4YTFA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune diseases
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
289
structure length
283
Chain Sequence
b'TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 283
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytfA01
2GPHA 3FQHA 4PDOA 3TZ8A 5EKNA 2CN5A 4CVAA 5IQBA 3H9RA 5AAEA 3TM0A 3QKLA 5LWNA 2J0JA 5EG3A 4I6QA 4OTIA 3P86A 2OH0E 2YJSA 3QRKA 3AC2A 4FTMA 3UTOA 3ZSHA 1O6KA 4DEBA 4NJDA 3TEIA 4CCBA 4EOQA 5HU9A 3PXZA 3DDPA 3EQDA 1PXNA 4FKJA 2YM5A 3VQUA 4A9YA 3FYJX 3FZ1A 3HRCA 1W0XC 5ETIA 5H9BA 2C30A 3OZ6A 4QYFA 3PLSA 4XBRA 4F99A 4FV9A 4J53A 1CTPE 4GK3A 2WMVA 3ZXZA 1XKKA 2ZM4A 3G0EA 3KC3A 4HGLA 3OS3A 4CRSA 5K5XA 4UZDA 1JPAA 1Y6AA 2XBAA 4APPA 2C6KA 4RQVA 3KK8A 4LL5A 4RJ8A 4YZMA 5DBXA 4ZXTA 3CKWA 3ULIA 3DB8A 4LYNA 2YDJA 3AC5A 5FTQA 4BCGA 5HBJA 1SNUA 2GDOA 3PIZA 5A4QA 4FSYA 1FMOE 4DHFA 5K9IA 4D5HA 1GY3A 2F4JA 4UZHA 4FEXA 4I93A 3AMBA 3BHTA 4G1WA 3EZVA 3QCSA 4QMWA 4IQ6A 3VW6A 1UNHA 5KUPA 2QOQA 4QNAA 5I9UA 4RWJA 3QTIA 4FVRA 3HGKA 5AUWA 2W7XA 2WU7A 3GEQA 3TKIA 4CG9A 5EOLA 3K5VA 3AQVA 3MTLA 4IZYA 4GS6A 4D4RA 3EJ1A 5C4KA 1A9UA 4J1RA 5ETCA 4FKWA 2VNWA 2Z60A 5GJFA 2BDJA 4ERKA 4AE9A 5A3XA 3FZOA 4BI1A 3LCSA 3QGWA 2QLQA 4H3BA 2UZVA 4GT5A 3IDPA 4BFMA 4EH5A 4BBMA 2OXDA 3QX2A 2XM8A 3PIYA 4O91A 3VN9A 3PP1A 5I0BA 1QPDA 4FK6A 3C51A 2YN8A 3HMOA 4KBCA 5AM6A 3UO4A 5JEBA 4A07A 5A4TA 4RX5A 3F2NA 4QMQA 4IXPA 4F7LA 4UWYA 3DNEA 3QTZA 3IKAA 4RVTA 3R7YA 4MVFA 4F9WA 5HVYA 4F1OA 3UNZA 2HWOA 2X8EA 3ITZA 5IUHA 5D11A 2YDKA 5AV3A 4Y95A 1OBDA 5C8MA 5DT0A 1H0WA 4CXAA 5JN2A 1WBNA 5L2IA 5F94A 4JVGA 3VBQA 3GUBA 5FBNC 4EQCA 3N9XA 3NW7A 3VF8A 2BKKA 5AUVA 3EIDA 3R2BA 2YWPA 5AMNA 3S4QA 5CNNA 2XUUA 4F0GA 5IQGA 1W84A 3QXPA 3FI4A 3H30A 4O27B 3UYTA 5J7BA 3MDYA 5HTCA 3HL7A 3TACA 2V22A 3EQFA 3IPHA 4UMUA 3LM5A 2Z7QA 4MNEB 3QZIA 1R3CA 4L6QA 3UZRA 2ITUA 4PP9A 4X2FA 4WBBB 4YLLA 5CEPA 5J95A 3I4BA 3TN8A 1CDKA 3D2IA 4NH1A 4DG0E 4DGMA 2UZNA 2YFXA 3MA3A 4I5CA 4X2KA 2UUEA 4U0IA 4KABA 4CFWA 5LCJA 4PPCA 4BBFA 3D15A 1Q41A 3ZUVA 4FSUA 5TR6A 1OVEA 4FL2A 2YERA 2Z7LA 4PL3A 4U9AA 4USFA 4M8TA 2IN6A 4G17A 4QT1A 1IAHA 1YDRE 3HMIA 2VWVA 1F3MC 1MRVA 2WTDA 3BQCA 1S9JA 4O7YA 5EM6A 3P7CA 1AQ1A 4B7TA 3RAKA 2GFCA 4KBKA 2Y6OA 5HG7A 4U41A 4A06A 4WNPA 5I3OA 2HXQA 4G31A 4FG9A 3K3JA 2PVHA 3GC7A 3HUBA 4QTCA 3R9NA 3UBDA 1STCE 2IW6A 4FSNA 2IO6A 5BVEA 2HW6A 2IVSA 4GJ2A 3TJCA 4MD9E 4TTHB 3O23A 3TT0A 2VX1A 3C4XA 3R9HA 1WAKA 4CZUA 3I7BA 3OUKA 3CY3A 3F88A 4EL9A 5FXRA 3ZZEA 4IE9A 4FI1A 3AC8A 4NM5A 4U6RA 4FTAA 3ZO1A 4F4PA 5IA3A 3D7TA 3HVCA 3LCDA 4FKIA 4O7TA 2R7BA 4Q2AA 5IQIA 4MXCA 3BGPA 4YJOA 4WUNA 2R3IA 2VZ6A 5LVOA 4NU1A 5D7AA 2HELA 4K9YA 1P4OA 2FVDA 5CVFA 4DH1A 5AADA 2QI8A 2WMBA 3OMVA 5CQWA 3R7EA 4PTCA 4ACCA 3UQFA 3LOKA 3B2WA 2JKKA 1OPKA 2W1HA 4FIEA 4QMNA 2GQGA 4MYGA 3R7IA 3NYXA 1HCLA 3D4QA 3EQGA 4JIKA 3GENA 4GEOA 4L3LA 4RRVA 5AM7A 1ZYSA 4QQTA 4K8AA 2XKCA 1DI9A 1O6YA 3BPRA 5CAQA 5I4NA 4M0YA 3C0GA 4IJPA 3DJ6A 3C4EA 3VBVA 1LR4A 2DWBA 3DK7A 4EYJA 5DEWA 3ZS5A 4G3DA 3CCNA 5AUXA 4E20A 2IVVA 4QD6A 4EZ5A 5IA4A 3PJ3A 4QNYA 3D5VA 2XKDA 2C0TA 5ANOA 2P4IA 2YIXA 3Q2JA 4IVDA 5BYLA 3ROYA 2PMNX 3GNIB 3NUAA 5AAFA 3C4WA 4FL1A 3QYWA 3DKGA 2OSCA 3P9JA 4TRLA 5ETFA 3NAXA 3QQHA 3BYMA 3PWDA 1KV2A 4EORA 4RIOA 3R04A 5CAUA 1YOJA 4J95A 2VV9A 4JG8A 3MYGA 4NCTC 3LFQA 4M0ZA 2O3PA 3Q6WA 5LVNA 2XM9A 2NP8A 2QO9A 3HV5A 3QD3A 4NJ3A 4CLIA 4FKGA 3GU4A 5CYIA 5KBQA 1YWVA 3U6HA 2F49A 5FTOA 4B8MA 4E8AA 5AP6A 1I44A 1OL6A 5CENA 3RTPA 4Y72A 5CXHA 5KMMA 4FVQA 2BR1A 3QQGA 2B7AA 3VUDA 3FKLA 1YDSE 3KY2A 3Q4ZA 3HP5A 2CNUA 4JAJA 1PKDA 4FTQA 1UKHA 2HAKA 2PMLX 4FZAB 3VBYA 4C02A 4E6QA 4O7SA 3AXWA 3VF9A 4XCUA 2ZV2A 3IDBA 5EK7A 1Q99A 2BAQA 3LQ8A 5AV0A 3OBGA 5FD2A 3ZLSA 1YXTA 3DJ5A 2W05A 5CEOA 2A2AA 4QMVA 3K5UA 3QHWA 3SRVB 1M2PA 4G5PA 2Y0AA 4AZVA 4J98A 5B2KA 4FKTA 3G15A 1GJOA 3IO7A 3P0MA 2GHMA 4QQCA 3QQKA 4E4XA 2W4KA 3DTWA 3FPMA 4BCHA 3GQLA 5TKDA 4AA4A 3F69A 3LQ3A 3FMDA 4NTTA 4C4FA 4W9WA 1SVHA 3LHJA 2BAKA 4HPTE 4IVCA 3PA3A 4F0IA 4G34A 4WG4A 4A4XA 4RIWA 4AOJA 3LE6A 4G6LA 2VTNA 4ZP5A 4FBXA 1PRYA 3PY0A 4GKIA 4K1BA 4AZSA 4MWHA 3RGFA 2OJ9A 2W5BA 3EFJA 5LMKC 2YZAA 4DGGA 2GFSA 3OOGA 4NT4A 1YOMA 3R22A 4JT3A 2PPQA 2XH5A 1GZOA 5ANJA 4OBOA 4DTKA 2J51A 3ZFYA 3R7UA 5J5SA 4PWNA 1M7QA 4HYIA 2CKPA 3A2CA 1NVRA 3QRJA 3FYKX 4GMYA 5M51A 4CFNA 4CLJA 5KHXA 4FTNA 4C4EA 4DE4A 2PZRA 3KK9A 4C3PA 4BIDA 4LUEA 3RP9A 4C36A 5L6OA 1J1BA 4YHTA 4AX8A 3BKBA 5H2UA 2JIIA 2X2MA 5I9ZA 3MB7A 4FGBA 5EM5A 3OHTA 2OFUA 5EYCA 2JBPA 3DBQA 1H26A 2YIWA 3A7HA 3NUUA 4XOYA 4BYJA 2OLCA 3ZM9A 1OKYA 4BGHA 2X4ZA 4I23A 3R9DA 4XG3A 2RKUA 3VRZA 3F5XA 2VTJA 4E7WA 4E26A 1SNXA 4G16A 1HOWA 1WVYA 3GCUA 3WZJA 2PMIA 4K6ZA 4UALA 3RPSA 1PJKA 1UKIA 4YBKA 1FGIA 3BRBA 3QCQA 5HG9A 5HEZA 4FK3A 4J71A 5C01A 3SOAA 2ETKA 3I0OA 4A7CA 5JQ8A 5FUTA 2RGPA 3MPTA 5M09A 2GNIA 2WMSA 1ZOGA 3HA8A 4MNFA 3VS0A 3ZSIA 5J79A 2WQMA 1Q61A 4L3JA 1IAJA 2REIA 3BE9A 3F7ZA 3SG8A 4H58A 4JX7A 3QTQA 4EJ7A 2IJMA 2OG8A 1DAWA 3IW7A 3EOCA 1FGKA 4E1ZA 2QOHA 3ZCLA 1KOBA 4I22A 4TZRA 3PWYA 4DC2A 