA 3U8WA 3BYSA 4DCEA 3LJ0A 4F08A 2RFSA 3RZBA 4CZUA 4D5KA 4UMUA 1JKLA 4X3FC 4O0XA 4Q5EA 3V5LA 1OZ1A 4EH3A 4YSMA 1JKTA 3UQCA 4ZOGA 4DT8A 4YJVA 4FUYA 5JGAA 5M51A 1F0QA 2PMLX 3E8CA 3OCGA 3QX2A 4PTCA 5K9IA 4DLIA 3FV8A 4O21A 2XBAA 3EFJA 2PYWA 4EOPA 2J51A 3MJ2A 5GIPE 4F1MA 2Y6OA 1OPJA 5B2LA 3QTUA 4BI2A 4FKTA 3QZFA 5FBNC 1CM8A 4O0SA 4TYHA 2GS6A 5TF9A 4NU1A 3TN8A 1Q24A 4CEGA 4ANOA 4YZNA 1P4OA 3IQ7A 3KC3A 2OJIA 1U5QA 4XV1A 4LGDA 4XH6A 4BDHA 1KE6A 4YZBA 2YIXA 3DXNA 4Y73A 2GHLA 3VJOA 4QMLA 3LFCA 4JX3A 5ITAA 2IW9A 3NLBA 2FA2A 1H1WA 3MFRA 4O0TA 3GQIA 2QI8A 2UV2A 3RVGA 3DJ5A 3FSKA 4YLLA 1NW1A 2GQRA 3WILA 1H08A 3CR0A 3PTGA 3VUIA 5BVNA 1IAHA 4JOAA 4ZMFA 4AFEA 4H58A 5LVMA 2VX1A 5L2SA 5IQCA 1X8BA 2UW8A 3LZBA 5AP3A 4L68A 3BEGA 2VWBA 4YO4A 5CU0A 4MQ2A 1UKHA 2YZAA 4XOYA 5KCVA 4OBOA 4E6CA 4ERKA 4H1MA 5JFXA 4ACGA 3BZ3A 4DBXA 2C47A 2BALA 3AMBA 4BHNA 2X81A 3S3IA 2QQ7A 4O27B 1J1BA 5CF8A 2UW6A 4QMTA 4O0YA 3E8NA 5EW9A 3ZLXA 3ZC6A 4S31A 3BPRA 3FQSA 3DAEA 3QAME 4GV1A 4Y72A 2OXXA 4CNHA 2HZ4A 4G3EA 3PJ8A 3FL4A 1B38A 4FSYA 4R3PA 3V04A 4BB4A 3HEGA 1OKVA 4QPSA 5CASA 1LEWA 3F3UA 3EZVA 3RNYA 2WPAA 5J5SA 4AX8A 3R1YA 2WKMA 3KRXA 5AP6A 2YCFA 5A54A 4AN2A 4JAJA 2W1ZA 3A7HA 3O7LD 2CN8A 4IAKA 2H96A 5BQ0A 4IAIA 5AA8A 4O7RA 4U41A 2PE2A 1QL6A 3Q4ZA 1XKKA 3R7GA 4L3JA 4D4RA 5FTOA 4YC8A 2FSMX 3QA8A 5J1VA 4JG7A 3DBEA 3EYHA 4BIDA 4IQ6A 2VGPA 4IB5A 5BVDA 2DYLA 3QYWA 4CFWA 4RA5A 3R7IA 3I0QA 4NZWB 3OUNB 4FTKA 1UU8A 2ZMDA 4RG0A 5HO8A 5HU9A 4NL0A 3UG1A 4FV0A 5EQYA 2XCKA 3NNUA 1Q8WA 3V8SA 2CGWA 3ZDIA 4AXAA 4D5HA 4F65A 2FH9A 5CENA 4KRCA 1UVRA 3DY7A 2PUUA 4GVJA 4F9WA 4NM7A 1YDSE 2W4KA 4ZJIA 4G1WA 4QOXA 4RWJA 3DA6A 3TG1A 4BI1A 4K1BA 4D2RA 1NT2A 5EOLA 5J7BA 2BROA 3PFQA 4UZDA 1UNLA 5IUGA 4RFZA 3JXWA 4TY1A 4ACDA 2XM9A 3RMFA 3P7AA 2CMWA 3HV3A 3QWJA 1PXMA 4FVRA 4XX9A 3S95A 2XUUA 3DV3A 2PHKA 3E8EA 4P7EA 4ENYA 3FZTA 4DTAA 1R1WA 2OJFE 4FICA 2Y0AA 4TPTA 5HE1A 3FKLA 3PUPA 4ZS0A 4QMMA 3ZO1A 4DBNA 4EWQA 4E4XA 4I6BA 3JVSA 4LI5A 2PE0A 3FQHA 2C6DA 3CKWA 3PY1A 5AWMA 3MA3A 2W9FB 4YJQA 3FPQA 1H0WA 2OBJA 4X2JA 1OUKA 4DEAA 1G8SA 1DS5A 4J71A 1NVQA 3AGLA 4O22A 5J1WA 5T6KA 3SVVA 3C5IA 3F66A 4ZSJA 1YOMA 1VYZA 4EC8A 4BCHA 