4YTFA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune diseases
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
289
structure length
283
Chain Sequence
TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 283
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytfA01
4YJNA 4KUJA 4W4XA 2CGUA 4IW0A 2YHVA 3BU3A 4L3PA 4PL5A 3G51A 3QUEA 4XV9A 3R8ZA 4XG7A 4DC2A 2F4JA 4AE6A 2CNVA 2VWUA 4IAFA 4LRJA 2GS6A 4FUXA 4WNMA 2YN8A 3TDVA 1XH6A 4J7BA 4EL9A 3TG1A 4Z7HA 2C4GA 1J3HA 3KRRA 4JQEA 5LWNA 4XRJA 4IFCA 3RCJA 1ZYSA 3F5PA 2PY3A 4KKEA 4NFMA 2J0KA 4AP7A 2W1EA 2C47A 4J8MA 4MWIA 3JVSA 1OM1A 3BZ3A 1S9IA 5A6OA 4LYNA 3FBVA 3SOAA 2J0LA 2ZV2A 4FVPA 4I92A 4ENYA 2P2IA 5BVDA 3IDCA 5LMKA 3V51A 4BTMA 2J0JA 3LXLA 3LMHA 3CE3A 3GCVA 2X8DA 1Q8ZA 5HE2A 3TL8A 1BI7A 3O7LB 4QO9A 4YNOA 4X3FB 5GZAA 1Y91A 4HJOA 1H08A 4H58A 2IW8A 2LAVA 3O0GA 2F57A 3NUPA 2VTAA 3K3JA 4TRLA 4Z16A 3DT1A 1YDRE 5C1QB 4ERWA 1YXVA 2B9JA 2Y4PA 3FI3A 3SC1A 2G9XA 2O2UA 2OG8A 3ETAA 4M84A 2C6TA 5CU2A 4B6LA 4DFUA 2QR8A 5H8EA 3T9TA 2JBOA 3BU6A 3PY1A 1A06A 1M14A 5H2UA 1ZAOA 3F61A 4OTIA 4C38A 3HMNA 4UXQA 3NW6A 3QTZA 2VV9A 2WIHA 4RRVA 3RINA 3TKIA 5LWMA 1TQPA 2BRMA 5D10A 3ZHPC 3CSVA 4RJ7A 2W5AA 2OBJA 2UW7A 4IB3A 4Q5HA 3G9NA 5AIKA 4CFVA 1PW2A 4EKKA 4YJOA 4K77A 2HIWA 5EDRA 3BEGA 4I94A 4DF3A 2Z60A 3R73A 5AR3A 3V6SA 4LV8A 5AV4A 4R3RA 3I1AA 4AZTA 3VS2A 2GFCA 3Q52A 1KE5A 5HO8A 3RHXA 5D7AA 3TKHA 4KWPA 4XUFA 4DINA 4I24A 1JBPE 3BGQA 1ATPE 4YC8A 2O3PA 2F49A 3WF7A 5IQBA 5FWKK 4EH2A 3FLSA 4NFNA 4OTGA 4HCTA 4O7YA 2ITWA 3VS4A 4F9YA 1CMKE 2GHLA 4EOMA 3TV7A 2PTKA 4PY1A 4EH7A 2Z7LA 3DQXA 3QZIA 3OBGA 3R02A 5E8YA 4BDJA 2CGWA 2YCFA 4F7JA 2ZM3A 3FMJA 1OPJA 4ANSA 3HRFA 4PF4A 4BIDA 4C7TA 3UE4A 3CTQA 2QHNA 3TJCA 4F70A 2OIBA 3F88A 4IWDA 1FOTA 3ZDIA 2ITNA 1H07A 5HTCA 3EN9A 2J5EA 4ZSJA 2GSFA 4FNZA 2X4FA 2CGXA 3I5NA 4XG4A 2C6LA 2JC6A 3LJ2A 4IADA 4M97A 2QD9A 5H3QA 4AOTA 2GNLA 4EH3A 3PIZA 3FKOA 3ZU7A 3NWWA 4DHFA 2PMIA 4OAVB 1BX6A 4II5A 4ZY6A 4GCJA 3EFJA 2PVHA 3QCQA 5HIBA 3B2WA 5AUVA 3D5UA 3DDQA 1JKLA 2JBPA 4FNYA 4UYAA 1XBCA 4IAZA 3A99A 3EQFA 1MRVA 5L6OA 3MVLA 4D5KA 3HVCA 4BYIA 4ITJA 5HBEA 2HOGA 3PZEA 4P2KA 4DGOA 1BKXA 5KKRB 4FT5A 4HW7A 5GIOE 5M4FA 4K9YA 3K54A 5HVYA 3EQHA 5L8JA 3S4QA 3GB2A 3ZEPA 3PPJA 4JJRA 4QMOA 5IEVA 4TWCA 3VUKA 5I0BA 2P0CA 3VHEA 3MTFA 1SNUA 3PXRA 4QYHA 4A9TA 3PUPA 1PXOA 3IW6A 4FKJA 4WG3A 3HAMA 4A4LA 3FV8A 4A9UA 3R63A 4U43A 2OIQA 3QD4A 1W7HA 2HZIA 2FVDA 5I9ZA 2FB8A 4A7CA 5LMBA 4NCTC 5A9UA 5B7VA 4U97A 3MB6A 5EKNA 4C3PA 2FUMA 2HW6A 2EXCX 3AG9A 5TF9A 5CLPA 4NUSA 2XEZA 4QNYA 2P2HA 4FSZA 3ORZA 1P4FA 3LMGA 3NYXA 4GS6A 4M15A 4OTWA 5A3XA 4FEWA 2Y4IB 2J4ZA 3FZ1A 3GT8A 3LCDA 1QCFA 5AAFA 3SX9A 1O6YA 4Y95A 4ZTSA 4TYIA 1ZYDA 4ACGA 2XNEA 4E8AA 4L43A 4FV7A 4A06A 4IAYA 4NM5A 2QOCA 1YOJA 2XKCA 3KRLA 4S31A 2EB3A 5KMJA 5IG1A 3P5KA 5EI2A 4LUEA 4D4SA 4G3CA 4C2VA 1Y6BA 5EH0A 3CQWA 4USDA 2H6DA 1SVEA 1H26A 4CG9A 1BMKA 3QA8A 3LAUA 4QMMA 4D4YA 3IS5A 3HUBA 3QQKA 4XG2A 3UIXA 3R8MA 2P4IA 1ZYLA 4GK2A 5FD2A 3MH3A 4TZRA 3L9NA 5CAPA 2R5TA 4GH2A 2Z8CA 5JZNA 4CQEA 4GK3A 3R9OA 4RIOA 1A48A 2BTRA 3F3VA 3HUCA 3PXQA 3V5WA 3GQIA 4EZ5A 3VQUA 2OF4A 4O84A 3FWQA 1E1XA 2HZNA 3F3WA 2OSCA 3QQFA 1XBAA 4NM3A 4GUBA 4ACMA 2GFSA 1J91A 2OJ9A 2WMAA 3FLYA 5T3QA 4OR5A 2YDIA 3PE1A 3FL4A 3A4OX 4LFIA 4MBLA 3PSCA 5J5SA 3TV6A 4KA3A 2WTKC 3Q3BA 3T8OA 2VTJA 4QYGA 4YZMA 4FTAA 2BIYA 2NNWB 3JY9A 4CRLA 4B4LA 5IU2A 3NS9A 4MK0A 4S2ZA 3RBWA 2XK7A 3EFKA 4QQCA 5FP5A 4C3FA 2WXVA 1WVWA 2GHGA 4KS7A 5IQCA 4XG9A 3U55A 4YTHA 4C61A 2BZKB 2NRYA 4JRNA 4G5PA 2UZDA 4LL5A 2X6EA 3D83A 4H1MA 5HG5A 4ASDA 3NW5A 4Y72A 4HGEA 3FZSA 4PPBA 1NVSA 2VN9A 1QPCA 2QG5A 4OW8A 3S2PA 3TTIA 3BV3A 3I4BA 4FTJA 3LW0A 3CJFA 1JWHA 1T46A 2J6MA 4UMRA 3KREA 4RWLA 3U6HA 3R8UA 3BQRA 3I6UA 5CENA 4ARKA 3QF9A 4QTCA 1Z57A 2ONLC 3I81A 3ZMMA 5JKGA 4S34A 2WZJA 5CSXA 4BDIA 4NK9A 2XZSA 4UY9A 3UG2A 5CXZA 3R8VA 3C4WA 2BRNA 3GOKA 1Z5MA 3Q5IA 3QBNA 1OBDA 3CLYA 2UW0A 4F64A 1IAJA 2QOKA 5FDXA 3VBYA 4O0YA 4FSUA 4IX6A 4N4SA 4X7QA 4BHZA 3QRIA 3RAKA 3CXWA 2NPQA 2ZM1A 4BCGA 5HZNA 3QHRA 3W2CA 1GZ8A 2XYNA 3HV6A 4JBOA 4FZ7A 4BC6A 2W1GA 1KE6A 3DKOA 4GU9A 1OVEA 4X3FA 3ZO4A 2PE0A 4KAOA 4FT7A 1U5RA 2VTPA 5J1WA 1MP8A 3VUDA 4X6RA 3C4ZA 3LXPA 3ZSGA 3QGYA 1ERKA 3CY2A 4A9YA 4D5HA 4ZZMA 5BNJA 4MCVA 4GFOA 3HAVA 4JBPA 4QQJA 2IN6A 4D9UA 3Q4TA 4FKRA 4QP2A 2PE2A 3HRCA 2OH4A 1VZOA 3DZOA 4I5PA 2XCKA 3DPKA 4S30A 2XRWA 4IBMA 5T68A 1CKPA 2WMWA 3QTXA 4HVHA 3V3VA 2JKQA 4FV6A 4D0XA 4CFUA 3U4UA 3MVMA 4DEDA 2ZM4A 2VTSA 4D1SA 2O63A 5CI7A 5LVLA 4FTRA 4IHPA 5A46A 4L46A 5E9EA 2HAKA 5IMXA 3FDNA 1OMWA 3MY0A 2B1PA 4XP2A 5AV2A 5BVOA 4XG8A 3OP5A 4XV1A 3MH2A 5K9IA 2BZHB 4FEQA 4O0VA 4RJ8A 3EYGA 4TXCA 2RFSA 3O50A 2IZUA 3VHKA 2VX0A 3DY7A 4FTQA 3I0QA 3JY0A 4CG8A 4RIYB 1KE9A 4AT3A 5CU6A 3UNZA 2JDVA 3N4VA 4YTIA 5A4EA 3NZ0A 5CVGA 3P08A 1JQHA 1ZMVA 4XV2A 4MH7A 4YBJA 3R9HA 4C34A 2I7QA 3ORXA 4AXAA 2JFMA 4JG7A 2HELA 4FTIA 5BYYA 3EQRA 3FL5A 3UIUA 3DS6A 3PRFA 4A9RA 1URWA 4BZDA 2J9MA 4F7LA 1UU7A 1HCLA 2PHKA 2W06A 3EKKA 3IOKA 3A8XA 3QXOA 4EEVA 5M08A 5EHLA 