2ESMA 4O0VA 1URWA 4CD0A 3DJ7A 3DQWA 4GK2A 4NSTA 5CQUA 4BYIA 2E9OA 4M97A 3R7VA 3WZEA 2VN9A 3TG1A 3I0QA 4CKJA 2R3GA 4LGGA 2JAMA 3E5AA 4P2KA 5JGBA 5CU6A 1ZY4A 2YLFA 4IWOA 3DCVA 5AFVA 4MBIA 4MXXA 3CTHA 4GUEA 1E9HA 5ICPA 3ULZA 2BFXA 4AA5A 2ITVA 2BROA 2NNWB 3ZXTA 2PVRA 1ATPE 3PE2A 3QZGA 4B6LA 3QKMA 4TWCA 5L8JA 3ATSA 2QR8A 4CMOA 4WO5A 2IPXA 2ITXA 2P2IA 4X3FA 4C4HA 2HZIA 3TNQB 4LRKA 5HCZA 1RDQE 3P7AA 5EQEA 4QTBA 4HGEA 4UY9A 1H1PA 3OY3A 3UO6A 5J1WA 2ZJWA 3P78A 4RX8A 4I6HA 5M4FA 2Y4PA 4XNEA 3G51A 4YZBA 5HKMA 3R9OA 3SW4A 4Q9ZA 2XEYA 5CU3A 2HY81 4EQUA 2V7AA 4ANOA 4XV2A 1H25A 3OUNB 3R7OA 2XEZA 3FAAA 4RC4A 1IRKA 3ANQA 1QPJA 3TNHA 4R7IA 2VWYA 2GCDA 2NRUA 2CGUA 4FT9A 4NIFB 3ZU7A 3O71A 3T9TA 1F5QA 4GUBA 2SRCA 2HZNA 3SXSA 3DGKA 2QR7A 3BHHA 1Q3WA 3ID6C 4IFGA 2C4GA 3P5KA 4ALUA 1RQQA 4QOXA 4CQGA 2C5VA 1PXPA 2VTTA 3HLLA 1K9AA 3I81A 4MKCA 4QP7A 3F66A 4EH6A 3TDWA 3VNTA 4FA2A 4HVSA 5IISA 4DFBA 2VGOA 5J9ZA 5CSVA 1H0VA 4YJVA 4F9CA 2BKZA 4A9TA 2W0JA 4WRGA 3ANRA 1OL5A 3LQ5A 4FKUA 3MWUA 4FT7A 4BB4A 5CU4A 3EFWA 4ANSA 5HTIA 2F7ZE 4X6QC 5DE2A 5HLWA 3DKCA 3D5XA 4BIEA 4HZRA 2YIYA 2BDFA 3P4KA 5TF9A 2UZUE 4ARKA 5EHOA 3LFEA 3KGAA 1W83A 3M11A 4GU9A 4B4LA 1A48A 3KN5A 4JRVA 4XP0A 1UNGA 2RSVA 4JJRA 4XX9A 4FMQA 5EDQA 2ITTA 3KA0A 3BU3A 3F3TA 3II5A 4KUJA 1BX6A 3DBCA 3ZMMA 3F82A 4C2VA 3DK6A 5LVLA 1G5SA 1UU8A 1WVXA 2ZM3A 4V05A 3VUMA 4HGTA 4Q9SA 2B4SB 5HTBA 4FG7A 4MXYA 2UZDA 4G3GA 5AUTA 4PUZA 3FXWA 5F1ZA 3SXRA 3UE4A 2J0MB 3KB7A 2C3IB 3MI9A 3RAHA 3RCDA 5BVWA 5EW3A 4I5MA 3UMXA 5HIEA 4HPUE 3BE2A 2H9VA 3AC1A 4UWCA 3CXWA 3SC1A 2IVUA 1YXXA 3RK9A 2XJ2A 1UU9A 2BPMA 4I0SA 3EB0A 3HDNA 4RVKA 4WNKA 3UC3A 3ZLYA 4AS0A 5BMSA 5IMXA 1FBNA 4BWPA 2Z02A 3NYNA 4BKJA 3RKBA 3UVPA 3QAME 2WTVA 3LFBA 3QCXA 4FOCA 3A99A 3LXPA 4N4SA 4UV0A 3R8LA 3NX8A 1H07A 2QG7A 5AR3A 2W1IA 4F09A 4FNXA 4D0XA 3PTGA 5HD7A 3U54A 2IZTA 2P0CA 2J2IB 3E64A 2ACXA 3QUDA 4IH8A 4PRJA 4I0RA 4X21A 3KCFA 2FYSA 5LMAA 5KZ0A 4AT4A 3VWAA 3LXLA 3DPKA 4F7SA 1K3AA 3Q4UA 4WIHA 5F9EA 4EOIA 2VO3A 2XK3A 2JGZA 5CI6A 3HX4A 3U9CA 1G8SA 3ENHA 3EQRA 5HVKA 3VHEA 5KX8A 1S9IA 3UYSA 5LWMA 3JYAA 5M44A 3MFSA 5FXSA 4F70A 2YCRA 1A06A 3CD3A 5DH3A 3PLAE 3WF7A 4AUAA 3F9NA 3O8TA 4MD8E 4TNBA 3MBLA 3QGYA 4R3RA 4TWNA 4C8BA 3BGQA 1OPLA 3L9MA 4TWOA 4G5JA 3LJ2A 4LM5A 4BTMA 3FZTA 4L44A 2GQRA 4HNIA 5D7VA 4ASXA 4K0YA 4C57A 1APME 4ZSJA 2BTRA 4MX9A 2PU8A 3ZRKA 3G5DA 3TNPC 2R5TA 2RIOA 4DEIA 5BVNA 4FKVA 5CASA 3G2FA 2WAJA 1JOWB 5KO1A 3GFWA 4JI9A 3FLNC 4BDIA 5EYKA 5K3YA 4ZY5A 3ATTA 2C3LA 4YJTA 3R8PA 2O5KA 3F3UA 3SA0A 4CGAA 2WMQA 3OWJA 4ZSLA 4F65A 4GU6A 1ZYDA 4JDHA 1H27A 3TCPA 5TE0A 4QYEA 2QHNA 3QL8A 4O22A 3BZ3A 3H0YA 5FBOA 3T3VA 3GBZA 3I1AA 1CKPA 1FVVA 2JEDA 4USDA 2BILB 3OBJA 2XB7A 4YTFA 2R3PA 3F2RA 4O81A 4FIGA 4O96A 5KMKA 5D10A 3WZDA 2YM6A 2ZAZA 3DDQA 2WMRA 5BYYA 3ERKA 2JKMA 2A1AB 4RIXA 4XG4A 2B53A 3L8PA 3TIYA 3CSVA 2EU9A 2R3HA 4L9IA 1MP8A 4IM2A 3Q3BA 4BI2A 4KIPA 2YWVA 4YBJA 3E88A 2PE0A 2VTMA 4O0XA 1J3HA 3FMEA 4X3JA 4AE6A 3WE4A 5IQCA 3UIBA 5L2WA 3RWQA 3JUHA 3TV4A 3N51A 4C7TA 5J1VA 4HYUA 2W4JA 5ANIA 4CCUA 5JSMA 4WBOA 4XG8A 3RBWA 2XNOA 2ZM1A 2ZOQA 4EOSA 3GGFA 1BKXA 3Q9ZA 1BL6A 4YNOA 1URCA 4DAWA 3D14A 2PZ5A 5FDXA 2C6MA 2YEXA 5BPYA 4OT6A 2PUNA 4EWQA 3EN5A 3FLZA 2XS0A 3KKVA 1OECA 5H3QA 4V04A 3BYOA 1OIUA 5D1JA 4JR7A 4NTSA 5B2LA 3HV4A 3KXMA 4IB5A 4IMYA 2UW8A 3D5UA 3FBVA 3CJFA 3PP0A 1ZOHA 4KA3A 4NKSA 2A19B 3GFEA 2OI4X 2KTYA 2V62A 5G1XA 3TV6A 3F61A 4IB0A 4MXOA 3V6SA 4ORKA 1M2RA 2R9SA 4KS8A 4IDVA 3IW6A 1DAYA 4FKQA 3NSZA 4RT7A 3PPZA 2YAAA 3C4ZA 3AOXA 3VBWA 1QMZA 1U46A 2I0HA 3BHYA 1YKRA 4RA5A 2J90A 3WF6A 4BDFA 2W4OA 3FDNA 3M2WA 4YZCA 4AN9A 3GOKA 5G6VA 4ZTMA 4U81A 5LARA 3NNWA 4PL5A 4W4YA 3KCKA 4DGOA 5GZ8A 1VYWA 3R1QA 2WEIA 4IAKA 4MK0A 5CT7A 4BCMA 1SZMA 3NR9A 5HGIA 2B54A 4YZNA 2C47A 4EYMA 3QRUA 3EHAA 2F7EE 1R0EA 4U80A 3ZM4A 2XNMA 1YOLA 4D1SA 3LMIA 3V8WA 4MF1A 5IDNA 4RFMA 4UMRA 2Q0BA 5J8IA 4X2JA 3PYYA 3DLSA 4DEEA 2JDOA 5AX3A 3SLSA 4IVAA 3ZDUA 2I6LA 4CYJA 3OCTA 5GNKA 2PVFA 4EH9A 5HO8A 3IECA 5CANA 4Y73A 2OXXA 3QZHA 4KRCA 4R5SA 3NDMA 3PXYA 4D4SA 5LJJA 4C4IA 3THBA 3SGCA 1H1WA 3ZRLA 3C4CA 4JBVA 3R1NA 3LJ1A 4M13A 2B0QA 4NZWB 5GZ9A 5CAPA 4TYJA 2ITNA 3OTUA 4BDCA 2ZV8A 4GT4A 4PTGA 3VQHA 3FE3A 3KXZA 3HECA 2R3JA 4D58A 4W8DA 5AR8A 2UZTA 4GIIA 4EBWA 4G3FA 2JAVA 3UGCA 4QPAA 5JFSA 3QCYA 4S34A 2I40A 2OK1A 4F9BA 5AP7A 2Y7JA 4RPVA 2GSFA 2IVTA 5ANEA 4DLJA 4OTFA 4YTIA 3O51A 1FVRA 2XIYA 4OLIA 3VS1A 3KXGA 4ZTHA 4A9UA 4BL1A 2I0YA 2R7IA 4FTKA 4LFIA 3ORNA 3DV3A 5AR7A 4CFFA 5HHWA 3FMJA 2DQ7X 5CEQA 5IU2A 3C13A 4H39A 1QPEA 4BCIA 3EN4A 1BYGA 2ERZE 4V0GA 5I9XA 4BCNA 4L8MA 4L3PA 5CF5A 3DKFA 3UNKA 4EQMA 3CIKA 3NLBA 5I5ZA 4FNYA 3W2RA 2C3KA 4EH8A 2OBJA 3MH1A 2FSTX 2PUPA 2C3JA 1UVRA 3SOCA 2XNGA 3QA0A 1NVQA 4MQ2A 4X3FC 4J7BA 3CJGA 3RMFA 4LOOA 3DXQA 3M1SA 1Y57A 3NUNA 1OMWA 3SAYA 4FV3A 4LQMA 3M42A 2OZOA 2YAKA 2JKQA 3C4FA 5HLNA 5M07A 4BICA 5A46A 4LMNA 5EM7A 2GNJA 4EHEA 4O6LA 3KRXA 1PXOA 5TO8A 2R3FA 5EOBA 3ORLA 5DR6A 2R3LA 5K0KA 4QMLA 3U51A 4JDJA 2W1CA 3BWJA 3KFAA 4MHAA 2UVYA 3FL4A 2CMWA 4ENXA 2QURA 4FZDB 