4PL4A 3RPOA 1Z5MA 2I0EA 4HYIA 2VO0A 5I4NA 4N4SA 3I4BA 4FL2A 1FVVA 1H1RA 4MKCA 4RIWA 5A6OA 4FKLA 2UW5A 3K3JA 3RZFA 2WTWA 3VN9A 3SGCA 4ZTSA 2PUPA 1K9AA 2PSQA 3IDCA 4MVFA 4QQCA 2GNIA 4OTQA 2XMYA 3K5VA 4CTCA 4D58A 2VWZA 1PXIA 2XK4A 3FDNA 4FT5A 4XV3A 4BGHA 4CV8A 3UIMA 1SMHA 2CNUA 3KA0A 2VTJA 1A48A 3E64A 5DG5A 1ZOHA 2JITA 2WFYA 4WD5A 3EFWA 3NAXA 4FK6A 4RPVA 2VUWA 4BDDA 2HIWA 3G90X 2DQ7X 1Y8GA 3TT0A 3VQUA 4C0TA 3H9RA 3G51A 4GCJA 3LXKA 4FZ6A 5HVJA 3FAAA 4Q5HA 2PMIA 1PMVA 3W33A 3G9LX 3MBLA 3R9HA 4JBQA 3PZEA 3I7CA 3EL7A 3QKLA 4J97A 4NKSA 4YLJA 2JDVA 2C5OA 3EZRA 1OL6A 3L8XA 3PRIA 2V22A 5J7HA 1BKXA 2WTVA 3UG2A 4RIOA 5IZFA 2VTTA 5JMSA 2YA9A 4BFMA 2C3KA 3P79A 2NNWB 3JS2A 3ANRA 3CQUA 2W5HA 4O6LA 1OIUA 1NVRA 1Y6BA 2RFDA 1UU7A 3NPCA 4DEEA 2CGVA 4L7SA 1V0PA 2ZM4A 2CHLA 4PL3A 3ZLSA 4QP9A 2EB2A 4EH8A 1BX6A 4XUFA 4MTAA 3KULB 3EJ1A 4QMZA 2OZAA 5EYDA 4PTGA 5KHWA 3OY1A 2DS1A 3U6IA 2ZV9A 4ACCA 3SOCA 4RJ4A 4E93A 2YM4A 4V01A 4CFFA 1GJOA 4WOVA 3VW8A 1YXSA 3KK9A 4JBVA 5C4KA 3R1SA 4C7TA 1FOTA 3VJNA 5GJDA 4R5YA 4C2WA 4DFUA 3M1SA 4BCNA 3RCJA 5HHWA 2BKZA 3T3VA 4ZLZA 5DOSA 4CLJA 5I9VA 3BU3A 3TNQB 3RJCA 5BUEA 2LGCA 3TEIA 3ZU7A 5HLWA 4FYOA 2FO0A 2WNTA 1FINA 3BQRA 3UOLA 3PDTA 2O0UA 3LM5A 4GJ3A 1WVYA 3RAWA 4RIXA 5J79A 4RT7A 4AU8A 5LCJA 2JIUA 4FSQA 3E7OA 3RWPA 5IQFA 3O51A 2OXDA 1JLUE 4XEYA 3KRLA 3QGYA 4DF3A 4C4JA 3PVWA 4WT6A 2FSTX 4RX5A 4QP1A 4AGCA 3LCTA 3UYSA 3FLYA 4QYGA 3RWQA 3E92A 3W16A 4F63A 3KXGA 2PE1A 2OGVA 3T8OA 5JK3A 2GS2A 1OKZA
chains in the Genus database with same CATH superfamily
1SNUA 4GT5A 4H3PA 4YHJA 3VBWA 5EKNA 5HNIX 3QFVA 5AAGA 2Z02A 1JAMA 2J5FA 2R9SA 3ELJA 4RIYA 4XV2A 3CTQA 3VUMA 3ALOA 2CGXA 5EDRA 2QNJA 2XNEA 4FV5A 5CEMA 3F2RA 2X39A 3WZJA 4G17A 5AAFA 2X0OA 3R7OA 4DN5A 1YKRA 5HBJA 1W2FA 2ETKA 3MA6A 3MB6A 2ZOQA 1YWVA 2JIIA 3D83A 3P7CA 2XNNA 3PWYA 2QODA 4JR3A 1O6LA 4ZEGA 3P1AA 3COKA 5HVKA 2ZJWA 4FIEA 1WBSA 4F7LA 3FMKA 4I5PA 4BL1A 3KXNA 5ANEA 5C8MA 4AZEA 2C3JA 4FT9A 4EH7A 1YOLA 3NCZA 3DBCA 3GXLA 1Q8ZA 3GC9A 2ZYBA 3QZGA 3JVRA 3ZRMA 4Z55A 5J87A 4G5PA 3GOPA 2XBJA 3RAIA 4TZRA 3QTSA 4EBWA 3HAVA 4FF8A 4L43A 1G5SA 2Y4IB 4A7CA 1VEBA 3GEQA 5IEXA 2QURA 3QQUA 3PJ3A 2KULA 