3RGFA 3L8VA 4PWNA 5M4CA 2OO8X 3BYUA 2BRHA 4L45A 4NJ3A 3TIZA 3G0FA 3ZXZA 1IA8A 2VO3A 3BE2A 4ASEA 4LOOA 3P23A 3R1NA 4K2RA 5LXMA 2UZBA 1ZOGA 3AC1A 3ACKA 4FTOA 5CYIA 4AA0A 4DH8A 4NKAA 5AUZA 2I6LA 3FHIA 3PP0A 4O0XA 4RPVA 5AR4A 4E4XA 4LOQA 3ID6C 4B8LA 5IDNA 3MY1A 5JMSA 2ACXA 2QOLA 2YAAA 1Q97A 3LHJA 5A54A 3ORMA 3QWJA 1IA9A 4EHEA 4HVSA 3FLWA 5E8UA 5EG3A 2XS0A 2IO6A 3EQGA 5CVFA 3DQWA 3ZEWA 4TYJA 3VS6A 4M13A 4E26A 3NMUF 3BGPA 3IGOA 4G34A 4JNWA 1RE8A 5AMNA 2PVNA 2NP8A 3TZ9A 4QMWA 2W1CA 3E7OA 3HV7A 3EN5A 3IK3A 5E8VA 2QOIA 3PYYA 1B38A 5CASA 4JVGA 3V8WA 4DEHA 1PXMA 1ZYJA 5JRSA 2YJRA 4EJNA 3OUKA 2GHMA 2HWPA 3DK3A 3WF6A 3WF5A 3R1YA 4RVMA 5FEQA 2AC5A 4GIIA 4L6QA 3R8LA 2ETMA 3QL8A 2QOHA 3R7UA 3LXKA 2JLDA 2GPHA 3V01A 2EXMA 4ITIA 3R21A 4WBBB 5AM7A 1ZY4A 1YXXA 4G16A 4RA4A 2VNYA 3K3IA 1CM8A 3P7AA 2A1AB 2X9EA 3BBTB 3BLRA 4RSSA 5D12A 5HQ0A 2CCIA 5I4NA 4LG4A 4YC3A 3DK7A 3LVPA 3R9NA 1TVOA 2H8HA 4Y5HA 2X2LA 1SZMA 3HYHA 5HLWA 4O7WA 2W9ZB 3NGAA 4RLLA 1H25A 3IDBA 4BDHA 1KE7A 1P4OA 1REJA 4DH1A 4AGUA 4YZ9A 2XKFA 2W4KA 1YWVA 4MXYA 4XJ0A 1URCA 3B2TA 3OWLA 4BI1A 4KNBA 3N4TA 2NRUA 2QKRA 3VUTA 4BKJA 4DLJA 3Q96A 4MXOA 2YEXA 4NTSA 5A14A 4Y85A 3C0IA 4I41A 1Q3WA 1PJKA 4IDVA 4M0YA 2JIUA 4ZSGA 5M55A 2XA4A 3ODYX 3OXZA 3ITZA 4ANQA 4BCMA 5KBRA 1KOBA 2R3OA 3D7ZA 5CEQA 4D0WA 3KCKA 1NA7A 5JQ5A 4I5CA 4E20A 1Y6AA 4E6DA 3LMIA 3FSFA 2J5FA 5A6NA 2C0IA 5E92A 4EZ3A 3LFDA 4FTKA 3ULZA 4GL9A 2CKOA 5IPJA 3FI2A 2HENA 3KQ7A 4I20A 5J7HA 2PYWA 1H1SA 3C0GA 1UNLA 3MVJA 3ZUTA 3DDPA 2A4LA 4QMUA 3DGKA 3ET7A 5C8MA 3PIXA 4QP4A 4FKSA 3DBDA 3QQJA 3U87A 1H1RA 5J87A 3B8RA 5AV3A 3UYSA 3MBLA 4FI1A 4LGDA 2XJ1A 1S9JA 3F9NA 2B9HA 5IA0A 2JIIA 3OTVA 2W17A 3QCXA 4V01A 4IM0A 4XH6A 5GZ9A 3AD6A 3GI3A 2QHMA 5ACBC 4X2NA 4G1WA 4EHZA 3FEGA 3JYAA 4PDYA 3DKCA 5D11A 4EC9A 3T3VA 3ZO1A 2UZNA 3NUNA 3VQHA 4XYFA 3KF7A 4ZTMA 4O7NA 3KXNA 1JOWB 2EVAA 2GS7A 3OCBA 2QNJA 3EJ1A 1JNKA 4QTDA 3HV5A 4FNXA 5BMMA 2VO6A 4JDHA 3R2BA 5AIRA 5ANJA 5AP2A 3N9XA 4MXAA 3RCDA 3LCTA 3WE8A 4DEGA 3U54A 3QZHA 3MS9A 4RQVA 4YMJA 2B55A 4BWKA 5IQEA 3ZSIA 1W98A 4FC0A 4CLJA 2I0YA 2XF0A 4RFZA 5KMKA 1KUTA 3PXKA 5J9YA 3FHRA 3LZBA 3Q60A 5TE0A 4FR4A 5B2MA 4O6EA 3ZUVA 2YISA 1ZWSA 4QPAA 1AQ1A 3DXQA 2VGOA 3MFRA 4CTBA 3D14A 3CBLA 2O65A 5HE1A 2ZB1A 5IUHA 3NYNA 2BHEA 3THBA 4RWJA 4W4VA 3SXFA 1YQJA 2XMYA 4BL1A 4L00A 2W1FA 1J7LA 4CFFA 3ATTA 4DEEA 2WAJA 3ZLSA 5E91A 4O81A 4U44A 4OTPA 2OXDA 4G9CA 3RPOA 3W16A 4CFNA 3LOKA 3OVVA 2PVFA 4D2WA 4EUTA 1A9UA 5EM8A 5AX9A 1AGWA 5JFXA 4W8EA 4FKPA 3CQUA 3C0HA 4HYHA 3I6WA 4ANBA 3PSDA 2QU6A 3ZO3A 1ZMUA 3SRVB 4CMUA 1UA2A 3C50A 5IEYA 5K4JA 5AR5A 5EM6A 1E1VA 5F94A 5HG7A 1YHWA 2PZ5A 3QUPA 5CF6A 4IVCA 2R3FA 4MQ2A 5EOBA 4YUQA 2XYUA 5IA2A 4BCNA 4FTUA 3OTUA 3E8EA 2QCSA 5IF1A 1GOLA 2GNGA 3GEQA 5FM3A 5AA8A 3F7ZA 4LV5A 4FYOA 2W5HA 2ZVAA 2VWXA 2GCDA 1VYZA 2J50A 3A62A 4IIRA 4ZTHA 4ZJVA 3QD0A 4ZSAA 1HCKA 4YSMA 1IRKA 3E62A 3HDMA 3LFSA 5H8BA 3VF8A 3SD0A 3COKA 3HECA 3FY0A 4I3ZA 3AT3A 4U6RA 2JAVA 2PK9A 3PXYA 4IB1A 4EOLA 4XG6A 1M2RA 3QLGA 5KZ0A 3EKNA 5TKDA 3KF4A 2XK6A 5JH6A 1G8SA 3H10A 2VWBA 3OT8A 4M14A 4FF8A 4I1ZA 4DGMA 3HA8A 4DCAA 4MD8E 1AD5A 4FV3A 4AU8A 2H34A 4YSJA 1JPAA 5AP0A 3PPKA 2HXQA 5IQDA 3G2FA 4WIHA 4AG8A 4GVJA 4NU1A 3W2PA 5K5NA 3AC8A 3QTSA 4PMSA 5KMLA 3GU7A 5ANIA 5HTBA 3MTLA 3LIJA 1Y8GA 5LCKA 4AGDA 3UNKA 4RIYA 3MPAA 4GVAA 2JGZA 5L2QA 1VR2A 2Y8OA 4MNFA 5LVNA 3RK7A 1OKZA 4D9TA 4DTBA 3OCTA 4UYNA 4NSTA 4X2GA 2X39A 2J0MB 4R3CA 4AT5A 2OU7A 5C27A 3ATSA 3UO5A 4BF2A 2GNJA 3BYMA 4JL9A 3VUGA 5DN3A 3PE2A 3OWJA 4CKJA 3R6XA 4U41A 5DT4A 3PG1A 4ID7A 3SOCA 3PRIA 4FT3A 4YC6A 5HD7A 4R1YA 5JQ8A 4F1OA 2C0OA 3OW3A 3ORIA 3MVHA 5GHVA 4O7LA 1XJDA 2GMXA 4H3QA 4H3PA 2GS2A 2YERA 3ANRA 4LI5A 4NIFB 4BTKA 1PY5A 4EONA 2KTYA 1SNXA 3AMYA 2OF2A 1IEPA 4FKGA 4XOYA 2E9PA 3AGMA 1UWJA 3ZOSA 4H05A 4FTCA 4I6BA 2CDZA 5LQFA 5J1VA 3SQQA 4M68A 5BUJA 1XWSA 4BR3A 1OL6A 2H96A 4AA5A 4PTCA 2VRXA 2FSTX 4R8QA 2PU8A 3FLQA 2WQBA 3SV0A 3QRJA 1U54A 4G3DA 4KD1A 3I60A 4O27B 4DBNA 3W55A 4C62A 2C0TA 4PMTA 2V7AA 4YZNA 3FMKA 4EOIA 2E9VA 3P0MA 4O7RA 4J8NA 2BAJA 5FDPA 2ZJWA 3O2MA 1M17A 2VZ6A 3ORKA 5GJFA 3UPXA 4B9DA 4BBEA 3GCPA 4YHTA 3UZRA 4XLVA 1EH4A 3CS9A 4BCOA 3A4PA 3D5VA 4U40A 5HCZA 4UWCA 4AFJA 4DFLA 3O96A 1YHSA 3CD8A 5HVJA 2R7BA 3SGCA 4QP6A 2E9NA 3FUPA 3QU0A 2W4JA 3WZEA 5B0XA 4UV0A 4CSVA 3QALE 4BRXA 2PE1A 3F3ZA 3FSKA 1K3AA 2QLQA 4FSQA 4DH5A 2PUUA 5DEWA 3TV4A 4C4IA 4EK4A 3LLAA 4IM3A 2PMOX 3W10A 3PG3A 1R78A 4AFEA 5CSVA 4CTCA 4GV1A 4D4RA 5DR6A 4O83A 1YRPA 3K2LA 2WU6A 1X8BA 4JX3A 4PL3A 4R77A 5AADA 5IMEA 4XP0A 1XH5A 3QZGA 3HDNA 5IQHA 4JIKA 4QPMA 4ACHA 3O7LD 1NVRA 5I9YA 4DTAA 4S32A 2BILB 1PXNA 3RMFA 4DBXA 1IR3A 3DAKA 4O0TA 5DLSA 3WYYA 4ACCA 2BFXA 4OBOA 1GNGA 5AUYA 4EZ7A 5J7BA 3NUSA 2Y6MA 2IJMA 4O0UA 3KU2A 1BL7A 3AMBA 3RPVA 3JVRA 1BUHA 3GCSA 3L9PA 1GAGA 2C1AA 3VUMA 1SYKA 4KBKA 2VU3A 4U8ZA 2WTKB 1IG1A 1K2PA 3I79A 4XMOA 3UBDA 4BZOA 5L2SA 5KE0A 3MFSA 3QX4A 1LPUA 4RIXB 3I7CA 2DQ7X 2YIWA 4MQ1A 4UZHA 3CC6A 3O51A 4U9AA 3U4WA 5I3OA 4AOIA 2JD5A 4XNEA 3ZS5A 3QCSA 2WMSA 3ORNA 3F2RA 2YIRA 1STCE 4DT8A 