2BRHA 2QOFA 5GIPE 4A9SA 4PV0A 5AJQA 3PE1A 3T8OA 5IDPA 2CLQA 2FA2A 3SX9A 4V01A 2Z8CA 3GU6A 4KKHA 1VJYA 4GIHA 2J7TA 4IAIA 3HNGA 2UV2A 4FV4A 3IS5A 4L7FA 3V51A 4C3FA 3ORXA 4IHPA 4XRLA 4RIWB 4RSSA 3W8QA 4DFUA 3OG7A 5ACKA 4TYEA 4FTRA 5E1EA 3EFKA 2HCKA 5HE0A 1XH5A 3F5GA 3R30A 4AG8A 1PXLA 4J52A 4I94A 4UMTA 4ALWA 5JZJA 4GW8A 2WO6A 2FB8A 4FKRA 1R0PA 1WBSA 3UOJA 5CSPA 2UZOA 4I24A 5M56A 2JIUA 2RFEA 3AD6A 3LM0A 4F08A 4O1PA 3FMKA 5KMOA 4D0WA 3MY0A 2FUMA 2QOOA 3CQEA 3PVGA 3TTJA 3LCTA 2BZHB 2GS7A 4GSBA 4RWIA 4Y8DA 3TZ9A 5K0XA 4EC9A 5IA2A 4BCJA 3E62A 2RF9A 5E8WA 4WG3A 4I0TA 1PXJA 1YHWA 2ZMCA 4KSQA 3VUHA 4ZLOA 3OT3A 4C33A 3HYHA 4F9AA 4CEGA 4ZS4A 2R0UA 3I6WA 1M2QA 5GHVA 2LAVA 1AD5A 4YZDA 2ZDTA 3C1XA 4HCTA 3RHXA 4RFZA 5DGZA 3ODYX 1YXVA 4N6YA 5HIBA 2CGVA 4Y5HA 4U43A 1WMKA 2ITQA 1P5EA 1UA2A 4ID7A 5JT2A 3U55A 5IKWA 3POOA 3VRYA 5HQ0A 4IWPA 4EOPA 2VO6A 3D9VA 4KWPA 5FP5A 4ANQA 4YLJA 4E93A 4FSRA 1LUFA 2WZJA 3O8UA 4MCVA 3KRRA 2HENA 4U44A 1FINA 3NYVA 4U40A 4FV0A 4TYHA 3VUTA 1H4LA 1OBGA 2F7XE 3WI6A 3ZFXA 1NW1A 4FNWA 3V8SA 4ZTRA 4DBXA 4UXQA 3DY7A 2HOGA 2F2CB 3EL7A 3KN6A 4UEUA 1T46A 4YP8A 4A4LA 4YUQA 1RW8A 3R2YA 3LLAA 5M06A 5DVRA 2W9FB 1PMUA 3I60A 1VZOA 4U3YA 5HNBA 5JMSA 4BRXA 2R3OA 4RX7A 1XH8A 1R1WA 2WD1A 3AT2A 1WBWA 3H10A 4MXAA 5KMJA 3G90X 1WCCA 3KULA 3PXQA 2UW7A 3NS9A 5CSWA 5EI2A 4NW6A 4PX6A 3O7LB 4FSTA 3ALOA 2C6DA 2VAGA 3DU8A 3GCPA 2H96A 3PA4A 2C68A 3O17A 3PRFA 3LZBA 3NYOA 3OCSA 3WOWA 2AYPA 3QTUA 4UYAA 3OOMA 1ZY5A 1GZ8A 4DEHA 3LIJA 2GTMA 2PY3A 4O7LA 3QQFA 3VS3A 3PSBA 2VWIA 5FGKA 5AUYA 4FUXA 4FYNA 4X3FB 2C1BA 4AT5A 4E4MA 3FHRA 4IBMA 4NEUA 4ERWA 2OXYA 2PL0A 2UW4A 2W1FA 2P2HA 2ZV7A 4YSJA 5E8XA 3LPBA 2BZKB 2J9MA 5L2QA 3RAIA 3HRBA 2J4ZA 3EYGA 5LXMA 4O0WA 1GAGA 2QVSE 3KMMA 2OWBA 4IX3A 1TQMA 1ZLTA 3GXLA 5C03A 1V0OA 5CF6A 2WNTA 3BU6A 3Q04A 4IADA 4M12A 2DYLA 2XIKA 3L1SA 5FWKK 3ZEWA 3P23A 3W32A 3DFCB 4R5YA 3WF5A 1M17A 3BELA 4YPDA 3FSFA 4S32A 4DFXE 3C5IA 2UW9A 3DOGA 5AP5A 1Q4LA 3CQWA 1OI9A 5FQDC 3MGYA 1XJDA 4TXCA 3UOLA 3KREA 4GG5A 4GKHA 5IQDA 4RG0A 2OJGA 3A8XA 4HYSA 2VTOA 4F6UA 2CKQA 4FV8A 4U5JA 5DOSA 4Z3VA 3MJ2A 5F95A 4RVLA 2P33A 5AV2A 2WTJA 3QXOA 3OCGA 3BBWA 2BIYA 3GC0A 4ASZA 3KQ7A 4BDGA 2BMCA 2VX0A 2ZYBA 4IZ5A 4NWMA 1ND4A 5L2SA 4OBQA 4WUAA 3WYYA 2VTIA 3ALNA 3OWPA 3NEWA 4PMTA 3PXFA 4YJUA 2XA4A 3QUPA 1I09A 1OUYA 3DK3A 4QP9A 3SD0A 3VS5A 1OITA 2WMXA 4FT5A 3V5QA 2QQ7A 3NIZA 1U54B 1AGWA 4ITIA 4FODA 2XZSA 4QMPA 4EHGA 3VC4A 3KU2A 2GS2A 3AD4A 3POZA 4YSMA 4FTCA 3UIUA 4E5AX 5AA8A 1GIIA 3Q4CA 3FWQA 4FIHA 3E3BX 4RVMA 5E8VA 3UZTA 3RVGA 1QPCA 3Q9XA 2C6LA 3KL8A 3MY5A 2GS6A 2QNJA 2WKMA 3PSCA 5E8SA 3COIA 3VAPA 3ZUTA 2BAJA 2EXCX 3TV7A 1YW2A 3PJCA 2G01A 4EONA 1Q5KA 1OKWA 3FY0A 3K54A 4P4CA 4TYGA 5DMZA 4OTWA 4I20A 5FEQA 3G9NA 2J6MA 3ORIA 4QYYA 5L6PA 2PZYA 3MS9A 3NNXA 4RJ4A 3W2OA 4DFYA 2GQSA 2QO7A 2BRGA 3GCSA 2OH4A 4Y83A 3IK3A 5L8KA 1OIYA 1WFCA 2OF4A 5CI7A 2XK8A 3OW3A 3ELJA 2WTKC 3DXNA 2JD5A 4U42A 5IA0A 3UZPA 1KE8A 3MB6A 5T6KA 2W9ZB 2O65A 2OJJA 2VTSA 3LW0A 4IJ9A 3RWPA 4Z7GA 5CVHA 1Q8ZA 3UO5A 3WBLA 2C5OA 1JBPE 3RJCA 4I6BA 4BTKA 4DEDA 4BWKA 2WTWA 4DFNA 1U4DA 5IQFA 4FV5A 3ZOSA 4D28A 3U6JA 3SG9A 4FV1A 4FC0A 4AGWA 3VBXA 4LOPA 4XH6A 2QC6A 2O8YA 3LXNA 3BYVA 5LQFA 5GZAA 3O8PA 4MXZA 3RPOA 4WKQA 2VU3A 4BTJA 3Q96A 4EOKA 3PFQA 4B0GA 4DTBA 2JDRA 4QMXA 4QMZA 2GMXA 4XG9A 4QTEA 3HAVA 1XH9A 2VO7A 3HKOA 3TWJA 1WVWA 4G3EA 4C58A 1JKSA 2XF0A 3SHEA 2XP2A 2OZAB 1UU3A 1KE9A 2GNFA 4HOKA 4Y85A 4CZYB 4RMZA 5JKGA 1SVGA 3QQUA 2CLXA 4YJSA 2EUFB 2G15A 4IACA 3ZBFA 3Q9YA 3JVSA 3VVHA 4DITA 5H8GA 3N4VA 2X7OA 2Q0NA 2AUHA 4ACDA 2JC6A 4KBAA 1XH7A 3GC8A 3PVBA 3V5TA 1UV5A 3RNIA 5CSHA 4MTAA 2YM7A 1M14A 3G33A 4DG2E 1P2AA 2RFSA 1H1SA 3HRFA 5CX9A 1MQ4A 3IOPA 2PE2A 2C0OA 4IZAA 4TN6A 1XH6A 4D2RA 4NM3A 4EHZA 5DG5A 3W33A 4CV9A 4QYGA 4I1ZA 3DLZA 4QP4A 3TZMA 4ASDA 2B9FA 5CVGA 5IA1A 4BCFA 4FX3A 2R3MA 4IX4A 3PPJA 4APCA 4YC3A 2QKRA 2WQBA 1H08A 3QFVA 5BQ0A 4IB1A 1UWJA 4EJNA 2CGXA 3QC9A 4JDIA 3RALA 5HLPA 4RIXB 5HESA 2ZV9A 2NPQA 4C35A 3Q53A 4UX9A 3FUPA 3E93A 3FLQA 2W1ZA 3GCQA 4NK9A 4BCOA 4CSVA 2IW9A 1Y8GA 5KNJA 1PMVA 4J8MA 1UWHA 1PMEA 4YZ9A 5FM2A 5IQHA 3A4OX 2V7OA 2FSOX 5C9CA 2X9EA 1NA7A 3AMAA 4ZOGA 2AC5A 4JR3A 3WARA 4FT3A 3TKHA 2CHLA 2H34A 4BGQA 2YA9A 3OXIA 3PVWA 3QD0A 4ACMA 3LFCA 3RPVA 2V5QA 4X7QA 4O83A 4FEQA 3U4WA 5AAGA 3FMLA 3TI1A 2V55A 5A54A 3UP7A 3UPZA 4BCQA 3LJ0A 2X1NA 4O0RA 3WF8A 2ZMDA 3PJ1A 5EW9A 5CU0A 3MFUA 1R39A 2EXMA 3QTRA 3QX4A 1GOLA 4D1XA 3BX5A 4IM0A 4KSPA 1YI6A 3CD8A 4JRNA 4ZY6A 3E8NA 1Q8WA 1YHVA 2X39A 3FLWA 4FKSA 5AV1A 1KWPA 3IG7A 2XK6A 3I5NA 3ZDIA 3LMHA 5CU2A 4FKPA 2R0IA 1RE8A 2HZ0A 5JH6A 2UW0A 1J7IA 3QD4A 3AC4A 3BU5A 4C62A 1U54A 3F6XA 4DT9A 4BCPA 4YGAA 2VTHA 4L01A 5J87A 1H8FA 2RFDA 3FXZA 2G2HA 3DS6A 4C34A 2XRWA 1O9UA 1IASA 1JKTA 3MIAA 3UOHA 2XRUA 3CPBA 4C4JA 5KZIA 3TL8A 2GNLA 1ZMUA 4QMOA 4DFZE 5IG1A 3SKCA 5FEDA 4JQ8A 4AP7A 5HNIX 5E1SA 2WTKB 5HE3A 3ORKA 4FVPA 4F7NA 4LRJA 2I7QA 3JY9A 3PY1A 5M08A 4GH2A 3RINA 4GVAA 4YTHA 3RI1A 5E92A 5A9UA 4QO9A 4IVBA 3D7ZA 2Y9QA 2YCSA 2QHMA 5TOZA 2IW8A 4DBNA 1LP4A 2J0LA 