4YTFA

Discovery of vx-509 (decernotinib): a potent and selective janus kinase (jak) 3 inhibitor for the treatment of autoimmune diseases
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
289
structure length
283
Chain Sequence
TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of VX-509 (Decernotinib): A Potent and Selective Janus Kinase 3 Inhibitor for the Treatment of Autoimmune Diseases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 283
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ytfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ytfA01
3IGGA 4UEUA 1Q99A 5JMSA 5LOHA 3TT0A 4YTFA 4OTPA 4K8AA 3A99A 2LGCA 3L8XA 3SGCA 2W4OA 3UIMA 3E64A 4ZLYA 4YHFA 2PTKA 5C8KA 4MVFA 2UW0A 5E8UA 5C4LA 3QTUA 4KBAA 4FKVA 3EN6A 3GI3A 3KXZA 5K4IA 1SMHA 2FA2A 4I1ZA 2OF2A 5HTIA 4IJ9A 2HY0A 4X3FC 3UYSA 3OVVA 4O0VA 5HCZA 2JC6A 4IB3A 2JIUA 3V5PA 2VTOA 4HYSA 3BU5A 3GUBA 4JG7A 4XS2A 4FTJA 3V6RA 2PZPA 3VS3A 4E6DA 4FKJA 1O6YA 5JSMA 3GBZA 5KHWA 4B8LA 5L6WL 2GQSA 2R3FA 4AFEA 2CNQA 4AOIA 2PUUA 5DH3A 4MXCA 3G90X 5DIAA 4C4IA 3COHA 3VC4A 4CMUA 2XRUA 4GG5A 1UVRA 2CKQA 5EI6A 4FV5A 4ANBA 4M97A 2PZ5A 1UNHA 4DFZE 2PHKA 5KBQA 3KRLA 5AR7A 5HU9A 5I4NA 1TQIA 2B54A 3O17A 3ZU7A 3BRBA 3LPBA 5EH0A 3LM0A 4HVGA 4L01A 3ULIA 2FB8A 1JBPE 3PSBA 3TZ7A 2CN8A 5H8BA 3IECA 3DDPA 3QRIA 4L8MA 5A3XA 4FTCA 4E93A 4JR3A 2C6KA 3Q3BA 4L43A 4RMZA 2OI4X 3FZRA 1CKJA 2PE1A 2XIRA 3IDCA 3AC5A 4JBQA 4BCIA 3HV3A 3GU4A 2ZM1A 4XEYA 4GV1A 3V6SA 4N57A 1KOBA 2RL5A 4GS6A 3R73A 3P5KA 3GU5A 3CTJA 2PPQA 3AGLA 4EOOA 3MBLA 4Z3VA 1YW2A 4C3RA 2O63A 3BYUA 4AGDA 2YDIA 3Q9WA 4NW6A 3QHWA 3C4WA 5EDPA 2QCSA 4JG6A 4IC8A 5FEQA 4IFCA 4AA0A 4ORKA 2GHMA 5CU6A 3QXOA 5FP6A 2YWPA 2REIA 3TI1A 4MBJA 3BYOA 4JIAA 2GDOA 4IFGA 5GJGA 2ERZE 5EKNA 1YI4A 2B4SB 4FTNA 3QQUA 1GZOA 1H24A 4AS0A 4KUJA 4DBXA 3DBCA 2YJRA 1QPDA 3QL8A 3GC8A 2FO0A 4EOJA 2ETRA 4I6QA 2OJJA 4XBRA 2PUIA 1Y91A 3JY0A 1UU8A 1J7IA 1PXJA 4PDOA 4QP1A 