4M3QA 5HU3A 4IFCA 4QMPA 4RJ5A 2GNHA 4XNEA 4LOQA 4EHZA 4UXQA 5KMKA 3R1NA 1CMKE 5TKDA 3E5AA 4K11A 5CAOA 4UY9A 5CAUA 1Q97A 5FTQA 2OIBA 1YI3A 1PXJA 2W05A 2I0VA 4FZDB 1CKPA 3TV7A 3JUHA 1XO2B 5FEEA 3HGKA 4OTRA 1GIHA 2UZUE 5ANDA 1UNHA 2NRYA 4NTTA 1HCLA 2I0YA 2WAJA 3II5A 3RI1A 2ERZE 3LFFA 4AF3A 4RZVA 5FXRA 5I9WA 4G6NA 3TJDA 3KEXA 3I5NA 5CF5A 3VULA 4OLIA 4TYEA 4DFXE 1Q8YA 1U59A 2XYUA 4QDVA 1IASA 2YIWA 2V5QA 4ZSLA 4CFUA 4LRMA 3BHUA 2R5TA 2UZNA 4QMWA 3BIZA 4BIEA 3ERKA 3VVHA 2QOKA 2R3HA 3OP5A 5AR3A 5DYJA 5F9EA 3Q9YA 3V5QA 4LGGA 2OW3A 5CALA 1WBNA 4QMUA 3GC8A 3KVXA 4P90A 3ZYAA 4DG2E 4JBOA 1Q3WA 3RCDA 3TUDA 1REJA 2X1NA 4MHAA 2NYAA 5LCKA 1XH8A 4QP3A 3WYYA 3QLFA 2VWIA 4O38A 3WI6A 4EYMA 3E8DA 3T9IA 5EKOA 1J1CA 1JPAA 3FPMA 2C0TA 4BWPA 2C1BA 3DKFA 3AC5A 3M42A 5A6NA 1Q8TA 3PA3A 4I41A 5TO8A 3LE6A 4M67A 3FZPA 5KZIA 3VBQA 1ZOEA 2QOBA 3NMUF 4NM3A 4HZRA 4MEDA 3ATSA 2UW0A 4AGDA 2FUMA 4FSNA 3IDPA 2XIKA 4ZLOA 1YWNA 5B2MA 1NY3A 4DFBA 3IGGA 4EKKA 5HO6A 5K5XA 3G0EA 3F3VA 4A4LA 5GJFA 2HAKA 4YNEA 3VS4A 5M4UA 3VBXA 4XLVA 3UYTA 1M2PA 2VO3A 4RFMA 4B99A 3QCYA 2ZDTA 3O17A 4U7ZA 3EIDA 4UZHA 2GU8A 3ORTA 1OBDA 2GSFA 5CVHA 4JMQA 3PG1A 4DH3A 3QQHA 1JSTA 1PMEA 5B7VA 2OO8X 2WMSA 3PXRA 5BV3A 5DH3A 4HYHA 4FKRA 3NFGB 4BCFA 3FZ1A 4YJNA 4IWOA 5DIAA 1JWHA 4XMOA 2YIYA 4BCQA 3VNTA 3GCPA 2XK6A 3A7FA 5B2KA 5IMEA 3DLSA 3A4OX 3JPVA 3VHKA 3IG7A 4TNBA 4WHZA 3UIXA 1ZYCA 4RVKA 5HIBA 4CT2A 1FVRA 4HGTA 4FNZA 4YR8A 4O83A 4AQCA 2XNBA 3NUXA 3N9XA 3DT1A 2XIXA 3VQHA 1M14A 3BLRA 4F6WA 3BYOA 2UVXA 2ITOA 2R3GA 2WIPA 3A4PA 3DJ6A 3QQFA 3ROCA 3CSVA 2X4FA 2JDOA 4EH6A 3U55A 2R3MA 3QTRA 3UC3A 4NCTC 2XK3A 3BV3A 4B4LA 2IN6A 3RAHA 1BUHA 4CV9A 2X0GA 1KE9A 1OL7A 3C0GA 1Q3DA 3V5WA 1O6KA 2WD1A 5M08A 2HZ0A 2WTIA 1FPUA 4OTWA 4ASEA 4FKVA 3RTPA 3ZSHA 2VV9A 2VWUA 4O4FA 4EK5A 4W4VA 5CANA 4M13A 3BLAA 5M55A 2C1AA 5F94A 1QMZA 3QXOA 4I94A 5FP6A 5A9UA 1J7IA 3R63A 3E87A 2PVMA 3DTWA 4QQTA 5L6PA 3ZC5A 2ZDUA 5F20A 4EONA 4U81A 2SRCA 4BCMA 2J50A 3ATTA 2P55A 3L9PA 4C38A 4QP2A 5CZIA 4KD1A 4S33A 4AAYA 4O1OA 3OFMA 4RJ7A 2QLUA 5FWKK 5L3AA 2XKEA 2X8EA 4O82A 3R02A 4PNKA 2JFLA 4OAUC 4RJ8A 3TZ8A 2BAKA 5C01A 4XJ0A 3GUBA 4C8BA 4DG0E 3DXQA 2ITYA 4I24A 