2C6EA 5AP1A 3ENMA 3QTWA 4FF8A 4DG3E 4KRDA 2BRMA 2V0DA 2X6EA 4CMUA 2GHLA 3DA6A 4C2WA 5IA5A 4PP7A 2XIXA 3Q32A 5DNRA 4YO4A 3O7LD 1TQPA 4O7VA 2PVYA 2O0UA 3KMWA 4DLIA 4IX5A 3TUDA 1XWSA 3PZHA 1T45A 1NXKA 3BWFA 5J9LA 2X7GA 4FKOA 4YR8A 5HX6A 2OIBA 5IH6A 4FSMA 1GIHA 4FIJA 3TNWA 2YABA 3VS7A 4KD1A 4XLVA 2XJ1A 2ZVAA 2Y6MA 4RWKA 4QMUA 1XH4A 4XS2A 3UDBA 4ACHA 2OW3A 2C1AA 1HCKA 3MFTA 3Q9WA 1B39A 2WQOA 2H8HA 4M66A 4O6EA 2WFYA 2YM4A 4RGJA 5DWRA 3OWKA 3QZFA 5A4EA 4D2VA 5D12A 4CRLA 4W4WA 2OF2A 3REPA 3GU5A 4EWHA 4FOBA 3RPYA 3EN7A 3JPVA 1YDTE 3HMPA 4M84A 3DQXA 4XHKB 2RG5A 4WT6A 3C9WA 2F9GA 2OKRA 1L3RE 4QYHA 3CGFA 2ETRA 5EH0A 3SVVA 3FLYA 3MTFA 2WEVA 4MEDA 4EI4A 3NPCA 3I5ZA 1NVSA 3UC4A 2ETMA 4FR4A 5B2MA 5A6OA 4JG7A 4EK4A 3MH3A 2OZAA 5H8BA 4I41A 1DM2A 5EHYA 4V0GB 2G1TA 3R1YA 5AIRA 5A4LA 1MRYA 3D2KA 3LKMA 4RBLA 5JGDA 5IEYA 1EH4A 4LV5A 3FJQE 4GFGA 2BDWA 2LGCA 5C8KA 5K5NA 2O63A 3RZBA 1J7UA 1ZRZA 3VBTA 5CAVA 4DT8A 3Q5ZA 4KKEA 4YJQA 1Z9XA 3WIKA 4YURA 2PVKA 5JFXA 2XIRA 3AGMA 1BI8A 1G8AA 4M68A 5E8UA 1YI3A 2VD5A 2C6TA 5C8NA 3R28A 1GZNA 4CMTA 4A4OA 4P7EA 4RFYA 5LCKA 1Y91A 5C26A 3AT3A 4OTPA 3UODA 1WBOA 2NRYA 5JK3A 4FSQA 3FEGA 4XG7A 2CN8A 5T3QA 5JFVA 4N6ZA 2JFMA 4O0YA 1YWRA 3NGAA 4FSZA 3QHRA 3PRIA 3TZ7A 4C3RA 2WB8A 2P55A 4JQEA 5T68A 2QLUA 2E9VA 4QP1A 5DEYA 2QOIA 3U4UA 5DR9A 3D83A 4DINA 2UVXA 2VTRA 3UJGA 1YXUA 3GI3A 4R77A 5CXZA 2X9FA 4P5QA 5B7VA 3BEAA 2JDSA 4E6CA 4BR3A 2PVMA 4NM7A 4BY9E 3TIZA 4L42A 2E2BA 3KXHA 4OW8A 2PUUA 4OGRA 5C27A 2VWWA 1VEBA 3QRTA 3CEKA 3MN3A 2UZWE 3QWKA 2WTCA 4RJ7A 2PVJA 2C69A 3UMWA 1REKA 5CZHA 2QOKA 3G6GA 1PXKA 4BWXA 2GNGA 2JKOA 3BYUA 4QQ5A 2E9UA 4PQNA 1GZKA 4X6RA 1FVTA 1ZZLA 3FZSA 1SMHA 2YM3A 4OTGA 4RJ3A 4S30A 3W16A 2J0IA 4RZWA 2F57A 5TT7A 4F1TA 5IZFA 4O38A 4I21A 2YLEA 4GJ3A 4XV9A 4Y5QA 3WE8A 5AA9A 3IW4A 5IEVA 2YCFA 4HNFA 3R8ZA 3RM7A 5KBRA 4J99A 4DCEA 4O84A 1H01A 4IANA 2AC3A 4WNMA 3T3UA 2PULA 4OR5A 1JVPP 4EH3A 1MQBA 4D2PA 2NO3A 1K2PA 4WOVA 3PJ8A 4LGHA 1XR1A 4EZ3A 3V8TA 3AT4A 4QP8A 5HBHA 2R2PA 4KIOA 4R8QA 4EOJA 4YC8A 3P1AA 2QONA 2B1PA 3OXTA 5H8EA 3PVUA 4XRJA 3ZO3A 5I9VA 4ANNA 3IQ7A 2B55A 3KRJA 4KIQA 4FKLA 4YJRA 4YMJA 4FUYA 4ITJA 4DN5A 4ZZNA 3R8UA 3MV5A 3CBLA 3EQPA 3F3WA 1VR2A 3BBTB 2ITZA 2XK4A 3EL8A 1SVEA 3R21A 4MF0A 2PSQA 5D9HA 3RK7A 4UN0C 4TYHB 2WMWA 2HK5A 5CY3A 4YHFA 4E6DA 2CNVA 3B8RA 4ZY4A 5IQAA 4DTAA 4DGLC 4AZFA 4AZTA 4JQ7A 3W18A 5KMNA 2OJIA 5I9WA 5ETAA 3QD2B 3OCBA 4LGDA 5FTGA 2XJ0A 4DF3A 5EHLA 4NFMA 4N0SA 1LEZA 5FP6A 3DXPA 3PUPA 2HZ4A 3ZLXA 2PHKA 3L8SA 4RIYA 4EEVA 2OGVA 2PZIA 1IG1A 2CJMA 2YACA 3EKKA 3KVWA 4GFMA 4JDKA 4BIBA 2IZUA 2X4FA 1MRUA 4O0SA 1JKKA 3COHA 4AZEA 3FI8A 4I4EA 3ZFMA 4EK8A 4AW0A 3EQHA 3BIZA 2BHHA 3KULB 4U8ZA 4AZWA 4CNHA 3HV3A 1Q24A 5IH5A 5FLFA 4O7WA 2VWXA 4ZEGA 3SQQA 5E91A 4DYMA 2C0IA 4AAAA 4HVIA 2UZEA 1PMNA 4K77A 3WIGA 4KIKA 2EVAA 3OROA 2OIDA 4ZMFA 4H3QA 4H3PA 5DA3A 5HG5A 5CTPA 3ZC6A 3RK5A 2W5AA 4KINA 4ZIMA 2EB3A 4G6NA 2WIHA 3KXXA 3SDJA 4MH7A 2FO0A 4O1OA 3MPAA 4FTJA 1DS5A 1FQ1B 4XOZA 3V5PA 1W82A 1ZWSA 1YRPA 3GVUA 4ACGA 4J97A 3LCOA 4PF4A 4AU8A 2GNHA 3B8QA 3PPKA 4F1MA 1KUTA 2X81A 1ERKA 2J0KA 4U3ZA 3VUIA 1KE7A 5LVPA 4UWBA 2HXLA 3H9OA 4EK6A 4CKIA 4ASEA 1XQZA 4BDEA 4G9CA 5CSXA 5K4IA 3FI2A 3NAYA 3GB2A 3CPCA 4XYFA 4N57A 1OPJA 4PDPA 1IA9A 4W4VA 4XP2A 3KRLA 4R6VA 5J5TA 3RAWA 5EDPA 3R8MA 1H1QA 4U7ZA 4CTBA 3MVHA 4HVHA 4QMSA 4ZTQA 4O82A 5M55A 3FLSA 4XJ0A 4EZ7A 3IW5A 4PMSA 5EM8A 3VJNA 3PY3A 5IEXA 5IH4A 2HY0A 5E8ZA 3H9FA 4O2PA 2PZPA 2VTAA 5DFPA 3PG3A 4PMPA 3QLGA 3OY1A 4UMQA 4WG5A 4BI0A 4LUDA 2Z7SA 5DLSA 4E6AA 3MFRA 3ETAA 2BTSA 3R73A 2CNQA 4P5ZA 3LLTA 2BZIB 3HAMA 4H36A 5CZIA 3KMUA 4EOOA 5M4UA 4BZNA 2QODA 4BHNA 4LMUA 3R01A 5HCYA 2XCKA 5HBEA 1ZZ2A 2X8IA 5C4LA 2QKWB 1WBTA 2ONLA 5HE2A 4FG8A 4B99A 4QMMA 4H1MA 5BMMA 1UU7A 4OTHA 3QTSA 4BTFA 2QG5A 3JS2A 1E1VA 2QOLA 1F0QA 1PW2A 4OBPA 1SM2A 3GOPA 1ZAOA 4QP2A 4JXFA 4UB7A 4F0FA 4ZZMA 4OAUC 1Y6BA 4C37A 4AW2A 1J7LA 5AWMA 3KF4A 2Z2WA 3VJOA 1WBPA 4IAAA 2BUJA 4RWLA 4PDYA 3JR1A 1MUOA 1VYZA 2YIRA 3A7IA 1V0PA 4YPSA 4MBJA 4TPTA 3EQIA 3BCEA 3TXOA 1OL1A 3F7WA 4NFNA 1OL7A 3MW1A 1PKGA 1R78A 3NIEA 3SV0A 5CEIA 4O0UA 4FV7A 1GIJA 2X7FA 5KE0A 5KHWA 3R7GA 4R1VA 4BKZA 3NMUF 2CGWA 5CLPA 3ORTA 4NM0A 3W1FA 2VO0A 2OJFE 4E3CA 3IDCA 3IGOA 2VTQA 1G3NA 1X8BA 4YU2A 4LL0A 3MVMA 2ITYA 4AACA 3ACKA 3O50A 4I4FA 1YQJA 1Q97A 2FSLX 3VO3A 4AN2A 2VGPA 4ZLZA 5AEPA 4CFUA 5I3RA 1OIQA 3VHKA 3COKA 5EW8A 5J9YA 4NUSA 2EWAA 3BV3A 4FICA 2A4LA 4AF3A 2HYYA 1Z5MA 3H0ZA 5K4JA 4GT3A 1E1XA 1Q8YA 3FQSA 2YDIA 2VWZA 4C59A 3GC9A 3OT8A 4II5A 4CYIA 3UG1A 3TKUA 4AWIA 1Y8YA 5AIKA 4E5BA 3OFMA 3S1HA 1QL6A 5CNOA 1JNKA 3ZBXA 3WYXA 2QD9A 3CP9A 1W8CA 3COMA 3IGGA 2PTKA 3DBEA 3ZEPA 2YM8A 3DAEA 4XP3A 3OW4A 4QQJA 4ZMEA 4WA9A 4ZJIA 3ZONA 3FXXA 2YZLA 4ALVA 2G9XA 3LFSA 4DCAA 4XV1A 5BVKA 4D9TA 4BC6A 3WZKA 4X2NA 1OM1A 1J1CA 3F5PA 4Z16A 4YNEA 5ITAA 2XKEA 3DZOA 3CE3A 3S0OA 2ITWA 3DAKA 3CR0A 3IONA 5ACBC 5CS6A 3EQBA 4JS8A 4AQCA 1CMKE 3R71A 4BDBA 4D2WA 2J5EA 4PPAA 1ZYLA 4QRCA 5KMIA 4NL0A 3R83A 3V5WA 4R78A 2A0CX 4KNBA 4O2ZA 3PSDA 2XIZA 3HV6A 2DUVA 