1Z9XA 3P1AA 5CENA 4DFXE 3EMGA 3KXXA 2I7QA 1PXPA 4FKUA 4DGNA 3K2LA 3UP7A 4A4LA 4B8MA 3BPRA 4H1MA 3RAHA 4PL3A 3NAXA 4W4YA 5HO8A 5HU3A 5KUPA 4GJ2A 1Q41A 1YWRA 3DBQA 3MFUA 3QXPA 4Z9LA 4ZJVA 4CQEA 5TE0A 3CR0A 3SHEA 4XV2A 1IA8A 4EQCA 4UMPA 2RFEA 4FSNA 2P55A 2ETMA 2QOLA 3SRVB 1HOWA 5JRSA 3PLAE 4X6RA 4F65A 5FM3A 4FVRA 4KSQA 4XG4A 4O6LA 5CU4A 1Q5KA 4GIHA 4EH4A 3F5PA 4GFMA 4I6HA 4JIKA 4R3RA 5E8VA 2EB3A 2OXYA 3HUBA 5LVLA 3SA0A 3R21A 3ITZA 2QG5A 4F4PA 1DS5A 2Z8CA 2VAGA 5DNRA 2RSVA 2UZDA 5DG5A 2C6TA 3UIXA 3V5TA 4QMXA 2OZAA 2XP2A 3DK3A 4FTIA 5CWZA 3QQLA 3TKIA 3NUSA 2VUWA 3ODZX 4EYMA 3R30A 5ACBC 3C5IA 2A1AB 2WIPA 2J4ZA 2YFXA 4RFMA 4BCPA 5JZNA 3TDWA 1GZNA 4CZYB 2QD9A 5CI7A 4EI4A 1RJBA 3ZUUA 3UYTA 1Q8ZA 1CTPE 2VTIA 1WAKA 3ET7A 5D1JA 3HAVA 1E1XA 4RSSA 1OECA 4FV2A 4BF2A 4RJ6A 2J6MA 5F4NA 3E8DA 3BHYA 3EQPA 4XX9A 2G2FA 2VTLA 3HGKA 3MTLA 4O82A 1ZY5A 4Y46A 4QQCA 5F20A 5CY3A 4NKAA 3ORTA 4FEVA 1OMWA 3VQHA 4O38A 2VTRA 4YHTA 3CP9A 3F7WA 4EC8A 5AFVA 4MD8E 1OIYA 5DEWA 2GSFA 4PMMA 2BDWA 3UPXA 4D4VA 3OW4A 4PP9A 1YXUA 3TL8A 4BHZA 4BRXA 4UMRA 4UN0C 4FUXA 4AOTA 2F2CB 4OBQA 3HYHA 3EZRA 3II5A 5CF6A 2B9FA 3KL8A 3TDVA 4HGLA 2R3GA 4O0RA 4ZMFA 1R3CA 3O71A 3D7TA 5KE0A 4HZRA 2R3KA 4P7EA 1XWSA 3QCYA 1MRVA 3WZUA 4P5ZA 4C58A 3EQBA 5EM8A 1OBDA 4LL5A 5IQIA 4TT7A 3D94A 3QWJA 4UXLA 4PPBA 2YZLA 4AW2A 3Q52A 1O6KA 3BI6A 4X3JA 2IVUA 4V0GA 2X8IA 3VIDA 5BVDA 4XYFA 4CYIA 3QLGA 4GT5A 4RC4A 4DF3A 3HMOA 5AM6A 4IB1A 4WA9A 3KN6A 4YSJA 3ZSHA 4XG7A 3V04A 4C4FA 4M13A 2BHEA 4AFJA 3M11A 2ZOQA 1GZKA 1R0PA 5AR4A 5DT4A 4KAOA 3UJGA 3UIBA 1ZYJA 2X2KA 3MPMA 3H30A 4Y95A 3Q9YA 4B4LA 1OKYA 2YA9A 2OZOA 2DWBA 2WQEA 4RZWA 4ANMA 3GOPA 4K18A 5F9EA 5IA3A 5TR6A 5HVJA 2CGXA 2O64A 2JDSA 3OTVA 5AIKA 3EQRA 3UO5A 1XJDA 5HG8A 4DLJA 3K54A 3O2MA 3VJNA 3Q6WA 3ZXZA 4O7VA 3VHEA 5FUTA 3U9CA 2IO6A 2FGIA 3Q53A 4L7FA 2WTKB 1FPUA 3R7GA 2CCHA 1GJOA 2OO8X 2VRXA 3D9VA 3NX8A 4H3QA 3W2CA 3NIEA 1YRPA 2VO0A 1L8TA 3R8LA 4WG4A 5HLPA 