3ENHA 2EUFB 4GRBA 3MY5A 3V5PA 3NNXA 2G15A 4L7FA 4F6WA 3TNQB 3UVRA 5E4HA 4BGQA 4R5SA 2R2PA 2C68A 1H0WA 5C4KA 2RG6A 3TUDA 1MUOA 4N6YA 2FSLX 3QWKA 4RMZA 5DRBA 2XUUA 5HEZA 5AA9A 3QA0A 4DT9A 3BE9A 4N70A 4D2VA 4Y83A 4Y73A 3ZFYA 4RX5A 1H28A 3GOPA 3ZXTA 5FP6A 5JT2A 4IWOA 3EN4A 3TT0A 4ALVA 4QYYA 4C4FA 2YCQA 3NUXA 1OL5A 3QQHA 4UB7A 4JS8A 1Z9XA 3PJ1A 1J7UA 3EYHA 2BUJA 2Y9QA 4FOCA 4O86A 4L52A 2XNMA 3DBFA 3PXZA 5FBNC 5FG8A 3F3UA 5HO7A 2BAQA 2QI8A 4FV8A 3BV2A 3PA3A 4PNKA 1NT2A 5IQGA 1Y8YA 4I93A 5FRIA 2UW5A 1BYGA 1PKDA 4TYHA 1GIJA 3FZOA 3IQ7A 2C5OA 5G1XA 3HV4A 4QTAA 3DFAA 3W32A 3PPZA 3DA6A 2Q0NA 4FTTA 5CF4A 5AUUA 2BR1A 3AT2A 5IKWA 2WQOA 5FLFA 4BWPA 3S95A 5IA3A 4GT3A 1WBTA 2I0VA 4DCEA 3WZDA 3WE4A 3E87A 4DEIA 4YO6A 5H9BA 3UZTA 2B9FA 1GIIA 4W4YA 4BGGA 1O6KA 2QR7A 4MNEB 2CCHA 1JSVA 4EK3A 5EW3A 2WU7A 1W82A 4WT6A 1H0VA 4BDEA 1KV2A 2CKQA 4F0GA 4NM7A 4X21A 3BRBA 5T6KA 4EYJA 2IW9A 4EH5A 2UZUE 2JKMA 3PVGA 4Y8DA 1XKKA 2GNIA 2XBJA 3MV5A 3Q53A 4RJ3A 4ACDA 4CV9A 2CKEA 2B53A 5I5ZA 3SRVA 3WARA 4LL0A 4WG5A 2YM7A 4RZVA 1YWRA 3ZYAA 4QMSA 1P14A 1K9AA 2DUVA 4GK4A 4IZAA 3OOGA 5CSWA 4EWQA 3JXWA 5AUTA 4NH1A 5HU9A 1H1WA 5EQPA 5M51A 2IVSA 2OH0E 2PMLX 2W7XA 4XBRA 5C8KA 2O5KA 2VTHA 3GC7A 2OXXA 4JXFA 4O96A 4ZEGA 4IB5A 2WTJA 4V05A 3KXGA 3SLSA 5F1ZA 4J96A 3DXPA 4HGTA 4MD7E 3LQ5A 2BIKB 3UNJA 1XHAA 4UZDA 2FH9A 4E93A 4ORKA 2HW7A 2ZYBA 5CU3A 5AV1A 5EYMA 3W1FA 4BTFA 4FIIA 2RG5A 1WAKA 3UVQA 3R1QA 4IVDA 3AMAA 2REIA 4PQNA 3MDYA 4QP1A 1XH8A 4Z55A 2F9GA 3I7BA 3QKMA 1DAYA 4N57A 1RDQE 1MRUA 2HY81 2UVZA 4R3PA 2G2HA 2QVSE 5AJQA 3S00A 2ESMA 3EQPA 3OROA 5C8NA 4CYJA 4ZJJA 3R01A 3D2IA 4P4CA 2VX1A 4NKSA 5IEXA 4IAIA 3NUAA 2BCJA 1VYWA 3QHWA 2O64A 4PV0A 3OWPA 4NJDA 3CP9A 2YDJA 3FPQA 4CYIA 4TL0A 3DNEA 5JN2A 3F5GA 3H30A 3P86A 4YJVA 4AAAA 4NW5A 4D55A 4RVLA 5EYDA 4F08A 3BU5A 1RW8A 2PPQA 2JIVA 3W2SA 3P79A 2G1TA 5DA3A 4OUCA 5DOSA 4KSPA 3F2NA 2C69A 1GZNA 3D0EA 4AW0A 4YU2A 2QO7A 3ODZX 4FL1A 4PNIA 3KXZA 4C4JA 4RT7A 2XIRA 5BVKA 4BICA 2F7ZE 5F95A 1JVPP 3DK6A 5F20A 5HG9A 2UUEA 4I0SA 5M4IA 4BIEA 4XP3A 4E6CA 3ZLWA 2UW4A 3Q9WA 3BIZA 3VF9A 2W1DA 1ZOHA 2V7OA 1U4DA 3HLLA 2YWPA 4GYIA 3IGGA 3IKAA 4NIFA 2BKZA 3DAEA 2HK5A 4GJ2A 5DRDA 4DFXE 3FMNA 4IZ7A 3ZH8A 1B39A 1PHKA 3G6GA 3SG8A 4NCTA 1OIUA 4I5HA 4F9WA 2VWVA 4FIJA 1NXKA 3P7CA 2BAKA 4ALUA 4BBFA 4FV9A 3KEXA 4QT1A 5I3RA 2X8EA 1BI8A 3CGFA 3MB7A 5L3AA 3FI4A 4FSWA 5EYKA 4DA5A 4RJ6A 1SVHA 4PDPA 4FL3A 2GU8A 1TQMA 3MFUA 3MFTA 3H9RA 1DI9A 2F2CB 5F9EA 5FBOA 3FI8A 4F63A 5CVHA 1U46A 1OIYA 3ZCLA 3ORTA 5KBQA 3SKCA 4MD9E 1WCCA 4IANA 1WVXA 3E63A 2OFUA 3H4JA 4KBAA 3HKOA 2A19B 4G3FA 1ZYCA 4I4FA 4MX9A 4CZYB 1IAHA 3Q2MA 4ZY4A 4NEUA 2WQEA 4WSQA 4BTJA 4MXZA 2B54A 2RF9A 2VTMA 3D15A 4M12A 4MHAA 5AP5A 5J8IA 4Z3VA 5I9WA 2LGCA 2YA9A 5HX6A 4IDTA 3RPYA 2IZTA 2VO0A 2XNNA 4IAKA 5FQDC 4BVUA 4HPTE 4DG2E 5DH3A 3RNYA 4DEBA 1TQIA 1UU9A 2W1IA 2XIZA 3SVVA 2VGPA 5GNKA 2QOFA 4R1VA 3JPVA 5E1EA 4ZY5A 4O1PA 1WBPA 2CN8A 3BYOA 2DYLA 2GDOA 2H9VA 2FA2A 2IVTA 2QOQA 2UZTA 4IAAA 4QTBA 5LMAA 5HESA 3VJNA 4EORA 5IA1A 5AP7A 4ZLOA 4ZTNA 4C37A 5JFWA 4ZMFA 3TACA 1PXLA 2Z02A 4F1TA 4ZS4A 3OOMA 4X2FA 3O23A 3O8UA 2WMXA 4IWQA 4WUNA 3R7EA 2ZMDA 4FKOA 3QRTA 4W4WA 2JKOA 1H24A 4D1XA 4K0YA 4B7TA 3QC4A 3R9RA 4JR3A 3HX4A 4L8MA 3BI6A 4FT9A 4RJ4A 3MESA 2PVYA 4FKVA 1F0QA 1FQ1B 4GFMA 4XEYA 4F9AA 5A4TA 1Q4LA 4E5AX 4RIXA 4ZZNA 5AP1A 1PXPA 3GNIB 3QD2B 3CR0A 2OWBA 5J95A 5AX3A 4J95A 4MEDA 2R64A 4C57A 3RPRA 2ZB0A 2R3LA 4C2WA 3R0TA 4CKIA 2X0GA 3UPZA 3A2CA 1Y57A 2IG7A 3IDPA 4BWXA 3UJGA 3JR1A 4YP8A 3D4QA 1P2AA 3ZONA 2Z2WA 3BHTA 3VBVA 3RVGA 5E8ZA 4EK8A 2BFYA 5E1SA 3IW7A 4FA2A 4JAIA 4AZFA 4YJSA 3TNWA 3FMEA 3QYWA 5ANDA 4EJ7A 5CQWA 4FEUA 3HP5A 5H8GA 4IX4A 3R1SA 3EMGA 2ONLA 5DBXA 3UTOA 3RZFA 4EUUA 4RX7A 1BLXA 1ZY5A 3C4XA 3ZZWA 2P55A 4RC4A 1QPDA 5C26A 3FYJX 4ZJIA 5J79A 4BB4A 2YIXA 2OJFE 4L9IA 1ND4A 5D7VA 1XQZA 1OI9A 3TJDA 4B99A 4Z9LA 3E7VA 3PA5A 4TPTA 2WO6A 3QCYA 5CY3A 4QMXA 5DR2A 3E8CA 1GZKA 3R7VA 2R7IA 4KRCA 3NAYA 4Z7GA 4O7ZA 2CN5A 1LP4A 3WYXA 1KE8A 4NT4A 1CTPE 2VX3A 1H8FA 1GY3A 4O6LA 4RVTA 1OKYA 3GU6A 3KN5A 5JRQA 1U54B 2VAGA 4QMTA 2C6IA 2R4BA 4RWIA 3P78A 4XRLA 2C5VA 4LGHA 1FBNA 4TTHB 2UV2A 5HG8A 3BEAA 2X1NA 4YJUA 3MPMA 3WZJA 1M7QA 4C4EA 3MW1A 3EB0A 2JITA 4P5ZA 4ALWA 4HGSA 2C6MA 4TWOA 2XK8A 4GJ3A 4MNEA 4CMOA 3DBEA 3NCZA 3P9JA 4OBQA 5KNJA 2YITA 2GNHA 3E88A 4U5JA 4TT7A 1OKWA 4RLKA 3TNPC 4OTRA 5HE0A 2OLCA 4U80A 4G9RA 3O71A 3H0ZA 5HNBA 3KC3A 3ALNA 3LXNA 3O8TA 4PTEA 4AWIA 2X81A 4BCFA 2C1BA 4EQCA 3OEZA 1R0EA 3FPMA 4K11A 2Y0AA 3WOWA 3ZRLA 2WMBA 4AUAA 4QOXA 4QNAA 4I21A 2OZOA 4IEBA 5IA5A 2XKEA 3VUHA 3WZKA 5ICPA 4GYGA 2V5QA 5DFPA 5HE3A 4L53A 4BCJA 4U7ZA 3Q2JA 1Q62A 3I5ZA 4FUYA 4AW5A 4UMTA 5FEDA 4MBJA 1Q8UA 3AGLA 3EWHA 3HMIA 2BZJA 3K5VA 4K6ZA 5DE2A 4AA4A 2WFYA 2BRGA 4DGGA 3L9LA 2PWLA 1G8AA 3GGFA 2ZDTA 4DG3E 4G2FA 1HOWA 3Q5ZA 4OGRA 3VW8A 2W9FB 5CSHA 4E1ZA 4FGRA 3V8TA 5E90A 4IX3A 3ZM9A 1OKVA 4NWMA 1UNHA 1UNGA 4KRDA 2C6EA 3WZUA 4L44A 5JGAA 4R78A 5K3YA 4O7TA 5HCXA 2EXEA 2FSMX 3BHUA 3QYZA 4FKWA 3F7WA 3RHKA 3W2OA 5J9ZA 2WOTA 4MTAA 2R3RA 3ALOA 