1PF8A 4W4XA 2UW5A 2CDZA 3FY2A 4LI5A 3NW6A 2UW3A 1BI7A 4PNKA 3UG2A 4RA4A 4CFVA 2PWLA 4HJOA 4AGUA 1SYKA 4K18A 4GYIA 3O96A 3RHKA 4E5WA 3C5UA 3MESA 1OKZA 1H24A 5FM3A 4LG4A 3H4JA 4FL3A 4AT3A 4FNZA 1ZYCA 4FIIA 5F20A 3UQGA 1ZXEA 2XNEA 4G6OA 5DR2A 3TUCA 3E8DA 3OC1A 4J8NA 4HYHA 4RC3A 5FRIA 5BUJA 4TNDA 5EYMA 5L3AA 1P4FA 2IZSA 2O64A 3CGOA 3MVLA 3ODZX 3OEZA 4GK4A 3CQUA 3ROCA 1PY5A 4H05A 3HP2A 3G9LX 5DHJA 2CSNA 3U9NA 4TKSA 3PXRA 3FPQA 5AV4A 4XG6A 3UVQA 3B2TA 4OUCA 3Q6UA 4GV1A 2R4BA 1JWHA 3ACJA 2YJRA 3P79A 3Q52A 4IM3A 4U79A 5GJGA 2DS1A 3QA8A 4IDTA 4EKLA 5IF1A 2C5NA 2GTNA 2W1GA 3MPMA 5EFQA 4O86A 4LV8A 4FTOA 1Q3DA 4XLIA 5E4HA 3L9LA 1Q62A 4I6FA 3TJDA 4EK3A 3ZZWA 3E92A 4E4NA 3TNIA 2BRBA 4JL9A 3V3VA 2CKOA 4IFCA 3QQLA 5CF4A 3OF0A 4JOAA 3ZTXA 3RCJA 4BDAA 2XMYA 4DEGA 4IC7A 3UQCA 5E8TA 3IOKA 3KRWA 4PL4A 3FKOA 5FEEA 1KOAA 5KKRC 4WNOA 3UOKA 4QP3A 3ET7A 1L8TA 3MJ1A 3NWWA 3GCVA 4L53A 3SW7A 4BHZA 2VNYA 3I7CA 1PXMA 4FV6A 4IAFA 2RFNA 4P90A 4OTRA 4K2RA 1JLUE 2BHEA 4XUFA 5EQYA 4IWDA 2XCHA 1U59A 4L67A 4C61A 4F64A 5JGAA 2W17A 3EZRA 1XHAA 3GU8A 4M15A 3TUBA 2I0VA 3ORZA 4NYEA 5JRSA 4C0TA 2WOUA 5JFWA 4H1JA 4RLLA 3RZFA 1OIRA 4RX9A 5DPVA 4GRBA 4PMMA 1PYXA 1OUKA 4FTIA 4YO6A 4N70A 5HOAA 4YC6A 4PNIA 2XNBA 3V5LA 4LOQA 4YTCA 5DIAA 4NKAA 5M4IA 2W1EA 4M67A 2PUIA 5CEKA 5E9EA 4TY1A 2R64A 4ZAUA 4E4LA 4O7RA 4I92A 3BLRA 3L8VA 4FIFA 5AR5A 1NT2A 5CT0A 4R1YA 3MY1A 2UW6A 4X2GA 4MNEA 1JSTA 2BCJA 5BVFA 3NVKI 4FTUA 2UZBA 1Q8TA 5LVMA 5DT3A 5CF8A 4IAYA 4F6SA 4HCUA 3G6HA 4RZVA 4PPBA 4CT2A 4MAOA 5LOHA 4D1ZA 1XO2B 3HEGA 5EDRA 2R3QA 5KMLA 1WZYA 4UXLA 4ZSGA 5ANKA 2BRNA 3PZEA 4OTDA 4ZTSA 5CALA 3MSSA 4OTQA 2PVLA 3A7GA 3TDVA 1U5RA 2WU6A 1Z57A 4JAIA 4PTEA 3W10A 1KE6A 3MIYA 3VW8A 3WF9A 1QCFA 5IMEA 2J50A 3PXKA 2XK7A 4FEWA 4D9UA 4CG8A 3GQIA 1XBCA 2R3RA 3DFAA 3A4PA 2WXVA 4BDKA 2W96B 4YJPA 1CSNA 4JX3A 2PMOX 3V6RA 3DAJA 2FSMX 4CFXA 4YHJA 5L2TA 4C4GA 3MH0A 3IW8A 3R1SA 3LVPA 3A62A 3CTQA 3RPRA 3EQCA 5L4QA 4FZ7A 3VUGA 3Q60A 3ORPA 1REJA 2PVNA 4CZTA 1KSWA 2ZDUA 4QPMA 4BVUA 3UIMA 3LFFA 3OD6X 2W5HA 5HVJA 3WILA 3HDMA 3VS6A 2BVAA 2XKFA 3OWLA 4B9DA 3RNYA 1XBBA 3GT8A 3RM6A 2VTPA 1YI4A 1BLXA 4W9XA 2CPKE 3MVJA 4M7IA 3W2SA 3L8XA 3Q2MA 4KB8A 4DGNA 3A7JA 4EUUA 4Z7HA 2WQEA 2JIVA 4I3ZA 4ZS0A 3W55A 5HZNA 1M52A 3A60A 2X0GA 3AGLA 3FMNA 4ONAA 2GU8A 3EWHA 3FQEA 4Z9LA 4PY1A 2I0EA 4FTTA 4KS7A 4S33A 5HG8A 3FC1X 2ZB0A 3CC6A 4IC8A 3VIDA 3KVXA 4WSYA 5AR4A 2WIPA 3S2PA 4PDSA 4AGCA 4BCKA 4ZSEA 4UYNA 2B9IA 4K11A 4OT5A 4EOLA 2F2UA 3N4UA 4QTDA 2HIWA 4TW9A 3NNVA 4UMPA 5JRQA 3U6IA 4MQ1A 5BVDA 1BMKA 1FMKA 3E63A 4AXAA 1IEPA 4WSQA 1H28A 5BX0A 1CKIA 4BDHA 3R00A 3ZYAA 5C1QB 1FPUA 4FEUA 4L52A 4FEVA 5B0XA 4B8LA 1U5QA 2C6OA 1GNGA 3GU7A 2O2UA 4AFEA 3ZRMA 3EFLA 4ANBA 2OICA 2WGJA 3E3PA 3NUSA 3R63A 4FT0A 3QBNA 3CS9A 3FMHA 4DH5A 2XNNA 4S31A 3ZO4A 4EBVA 5CEMA 3FZRA 4BDJA 4X0MA 4IAZA 1ZMVA 2B9HA 1NY3A 3JVRA 3L9PA 3QKKA 4ZTLA 3ZLWA 4USEA 2Y4IC 5KKRB 2WPAA 1ZYJA 2VUWA 4L45A 4ANMA 2XK9A 4IB3A 3HMNA 3SXFA 2XBJA 3DZQA 2P3GX 3E87A 4K33A 3Q5IA 2HW7A 2VWUA 4TYIA 3W2CA 4TL0A 2WTIA 5M53A 2C5XA 3PJ2A 2W06A 4JBPA 1PYEA 1W98A 3C50A 4DH7A 2VTLA 2CKEA 2FH9A 3LFDA 4LRMA 4GL9A 5HX8A 1YXSA 3QALE 4BKYA 5IUGA 4O7ZA 4CV8A 4HCVA 4IEBA 4MD7E 3QQJA 2BALA 2A27A 1RJBA 2E9PA 3I6UA 4RLKA 3JXWA 3A7FA 3C7QA 3KXNA 2ONLC 3FMMA 4AW1A 5HD4A 2IWIA 2X8DA 1CKJA 5DRBA 4Q5EA 2RG6A 3DTCA 3K2LA 3V04A 2EB2A 1ZARA 2B52A 3U8WA 3FHIA 4WRSA 3S95A 2Q83A 3E8CA 5DT4A 3ORMA 3CLYA 3PG1A 4EH7A 1H00A 2KULA 5AP3A 4U97A 1TVOA 5HNGA 1CM8A 4R3CA 1KE5A 4AW5A 5IUIA 1ZOEA 3SRVA 4R7BA 1TQIA 4ZSAA 4QMYA 3BHVA 3NW5A 3T9IA 4EHVA 5CAOA 3EH9A 3CKXA 4XV3A 5M57A 3C0IA 3KEXA 3WZUA 4EH4A 1V0BA 3BLHA 3DT1A 3R02A 3OXZA 4YJNA 4D2SA 1DI8A 3CTJA 2UVZA 4FV2A 4M14A 2ERKA 3ZUUA 3OTVA 4MBLA 4M69B 5HCXA 3GP0A 5HI2A 4AGDA 5JZNA 2BIKB 2WQNA 2ZB1A 4CT1A 5BUEA 1JSVA 2XNPA 3BLQA 2QU5A 5AP2A 2PE1A 4DFLA 3F3ZA 4L00A 3VUKA 2OIQA 3ZH8A 1H1RA 3R9RA 2C6IA 4RIYB 3E7VA 5AX9A 1V1KA 4QPSA 3AD5A 4QP6A 3F5UA 4E73A 4BN1A 4O7NA 3KF7A 4HGSA 3A8WA 4FYOA 4EOMA 3I79A 3R6XA 5IQEA 2YITA 3FL5A 4BZDA 1XBAA 4EH2A 4CKRA 5BNJA 4ZJJA 3EMGA 5BUIA 4GCJA 3NZ0A 3NCGA 4JBQA 3OVVA 3QRIA 4CQEA 3UNJA 3DNDA 4C38A 4IW0A 1KV1A 1JQHA 1O6LA 3EKNA 1IR3A 2I1MA 5AUZA 4KIKB 3DKOA 4D5KA 4DH3A 4ANLA 4HVGA 1YVJA 4BF2A 3HUCA 4I5PA 4RJ6A 2JITA 4D4VA 3W2PA 4R3PA 3UP2A 3NCZA 5DYJA 3HMMA 4JLCA 4GFOA 2IZRA 4RJ5A 4RQKA 2YIQA 4JG6A 3R8VA 4KKGA 3FZPA 5AUUA 4ZZOA 2W1DA 4FTLA 4HVDA 4TT7A 3PDTA 4O0TA 4FZ6A 4A9RA 1OKVA 2WMTA 1P14A 3QYZA 2ITPA 4KAOA 4W8EA 2BFYA 3F2AA 4S2ZA 4L68A 4O21A 5GINE 1JSUA 3PA5A 3OEFX 3QUEA 4JBOA 5ANGA 3BYSA 2OFVA 2W99B 2QO2A 2YISA 2JDVA 5EYDA 1BL7A 3W2QA 2X2KA 3QU0A 4XMOA 5EQPA 5I9YA 4D2TA 4L46A 4GYGA 4IIRA 3JY0A 3ZO2A 4XG2A 4NW5A 2FGIA 3BGZA 3NUXA 5DN3A 3N4TA 1B6CB 3FV8A 3HA6A 4G3CA 2Y4IB 4QTAA 3DBDA 3Q4TA 4QMTA 1LEWA 5ANDA 3ZHPC 3LAUA 3QC4A 3E8EA 4JIAA 4MWIA 5F4NA 5L6WL 1PXIA 4EKKA 3UPXA 5DI1A 1ZMWA 1OGUA 4ZTNA 5HE1A 4F9YA 4XBUA 5FDPA 2WMAA 4NCTA 4FSWA 1JAMA 1UNLA 4EK5A 4YLKA 5FG8A 5EKOA 5D41A 4BDDA 3BQRA 3FI3A 4BGGA 5HO7A 3S3IA 2E9NA 2X2LA 3AC3A 