5JGBA 4MQ1A 4J7BA 4K9YA 4IXPA 3QQKA 3TWJA 1T46A 4AOJA 4FG8A 2C5XA 5A4LA 4FRFA 1IA9A 4J52A 4TYIA 4DINA 4O7YA 2A0CX 5D41A 2RG5A 2R3OA 1NVSA 4R8QA 5AP5A 4A9TA 1MP8A 3LFQA 3OS3A 3HA6A 3OWJA 5ANOA 3LXPA 2CCIA 5LWNA 5I9YA 5AMNA 3AT4A 3F3ZA 4IVCA 5AR5A 4TRLA 1NXKA 5KZ0A 4F78A 3QUDA 5A4QA 2VN9A 3ZEPA 5CEPA 4KIPA 2YLFA 4MCVA 3C4WA 1XJDA 2R7IA 5DVRA 2VO6A 3EKKA 4C62A 3S4QA 2R3IA 1CSNA 3F88A 3UOKA 1P4FA 4I1ZA 3IS5A 2F57A 3OZ6A 2ETRA 3G5DA 5LMAA 3RINA 2QG7A 3ZRLA 1OMWA 2HW7A 1SM2A 4KKEA 3I6UA 2QLQA 3O23A 5GZ8A 3D7TA 3LMGA 5KKRB 2O64A 3AC1A 2FB8A 4E6QA 2W17A 1OVEA 1XH9A 3IOPA 4FMQA 4IACA 4TL0A 5AUVA 5DHJA 5HG9A 4DH8A 3VWAA 4YZCA 3TV4A 2YAKA 4OBQA 4AQKA 4GSBA 2WMXA 1QPEA 4JT3A 4D1ZA 3UIBA 3W0MA 4IHPA 3POOA 4C35A 2I40A 2Y9QA 3EMGA 2JDSA 3R7UA 4ZAUA 5AP0A 3FXWA 4BTJA 3IK3A 4A9UA 3JR1A 4RMZA 4QP6A 2UZLA 2GHGA 3NUUA 4W4YA 4MUQA 2BDFA 3DAKA 3ANQA 2PL0A 4WNOA 5EI6A 3ZRKA 1IAJA 5F95A 3RPVA 1BI8A 4EK8A 3R8MA 4EH5A 2C3IB 1YXTA 3PIYA 2GTNA 2FYSA 4I6QA 2JKQA 1WBWA 4IAZA 5AV3A 3TTJA 4BWXA 4ZJVA 5IU2A 4DFYA 1XWSA 1ZYJA 5AUUA 3W2RA 3MVHA 5KMLA 2X9FA 2YLEA 2HOGA 1RE8A 3DZOA 3F7ZA 3EN7A 5CTPA 3TZ7A 4GMYA 5C8KA 4Z3VA 3PE2A 2B4SB 1ZAOA 3UOJA 4HVIA 5EI8A 3R1QA 3LQ3A 3L9NA 5AFVA 4N57A 2ERKA 3C50A 4C4EA 3O71A 4R7IA 2JDRA 4RC4A 2A4LA 3MIYA 2YISA 3HVCA 2WQOA 3ZDUA 5HBHA 4BYIA 4F09A 3TUBA 3MS9A 2VTNA 5DRBA 3C4XA 4QNYA 3BV2A 1YOJA 2ITZA 4L42A 4O0WA 1H0VA 2QHMA 4E8AA 5DT0A 4DHJA 3NGAA 4RJ3A 3BHVA 3PXZA 5BYZA 2ITXA 3ZS5A 4ASDA 3ULZA 4CMUA 4CRSA 4EK6A 3VONA 4M84A 4Q9SA 3WOWA 2YFXA 1WVWA 3C1XA 3DQXA 4FTTA 4EOOA 1W83A 1UV5A 2BZIB 4DEBA 2HCKA 5IQAA 4D9TA 4NEUA 4HCTA 3KIOC 3GFEA 5HVYA 1ST0A 2BFYA 4DC2A 4FIFA 2B9FA 2R3NA 3D7ZA 2EB3A 3SRVB 3P5KA 3WARA 5AADA 5FDPA 5IQGA 3AC2A 3QALE 5T68A 1H8FA 4IMYA 5BVOA 4FKUA 5G1XA 5HCYA 3MESA 3VF8A 4L9IA 4I3ZA 5AUWA 4AT4A 2R3QA 5LMKC 4DTBA 2C6EA 1JQHA 4J53A 4O7NA 3QRUA 2JGZA 4GU9A 4IE9A 4CD0A 1G8JA 4A9YA 4ITJA 3N4UA 5AUTA 4MXAA 3ZO3A 2R3PA 3UQGA 2B52A 3GCSA 3E62A 4ASZA 4I5MA 4GJ2A 4FK3A 5AIRA 5EW3A 3F2AA 2R2PA 3PE1A 1WFCA 3S2PA 4FJVA 1SYKA 2UW4A 4FSTA 3W0PA 5KMOA 3DK7A 3MB7A 1VZOA 1PXNA 1PXOA 2XJ2A 3QX4A 3QYZA 1Q61A 1ZMUA 3TIZA 3UMXA 3ORMA 5TR6A 