3PJ2A 2W5BA 1V1KA 3MI9A 3T9IA 4DYMA 2VO7A 3BYSA 4AN2A 2OZAB 5K0XA 2CMWA 2XK3A 2A27A 2HXLA 3VS3A 4F6UA 4ZLYA 4HPUE 5HBHA 4EOPA 4QMPA 4F4PA 4L67A 4GW8A 4D2PA 3W2QA 4F99A 4QPSA 3OF0A 4DH3A 1APME 2Z7RA 3FQSA 3PP1A 3HMOA 5LCJA 5BQ0A 4FK3A 4I4EA 5AEPA 4PMPA 1LEZA 1V0BA 4JDJA 3CJGA 4QYEA 3VAPA 1XH7A 2BHHA 3DXNA 5ETAA 4B0GA 3VVHA 1J1BA 4FODA 5KUPA 3Q6WA 4PDSA 4MKCA 5EHYA 3VRZA 3E93A 3QFVA 3RPSA 4BFMA 4CMTA 2XK4A 3KY2A 5HLPA 1UVRA 3U9NA 4JX7A 4QQ5A 3RAWA 3LKMA 2C30A 4R7HA 4ANLA 4FBXA 2XK9A 5FGKA 3FKLA 4EI4A 2ERKA 4C3RA 4HZRA 2WHBA 3DFCB 5EI8A 3H9OA 4DLIA 1RJBA 4TYHB 4QRCA 4FKIA 2YLEA 4HNIA 4E6AA 4RBLA 2C6KA 5CXHA 3FZRA 2J2IB 3Q4CA 3PJCA 3OCSA 4ANOA 1WMKA 3GQLA 2YIYA 2VWYA 4AZEA 2CNUA 4L3LA 1GJOA 2VTIA 2VWWA 2VTOA 2WEVA 2YJSA 3DBQA 3RALA 3W33A 5CEPA 1FVRA 4YJTA 2HZ4A 4JRVA 2EU9A 2JDTA 5EKOA 3R30A 4RGJA 4BDKA 4P90A 4FOBA 5AUXA 4M7IA 4R7IA 3EQDA 2DWBA 3UODA 3C5IA 3PJ3A 4OT5A 3DBCA 3GC9A 3NPCA 3GENA 5CNOA 5J9LA 1OL7A 3LQ3A 3VJOA 4L68A 5M06A 2I40A 4XG3A 3GFWA 1YOMA 3LCKA 3UP7A 3UIBA 1H01A 3IW5A 3DLSA 5ETIA 3ZBFA 4EOKA 5LARA 4MAOA 3DU8A 3ZM4A 3RM6A 5IISA 3EL7A 2R3QA 2UZVA 3NUUA 4YGAA 2P33A 3RAHA 3VWAA 2YZLA 5CZIA 4RIWB 3TN8A 5DT0A 5FM2A 1Q24A 5CEMA 3REPA 2ITXA 4MYGA 5L2WA 5HVKA 2CGVA 2R3PA 2WMUA 5CS6A 3R7YA 2R3NA 3QXPA 4YHJA 4DAWA 3MJ2A 3NAXA 4WG4A 4BCHA 3ORLA 5DI1A 1GIHA 3LCSA 5TOZA 4C0TA 1T45A 4FEVA 4TWPA 3TI1A 4YLJA 4LRMA 3UP2A 4RFMA 1KOAA 4CNHA 2EB2A 2G2FA 1W0XC 3CY3A 4D58A 3FQEA 2RFEA 1UKHA 3DKGA 4TNDA 3HA6A 4G6LA 5KMMA 4ZIMA 4BCPA 4CLIA 4PTGA 1LUFA 3OUNB 4XS2A 4YR8A 3C9WA 4ZLZA 3ZFMA 5FTGA 3M1SA 4U45A 4P7EA 1YXTA 2YZAA 3HMMA 3VBXA 4FSTA 3K5UA 5FUTA 5BVNA 3A8WA 3LFBA 1QPEA 3MA6A 5A4QA 2J90A 3F2AA 3W18A 2DS1A 3KGAA 2I1MA 3LFEA 3MIAA 4D28A 2PL0A 3TM0A 1BL6A 1KSWA 2OJJA 1F3MC 1R1WA 4CVAA 3UO4A 5LMKC 3NVMB 4JI9A 3L8XA 3MWUA 4UMPA 3P7BA 4HVGA 2ETRA 2W1ZA 2JEDA 4IB0A 3P1AA 3A60A 4ZTQA 2AUHA 3OW4A 2CLQA 4M69B 3IPHA 3D5WA 3TCPA 2CHLA 3HP2A 5DNRA 3R2YA 4APPA 4GUEA 3ZZEA 4G31A 4EKLA 4BY9E 3Q6UA 3ORPA 4EH8A 3VS1A 2JAMA 4IFGA 4GMYA 3FC1X 4O2ZA 5AUWA 4O22A 3GC0A 3IOPA 3LLTA 4BCKA 5DR9A 5HI2A 4FIEA 2WB8A 2ERZE 1WBWA 4IMYA 4J52A 4M67A 4AX8A 4QMQA 2Q83A 4MBIA 4NZWB 1JKTA 4O82A 4O0WA 1UU8A 1U5QA 4F9CA 2WQNA 4IQ6A 5D1JA 2BTSA 4NW6A 2SRCA 4AZSA 4YZDA 5HKMA 3QTRA 5GZ8A 2XM9A 3A7GA 3E64A 3G5DA 2BALA 4I22A 3WIGA 3UQFA 4RA5A 3V8SA 4YLLA 3DZQA 2HY0A 4FV4A 4F9BA 4DEAA 4DFBA 2BDJA 3KA0A 3IW8A 3L8PA 3NUYA 3HGKA 3QD3A 4IX5A 4M8TA 5AP6A 1FGIA 3LE6A 2PULA 2Q0BA 5HCYA 1YI3A 3F5XA 3D9VA 3ZRKA 2B52A 2QG7A 4JG8A 4V04A 2OFVA 5M53A 1W83A 1MQBA 1DAWA 4QMLA 2E2BA 3AXWA 4YBKA 4WOVA 3NSZA 3C51A 3DJ7A 4YTFA 2B0QA 4I6HA 4HNFA 1MQ4A 4EH9A 3F82A 1O6LA 2ITUA 3EN7A 5K0KA 2YM3A 5DYJA 2RL5A 3UOJA 4O2PA 3BWFA 1ZOEA 3CEKA 4RG0A 4D1ZA 4RWKA 3A7IA 4OTFA 3R7OA 3R22A 2PZRA 3MSSA 3EOCA 2X7FA 3UO6A 4BKZA 3COHA 2QU5A 3PIYA 4JDKA 4FTNA 1PYXA 5BYLA 2P3GX 2BZIB 2WMRA 4ZTLA 2PVKA 3LFCA 5KHWA 4UWYA 5EW9A 5KMNA 4O38A 5EK7A 4L01A 4D2RA 4FV5A 4GU6A 2W0JA 3R00A 4BDGA 4OLIA 3KCFA 2YAKA 2PUPA 2F7XE 3RK9A 5D41A 4O1OA 3GVUA 2WEIA 1CKJA 4BDBA 4LMNA 2F2UA 4FG7A 4QP3A 4E7WA 5ANEA 3OXIA 1H00A 3AC3A 5EHOA 3UIMA 4ZP5A 2AC3A 3ZC6A 3CPBA 4IC8A 2UZOA 2X9FA 2ETKA 4QYFA 4CV8A 4JG6A 4CFWA 3OBJA 3OY1A 4W8DA 3HZTA 5EYCA 4XHKB 5BX0A 2CJMA 4FIGA 5M4UA 3OZ6A 3MIYA 5LOHA 4OT6A 1JSTA 4PP7A 4XBUA 3FMLA 3H3CA 5CSPA 4DE4A 1OPLA 5JEBA 5C01A 3UC4A 2PZIA 2XRUA 4FMQA 1YI4A 4IH8A 3ZDUA 4EOSA 3FMDA 4FNWA 3ROCA 2OICA 2IZRA 5DMZA 4FSMA 1G3NA 4BDCA 2XNGA 1O9UA 5DEYA 5FXSA 3KMUA 5IQAA 4ZAUA 2JDSA 2OZAA 4TYEA 3ZRMA 4DFZE 5AM6A 1R3CA 3FQHA 3KULB 1OUKA 4CD0A 4U42A 3UGCA 3R9DA 3FZTA 3R7GA 4FZAB 4J97A 3KXMA 3TZ8A 5DIAA 3U6JA 4BHNA 4GKHA 4G5JA 2UZEA 2WPAA 3G90X 4AT4A 4W9XA 3OG7A 4AF3A 5L2TA 1TKIA 5BUIA 4USFA 5F4NA 3ZTXA 4KINA 3RK5A 1I44A 4UBAA 3V5QA 3KK8A 1B6CB 5CEIA 4D4VA 2QOOA 4FKUA 4O91A 2C3KA 2UZLA 2WTWA 3E8DA 3TKUA 2RFDA 3IECA 1XR1A 4HVDA 3DB6A 3SDJA 3Q04A 3MGYA 2VWIA 4DFNA 3PVBA 2QO2A 2QURA 3NNVA 4BDAA 3LFAA 4LMUA 4YTCA 3VS0A 1YOLA 4DFYA 2QQ7A 4AW1A 4ASXA 3TTJA 1V0PA 4TW9A 1OPKA 2YDKA 4HGLA 3GUBA 3KL8A 3NRMA 4LOPA 2HZ0A 2PMNX 4DTKA 3QTIA 1WVYA 3IO7A 5TO8A 4I5MA 5HICA 3VS7A 3SG9A 3A61A 4F1MA 2V62A 1L3RE 2BRBA 4F0FA 4GKIA 5AFVA 1CDKA 5GINE 1OB3A 2J51A 4CFXA 4B8MA 1OITA 4E6QA 3BLQA 4JT3A 2CLXA 1W84A 2XCHA 4FEXA 3MH1A 4PMMA 1YXSA 4LGGA 2E9UA 3H9FA 5L2IA 3EHAA 5CEOA 1OL2A 3CPCA 4ANNA 4E4LA 3TDWA 5IQFA 2J0IA 3WIKA 2OI4X 3NIZA 4IVAA 4F65A 5FTQA 3SXSA 4D2SA 1R0PA 3E5AA 4FT0A 3ZBXA 3WBLA 2OKRA 4RIWA 4APCA 3NIEA 4JBQA 4I6QA 5FXQA 3R04A 3UYTA 3ANQA 4IWPA 2C3LA 3P4KA 4WRGA 3CD3A 1WFCA 3TZ7A 3WF9A 4FV0A 4AN9A 3ZLXA 4JIAA 3GP0A 4FTMA 4PX6A 1VEBA 4ZZOA 3VBQA 5CU0A 4QP9A 5IQIA 1Q8WA 4WSYA 4WA9A 3LCOA 3TZMA 3UOHA 4YHFA 4C58A 3JUHA 5CF8A 1SMHA 4WUAA 3FY2A 3NYOA 4KIQA 4OTDA 4QMYA 5CT0A 4U81A 4E5WA 4X2JA 5A4CA 2QC6A 3A7JA 4ZTRA 3GCUA 2PVRA 3FLNC 5C9CA 3PXFA 5ANGA 4EK5A 4R6VA 2BMCA 2BDWA 4TY1A 1FVTA 4YO4A 2Y6OA 3GXLA 1UU3A 2VTRA 1JKSA 2R3HA 4L3JA 4BI0A 5ITAA 3QRUA 3W2RA 2RSVA 4FYNA 4AOJA 5JFSA 2QO9A 2O8YA 5DHJA 2UW9A 4PUZA 4U3YA 