1JNKA 3E7OA 4L00A 5C8NA 1VZOA 1PMVA 4YPSA 2PULA 2VD5A 1XBAA 4ZTQA 4ANNA 4EKKA 3VBQA 5AR3A 1Y8GA 4EEVA 4HVIA 2F7ZE 3W2RA 2VX0A 2G2HA 4YC6A 4ZSLA 4FNYA 3BX5A 2X0GA 5GZAA 2B9HA 1YHSA 5GJDA 1ZYLA 4FUYA 4F99A 4TPTA 2YCFA 4F7LA 3FLNC 1AD5A 5KO1A 2BTSA 4EK3A 4ZTHA 2VZ6A 4TYJA 3SW7A 4BR3A 3PVGA 3KULA 1XBBA 2BAKA 4LM5A 5E8ZA 5DR6A 5EI8A 1M2RA 5AP0A 4AE9A 2FSMX 3HNGA 4RWKA 5CSVA 2PYWA 1P14A 3GT8A 1J91A 3FXZA 4DFYA 5GIPE 5A4EA 2VTNA 4YJOA 3PP1A 2BUJA 4HCVA 2Y6OA 2BTRA 1R1WA 2ITOA 3AMBA 3C9WA 4JAJA 2C6DA 2P33A 5BYZA 3F3UA 1PY5A 4ZSAA 2H6DA 4EH3A 4NEUA 3QX4A 2GS7A 2VWXA 4WNKA 5HGIA 4O81A 4LV5A 2X7OA 4ZLOA 1W83A 1GIIA 3UBDA 3W8LA 4TRLA 5CNOA 1PRYA 3CQWA 4R78A 1H8FA 3VAPA 2W9FB 3G15A 3L1SA 4PTCA 3RI1A 4H39A 2CGVA 4G2FA 2RIOA 4N70A 3REPA 3W32A 3MH2A 4FMQA 5I5ZA 4H58A 4S2ZA 2GS2A 3D5WA 3FBVA 3QQHA 3W8QA 4O22A 4CG9A 3QQKA 1H00A 4AZWA 2W1HA 4RQKA 3MW1A 4FOBA 3ZDIA 3NYXA 5HG9A 3VS4A 4I0TA 3LFCA 5LMBA 4WRGA 4ZAUA 3UOHA 4ZZMA 1U5QA 3BGQA 3GGFA 4H3PA 1KV2A 2BHHA 2F7XE 4RIOA 5GJFA 3W2PA 5ANIA 4ANSA 3D4QA 4PY1A 2P0CA 3QKMA 4M8TA 5D7VA 5FQDC 2YJSA 3LIJA 4GSBA 2XJ1A 3ZOSA 4WNOA 5AP1A 4HPTE 4NU1A 2WHBA 2Z7RA 4A9RA 1JSUA 2J0LA 4DG2E 2C5XA 3OY1A 4IAYA 2FSOX 3CTQA 4GL9A 4D4RA 4M66A 5HESA 3QTIA 2ITYA 1KE7A 3H0ZA 4IX3A 5DGZA 3RWQA 3O23A 4LRMA 1LEZA 2O3PA 4R7BA 4MHAA 4X0MA 4W4VA 2W0JA 2W1GA 1ZAOA 5KZ0A 2R0IA 2YERA 4FKOA 2EU9A 3I81A 3D15A 3MS9A 2ETKA 4MBLA 4EK5A 3R04A 3H3CA 5E92A 2QOHA 2GCDA 2QOOA 5FTGA 2AC3A 2ITTA 4ACHA 5D41A 4C35A 4F63A 2VTTA 4FSQA 4EHVA 5M51A 5GINE 2QU5A 3N9XA 5B2MA 3VF8A 1Q8UA 3BU6A 4I6BA 4FEUA 3ID6C 3Q4TA 1SVEA 4Y85A 2ZDTA 3RPRA 4LOQA 3E93A 2HZ0A 3SVVA 3QTQA 3PXQA 5HE2A 3LXNA 3TUDA 3PIXA 3D5VA 3MV5A 3PVUA 4QRCA 3CEKA 3UVPA 4CV8A 5LVOA 3U54A 5DLSA 4HPUE 5E91A 3R7VA 5D12A 3HECA 1OB3A 5IMEA 4UV0A 3L8SA 4ARKA 2XEYA 3QX2A 5EW3A 4MEDA 4XV1A 3ZFYA 3Q9ZA 5E4HA 3GU6A 5JGBA 1SNXA 4IAFA 3FE3A 4P4CA 3NVKI 1DI9A 2ITXA 4UWBA 1ZMWA 2XKFA 3FJQE 5H3QA 2A4LA 