3WE4A 4UN0C 4M0ZA 3Q52A 1J91A 4WA9A 4FOBA 5KUPA 4BCOA 2F49A 2F2UA 3CTJA 4OTHA 2WMWA 3R22A 3LQ8A 4EYJA 4F1OA 4Y85A 2ZFYA 1P14A 2BRMA 3QC9A 5A14A 1IR3A 4JVGA 5LJJA 4U9AA 3ZLWA 4E6DA 4BDAA 2QO9A 5DBXA 1XH7A 2IVUA 4MXZA 3ACKA 4ZS4A 3O2MA 3UVRA 2WO6A 4IZ7A 3TACA 4AW1A 3BKBA 3ORKA 3Q9XA 4WSQA 1UKIA 3IW4A 4IWDA 3BBTB 5L2IA 1KE8A 3DS6A 4XP0A 5BUIA 3ZHPC 3UNKA 2QHNA 3MW1A 1XR1A 5CXZA 3EQGA 4KNBA 2GQSA 2Y4IC 1URCA 4JBPA 3UMWA 4EK3A 3QD2B 4OTDA 3DU8A 3PYYA 3BU6A 3IOKA 4PMTA 3QZHA 4I93A 4BZNA 4TYHB 4JDIA 4GUEA 4DLJA 2ONLC 1W8CA 1ZYLA 3NSZA 1PXLA 1BMKA 3VS0A 4I6HA 3UC4A 4IVDA 2BPMA 1MRVA 2H9VA 4L52A 4CG9A 2C69A 4YZ9A 2CSNA 3MVJA 2RFNA 3GENA 3F5PA 3QD3A 4B8MA 4BKJA 2A1AB 4JIAA 3PZHA 2CKEA 2WU6A 4U3YA 4IDTA 3T3UA 5I0BA 4ZZOA 4WBBB 5DFPA 4K18A 3CD3A 3ZFYA 2GNFA 3NYNA 1OITA 2Y8OA 1QPJA 3V3VA 2VRXA 1W98A 2X7OA 5CNNA 4UWBA 4O4CA 2EXCX 2J2IB 3O8PA 4DH1A 3IW8A 4O7LA 4J8MA 3R83A 1RDQE 2HZNA 2W96B 3OWLA 2FVDA 4BDGA 3E3PA 3S00A 3AC4A 2JC6A 4XCUA 1J7LA 4DA5A 5L2QA 1QPCA 1M7QA 2ETMA 2BR1A 2GHMA 4S30A 3LQ5A 4F70A 4NIFA 4DHFA 2QKRA 4FG9A 3R7VA 1V1KA 3OC1A 5CEQA 3U9NA 4PDPA 3V5TA 4BYJA 4O0RA 4CRLA 4QTAA 4YHTA 2VTQA 4FTMA 3ZSIA 2Z7RA 4RX8A 2B9HA 4FTCA 3RP9A 4IWPA 4EUUA 4PF4A 2OJ9A 3CPBA 4BC6A 1XBAA 3COHA 4UBAA 3LLAA 4DYMA 1Q4LA 5H3QA 5CT7A 3RPYA 2PVKA 5ACBC 2IG7A 4FTRA 4L6QA 3QUEA 4B9DA 1OIYA 3W2CA 3PWDA 4CKRA 5M4CA 3TNWA 3C0HA 3BYVA 4P2KA 3FMMA 3NAYA 4LG4A 4N6YA 2VTHA 2A27A 3FHIA 1E9HA 3O8TA 4Z16A 4KKHA 3WZUA 4AXEA 1QPDA 3C9WA 2BCJA 5E8YA 4CFVA 4R78A 2W1IA 5EFQA 3HRBA 2XEYA 3Q60A 5DGZA 2ZV2A 3I79A 3CKXA 3FWQA 3NVMB 4WNMA 2KTYA 4ERWA 1H1SA 4U3ZA 4ANQA 4U5JA 4WG3A 4AP7A 4EOQA 1KOBA 4NCTA 3GGFA 4R3RA 5IISA 5DPVA 5HEZA 2G2FA 3BELA 2VWXA 2B53A 3O7LB 3Q3BA 1ZZLA 4EOLA 2FSOX 4S2ZA 3R9DA 3KF4A 5HE0A 4H39A 2W99B 3PSBA 3GQLA 4FOCA 1M7NA 4IIRA 4JLCA 2RGPA 4ZY4A 3G2FA 3KKVA 4ITHA 4C57A 3SOAA 3QXPA 3RM7A 2C6IA 5FXQA 2YJSA 2WTCA 4U0IA 3RHXA 4NJ3A 2X6DA 3OUKA 1Y57A 4DG3E 5M4IA 3Q4CA 4AW2A 3MGYA 2W7XA 4AT5A 3D5WA 2VTPA 4CFXA 2JKOA 3L9MA 4IDVA 1JKKA 2UVZA 5J9ZA 4TWNA 3DCVA 4ANNA 4PPBA 5E7RA 1XBCA 3MIAA 4I20A 2PY3A 2OSCA 4PUZA 5E8VA 3EQPA 2V7OA 5BVKA 5LQFA 2W1GA 3ORIA 4PPCA 3UGCA 2V62A 