5E8TA 3V6RA 4YURA 3UG1A 2BDFA 4K8AA 4R7BA 3Q4ZA 4HYUA 3NLBA 3NDMA 4M66A 4J99A 3OS3A 2JFLA 3D7TB 2X8IA 1P5EA 4X3FC 4A9SA 4M69A 5BYZA 3O8PA 5DG5A 4XX9A 3R7IA 1FVVA 2UVXA 3PWYA 1YXUA 2R9SA 4JQ8A 4RJ5A 2ZOQA 4XOZA 2HCKA 2W1HA 1U59A 1M2QA 3EZRA 2VNWA 4FV1A 1FINA 4WNKA 3RM7A 4YPSA 4ERKA 3Q9XA 3C5UA 4PL4A 4EHGA 3NEWA 3EQBA 5DWRA 2ITOA 5L8LA 5C03A 4G3GA 3PY0A 4F6SA 1G5SA 3EQCA 2OJGA 3PJ8A 4O7SA 2ZAZA 4X3JA 5HIDA 4G6OA 5JFVA 4EOQA 1FPUA 1IASA 4FKQA 4FKTA 4YZCA 1GZOA 3KXHA 1LEWA 3OY3A 4XCUA 4MF0A 2IWIA 3KRXA 2ZV7A 4QQTA 5I9XA 1ZXEA 2IW6A 3Q4UA 3OFMA 5JSMA 3KFAA 4XV3A 3MPTA 4C4HA 1OBGA 5L6WL 3IG7A 3OXTA 1YVJA 3LM0A 4FZ6A 5CX9A 4KKHA 2PVMA 4KABA 3EH9A 5E8XA 4NYEA 5E8WA 4BGHA 3V04A 4N0SA 4FG8A 4L42A 3VO3A 1PXKA 4U3ZA 2CNQA 3DV3A 2GQSA 4F0IA 3BPRA 5HX8A 3VN9A 4YPDA 4U0IA 2OIDA 3LQ8A 4CKRA 4NM0A 4H1JA 4G3EA 3NCGA 3PVUA 3KRWA 4PPAA 4QP7A 3LFQA 3TUCA 2UZWE 2QOBA 3HL7A 4YJPA 4ENXA 3BQCA 4MXXA 5KMOA 1NVQA 4QMVA 4WRSA 3AC4A 3QUDA 3VIDA 4G6NA 4MXCA 5KCVA 4R5YA 5L4QA 2C5YA 5DT3A 4FL2A 4JR7A 5CF5A 1Q8YA 2QLUA 4IXPA 4RC3A 2C5XA 1Q61A 4CQGA 3NR9A 3BKBA 1WZYA 4M0ZA 3D2KA 3F5UA 2C3JA 2WOUA 4O0RA 4AS0A 3H0YA 4JDIA 1LR4A 4C8BA 5E8SA 4RQKA 4KIKB 5CQUA 3ENMA 5BVWA 4FIHA 5KZIA 2HWOA 4ZSEA 4NTTA 2WNTA 4D2TA 5EW8A 4CZUA 5C4LA 3ROYA 5FEEA 2RKUA 4K33A 4E3CA 1QMZA 3RTPA 2XIYA 4CRSA 5HU3A 5IH5A 2BVAA 3QC9A 3VNTA 3QKLA 3GU8A 4XLIA 1KWPA 3ZSHA 3KMWA 5AR7A 5KKRC 3NNUA 2VD5A 2W99B 4EH4A 4AE9A 3TUBA 1FGKA 1H4LA 2XP2A 3V5TA 2PSQA 3D94A 1SVGA 2GTMA 3OT3A 5EDQA 1YWNA 2RGPA 3UOKA 4UMUA 4FZDB 5HOAA 3TEIA 3ERKA 4IJ9A 4Q9SA 4Y5QA 2VUWA 4OBPA 1I09A 3N51A 4BZNA 3V5JA 1E9HA 2R0UA 4EBVA 3AQVA 3OMVA 3Q9YA 3HV3A 2V0DA 4AACA 2YM4A 3KULA 4X6QC 5CWZA 4IJPA 1YKRA 5CI6A 2GNFA 1UKIA 4FTLA 4ITHA 3FMMA 5ETCA 3RZBA 4OAUC 4HCVA 4ANMA 1NW1A 2R0IA 4IVBA 3AD4A 3W8QA 2XNPA 3BWJA 3G0EA 3DAJA 5EM7A 3CIKA 5I9VA 5HGIA 5I9UA 2FO0A 3CQEA 4TN6A 3DJ5A 3WILA 3G9LX 2Y4IC 5LVPA 3IONA 4GEOA 4KB8A 2XM8A 2YIQA 5M44A 5B2KA 4GFGA 1OZ1A 4AZVA 2YM6A 3T3UA 3EFLA 4MVFA 4CEGA 1Q41A 4O21A 3QRKA 4H3BA 3A7HA 5KX8A 4I6FA 2R3MA 5BMSA 4ZK5A 1M52A 3O17A 2C5NA 1REKA 2FSOX 2YCRA 4GG5A 3PDTA 3TXOA 4ZOGA 3OD6X 3RWQA 3COMA 4KSQA 4ZS0A 4EWHA 2B4SB 5KHXA 1YDSE 2B7AA 2BROA 3FE3A 2IZSA 3BLHA 3L1SA 5GJGA 3EN6A 4JLCA 3RAIA 3ZLYA 5HTIA 3NYVA 5HO6A 2KULA 3GU5A 2WTVA 5TT7A 4BN1A 4V0GB 4CXAA 3L9MA 3C4FA 4RX8A 2X6DA 4TNBA 3CGOA 2RFNA 3RKBA 5G6VA 2W05A 1PYEA 3RNIA 4BI2A 1WBVA 4IC7A 2XJ0A 4WNPA 3TNHA 2IVVA 4JOAA 4CZTA 3MJ1A 5AP4A 4DGLC 1ZARA 3DTWA 5JK3A 1JLUE 4UMQA 3KVWA 3AT4A 3U6IA 3OWKA 3R8PA 3EIDA 1VJYA 3BBWA 4RC2A 5KO1A 2YM5A 4QP8A 1DS5A 1CSNA 1XH9A 3QLFA 4HZSA 3HRBA 4JQ7A 3RWPA 3MYGA 1PRYA 5LVOA 3N4UA 2V22A 4PP9A 1M2PA 2CPKE 1M7NA 4WHZA 5D9HA 5M09A 3NNWA 2ITYA 3CCNA 4PDOA 3FXZA 3KRJA 2JDRA 4UALA 1W8CA 3BHYA 3PLSA 4LRKA 4FVQA 4M3QA 3DNDA 1Q3DA 3FJQE 1OECA 3COIA 4J98A 2GTNA 2VTNA 3U51A 4A4OA 4CFMA 2WTCA 2Y7JA 5IUGA 3S1HA 4QTEA 2R3GA 3GFEA 2G2IA 5GJDA 3VULA 3FMHA 3NVKI 2GQGA 2OJIA 3UMXA 2XEYA 4FG9A 3QTWA 4J1RA 2VWZA 5K5XA 3AOXA 3ZO2A 2VTTA 2WTIA 4O0SA 3EL8A 4JBVA 4KIPA 3QQGA 3U8WA 4EQMA 4USEA 1H1PA 2G01A 3D5XA 3UMWA 5IA4A 3R71A 1PMVA 4QD6A 1H1QA 2OXYA 1YI6A 4KS8A 2WQMA 2YACA 1QL6A 3KB7A 4FKLA 3TWJA 3MH0A 1FMOE 3R28A 5HHWA 5AAGA 3BHHA 5GIPE 3CTHA 4FSNA 1DM2A 3B8QA 2ITPA 3CKXA 3LJ1A 4UX9A 4FIFA 5IUIA 4BBMA 4KIOA 2W96B 5JGBA 4C36A 4AZWA 1OGUA 2EWAA 2OW3A 3HNGA 3V5LA 4OTQA 4IZYA 1YDTE 4EQUA 2YWVA 4FV2A 2FGIA 3UQCA 5CALA 5CEKA 1PMUA 5L6PA 3AD5A 1SM2A 2WKMA 3DKFA 3OHTA 3CTJA 2X7GA 3PVWA 5AAEA 5LJJA 3F66A 3SHEA 5A4LA 5AR8A 4FK6A 3BYVA 4HCUA 4W9WA 3L8SA 5DVRA 3UQGA 4IM2A 5M57A 2XH5A 2X7OA 4RFYA 4Y46A 5ANOA 3BCEA 3GCQA 3POOA 4EBWA 4CGAA 4E4MA 5CNNA 5K4IA 3D7TA 3NW7A 4HVIA 4FE2A 2QKWB 3CKWA 4PPCA 3FXWA 4U79A 5EQYA 3UZPA 1JKKA 3C7QA 4DG0E 2UW8A 5BPYA 4UN0C 3FKNA 2C3IB 5EFQA 5HNIX 3II5A 3KK9A 2B9IA 3FXXA 3VBWA 3BGZA 4WD5A 4IACA 4J53A 1FMKA 1KV1A 4FGBA 4IZ5A 1ZLTA 4WNOA 3E3PA 3SXRA 2PZPA 3TIYA 4BYJA 2XIXA 3E8NA 4KKGA 2WTDA 3POZA 2Z7QA 4BCIA 4F7SA 4RZWA 3A7FA 3M2WA 2A2AA 3GU4A 2ZV9A 4YZBA 5HD4A 5ANKA 2X2KA 1OIRA 3KN6A 4Q9ZA 4E4NA 2X2MA 1PMNA 3DB8A 4TWNA 4GSBA 5CAUA 5FXRA 1UV5A 3LM5A 4H39A 5AWMA 5LVMA 4ZSLA 4DH7A 2ITZA 1OL1A 3ZC5A 3I0OA 1XH4A 3VBTA 4CT1A 2PUIA 4ASZA 2WMQA 4ONAA 5CU4A 2ITVA 3LPBA 5HNGA 4C35A 2E9OA 2YLFA 2Z7SA 2WD1A 4YNEA 3HEGA 4TYGA 5AV0A 4C4GA 4GIHA 5J5TA 4C33A 4H36A 3F6XA 4Q5EA 4A07A 5HLNA 3C13A 3KMMA 5EM5A 3Q32A 2XJ2A 2AYPA 4RX9A 5IH6A 1YW2A 3AC5A 5DPVA 3SAYA 3BELA 4BIBA 4EOJA 4EHVA 1Q5KA 2IVUA 2YCSA 5EI6A 3PSBA 1J7IA 4GT4A 3VUIA 2CKPA 3UVPA 2F7EE 3DCVA 3ULIA 3C1XA 4JAJA 3QQUA 3ELJA 5HIEA 3VC4A 4FICA 2OGVA 5HBJA 5TR6A 5BUEA 3LJ0A 3MA3A 4UXLA 3R83A 5KMIA 5E7RA 2JKKA 2O0UA 2XBAA 1CKIA 3E92A 1JAMA 2HYYA 2YM8A 3FAAA 3RJCA 3QAME 3QQLA 5B2LA 2VTQA 3S3IA 3PA4A 2ZV8A 3UC3A 1XBBA 2UVYA 4BDFA 2CSNA 2WMVA 3WF8A 4FZFB 2UW3A 2V55A 3GC8A 4DITA 4G17A 3ZFXA 4LQMA 5IDPA 5IZFA 2A0CX 3DLZA 4N6ZA 5CAQA 4KIKA 5M07A 2XIKA 4E5BA 5EDPA 1UWHA 3KVXA 5L8KA 1WBOA 3LFFA 2FYSA 3F69A 1DI8A 4GT5A 3AC2A 3BHVA 4EYMA 2GQRA 2XB7A 4WBOA 1L8TA 4J71A 