5HIDA 4ITHA 4BBEA 3U87A 3UIXA 1Q8UA 4ZLYA 5GIOE 3R0TA 2VWBA 3OP5A 3ZC5A 3AMYA 4F7JA 3BI6A 3DBFA 3DB6A 3LCKA 4AN3A 4DEAA 3L9NA 2X6DA 4EC8A 4AA0A 2J5FA 2QCSA 2WOTA 4ENYA 5HORA 5LMBA 3FKNA 5IPJA 3VS4A 2BZJA 1OB3A 5EI6A 5BYZA 3LFNA 3D5WA 4IZ7A 3MH2A 4R7HA 4XEYA 3V5JA 1YHSA 4CTCA 4EUTA 5GJDA 4DA5A 4FZFB 5A4CA 1JKLA 2QOBA 5L8LA 2WMUA 3QWJA 4GG7A 3P08A 2Y8OA 2HWPA 4Q5HA 4IWQA 3PIXA 2IG7A 3F3VA 2ITOA 4UBAA 5E90A 2EXEA 4D4YA 1OL2A 1YWNA 2YCQA 4G9RA 3G0FA 5BVOA 1BUHA 2R3KA 3UVRA 5HU3A 3LMGA 1OZ1A 2H6DA 4FE2A 5A6NA 5HICA 4Y46A 4NIFA 3A61A 3EN9A 4DH8A 3HV7A 4RC2A 1IA8A 4Z55A 4F63A 5J7HA 4L43A 5AR2A 2VRXA 4G2FA 5E8YA 2G2FA 2R3NA 2G2IA 2QOCA 3CY2A 5DRDA 5HO6A 4BZOA 3LFAA 3NVMB 5M4CA 5AP4A 4AOIA 4FGRA 3HZTA 3ZSGA 3QLFA 1B38A 4TWPA 3D0EA 2Z7RA 2YHVA 3W8LA 2OO8X 4OAVB 2QU6A 3NUYA 4D55A 5E7RA 5LMKA 2JBOA 4WHZA 1M7NA 3EYHA 3D94A 3O2MA 1J91A 4ZK5A 2JFLA 3BEGA 2JLDA 3V01A 4HW7A 4AOTA 3O0GA 3QF9A 4J96A 4CFMA 3BHUA 1TKIA 1W7HA 4ZJVA 5EI8A 3TTIA 3S00A 4M69A 4JNWA 5CWZA 2WELA 4L7SA 2PK9A 5JQ5A 4GVJA 3LXKA 3QTXA 4U45A 2XYNA 3BV2A 4F6WA 1PHKA 2CCIA 2GHGA 3K3IA 4I5HA 2RL5A 3E7OA 2CCHA 2C5YA 2XVDA 1LPUA 3H3CA 2JDTA 3VS2A 4HZSA 3NRMA 3EN6A 3VULA 3FC2A 2B9JA 2OU7A 5AP0A 1FOTA 2UZLA 2VX3A 3D7TB 3NUPA 5KCVA 3FSKA 1WBVA 5FXQA 5A14A 2PYWA 2WHBA 3NNUA 4M3QA 4AFJA 3C0HA 2XYUA 3MA6A 3P7BA 3AG9A 4WD5A 4IX6A
chains in the Genus database with same CATH superfamily
2GPHA 3FQHA 4PDOA 3TZ8A 5EKNA 2CN5A 4CVAA 5IQBA 3H9RA 5AAEA 3TM0A 3QKLA 5LWNA 2J0JA 5EG3A 4I6QA 4OTIA 3P86A 2OH0E 2YJSA 3QRKA 3AC2A 4FTMA 3UTOA 3ZSHA 1O6KA 4DEBA 4NJDA 3TEIA 4CCBA 4EOQA 5HU9A 3PXZA 3DDPA 3EQDA 1PXNA 4FKJA 2YM5A 3VQUA 4A9YA 3FYJX 3FZ1A 3HRCA 1W0XC 5ETIA 5H9BA 2C30A 3OZ6A 4QYFA 3PLSA 4XBRA 4F99A 4FV9A 4J53A 1CTPE 4GK3A 2WMVA 3ZXZA 1XKKA 2ZM4A 3G0EA 3KC3A 4HGLA 3OS3A 4CRSA 5K5XA 4UZDA 1JPAA 1Y6AA 2XBAA 4APPA 2C6KA 4RQVA 3KK8A 4LL5A 4RJ8A 4YZMA 5DBXA 4ZXTA 3CKWA 3ULIA 3DB8A 4LYNA 2YDJA 3AC5A 5FTQA 4BCGA 5HBJA 1SNUA 2XALA 2GDOA 3PIZA 5A4QA 4FSYA 1FMOE 4DHFA 5K9IA 4D5HA 1GY3A 2F4JA 4UZHA 4FEXA 4I93A 3AMBA 3BHTA 4G1WA 3EZVA 3QCSA 4QMWA 4IQ6A 3VW6A 1UNHA 5KUPA 2QOQA 4QNAA 5I9UA 4RWJA 3QTIA 4FVRA 3HGKA 5AUWA 2W7XA 2WU7A 3GEQA 3TKIA 4CG9A 5EOLA 3K5VA 3AQVA 3MTLA 4IZYA 4GS6A 4D4RA 3EJ1A 5C4KA 1A9UA 4J1RA 5ETCA 4FKWA 2VNWA 2Z60A 5GJFA 2BDJA 4ERKA 4AE9A 5A3XA 3FZOA 4BI1A 3LCSA 3QGWA 2QLQA 4H3BA 2UZVA 4GT5A 3IDPA 4BFMA 4EH5A 4BBMA 2OXDA 3QX2A 2XM8A 3PIYA 4O91A 3VN9A 3PP1A 5I0BA 1QPDA 4FK6A 3C51A 2YN8A 3HMOA 4KBCA 5AM6A 3UO4A 5JEBA 4A07A 5A4TA 4RX5A 3F2NA 4QMQA 4IXPA 4F7LA 4UWYA 3DNEA 3QTZA 3IKAA 4RVTA 3R7YA 4MVFA 4F9WA 5HVYA 4F1OA 3UNZA 2HWOA 2X8EA 3ITZA 5IUHA 5D11A 3ML1A 2YDKA 5AV3A 4Y95A 1OBDA 5C8MA 3PFYA 5DT0A 1H0WA 4CXAA 5JN2A 1WBNA 5L2IA 5F94A 4JVGA 3VBQA 3GUBA 5FBNC 4EQCA 3N9XA 3NW7A 3VF8A 5BV3A 2BKKA 5AUVA 3EIDA 3R2BA 2YWPA 5AMNA 3S4QA 5CNNA 2XUUA 4F0GA 5IQGA 1W84A 3QXPA 3FI4A 3H30A 4O27B 3UYTA 5J7BA 3MDYA 5HTCA 3HL7A 2AEGA 3TACA 2V22A 3EQFA 3IPHA 4UMUA 3LM5A 2Z7QA 4MNEB 3QZIA 1R3CA 4L6QA 3UZRA 2ITUA 4PP9A 4X2FA 4WBBB 4YLLA 5CEPA 5J95A 3I4BA 3TN8A 1CDKA 3D2IA 4NH1A 4DG0E 4DGMA 2UZNA 2YFXA 3MA3A 3BL7A 4I5CA 4X2KA 2UUEA 4U0IA 4KABA 4CFWA 5LCJA 4PPCA 4BBFA 3D15A 1Q41A 3ZUVA 4FSUA 5TR6A 1OVEA 4FL2A 2YERA 2Z7LA 4PL3A 4U9AA 4USFA 4M8TA 2IN6A 4G17A 4QT1A 1IAHA 1YDRE 3HMIA 2VWVA 1F3MC 3TMOA 1MRVA 2WTDA 3BQCA 1S9JA 4O7YA 5EM6A 3P7CA 1AQ1A 4B7TA 3RAKA 2GFCA 4KBKA 2Y6OA 5HG7A 4U41A 4A06A 4WNPA 5I3OA 3TYKA 2HXQA 4G31A 4FG9A 3K3JA 2PVHA 3GC7A 3HUBA 4QTCA 3R9NA 3UBDA 1STCE 2IW6A 4FSNA 2IO6A 5BVEA 2HW6A 2IVSA 4GJ2A 3TJCA 4MD9E 4TTHB 3O23A 3TT0A 2VX1A 3C4XA 3R9HA 1WAKA 4CZUA 3I7BA 3OUKA 3CY3A 3F88A 4EL9A 5FXRA 3ZZEA 4IE9A 4FI1A 3AC8A 4NM5A 4U6RA 4FTAA 3ZO1A 4F4PA 5IA3A 3D7TA 3HVCA 3LCDA 4FKIA 4O7TA 2R7BA 4Q2AA 5IQIA 4MXCA 3BGPA 4YJOA 4WUNA 2R3IA 2VZ6A 5LVOA 4NU1A 5D7AA 2HELA 4K9YA 1P4OA 2FVDA 5CVFA 4DH1A 5AADA 2QI8A 2WMBA 3OMVA 5CQWA 3R7EA 4PTCA 4ACCA 3UQFA 3LOKA 3B2WA 2JKKA 1OPKA 2W1HA 4FIEA 4QMNA 2GQGA 4MYGA 3R7IA 3NYXA 1HCLA 3D4QA 3EQGA 4JIKA 3GENA 4GEOA 4L3LA 4RRVA 5AM7A 1ZYSA 4QQTA 4K8AA 4AXEA 2XKCA 1DI9A 1O6YA 3BPRA 5CAQA 5I4NA 4M0YA 3C0GA 4IJPA 3DJ6A 3C4EA 3VBVA 1LR4A 2DWBA 3DK7A 4EYJA 5DEWA 3ZS5A 4G3DA 3CCNA 5AUXA 4E20A 2IVVA 4QD6A 4EZ5A 5IA4A 3PJ3A 4QNYA 3D5VA 2XKDA 2C0TA 5ANOA 2P4IA 2YIXA 3Q2JA 4IVDA 5BYLA 3ROYA 2PMNX 3GNIB 3NUAA 5AAFA 3C4WA 4FL1A 3QYWA 3DKGA 2OSCA 3P9JA 4TRLA 5ETFA 3NAXA 3QQHA 3BYMA 3PWDA 1KV2A 4EORA 4RIOA 3R04A 5CAUA 1YOJA 4J95A 2VV9A 4JG8A 3MYGA 4NCTC 3LFQA 4M0ZA 2O3PA 3Q6WA 5LVNA 2XM9A 2NP8A 2QO9A 3HV5A 3QD3A 4NJ3A 4CLIA 4FKGA 3GU4A 5CYIA 5KBQA 1YWVA 3U6HA 2F49A 5FTOA 4B8MA 4E8AA 4QDEA 5AP6A 1I44A 1OL6A 5CENA 3RTPA 4Y72A 5CXHA 5KMMA 4FVQA 2BR1A 3QQGA 2B7AA 3VUDA 3FKLA 1YDSE 3KY2A 3Q4ZA 3HP5A 2CNUA 4JAJA 1PKDA 4FTQA 1UKHA 2HAKA 2PMLX 4FZAB 3VBYA 4C02A 4E6QA 4JMQA 4O7SA 3AXWA 3VF9A 4XCUA 2ZV2A 3IDBA 5EK7A 1Q99A 2BAQA 3LQ8A 4BJJB 5AV0A 3OBGA 5FD2A 3ZLSA 1YXTA 3W0QA 3DJ5A 2W05A 5CEOA 2A2AA 4QMVA 4DDGA 3K5UA 3QHWA 3SRVB 1M2PA 4G5PA 2Y0AA 4AZVA 4J98A 5B2KA 4FKTA 