5CY3A 2GFCA 4AOTA 4FTQA 2JLDA 4FV1A 5L8LA 3QD4A 1TFFA 3UJGA 3NNWA 4WO5A 1STCE 3GCQA 4C36A 2PZRA 1M2RA 4FV8A 5AM6A 4EHEA 3W0OA 2R4BA 2BTRA 1W82A 4G16A 4JI9A 5E91A 2REIA 3ET7A 2CPKE 2XK9A 4ACHA 2C68A 4FTOA 3FYKX 2GNLA 2PZPA 5LVNA 2YHVA 2OKRA 1O9UA 2J0JA 4IH8A 4RIWB 3QTXA 4L8MA 4PMMA 4LUEA 2PULA 4E4NA 2HZIA 4JDKA 4I21A 3SX9A 3V5JA 4DDGA 3HV6A 2XNGA 4W8EA 3UDBA 3TKUA 5L2TA 5K4IA 3A7IA 2RIOA 2Z60A 2Z7LA 2PUNA 3TNPC 3KY2A 3TV6A 4BN1A 5KNJA 5CQUA 4YLKA 2B54A 4RQVA 1H1PA 3FLWA 3KK8A 3PY0A 4PTEA 3G15A 1WVXA 4PPAA 2O65A 1K2PA 5LWMA 2WEIA 3NX8A 3HDMA 2R3FA 2EVAA 4ALUA 3PXQA 4Q2AA 5HE3A 3EHAA 4PV0A 3NIZA 3VBVA 5T3QA 2Q0BA 3EKNA 2P2IA 4I0TA 5IQEA 4GUBA 4S32A 2XJ0A 4OW8A 4RZWA 3TXOA 1CKIA 3UBDA 4I6FA 1FBNA 4WBOA 1WBVA 1BI7A 3G9NA 3MY0A 5AV1A 2UW9A 3RNIA 4ORKA 4HZSA 4J95A 4QYYA 3EYGA 4KSQA 4C4FA 2QOCA 3GU8A 4BBFA 4IX3A 3BYMA 5CAPA 4LDTA 4WUNA 5DI1A 2QOFA 2XK7A 4PRJA 2XP2A 4DITA 3GNIB 3UOHA 5J8IA 3LIJA 2OZAB 4ZSAA 3S1HA 3R30A 4BHZA 2QOQA 3F82A 3CP9A 4DGLC 4I0SA 4Z7GA 1EH4A 2F7EE 3OOMA 5KKRC 4V04A 3HV5A 3EB0A 2WMQA 2P4IA 4EOJA 2VTMA 3GP0A 4X2NA 2IJMA 2J90A 3PIZA 3HKOA 3OVVA 2UZEA 5ANIA 4EL9A 4IB0A 4V0GA 3RM6A 4IX5A 5FXSA 2C0IA 3D4QA 5A3XA 5CF4A 4FKSA 3A99A 2G15A 4BJJA 1Q99A 3H0YA 2QR8A 4AZSA 4J98A 4DFNA 3NNXA 3GC7A 3PVBA 5HO7A 4IW0A 3LCDA 3GU5A 2CDZA 3TNIA 3WIKA 1PW2A 4NUSA 5FRIA 4GT3A 3WE8A 5DRDA 4GU6A 5CU2A 5H2UA 3OCBA 3DDPA 3OD6X 4MF0A 4KIKB 3SHEA 1GOLA 1KE5A 3QL8A 4U97A 2W06A 2IZTA 5CNOA 3FI2A 1TZDA 5DR2A 5HQ0A 3PLSA 4L46A 3D0EA 4A4XA 4AAAA 4GKHA 2HY81 4FNXA 4RIYB 5HLPA 2ITNA 3UDZA 2OH4A 2VX3A 5HG5A 3P0MA 4IAYA 5IA0A 1AQ1A 1OIRA 3PXKA 3F61A 3LMHA 3H9OA 4O2ZA 4D2WA 3IONA 4JJRA 5IKWA 4KBKA 3ZFXA 2NO3A 3BX5A 5IH4A 3VBTA 5HORA 3PY3A 5JZNA 1YQJA 2I6LA 2PVHA 3AQVA 4AA0A 4EQMA 1LP4A 3CQWA 4BGQA 4F99A 3R71A 2WIHA 5ANJA 3CCNA 3SXSA 5AR4A 3QC4A 5LXMA 3IKAA 4R1YA 3T9TA 4LGHA 4K33A 3AG9A 4PQNA 4LMNA 1E1XA 5C26A 5IPJA 4BDJA 4HW7A 2P2HA 4JG8A 2F4JA 4HCVA 2Z7SA 1JBPE 5E8TA 4OTIA 5J9LA 4JQ7A 4QO9A 4AXDA 3BGPA 4JQEA 3LPBA 5FDXA 4X2GA 3BWFA 2ZM1A 3MTFA 5CU3A 1UWJA 5HLNA 4O6EA 2ZV7A 3BGZA 4PDSA 3NWWA 3W0SA 2EU9A 4FX3A 4NWMA 5CSXA 5HESA 2XKDA 4GFOA 3W0RA 3KXMA 3QQLA 