2PVLA 2UW6A 3ACJA 4A4XA 3FYKX 2C6OA 4LUDA 3RP9A 3U9CA 1JSUA 3E3BX 3PFQA 2PVJA 3VW6A 1RQQA 1WBSA 1QPJA 2WGJA 2XKDA 3EFWA 3HMPA 3Q9ZA 1ZMWA 2I0HA 2R3KA 3QX2A 4I0TA 4K18A 4AQCA 5JZJA 1F5QA 4DGNA 4EH6A 1J1CA 2WIPA 5CAVA 4I23A 3IW4A 1ZRZA 2J7TA 5EQEA 3G15A 2R3JA 5DGZA 4CCUA 2YABA 3OCGA 5BVFA 3EQIA 4Q2AA 4BDDA 4NL0A 3UDBA 4UWBA 3UOLA 3DOGA 4EC8A 1PXIA 4F7NA 2XNOA 4QMNA 3SA0A 4E73A 2YFXA 2X4ZA 2I0EA 1PF8A 2QONA 5IH4A 2PZYA 3QZFA 1R39A 5CZHA 5AR2A 5ACKA 4DN5A 2R3IA 3TNIA 2ITTA 3QTUA 4X0MA 4CCBA 4EOOA 5M56A 2WELA 3QGWA 3WI6A 4FSYA 4MF1A 3FLZA 5AP3A 4F09A 2BKKA 4AGCA 4CT2A 2WMTA 3DJ6A 1Q99A 1WBNA 4C02A 4LM5A 3PWDA 2ITQA 2ZDUA 2NO3A 2BPMA 1Q8TA 4I0RA 4OTHA 1OIQA 4BKYA 3PTGA 4YLKA 4O7VA 4P5QA 2VTLA 5HORA 2ZMCA 1MRYA 4WO5A 4HOKA 3RI1A 4YJRA 5JGDA 5CTPA 4L7SA 3EZVA 1OUYA 5EOLA 3OC1A 2C6DA 5CAOA 4RVKA 5BVEA 2QODA 1PMEA 4FX3A 3VRYA 2XVDA 1ZZ2A 3FC2A 3JS2A 3PZHA 4S33A 3VS5A 3ZUUA 3FZPA 3M42A 4MWHA 5FTOA 5ETFA 1V0OA 4V0GA 1PKGA 3G33A 4FSRA 3F3TA 2IPXA 4K1BA 4QMZA 4UEUA 4GG7A 4IE9A 4HYIA 2XNBA 4ZXTA 3SW4A 3DTCA 3KKVA 3PY3A 4TKSA 2RIOA 3KXXA 4AN3A 3NX8A 5CANA 3LFNA 4WKQA 3S0OA 1YHVA 3SW7A 4ZMEA 4BCQA 1PXJA 3MN3A 4PRJA 3M11A 3G6HA 1XO2B 3OEFX 1ZZLA 4KBCA 3GBZA 4YJQA 4EK6A 3C4CA 1H27A 4HYSA 2PUNA 4C59A 2W4OA 2OK1A 4X2KA 3W8LA 3QTQA 4AGWA 3PLAE 4AW2A 5CT7A 3BX5A 1NY3A 4FVRA 2JDOA 3QKKA 3C4EA
chains in the Genus database with same CATH superfamily
4YJNA 4KUJA 4W4XA 2CGUA 4IW0A 2YHVA 3BU3A 4L3PA 4PL5A 3G51A 3QUEA 4XV9A 3R8ZA 4XG7A 4DC2A 2F4JA 4AE6A 2CNVA 2VWUA 4IAFA 4LRJA 2GS6A 4FUXA 4WNMA 2YN8A 3TDVA 1XH6A 4J7BA 4EL9A 3TG1A 4Z7HA 2C4GA 1J3HA 3KRRA 4JQEA 5LWNA 4XRJA 4IFCA 3RCJA 1ZYSA 3F5PA 2PY3A 4KKEA 4NFMA 2J0KA 4AP7A 2W1EA 2C47A 4J8MA 4MWIA 3JVSA 1OM1A 3BZ3A 1S9IA 5A6OA 4LYNA 3FBVA 3SOAA 2J0LA 2ZV2A 4FVPA 4I92A 4ENYA 2P2IA 5BVDA 3IDCA 5LMKA 3V51A 4BTMA 2J0JA 3LXLA 3LMHA 3CE3A 3GCVA 2X8DA 1Q8ZA 5HE2A 3TL8A 1BI7A 3O7LB 4QO9A 4YNOA 4X3FB 5GZAA 1Y91A 4HJOA 1H08A 4H58A 2IW8A 2LAVA 3O0GA 2F57A 3NUPA 2VTAA 3K3JA 4TRLA 4Z16A 3DT1A 1YDRE 5C1QB 4ERWA 1YXVA 2B9JA 2Y4PA 3FI3A 3SC1A 2G9XA 2O2UA 2OG8A 3ETAA 4M84A 2C6TA 5CU2A 4B6LA 4DFUA 2QR8A 5H8EA 3T9TA 2JBOA 3BU6A 3PY1A 1A06A 1M14A 5H2UA 1ZAOA 3F61A 4OTIA 4C38A 3HMNA 4UXQA 3NW6A 3QTZA 2VV9A 2WIHA 4RRVA 3RINA 3TKIA 5LWMA 1TQPA 2BRMA 5D10A 3ZHPC 3CSVA 4RJ7A 2W5AA 2OBJA 2UW7A 4IB3A 4Q5HA 3G9NA 5AIKA 4CFVA 1PW2A 4EKKA 4YJOA 4K77A 2HIWA 5EDRA 3BEGA 4I94A 4DF3A 2Z60A 3R73A 3VONA 5AR3A 3V6SA 4LDTA 4LV8A 5AV4A 4R3RA 3I1AA 4AZTA 3VS2A 2GFCA 3Q52A 1KE5A 5HO8A 3RHXA 5D7AA 3TKHA 4KWPA 4XUFA 4DINA 4I24A 1JBPE 3BGQA 1ATPE 4YC8A 2O3PA 2F49A 3WF7A 5IQBA 5FWKK 4EH2A 3FLSA 4NFNA 4OTGA 4HCTA 4O7YA 2ITWA 3VS4A 4F9YA 1CMKE 2GHLA 4EOMA 3TV7A 2PTKA 4PY1A 4EH7A 2Z7LA 3DQXA 3QZIA 3OBGA 3R02A 5E8YA 4BDJA 2CGWA 2YCFA 4F7JA 2ZM3A 3FMJA 1OPJA 4ANSA 3HRFA 4PF4A 4BIDA 4C7TA 3UE4A 3CTQA 2QHNA 3TJCA 4F70A 2OIBA 3F88A 4IWDA 1FOTA 3ZDIA 2ITNA 1H07A 5HTCA 3EN9A 2J5EA 4ZSJA 2GSFA 4FNZA 2X4FA 2CGXA 3I5NA 4XG4A 2C6LA 2JC6A 3LJ2A 4F78A 4IADA 4M97A 2QD9A 5H3QA 4AOTA 2GNLA 3BL7A 4EH3A 3PIZA 3W0PA 3FKOA 3ZU7A 3NWWA 4DHFA 2PMIA 4OAVB 1BX6A 4II5A 4ZY6A 4GCJA 3EFJA 2PVHA 3QCQA 5HIBA 3B2WA 5AUVA 3D5UA 3DDQA 1JKLA 2JBPA 4FNYA 4UYAA 1XBCA 4IAZA 3A99A 3EQFA 1MRVA 5L6OA 3MVLA 4D5KA 3HVCA 4BYIA 4ITJA 5HBEA 2HOGA 3PZEA 4P2KA 4DGOA 1BKXA 5KKRB 4FT5A 4HW7A 5GIOE 5M4FA 4K9YA 3K54A 2A98A 5HVYA 3EQHA 5L8JA 3S4QA 3GB2A 3ZEPA 3PPJA 4JJRA 4QMOA 5IEVA 4TWCA 3VUKA 5I0BA 2P0CA 3VHEA 3MTFA 1SNUA 3PXRA 4QYHA 4A9TA 3PUPA 1PXOA 3IW6A 4FKJA 4WG3A 3HAMA 4A4LA 3FV8A 4A9UA 3R63A 4U43A 2OIQA 3QD4A 1W7HA 2HZIA 2FVDA 5I9ZA 2FB8A 4A7CA 5LMBA 4NCTC 5A9UA 5B7VA 4U97A 3MB6A 5EKNA 4C3PA 2FUMA 2HW6A 2EXCX 3AG9A 5TF9A 5CLPA 4NUSA 2XEZA 4QNYA 2P2HA 4FSZA 3ORZA 1P4FA 3LMGA 3NYXA 4GS6A 4M15A 4OTWA 5A3XA 4FEWA 2Y4IB 2J4ZA 3FZ1A 3GT8A 3LCDA 1QCFA 5AAFA 3SX9A 1O6YA 4Y95A 4ZTSA 3W0RA 4TYIA 1ZYDA 4ACGA 2XNEA 4E8AA 4L43A 4FV7A 4A06A 4IAYA 4NM5A 2QOCA 1YOJA 2XKCA 3KRLA 4S31A 2EB3A 5KMJA 5IG1A 3P5KA 5EI2A 4LUEA 4D4SA 4G3CA 4C2VA 1Y6BA 5EH0A 3CQWA 4USDA 2H6DA 1SVEA 1H26A 4CG9A 1BMKA 3QA8A 3LAUA 4QMMA 4D4YA 3IS5A 3HUBA 3QQKA 4XG2A 3UIXA 3R8MA 2P4IA 1ZYLA 4GK2A 5FD2A 3MH3A 4TZRA 3L9NA 5CAPA 2R5TA 4GH2A 2Z8CA 5JZNA 4CQEA 4GK3A 3R9OA 4RIOA 1A48A 2BTRA 3F3VA 3HUCA 3PXQA 3V5WA 3GQIA 4EZ5A 3VQUA 2OF4A 4O84A 3FWQA 1E1XA 2HZNA 3F3WA 2OSCA 3QQFA 1XBAA 4NM3A 4GUBA 4ACMA 2GFSA 1J91A 2OJ9A 2WMAA 3FLYA 5T3QA 4OR5A 2YDIA 3PE1A 3FL4A 3A4OX 4LFIA 4MBLA 3PSCA 5J5SA 3TV6A 4KA3A 2WTKC 3Q3BA 1XMMA 2X0OA 3T8OA 2VTJA 4QYGA 4YZMA 4FTAA 2BIYA 2NNWB 3JY9A 4CRLA 4B4LA 5IU2A 3NS9A 4MK0A 4S2ZA 4DHJA 3RBWA 2XK7A 3EFKA 4QQCA 5FP5A 4C3FA 2WXVA 1WVWA 2GHGA 4KS7A 5IQCA 4XG9A 3U55A 4YTHA 4C61A 2BZKB 2NRYA 4JRNA 4G5PA 2UZDA 4LL5A 2X6EA 3D83A 4H1MA 5HG5A 4ASDA 3NW5A 4Y72A 4HGEA 3FZSA 4PPBA 1NVSA 2VN9A 1QPCA 2QG5A 4OW8A 3S2PA 3TTIA 1W2CA 3BV3A 3I4BA 4FTJA 3LW0A 3CJFA 1JWHA 1T46A 2J6MA 4UMRA 3KREA 4RWLA 3U6HA 3R8UA 3BQRA 3I6UA 5CENA 4ARKA 4LV7A 3QF9A 4QTCA 1Z57A 2ONLC 3I81A 3ZMMA 5JKGA 4S34A 2WZJA 5CSXA 4BDIA 1TFFA 