3G15A 1GJOA 3IO7A 3P0MA 2GHMA 4QQCA 3QQKA 4E4XA 2W4KA 3DTWA 3FPMA 4BCHA 3GQLA 5TKDA 4AA4A 3F69A 3LQ3A 3FMDA 4NTTA 4C4FA 4W9WA 1SVHA 3LHJA 2BAKA 4HPTE 4IVCA 3PA3A 4F0IA 4G34A 4WG4A 4A4XA 4RIWA 4AOJA 3LE6A 4G6LA 2VTNA 4ZP5A 4FBXA 1PRYA 3PY0A 4GKIA 4K1BA 4AZSA 4MWHA 3RGFA 2OJ9A 2W5BA 3EFJA 5LMKC 2YZAA 4DGGA 2GFSA 3OOGA 4NT4A 1YOMA 3R22A 4JT3A 2PPQA 2XH5A 1GZOA 5ANJA 3W0RA 4OBOA 4DTKA 2J51A 3ZFYA 3R7UA 5J5SA 4PWNA 1M7QA 4HYIA 2CKPA 3A2CA 1NVRA 3QRJA 3FYKX 4GMYA 5M51A 4CFNA 4CLJA 5KHXA 4FTNA 4C4EA 4DE4A 2PZRA 3KK9A 4C3PA 4BIDA 4LUEA 3RP9A 4C36A 5L6OA 1J1BA 4YHTA 4AX8A 3BKBA 5H2UA 2JIIA 2X2MA 5I9ZA 3MB7A 4FGBA 5EM5A 3OHTA 2OFUA 5EYCA 2JBPA 3DBQA 1H26A 2YIWA 3A7HA 3NUUA 4XOYA 4BYJA 2OLCA 3ZM9A 1OKYA 4BGHA 2X4ZA 4I23A 3R9DA 4XG3A 2RKUA 3VRZA 3F5XA 2VTJA 4E7WA 4E26A 1SNXA 4G16A 1HOWA 1WVYA 3GCUA 3WZJA 2PMIA 1TFFA 4K6ZA 4UALA 3RPSA 1PJKA 1UKIA 4YBKA 1FGIA 3BRBA 3QCQA 5HG9A 5HEZA 4FK3A 4J71A 5C01A 3SOAA 2ETKA 3I0OA 4A7CA 5JQ8A 5FUTA 2RGPA 3MPTA 5M09A 2GNIA 2WMSA 1ZOGA 3HA8A 1OGYA 4MNFA 3VS0A 3ZSIA 5J79A 2WQMA 1Q61A 4L3JA 1IAJA 2REIA 3BE9A 3F7ZA 3SG8A 4H58A 4JX7A 3QTQA 4EJ7A 2IJMA 2OG8A 1DAWA 3IW7A 3EOCA 1FGKA 4E1ZA 2QOHA 3ZCLA 1KOBA 4I22A 4TZRA 3PWYA 4DC2A 2ESMA 4O0VA 1URWA 4CD0A 3DJ7A 3DQWA 4GK2A 4NSTA 5CQUA 4BYIA 2E9OA 4M97A 3R7VA 3WZEA 2VN9A 3TG1A 3I0QA 4CKJA 2R3GA 4LGGA 3VONA 2JAMA 3E5AA 4P2KA 5JGBA 5CU6A 1ZY4A 2YLFA 4IWOA 3DCVA 5AFVA 4MBIA 4MXXA 3W0MA 3CTHA 4GUEA 1E9HA 5ICPA 3ULZA 2BFXA 4AA5A 2ITVA 2BROA 2NNWB 3ZXTA 2PVRA 1ATPE 2X0PA 3PE2A 3QZGA 4B6LA 3QKMA 4TWCA 5L8JA 3ATSA 2QR8A 4CMOA 4WO5A 2IPXA 2ITXA 2P2IA 4X3FA 4C4HA 2HZIA 3TNQB 4LRKA 5HCZA 1RDQE 3P7AA 5EQEA 4QTBA 4HGEA 4UY9A 1H1PA 3OY3A 3UO6A 5J1WA 2ZJWA 3P78A 1VLRA 4RX8A 4I6HA 5M4FA 2Y4PA 4XNEA 3G51A 4YZBA 5HKMA 3R9OA 3SW4A 4Q9ZA 2XEYA 5CU3A 2HY81 4EQUA 2V7AA 4ANOA 4XV2A 1H25A 3OUNB 3R7OA 2XEZA 3FAAA 4RC4A 1IRKA 3ANQA 1QPJA 3TNHA 2IEWA 4R7IA 2VWYA 2GCDA 2NRUA 2CGUA 4FT9A 4NIFB 3ZU7A 3O71A 3T9TA 1F5QA 4GUBA 2SRCA 2HZNA 3SXSA 3DGKA 2QR7A 3BHHA 1Q3WA 3ID6C 4IFGA 2C4GA 3P5KA 4ALUA 1RQQA 4QOXA 4CQGA 2C5VA 1PXPA 2VTTA 3HLLA 1K9AA 3I81A 4MKCA 4QP7A 3F66A 4EH6A 3TDWA 3VNTA 4FA2A 4HVSA 5IISA 4DFBA 2VGOA 5J9ZA 5CSVA 1H0VA 4YJVA 4F9CA 2BKZA 4A9TA 2W0JA 4WRGA 3ANRA 1OL5A 3LQ5A 4FKUA 3MWUA 4FT7A 4BB4A 5CU4A 3EFWA 4ANSA 4F78A 5HTIA 2F7ZE 4X6QC 5DE2A 5HLWA 3DKCA 3D5XA 4BIEA 4HZRA 2YIYA 2BDFA 3P4KA 5TF9A 2UZUE 4ARKA 1G8KA 5EHOA 3LFEA 3KGAA 1W83A 3M11A 4GU9A 4B4LA 1A48A 3KN5A 4JRVA 4XP0A 1UNGA 2RSVA 4JJRA 4XX9A 4FMQA 5EDQA 2ITTA 3KA0A 3BU3A 3F3TA 3II5A 4KUJA 1BX6A 3DBCA 3ZMMA 3F82A 4C2VA 3DK6A 5LVLA 1G5SA 1UU8A 1WVXA 2ZM3A 4V05A 3VUMA 4HGTA 4Q9SA 2B4SB 5HTBA 4FG7A 4MXYA 2UZDA 4G3GA 5AUTA 4PUZA 3FXWA 5F1ZA 3SXRA 3UE4A 2J0MB 3KB7A 2C3IB 3MI9A 3RAHA 3RCDA 5BVWA 5EW3A 4I5MA 3UMXA 5HIEA 4HPUE 3BE2A 2H9VA 3AC1A 4UWCA 3CXWA 3SC1A 2IVUA 1YXXA 3RK9A 2XJ2A 1UU9A 2BPMA 4I0SA 3EB0A 3HDNA 4RVKA 4WNKA 3UC3A 3ZLYA 4AS0A 5BMSA 5IMXA 1FBNA 4BWPA 2Z02A 3NYNA 4BKJA 3RKBA 3UVPA 3QAME 2WTVA 3LFBA 3QCXA 4FOCA 4O4FA 3A99A 3LXPA 4N4SA 4UV0A 3R8LA 3NX8A 1H07A 2QG7A 5AR3A 2W1IA 4F09A 4FNXA 4D0XA 3PTGA 5HD7A 3U54A 2IZTA 2P0CA 2J2IB 3E64A 2ACXA 3QUDA 4IH8A 4PRJA 4I0RA 4X21A 3P5JC 3KCFA 2FYSA 5LMAA 5KZ0A 4AT4A 3VWAA 3LXLA 3DPKA 4F7SA 1K3AA 3Q4UA 4WIHA 5F9EA 4EOIA 2VO3A 2XK3A 2JGZA 5CI6A 3HX4A 3U9CA 1G8SA 3ENHA 3EQRA 5HVKA 3VHEA 2IF8A 1S9IA 5KX8A 3UYSA 3NFFB 5LWMA 3JYAA 4I6LA 5M44A 3MFSA 5FXSA 4F70A 2YCRA 1A06A 3CD3A 5DH3A 3PLAE 3WF7A 4AUAA 3F9NA 3O8TA 4MD8E 4TNBA 3MBLA 3QGYA 4R3RA 4TWNA 4C8BA 3BGQA 1OPLA 3L9MA 4TWOA 4G5JA 3LJ2A 4LM5A 4BTMA 3FZTA 4L44A 2GQRA 4HNIA 5D7VA 4ASXA 4K0YA 4C57A 1APME 4ZSJA 2BTRA 4MX9A 2PU8A 3ZRKA 3G5DA 3TNPC 2R5TA 2RIOA 4DEIA 5BVNA 4FKVA 5CASA 3G2FA 2WAJA 1JOWB 5KO1A 3GFWA 4JI9A 3FLNC 4BDIA 5EYKA 5K3YA 4ZY5A 3ATTA 2C3LA 4YJTA 3R8PA 2O5KA 3F3UA 3SA0A 4CGAA 2WMQA 3OWJA 4ZSLA 4F65A 4GU6A 1ZYDA 4JDHA 1H27A 3TCPA 5TE0A 4QYEA 2QHNA 3QL8A 4O22A 3BZ3A 3H0YA 5FBOA 3T3VA 3GBZA 3I1AA 1CKPA 1FVVA 2JEDA 4USDA 2BILB 3OBJA 2XB7A 4YTFA 2R3PA 3F2RA 4O81A 4FIGA 4O96A 5KMKA 5D10A 3WZDA 2YM6A 2ZAZA 3DDQA 2WMRA 5BYYA 3ERKA 2JKMA 2A1AB 4RIXA 4XG4A 2B53A 3L8PA 3TIYA 3CSVA 2EU9A 2R3HA 4L9IA 1MP8A 4IM2A 3Q3BA 4BI2A 4KIPA 2YWVA 4YBJA 3E88A 2PE0A 2VTMA 4O0XA 1J3HA 3FMEA 4X3JA 4AE6A 3WE4A 5IQCA 3UIBA 5L2WA 3RWQA 3JUHA 3TV4A 3N51A 4C7TA 5J1VA 4HYUA 2W4JA 5ANIA 4CCUA 5JSMA 4WBOA 4XG8A 3RBWA 2XNOA 2ZM1A 2ZOQA 4EOSA 3GGFA 1BKXA 3Q9ZA 1BL6A 4YNOA 1URCA 4DAWA 3D14A 2PZ5A 5FDXA 2C6MA 2YEXA 5BPYA 4OT6A 2PUNA 4EWQA 3EN5A 3FLZA 2XS0A 3KKVA 1OECA 5H3QA 4V04A 3BYOA 1OIUA 5D1JA 4JR7A 4NTSA 5B2LA 3HV4A 3KXMA 4IB5A 4IMYA 2UW8A 3D5UA 3FBVA 2NYAA 3CJFA 3PP0A 1ZOHA 4KA3A 4NKSA 2A19B 3GFEA 2OI4X 2KTYA 2V62A 5G1XA 3TV6A 3F61A 4IB0A 4MXOA 3V6SA 4ORKA 1M2RA 2R9SA 4KS8A 4IDVA 3IW6A 4O4CA 1DAYA 4FKQA 3NSZA 4RT7A 3PPZA 2YAAA 3C4ZA 3AOXA 3VBWA 1QMZA 1U46A 2I0HA 3BHYA 1YKRA 4RA5A 2J90A 3WF6A 4BDFA 2W4OA 3FDNA 3M2WA 4YZCA 4AN9A 3GOKA 5G6VA 4ZTMA 4U81A 5LARA 3NNWA 4PL5A 4W4YA 3KCKA 4DGOA 5GZ8A 1VYWA 3R1QA 2WEIA 4IAKA 4MK0A 5CT7A 