4YJSA 4ZZMA 3P78A 3WF5A 4C33A 2XB7A 3UDTA 3Q2MA 4QDEA 1L8TA 4K0YA 3Q04A 4BCPA 1DAWA 2PZ5A 4EBVA 3FUPA 5FD2A 4BDEA 4BIBA 5CSPA 4Q9ZA 5D1JA 3PUFC 1YXVA 3PSDA 4QMYA 1SVGA 1I44A 5EM7A 5JFSA 3VS7A 4FEUA 3IPHA 4UALA 5CVFA 5AM7A 2R0UA 4PP9A 4RWIA 1PYXA 1GZOA 4EEVA 3NNVA 3QQGA 2RL5A 3FBVA 5EDQA 4IC8A 2OFVA 3ORNA 3QD0A 3QRJA 4N0SA 5ANGA 4C4HA 2CNVA 3PSCA 2O2UA 3F7WA 4RGJA 4ZZNA 1H24A 3BHYA 3EQRA 4NFNA 3VS6A 3QCXA 4JXFA 1WBTA 3OY3A 4X2FA 4X3FA 5BVWA 3H4JA 3VUHA 5BX0A 2RG6A 5HNGA 4FTJA 4HGEA 3QF9A 3LVPA 2BUJA 4FV7A 3CJGA 5L6OA 4U79A 5JSMA 2XZSA 4AG8A 2ONLA 3CTHA 2ITVA 4JR7A 2PWLA 4MD8E 3ALNA 1WBPA 1XH6A 2NPQA 3ETAA 4RVTA 2YAAA 2QCSA 2P3GX 4O7WA 4C3FA 3ZM9A 4HVHA 4FUXA 3D15A 2J6MA 1T45A 2C4GA 4BDCA 3VO3A 3LXLA 2A98A 4RX9A 3FJQE 5I9UA 1PMUA 3D9VA 1OPKA 3A8XA 1L3RE 2C5YA 3GB2A 1PJKA 3L8SA 3SXRA 2QG5A 3OTVA 4DHIB 1XH4A 3DKOA 3LCSA 4V05A 5D9HA 3GBZA 4M12A 2X6EA 3TZ9A 3VRZA 4F0FA 4FT7A 5BPYA 3LFNA 3FI4A 3CY3A 4N6ZA 2HELA 4CQGA 3WF9A 4FL1A 4I6LA 4DTKA 3FLQA 4C61A 3KCKA 3DBQA 4ZTMA 1U54A 3QQJA 5EYCA 2BMCA 4G3DA 1GNGA 4AT3A 4HVGA 4E5WA 3F9NA 4GK4A 2XYNA 5HD4A 3ZXTA 4BICA 4C37A 2BVAA 5JZJA 1APME 4ZSGA 2OWBA 1PMNA 1M2QA 4R1VA 3KB7A 1Q62A 4YU2A 4RX7A 3MTLA 1ZXEA 2V55A 5D10A 4AFJA 1H26A 4JG6A 3MI9A 5LVPA 2JDTA 4X21A 2OI4X 4E5BA 2EUFB 3FY0A 4FKJA 4I5CA 4CZTA 4CVAA 4OT6A 3QHWA 3DXPA 3NW7A 2HYYA 2P33A 3GVUA 5CXHA 4FTLA 1VJYA 4TT7A 4QMNA 4EOMA 4R3CA 3VC4A 1OIQA 1G8AA 3AT2A 3D94A 4QTEA 4MXCA 3U87A 3NW6A 1YVJA 4R77A 5EYMA 5KMMA 4NSTA 5FP5A 5E1SA 2UZOA 3FMDA 3CJFA 4M15A 4A4OA 1E1VA 3KF7A 4AW5A 4X2KA 2VWWA 2WU7A 2YERA 1Y6AA 4ANLA 4PMPA 3P5JC 1R39A 5HICA 2RF9A 3QRTA 1PRYA 4MNEB 3AD6A 4LM5A 3FHRA 3OWKA 3ZZWA 4F0GA 1Q41A 4QD6A 4ALWA 1PYEA 3IO7A 4MF1A 2EXMA 4GW8A 3UQFA 5LVLA 2WMUA 1TVOA 2O63A 2WQBA 2XNPA 3CY2A 3EQCA 5JT2A 4FSZA 2VAGA 2WMRA 4FKWA 5H8EA 4XRJA 3GC0A 3HYHA 5HG7A 2WB8A 2XF0A 4FSWA 3M2WA 3QCQA 2ITPA 3L1SA 1MQ4A 1SNXA 3KRRA 2UZDA 4YURA 4AGUA 3TKIA 4CKIA 4JDHA 3QTZA 4H1JA 5IQBA 5EQEA 3DBDA 4FEQA 1YHSA 2WXVA 3PJ1A 3OG7A 1KWPA 2OIDA 1CTPE 4GEOA 3Q53A 3SDJA 4XLIA 1PKDA 2QOLA 3ZM4A 4RJ6A 4FNWA 4OUCA 5HIDA 4IAAA 5HKMA 4XV9A 4YNOA 2OK1A 2XCHA 4KIQA 4A06A 4F6SA 3HMNA 