4NK9A 2XZSA 4UY9A 3UG2A 5CXZA 3R8VA 3C4WA 2BRNA 3GOKA 1Z5MA 3Q5IA 3QBNA 1OBDA 4AXCA 3CLYA 2UW0A 4F64A 1IAJA 2QOKA 5FDXA 3VBYA 4O0YA 4FSUA 4IX6A 4N4SA 4X7QA 4BHZA 3QRIA 3RAKA 3CXWA 2NPQA 2ZM1A 4BCGA 5HZNA 3QHRA 3W2CA 1GZ8A 2XYNA 3HV6A 4JBOA 4FZ7A 4BC6A 2W1GA 1KE6A 3DKOA 4GU9A 3AKLA 1OVEA 4X3FA 3ZO4A 2PE0A 4KAOA 4FT7A 1U5RA 2VTPA 5J1WA 1MP8A 3VUDA 4X6RA 3C4ZA 3LXPA 3ZSGA 3QGYA 1ERKA 3CY2A 4A9YA 4D5HA 4ZZMA 5BNJA 4MCVA 4GFOA 3HAVA 4JBPA 4QQJA 2IN6A 4D9UA 3Q4TA 4FKRA 4QP2A 2PE2A 3HRCA 2OH4A 1VZOA 3DZOA 4I5PA 2XCKA 3DPKA 4S30A 2XRWA 4IBMA 5T68A 1CKPA 2WMWA 3QTXA 4HVHA 3V3VA 2JKQA 4FV6A 4D0XA 4CFUA 3U4UA 1VLRA 2NYAA 1W2DA 3MVMA 4DEDA 2ZM4A 2VTSA 4D1SA 2O63A 5CI7A 5LVLA 4FTRA 4IHPA 5A46A 4L46A 5E9EA 2HAKA 5IMXA 3FDNA 1OMWA 3MY0A 2B1PA 4XP2A 5AV2A 5BVOA 4XG8A 3OP5A 4XV1A 3MH2A 5K9IA 2BZHB 4FEQA 4O0VA 4RJ8A 3EYGA 4TXCA 2RFSA 3O50A 2IZUA 3VHKA 2VX0A 3DY7A 4FTQA 3I0QA 3JY0A 4CG8A 4RIYB 1KE9A 4AT3A 5CU6A 3UNZA 2JDVA 3N4VA 4YTIA 5A4EA 3NZ0A 5CVGA 3P08A 1JQHA 1ZMVA 4XV2A 4MH7A 4YBJA 3R9HA 4C34A 2I7QA 3ORXA 4AXAA 2JFMA 4JG7A 2HELA 4FTIA 5BYYA 3EQRA 3FL5A 3UIUA 3DS6A 3PRFA 4A9RA 1URWA 4BZDA 2J9MA 4F7LA 1UU7A 1HCLA 2PHKA 2W06A 3EKKA 3IOKA 3A8XA 3QXOA 4EEVA 5M08A 5EHLA 3RGFA 3L8VA 4PWNA 5M4CA 2OO8X 3BYUA 2BRHA 4L45A 4NJ3A 3TIZA 3G0FA 3ZXZA 1IA8A 2VO3A 3BE2A 4ASEA 4LOOA 3P23A 3R1NA 4K2RA 5LXMA 2UZBA 1ZOGA 3AC1A 3ACKA 4FTOA 5CYIA 4AA0A 4DH8A 4NKAA 5AUZA 2I6LA 3FHIA 3PP0A 4O0XA 4RPVA 5AR4A 4E4XA 4LOQA 3ID6C 4B8LA 5IDNA 3MY1A 5JMSA 2ACXA 2QOLA 2YAAA 1Q97A 3LHJA 3W0NA 5A54A 3ORMA 3QWJA 1IA9A 4EHEA 4HVSA 3FLWA 5E8UA 5EG3A 2XS0A 2IO6A 3EQGA 5CVFA 3DQWA 3ZEWA 4TYJA 3VS6A 4M13A 4E26A 3NMUF 3BGPA 3IGOA 4G34A 4JNWA 1RE8A 5AMNA 2PVNA 2NP8A 3TZ9A 4QMWA 2W1CA 3E7OA 3HV7A 3EN5A 3IK3A 5E8VA 2QOIA 3PYYA 1B38A 5CASA 4JVGA 3V8WA 4DEHA 1PXMA 1ZYJA 5JRSA 2YJRA 4EJNA 3OUKA 2GHMA 2HWPA 3DK3A 3WF6A 5BV3A 3WF5A 3R1YA 4RVMA 5FEQA 2AC5A 4GIIA 4L6QA 3R8LA 2ETMA 3QL8A 2QOHA 3R7UA 3LXKA 2JLDA 2GPHA 3V01A 2EXMA 4ITIA 3R21A 4WBBB 5AM7A 1ZY4A 1YXXA 4G16A 4RA4A 2VNYA 3K3IA 1CM8A 3P7AA 2A1AB 2X9EA 3BBTB 3BLRA 4RSSA 5D12A 5HQ0A 2CCIA 5I4NA 4LG4A 4YC3A 3DK7A 3LVPA 3R9NA 1TVOA 2H8HA 4Y5HA 2X2LA 1SZMA 3HYHA 4EK3A 5HLWA 1XMLA 4O7WA 2W9ZB 3NGAA 4RLLA 1H25A 3IDBA 4BDHA 1KE7A 1P4OA 1REJA 4DH1A 4AGUA 4YZ9A 2XKFA 2W4KA 1YWVA 4MXYA 4XJ0A 1URCA 3B2TA 3OWLA 4BI1A 4KNBA 3N4TA 2NRUA 2QKRA 3VUTA 4BKJA 4DLJA 3Q96A 4MXOA 2YEXA 4NTSA 5A14A 4Y85A 3C0IA 4I41A 1Q3WA 1PJKA 4IDVA 4M0YA 2JIUA 4ZSGA 5M55A 2XA4A 3ODYX 3OXZA 3ITZA 4ANQA 4BCMA 5KBRA 1KOBA 2R3OA 3D7ZA 5CEQA 4D0WA 3KCKA 1NA7A 5JQ5A 4I5CA 4E20A 1Y6AA 4E6DA 3LMIA 3FSFA 2J5FA 5A6NA 2C0IA 5E92A 4EZ3A 3LFDA 4FTKA 3ULZA 4GL9A 2CKOA 1G8KA 5IPJA 3FI2A 2HENA 4QEBA 3KQ7A 4I20A 5J7HA 2PYWA 1H1SA 3C0GA 1UNLA 3MVJA 3ZUTA 3DDPA 2A4LA 4QMUA 3DGKA 3ET7A 5C8MA 3PIXA 4QP4A 4FKSA 3DBDA 3QQJA 3U87A 1H1RA 5J87A 3B8RA 5AV3A 3UYSA 3MBLA 4FI1A 4LGDA 2XJ1A 1S9JA 3F9NA 2B9HA 5IA0A 2JIIA 3OTVA 2W17A 3QCXA 4V01A 4IM0A 4XH6A 5GZ9A 3AD6A 3GI3A 2QHMA 5ACBC 4X2NA 4G1WA 4EHZA 3FEGA 3JYAA 4PDYA 3DKCA 5D11A 4EC9A 3T3VA 3ZO1A 2UZNA 3NUNA 3VQHA 4XYFA 3KF7A 4ZTMA 4O7NA 3KXNA 1JOWB 2EVAA 2GS7A 3OCBA 2QNJA 3EJ1A 1JNKA 4QTDA 3HV5A 4FNXA 5BMMA 2VO6A 4JDHA 3R2BA 5AIRA 5ANJA 5AP2A 3N9XA 4MXAA 3RCDA 3LCTA 3WE8A 4DEGA 3U54A 3QZHA 3MS9A 4RQVA 4YMJA 2B55A 4BWKA 5IQEA 3ZSIA 2AEGA 1W98A 4FC0A 4CLJA 2I0YA 2XF0A 4RFZA 5KMKA 1KUTA 3PXKA 5J9YA 3FHRA 3LZBA 3Q60A 5TE0A 4FR4A 5B2MA 4O6EA 3ZUVA 2YISA 1ZWSA 4QPAA 1AQ1A 3DXQA 2VGOA 3MFRA 4CTBA 3D14A 3CBLA 2O65A 5HE1A 2ZB1A 5IUHA 3NYNA 2BHEA 3THBA 4RWJA 4W4VA 3SXFA 1YQJA 2XMYA 4BL1A 4L00A 2W1FA 1J7LA 4CFFA 3ATTA 4DEEA 2WAJA 3ZLSA 5E91A 4O81A 4U44A 4OTPA 2OXDA 4G9CA 3RPOA 3W16A 4CFNA 3LOKA 3OVVA 2PVFA 4D2WA 4EUTA 1A9UA 5EM8A 5AX9A 1AGWA 5JFXA 4W8EA 4FKPA 3CQUA 3C0HA 4HYHA 3I6WA 4ANBA 3PSDA 2QU6A 3ZO3A 1ZMUA 3SRVB 4CMUA 1UA2A 3C50A 5IEYA 5K4JA 5AR5A 5EM6A 1E1VA 5F94A 5HG7A 1YHWA 2PZ5A 3QUPA 5CF6A 4IVCA 2R3FA 4MQ2A 5EOBA 4YUQA 2XYUA 5IA2A 4BCNA 4FTUA 3OTUA 3E8EA 2QCSA 5IF1A 1GOLA 2GNGA 3GEQA 5FM3A 5AA8A 3F7ZA 4LV5A 4FYOA 2W5HA 2ZVAA 2VWXA 2GCDA 1VYZA 2J50A 3A62A 4IIRA 4ZTHA 4ZJVA 3QD0A 4ZSAA 1HCKA 4YSMA 1IRKA 3E62A 3HDMA 3LFSA 5H8BA 3VF8A 3SD0A 3COKA 3HECA 3FY0A 4I3ZA 3AT3A 4U6RA 2JAVA 2PK9A 3PXYA 4IB1A 4EOLA 4XG6A 1M2RA 3QLGA 5KZ0A 4AAYA 3EKNA 5TKDA 3KF4A 2XK6A 5JH6A 1G8SA 3H10A 2VWBA 3OT8A 4M14A 4FF8A 4I1ZA 4DGMA 3HA8A 4DCAA 4MD8E 1AD5A 4FV3A 4AU8A 2H34A 4YSJA 1JPAA 5AP0A 3PPKA 2HXQA 5IQDA 3G2FA 4WIHA 4AG8A 4GVJA 4NU1A 3W2PA 5K5NA 3AC8A 3QTSA 4PMSA 5KMLA 3GU7A 5ANIA 5HTBA 3MTLA 3LIJA 1Y8GA 5LCKA 4AGDA 3UNKA 4RIYA 3MPAA 4GVAA 2JGZA 5L2QA 1VR2A 2Y8OA 4MNFA 5LVNA 3RK7A 1OKZA 4D9TA 4DTBA 3OCTA 4UYNA 4NSTA 4X2GA 2X39A 2J0MB 4R3CA 4AT5A 2OU7A 5C27A 3ATSA 3UO5A 4BF2A 2GNJA 3BYMA 4JL9A 3VUGA 5DN3A 3PE2A 3OWJA 4CKJA 3R6XA 4U41A 5DT4A 3PG1A 4ID7A 3SOCA 3PRIA 4FT3A 4YC6A 5HD7A 4R1YA 5JQ8A 4F1OA 2C0OA 3OW3A 3ORIA 3MVHA 5GHVA 4O7LA 1XJDA 2GMXA 4H3QA 4H3PA 2GS2A 2YERA 3ANRA 4LI5A 4NIFB 4BTKA 1PY5A 4EONA 2KTYA 1SNXA 3AMYA 2OF2A 1IEPA 4FKGA 4XOYA 