4BCMA 1SZMA 3NR9A 5HGIA 2B54A 4YZNA 2C47A 4EYMA 3QRUA 3EHAA 2F7EE 1R0EA 4U80A 3ZM4A 2XNMA 1YOLA 4D1SA 3LMIA 3V8WA 4MF1A 5IDNA 4RFMA 4UMRA 2Q0BA 5J8IA 4X2JA 3PYYA 3DLSA 4DEEA 2JDOA 5AX3A 3SLSA 4IVAA 3ZDUA 2I6LA 4CYJA 3OCTA 5GNKA 2PVFA 4EH9A 5HO8A 3IECA 5CANA 4Y73A 2OXXA 3QZHA 4KRCA 4R5SA 3NDMA 3PXYA 4D4SA 5LJJA 4C4IA 3THBA 3SGCA 1H1WA 3ZRLA 3C4CA 4JBVA 3R1NA 3LJ1A 4M13A 2B0QA 4NZWB 5GZ9A 5CAPA 4TYJA 2ITNA 3AKKA 3OTUA 4BDCA 2ZV8A 4GT4A 4PTGA 3VQHA 4LDTA 3FE3A 3KXZA 2X0OA 2R3JA 3HECA 4D58A 4W8DA 5AR8A 2UZTA 4GIIA 4EBWA 4G3FA 2JAVA 3UGCA 4QPAA 5JFSA 3QCYA 4S34A 2I40A 2OK1A 4F9BA 5AP7A 2Y7JA 4RPVA 2GSFA 2IVTA 5ANEA 4AXCA 4DLJA 4OTFA 4YTIA 3O51A 1FVRA 2XIYA 4O4BB 4OLIA 3KXGA 4ZTHA 3VS1A 4A9UA 4BL1A 2I0YA 2R7IA 4FTKA 4LFIA 3ORNA 3DV3A 5AR7A 4CFFA 5HHWA 3FMJA 2DQ7X 5CEQA 5IU2A 3C13A 4H39A 2ZFYA 1QPEA 4BCIA 3EN4A 1BYGA 2ERZE 4V0GA 5I9XA 4BCNA 4L8MA 4L3PA 5CF5A 3DKFA 3UNKA 4EQMA 3CIKA 3NLBA 5I5ZA 4FNYA 3W2RA 2C3KA 4EH8A 2OBJA 3MH1A 2FSTX 2PUPA 2C3JA 1UVRA 3SOCA 2XNGA 3QA0A 1NVQA 4MQ2A 4X3FC 4J7BA 3CJGA 3RMFA 4LOOA 3DXQA 3M1SA 1Y57A 3NUNA 1OMWA 3SAYA 4FV3A 4LQMA 3M42A 2OZOA 2YAKA 2JKQA 3C4FA 5HLNA 5M07A 4BICA 5A46A 4LMNA 5EM7A 2GNJA 4EHEA 4O6LA 3KRXA 1PXOA 5TO8A 2R3FA 5EOBA 3ORLA 5DR6A 2R3LA 5K0KA 4QMLA 3U51A 4JDJA 2W1CA 3BWJA 3KFAA 4MHAA 2UVYA 3FL4A 2CMWA 4ENXA 2QURA 4FZDB 2BRHA 2QOFA 5GIPE 4A9SA 4PV0A 5AJQA 3PE1A 3T8OA 5IDPA 2CLQA 2FA2A 3SX9A 4V01A 2Z8CA 3GU6A 4KKHA 1VJYA 4GIHA 2J7TA 4IAIA 3HNGA 2UV2A 4FV4A 3IS5A 4L7FA 3V51A 4C3FA 2XANA 3ORXA 4IHPA 4XRLA 4RIWB 4RSSA 3W8QA 4DFUA 3OG7A 5ACKA 4TYEA 4FTRA 5E1EA 3EFKA 2HCKA 5HE0A 1XH5A 3F5GA 3R30A 4AG8A 1PXLA 4J52A 4I94A 4UMTA 4ALWA 5JZJA 4GW8A 2WO6A 2FB8A 4FKRA 1R0PA 1WBSA 3UOJA 5CSPA 2UZOA 4I24A 5M56A 2JIUA 2RFEA 3AD6A 1W2FA 3LM0A 4F08A 4O1PA 3FMKA 5KMOA 4D0WA 3MY0A 2FUMA 2QOOA 3CQEA 3PVGA 3TTJA 3LCTA 2BZHB 2GS7A 4GSBA 4RWIA 4Y8DA 3TZ9A 5K0XA 4EC9A 5IA2A 4BCJA 3E62A 2RF9A 5E8WA 4WG3A 4I0TA 1PXJA 1YHWA 2ZMCA 4DHIB 4KSQA 3VUHA 4ZLOA 3OT3A 4C33A 3HYHA 4F9AA 4CEGA 4ZS4A 2R0UA 3I6WA 1M2QA 5GHVA 2LAVA 1AD5A 4YZDA 2ZDTA 3C1XA 4HCTA 3RHXA 4RFZA 5DGZA 3ODYX 1YXVA 4N6YA 5HIBA 2CGVA 4Y5HA 4U43A 1WMKA 2ITQA 1P5EA 1UA2A 4ID7A 5JT2A 3U55A 5IKWA 3POOA 3VRYA 1W2DA 5HQ0A 4IWPA 4EOPA 2VO6A 3D9VA 4KWPA 5FP5A 4ANQA 4YLJA 4E93A 4FSRA 1LUFA 2WZJA 3O8UA 4MCVA 3KRRA 2HENA 4U44A 1FINA 3NYVA 4U40A 4FV0A 4TYHA 3VUTA 1H4LA 1OBGA 2F7XE 3WI6A 3ZFXA 1NW1A 4FNWA 3V8SA 4ZTRA 4DBXA 4UXQA 3DY7A 2HOGA 2F2CB 3EL7A 3KN6A 4UEUA 1T46A 4YP8A 4A4LA 4YUQA 1RW8A 3R2YA 3LLAA 5M06A 5DVRA 2W9FB 1PMUA 3I60A 1VZOA 4U3YA 5HNBA 5JMSA 4BRXA 2R3OA 4RX7A 1XH8A 1R1WA 2WD1A 3AT2A 1WBWA 3H10A 4MXAA 5KMJA 3G90X 1WCCA 3KULA 3PXQA 2UW7A 3NS9A 5CSWA 5EI2A 4NW6A 4PX6A 3O7LB 4FSTA 3ALOA 2C6DA 2VAGA 3DU8A 3GCPA 2H96A 3PA4A 2C68A 3O17A 3PRFA 3LZBA 3NYOA 3OCSA 3WOWA 2AYPA 3QTUA 4UYAA 3OOMA 1ZY5A 1GZ8A 4DEHA 3LIJA 2GTMA 2PY3A 4O7LA 3QQFA 3VS3A 3PSBA 2VWIA 5FGKA 5AUYA 4FUXA 4FYNA 4X3FB 2C1BA 4AT5A 4E4MA 3FHRA 4IBMA 4NEUA 4ERWA 2OXYA 2PL0A 2UW4A 2W1FA 2P2HA 2ZV7A 4YSJA 5E8XA 3LPBA 2BZKB 2J9MA 5L2QA 3RAIA 3HRBA 2J4ZA 3EYGA 5LXMA 4O0WA 1GAGA 2QVSE 3KMMA 2OWBA 4IX3A 1TQMA 1ZLTA 3GXLA 5C03A 1V0OA 5CF6A 2WNTA 3BU6A 3Q04A 4IADA 4M12A 2DYLA 2XIKA 3L1SA 5FWKK 3ZEWA 3P23A 3W32A 3DFCB 4R5YA 3WF5A 1M17A 3BELA 4YPDA 3FSFA 4S32A 4DFXE 3C5IA 2UW9A 3DOGA 5AP5A 1Q4LA 3CQWA 1OI9A 5FQDC 3MGYA 1XJDA 4TXCA 3UOLA 3KREA 4GG5A 4GKHA 5IQDA 4RG0A 2OJGA 3A8XA 4HYSA 2VTOA 4F6UA 2CKQA 4FV8A 4U5JA 5DOSA 4Z3VA 3MJ2A 5F95A 4RVLA 2P33A 5AV2A 2WTJA 3QXOA 3OCGA 3BBWA 2BIYA 3GC0A 4ASZA 3KQ7A 4BDGA 2BMCA 2VX0A 2ZYBA 4IZ5A 4NWMA 1ND4A 5L2SA 4OBQA 4WUAA 3WYYA 2VTIA 3ALNA 3OWPA 3NEWA 4PMTA 3PXFA 4YJUA 2XA4A 3QUPA 1I09A 1OUYA 3DK3A 4QP9A 3SD0A 3VS5A 1OITA 2WMXA 4FT5A 3V5QA 2QQ7A 3NIZA 1U54B 1AGWA 4ITIA 4FODA 2XZSA 4QMPA 4EHGA 3VC4A 3KU2A 2GS2A 3AD4A 3POZA 4YSMA 4FTCA 3UIUA 4E5AX 5AA8A 1GIIA 3Q4CA 3FWQA 4FIHA 3E3BX 4RVMA 5E8VA 1ST0A 3UZTA 3RVGA 1QPCA 3Q9XA 2C6LA 3KL8A 3MY5A 2GS6A 2QNJA 2WKMA 3PSCA 5E8SA 3COIA 3VAPA 3ZUTA 2BAJA 2EXCX 3TV7A 1YW2A 3PJCA 2G01A 4EONA 1Q5KA 1OKWA 3FY0A 3K54A 4P4CA 4TYGA 5DMZA 4OTWA 4I20A 5FEQA 3G9NA 2J6MA 3ORIA 4QYYA 5L6PA 2PZYA 3MS9A 3NNXA 4RJ4A 3W2OA 4DFYA 2GQSA 2QO7A 2BRGA 3GCSA 2OH4A 4Y83A 3IK3A 5L8KA 1OIYA 1WFCA 2OF4A 5CI7A 2XK8A 3OW3A 3ELJA 2WTKC 3DXNA 2JD5A 4U42A 5IA0A 3UZPA 1KE8A 3MB6A 5T6KA 2W9ZB 2O65A 2OJJA 2VTSA 3LW0A 4IJ9A 3RWPA 4Z7GA 5CVHA 1Q8ZA 3UO5A 3WBLA 2C5OA 1JBPE 3RJCA 4I6BA 4BTKA 4DEDA 4BWKA 4AAYA 2WTWA 4DFNA 1U4DA 5IQFA 4FV5A 3ZOSA 4D28A 3U6JA 3SG9A 4FV1A 4FC0A 4AGWA 3VBXA 4LOPA 4XH6A 2QC6A 2O8YA 3LXNA 3BYVA 5LQFA 5GZAA 3O8PA 3BLAA 4MXZA 3RPOA 4WKQA 2VU3A 4BTJA 3Q96A 4EOKA 3PFQA 4B0GA 4DTBA 2JDRA 4QMXA 4QMZA 2GMXA 4XG9A 4QTEA 3HAVA 1XH9A 2VO7A 3HKOA 3TWJA 1WVWA 4G3EA 4C58A 1JKSA 2XF0A 3SHEA 2XP2A 2OZAB 1UU3A 1KE9A 2GNFA 4HOKA 4Y85A 4CZYB 4RMZA 5JKGA 1SVGA 3QQUA 2CLXA 4YJSA 2EUFB 2G15A 4IACA 3ZBFA 3Q9YA 3JVSA 3VVHA 4DITA 5H8GA 3N4VA 2X7OA 2Q0NA 2AUHA 4ACDA 2JC6A 4KBAA 1XH7A 3GC8A 3PVBA 3V5TA 1UV5A 3RNIA 5CSHA 4MTAA 2YM7A 1M14A