3COIA 5AV4A 2GMXA 2C6LA 4QMVA 4RWLA 2WZJA 3GFWA 3NUSA 4BZDA 3HP5A 5CEKA 3PJ2A 2Q0NA 4GK3A 4GH2A 3PXFA 4RWKA 4KIOA 4AZWA 3TCPA 3D7TB 4ZP5A 5H9BA 4QP4A 2OJGA 3DQWA 1FMOE 3KN5A 3MWUA 4ANSA 4YZMA 5IDNA 3OMVA 5JKGA 3DDQA 3VW6A 4GYGA 4QYEA 5AP2A 1S9IA 4UMTA 3I1AA 3CE3A 3KL8A 4NW5A 4F9CA 3SA0A 5E9EA 1H25A 2C3LA 3LFBA 3C4CA 4HYUA 3LCKA 4X6RA 4D4SA 2X0QA 4ZMEA 2G2IA 4YC6A 2GFSA 3F3TA 4UB7A 3FI3A 3VS2A 2WQEA 3FXXA 1TQIA 4Y8DA 1ERKA 4AOIA 5DN3A 4MXXA 3NIEA 4QPAA 5AP4A 2HXLA 1WAKA 4FZAB 3DK6A 3H0ZA 2WQNA 5F4NA 3I7BA 4IM3A 4F64A 3FLSA 4Z7HA 5E8XA 4IAFA 5JFVA 2AC3A 3ZSGA 4IJPA 2BILB 1ZYDA 2E2BA 3EN9A 4AXCA 3RK9A 3P7BA 1UU9A 2XRWA 1ZOGA 4XG8A 5LARA 4CKJA 3KCFA 4NYEA 4FKIA 3TDWA 3IW6A 1IRKA 4JRVA 4O2PA 4EHVA 5M4FA 1BL6A 4CGAA 1DM2A 2PZYA 1OL1A 3L8VA 2OZOA 4RSSA 3F5XA 1VLRA 5FM2A 4C3PA 1ZYSA 3EQDA 3Q32A 3Q9WA 4ACMA 1WZYA 2VWYA 2QC6A 2W5AA 3FQEA 4O4EA 3BHTA 4DCAA 4BKZA 4Z9LA 3S0OA 5IA2A 4U42A 2XJ1A 4II5A 3V8WA 3TNHA 1WMKA 5AR2A 4XG4A 2OLCA 3PJCA 4NW6A 4YTIA 3CBLA 4TKSA 4M7IA 3O96A 1H4LA 4FNYA 4M69B 2FSLX 1YXXA 1IG1A 2CJMA 4UXLA 4CZYB 3E88A 4G3GA 5HIEA 4LUDA 2BIKB 2J9MA 2JD5A 3OWPA 4X0MA 5FEDA 5HG8A 3WYXA 2J5EA 4EK4A 1W0XC 4MBJA 4UWYA 3UO5A 4QP8A 2P0CA 4U80A 4MNFA 2PUIA 3P23A 2E9VA 4KBAA 5L8JA 4E20A 4F7NA 4HJOA 4YJTA 2PVLA 3HUBA 4FVQA 2V0DA 4E4MA 3W10A 2IW8A 5BMMA 5I9ZA 1BLXA 3ZO4A 4IANA 4FTUA 2R7BA 1ZWSA 4GIHA 3FZRA 2XAOA 3R04A 3VAPA 2WMTA 2IPXA 3E7VA 5AP1A 3VUDA 3U54A 3MYGA 4O4BB 2BTSA 3KXHA 4CFNA 1UU3A 4YP8A 5ETIA 3EOCA 3R8ZA 4KABA 1OI9A 2YWPA 4GFGA 4FZ7A 3WZDA 5FEQA 4IB1A 4QTCA 1OL5A 3HL7A 3IW5A 2HY0A 3R6XA 4WKQA 3F5GA 3HV7A 4USFA 4D4VA 5M56A 4O81A 4BY9E 2B9IA 4MXOA 4ZIMA 5E8WA 1GIJA 4AN9A 2X2LA 4GG5A 2XKCA 1RJBA 3NFFB 5CSWA 2A2AA 4ZTQA 3BYUA 3B8RA 3ORPA 5JN2A 4EQUA 4GKIA 1Z9XA 4J1RA 2BFXA 3U51A 4IBMA 3KMUA 1MRYA 3BE2A 3QRIA 5AUZA 2XAMA 4JRNA 3W0NA 4NT4A 2JBPA 1OGUA 2VTLA 4U45A 4IWQA 4TW9A 3R9NA 1P5EA 3SRVA 4XG6A 4C4GA 3ODZX 4EZ5A 4G3CA 4E3CA 3EH9A 3EQIA 3MVMA 5M53A 4EC9A 4Y5QA 3LXNA 4F7SA 2DUVA 2WMVA 4ID7A 3U9CA 2J0MB 4JIKA 4BI0A 2QO2A 5BVFA 3BBWA 3P9JA 1H07A 5CAQA 2BZHB 5K0KA 4G6LA 4E1ZA 4F9YA 5D7AA 1PF8A 3CEKA 2WOTA 2ZV8A 1JOWB 1IA8A 2AEGA 3HAMA 3KMMA