2E9PA 3AGMA 1UWJA 3ZOSA 4H05A 4FTCA 4I6BA 2CDZA 5LQFA 5J1VA 3SQQA 4M68A 5BUJA 1XWSA 4BR3A 1OL6A 2H96A 4AA5A 4PTCA 2VRXA 2FSTX 4R8QA 2PU8A 3FLQA 2WQBA 3SV0A 3QRJA 1U54A 4G3DA 4KD1A 3I60A 4O27B 4DBNA 3W55A 4C62A 2C0TA 4PMTA 2V7AA 4YZNA 3FMKA 4EOIA 2E9VA 3P0MA 4O7RA 4J8NA 2BAJA 5FDPA 2ZJWA 3O2MA 1M17A 2VZ6A 3ORKA 5GJFA 3UPXA 4B9DA 4BBEA 3GCPA 4YHTA 3UZRA 4XLVA 1EH4A 3CS9A 4BCOA 3A4PA 3D5VA 4U40A 5HCZA 4UWCA 4AFJA 4DFLA 3O96A 1YHSA 3CD8A 5HVJA 2R7BA 3SGCA 4QP6A 2E9NA 3FUPA 3QU0A 2W4JA 3WZEA 5B0XA 4UV0A 4CSVA 3QALE 2XALA 4BRXA 2PE1A 3F3ZA 3FSKA 1K3AA 2QLQA 4FSQA 4DH5A 2PUUA 5DEWA 3TV4A 4C4IA 4EK4A 3LLAA 4IM3A 2PMOX 3W10A 3PG3A 1R78A 4AFEA 5CSVA 4CTCA 4GV1A 4D4RA 5DR6A 4O83A 1YRPA 3K2LA 2WU6A 1X8BA 4JX3A 4PL3A 4R77A 5AADA 5IMEA 4XP0A 1XH5A 3QZGA 3HDNA 5IQHA 4JIKA 4QPMA 4ACHA 3O7LD 1NVRA 5I9YA 4DTAA 4S32A 2BILB 1PXNA 3RMFA 4DBXA 1IR3A 3DAKA 4O0TA 5DLSA 3WYYA 4ACCA 2BFXA 3AKJA 4OBOA 1GNGA 5AUYA 4EZ7A 5J7BA 3NUSA 2Y6MA 2IJMA 4O0UA 3KU2A 1BL7A 3AMBA 3RPVA 3JVRA 1BUHA 3GCSA 3L9PA 1GAGA 2C1AA 3VUMA 1SYKA 4KBKA 2VU3A 4U8ZA 2WTKB 1IG1A 1K2PA 3I79A 4XMOA 3UBDA 4BZOA 5L2SA 5KE0A 3MFSA 3QX4A 1LPUA 4RIXB 3I7CA 2DQ7X 2YIWA 4MQ1A 4UZHA 3CC6A 3O51A 4U9AA 3U4WA 5I3OA 4AOIA 2JD5A 4XNEA 3ZS5A 3QCSA 2WMSA 3ORNA 3F2RA 2YIRA 1STCE 4DT8A 3ENHA 2EUFB 4GRBA 3MY5A 3V5PA 3NNXA 2G15A 4L7FA 4F6WA 3TNQB 3UVRA 5E4HA 4BGQA 4R5SA 2R2PA 2C68A 1H0WA 5C4KA 2RG6A 3TUDA 1MUOA 4N6YA 2FSLX 3QWKA 4RMZA 5DRBA 2XUUA 5HEZA 5AA9A 3QA0A 4DT9A 1W2FA 3BE9A 4N70A 4Y83A 4Y73A 4D2VA 3ZFYA 4RX5A 1H28A 3GOPA 3ZXTA 5FP6A 5JT2A 4IWOA 3EN4A 3TT0A 4ALVA 4QYYA 4C4FA 2YCQA 3NUXA 1OL5A 3QQHA 4UB7A 4JS8A 1Z9XA 3PJ1A 1J7UA 3EYHA 2BUJA 2Y9QA 4FOCA 4O86A 4L52A 2XNMA 3DBFA 3PXZA 5FBNC 5FG8A 3F3UA 5HO7A 2BAQA 2QI8A 4FV8A 3BV2A 3PA3A 4PNKA 1NT2A 5IQGA 1Y8YA 4I93A 5FRIA 2UW5A 1BYGA 1PKDA 4TYHA 1GIJA 3FZOA 3IQ7A 2C5OA 5G1XA 4O4BB 3HV4A 4QTAA 3DFAA 3W32A 3PPZA 3DA6A 2Q0NA 4FTTA 5CF4A 5AUUA 2BR1A 3AT2A 5IKWA 2WQOA 5FLFA 4BWPA 3S95A 5IA3A 4GT3A 1WBTA 2I0VA 4DCEA 3WZDA 3WE4A 3E87A 4DEIA 4YO6A 5H9BA 3UZTA 2B9FA 1GIIA 4W4YA 4BGGA 1O6KA 2IEWA 2QR7A 2CCHA 1JSVA 4MNEB 5EW3A 2WU7A 1W82A 4WT6A 1H0VA 4BDEA 1KV2A 2CKQA 4F0GA 4NM7A 4X21A 3BRBA 5T6KA 4EYJA 2IW9A 4EH5A 2UZUE 2JKMA 3PVGA 4Y8DA 1XKKA 2GNIA 2XBJA 3MV5A 3Q53A 4RJ3A 4ACDA 4CV9A 2CKEA 2B53A 5I5ZA 3SRVA 3WARA 4LL0A 4WG5A 2YM7A 4RZVA 1YWRA 3ZYAA 4QMSA 1P14A 1K9AA 2DUVA 4GK4A 4IZAA 3OOGA 5CSWA 4EWQA 3JXWA 5AUTA 4NH1A 5HU9A 1H1WA 5EQPA 5M51A 2IVSA 2OH0E 2PMLX 2W7XA 4XBRA 5C8KA 2O5KA 2VTHA 3GC7A 2OXXA 4JXFA 4O96A 4ZEGA 4IB5A 3W0SA 2WTJA 4V05A 3KXGA 3SLSA 5F1ZA 4J96A 3DXPA 4HGTA 4MD7E 3LQ5A 2BIKB 3UNJA 1XHAA 4UZDA 2FH9A 4E93A 4ORKA 2HW7A 2ZYBA 5CU3A 5AV1A 5EYMA 3W1FA 4BTFA 4FIIA 2RG5A 1WAKA 3UVQA 3R1QA 4IVDA 3AMAA 2REIA 4PQNA 3MDYA 4QP1A 1XH8A 4Z55A 2F9GA 3I7BA 3QKMA 1DAYA 4N57A 1RDQE 1MRUA 2HY81 2UVZA 4R3PA 2G2HA 2QVSE 5AJQA 3S00A 2ESMA 3EQPA 3OROA 5C8NA 4CYJA 4ZJJA 3R01A 3D2IA 4P4CA 2VX1A 4NKSA 5IEXA 4IAIA 3NUAA 2BCJA 1VYWA 3QHWA 2O64A 4PV0A 3OWPA 4NJDA 3CP9A 2YDJA 3FPQA 4CYIA 4TL0A 3DNEA 5JN2A 3F5GA 3H30A 3P86A 4YJVA 4AAAA 3BL9A 4NW5A 4D55A 4RVLA 5EYDA 4F08A 3BU5A 1RW8A 2PPQA 2JIVA 3W2SA 3P79A 2G1TA 5DA3A 4OUCA 5DOSA 4KSPA 3F2NA 2C69A 4QDVA 1GZNA 3D0EA 4AW0A 4YU2A 2QO7A 3ODZX 4FL1A 4PNIA 3KXZA 4C4JA 4RT7A 2XIRA 5BVKA 4BICA 2F7ZE 5F95A 1JVPP 3DK6A 5F20A 5HG9A 2UUEA 4I0SA 5M4IA 4BIEA 4XP3A 4E6CA 3ZLWA 2UW4A 3Q9WA 3BIZA 3VF9A 2W1DA 1ST0A 1ZOHA 2V7OA 1U4DA 3HLLA 2YWPA 4DHIB 4GYIA 3IGGA 3IKAA 4NIFA 2BKZA 3DAEA 2HK5A 4GJ2A 5DRDA 4DFXE 3FMNA 4IZ7A 3ZH8A 1B39A 1PHKA 3G6GA 3SG8A 4NCTA 1OIUA 4I5HA 4F9WA 2VWVA 4FIJA 1NXKA 3P7CA 2BAKA 4ALUA 4BBFA 4FV9A 3KEXA 4QT1A 5I3RA 2X8EA 1BI8A 3CGFA 3MB7A 5L3AA 3FI4A 4FSWA 5EYKA 4DA5A 4RJ6A 1SVHA 4PDPA 4FL3A 2GU8A 1TQMA 3MFUA 3MFTA 3H9RA 1DI9A 2F2CB 5F9EA 5FBOA 3FI8A 4F63A 5CVHA 1U46A 1OIYA 3ZCLA 3ORTA 5KBQA 3SKCA 4MD9E 1WCCA 4IANA 1WVXA 3E63A 2OFUA 3H4JA 4KBAA 4JMQA 3HKOA 2A19B 4G3FA 1ZYCA 4I4FA 4MX9A 4CZYB 1IAHA 3Q2MA 4ZY4A 4NEUA 2WQEA 4WSQA 4BTJA 4MXZA 2B54A 2RF9A 2VTMA 3D15A 4M12A 4MHAA 5AP5A 5J8IA 4Z3VA 5I9WA 2LGCA 2YA9A 5HX6A 4IDTA 3RPYA 2IZTA 2VO0A 2XNNA 4IAKA 5FQDC 4BVUA 4HPTE 4DG2E 2IF8A 5DH3A 3RNYA 1TQIA 1UU9A 2W1IA 2XIZA 4DEBA 3SVVA 2VGPA 5GNKA 2QOFA 4R1VA 3JPVA 5E1EA 4ZY5A 4O1PA 1WBPA 2CN8A 3BYOA 2DYLA 2GDOA 2H9VA 2FA2A 2IVTA 2QOQA 2UZTA 4IAAA 4QTBA 5LMAA 5HESA 3VJNA 4EORA 5IA1A 5AP7A 4ZLOA 4ZTNA 4C37A 5JFWA 4ZMFA 3TACA 1PXLA 2Z02A 4F1TA 4ZS4A 3OOMA 4X2FA 3O23A 3O8UA 2WMXA 4IWQA 4WUNA 3R7EA 2ZMDA 4FJVA 4FKOA 3QRTA 4W4WA 2JKOA 1H24A 4D1XA 4K0YA 4B7TA 3QC4A 3R9RA 4JR3A 3HX4A 4L8MA 3BI6A 4FT9A 4RJ4A 3MESA 2PVYA 4FKVA 1F0QA 1FQ1B 4GFMA 4XEYA 4F9AA 5A4TA 1Q4LA 4E5AX 4RIXA 4ZZNA 5AP1A 1PXPA 3GNIB 3QD2B 3CR0A 2OWBA 5J95A 5AX3A 4J95A 4MEDA 2R64A 4C57A 3RPRA 2ZB0A 2R3LA 4C2WA 3R0TA 4CKIA 2X0GA 3UPZA 3A2CA 1Y57A 2IG7A 3IDPA 4BWXA 3UJGA 2XAMA 3JR1A 4YP8A 3D4QA 1P2AA 3ZONA 2Z2WA 3BHTA 3VBVA 3RVGA 5E8ZA 4EK8A 2BFYA 5E1SA 3IW7A 4FA2A 4JAIA 4AZFA 4YJSA 3TNWA 3FMEA 3QYWA 5ANDA 4EJ7A 5CQWA 4FEUA 3HP5A 5H8GA 4IX4A