4FSYA 4EUUA 1UV5A 2HZNA 4CFXA 4UXQA 5HHWA 3LE6A 4NJDA 3MJ1A 5AX3A 3H9RA 1VJYA 4FTOA 4EH9A 4H05A 4BBEA 3KGAA 5AX9A 3EWHA 1K9AA 4ZY5A 2W1EA 3G9LX 4Z7HA 5M57A 3UQFA 3JS2A 3G5DA 2HENA 4ZS0A 4P90A 3E8NA 4C4JA 3OWLA 3LMIA 3PPKA 2UZNA 1XH4A 4XRJA 3T3UA 3ATTA 5H8GA 3A2CA 4M84A 1S9JA 3FQEA 3IO7A 3NCGA 3WIGA 5E7RA 2UW3A 4DEIA 4EOPA 1YDTE 2QQ7A 2C68A 4O1PA 5TF9A 1NW1A 5IF1A 3QAME 4DCEA 1W8CA 3F2AA 3KMUA 2XIXA 5HD4A 3NW5A 5IH4A 3UE4A 4OTFA 4UB7A 4HGTA 1UU3A 4JDHA 3VW8A 2H34A 3SRVA 2JDRA 1UU9A 5EDQA 3F69A 3F3VA 5HE1A 4TWOA 3VRZA 2GMXA 1YXSA 3E87A 5GZ9A 4MXZA 5AAEA 1ND4A 3UGCA 4CKJA 3FL5A 2VWVA 2WMSA 3ACJA 4QYHA 4U42A 1UWHA 4MXYA 3A7JA 4E6QA 4KS7A 3KRJA 1SYKA 3HV6A 2C3LA 1YDSE 3FI2A 3PUPA 1OL1A 5ETIA 3R8ZA 3FSFA 3PIZA 5EKOA 3CY2A 4IACA 2CMWA 2PWLA 3IK3A 4YNOA 3ZZEA 3PXRA 4B6LA 2YM7A 3KXMA 5KMOA 4FV9A 4PV0A 1GAGA 2IPXA 3HV7A 4ZJIA 3VVHA 2X7GA 3NPCA 2GNGA 2PK9A 4RJ4A 3HP2A 1NT2A 2WMBA 1OI9A 1P2AA 4K11A 3DU8A 3RAIA 4HVSA 5HG5A 4NKSA 4JI9A 4DEDA 2BPMA 3R6XA 4NFMA 4YO4A 1F0QA 4O2ZA 3W10A 5BUIA 2FUMA 4WKQA 3R7EA 4X7QA 4BCHA 4FGRA 3HEGA 2VWYA 3PSDA 4FKQA 2C6IA 4TWCA 2G1TA 4Q2AA 5EYDA 3NNWA 2HXLA 4QMYA 4QT1A 3R7UA 3OEZA 3WI6A 3PPJA 2XNMA 3DOGA 4RVLA 3U4WA 3PVBA 4L3PA 3L9MA 3MY0A 3RCDA 5E8YA 4WG5A 2H8HA 2YLFA 4FZ6A 4R7HA 4M14A 3JY9A 3DZOA 4D9TA 3CS9A 3BWJA 2X2LA 3OBGA 4D58A 3QF9A 2O0UA 4O27B 1J7LA 4YTIA 2IN6A 2QOKA 4YJNA 3LFQA 4PDPA 3FI4A 4LGDA 2NRYA 4DLIA 2HW7A 4C8BA 5LXMA 1P4OA 3EZVA 5DVRA 5IEVA 2GQRA 2IZTA 1JKLA 1OPJA 3KCFA 1OL6A 4G3CA 4BI2A 2GNHA 4BTFA 4XCUA 2RG5A 4A9YA 3PG1A 5M07A 3KU2A 3R8VA 2GQGA 1ZYCA 5E1SA 2XNEA 3QBNA 3O8PA 4FC0A 3ALNA 3GU7A 5IA5A 3ZEWA 4BC6A 3OY3A 3FC2A 4C38A 4IB5A 4ZJJA 4QP9A 3P7BA 4E3CA 3QTXA 3EN5A 4DEHA 4JL9A 1TVOA 3TV7A 3DJ7A 2W99B 3AC1A 3OMVA 3O7LD 4JT3A 4ALUA 5CEQA 2R3LA 4C57A 4GFOA 1IA9A 1SVHA 4YUQA 3CQEA 3IDPA 4MTAA 5ANJA 4AZFA 2ZV2A 3RZFA 3B2WA 4AN9A 5CXZA 4FIJA 4CT1A 5KMNA 1A06A 5JFXA 5C8MA 3MB7A 5EYCA 3KF4A 1ATPE 5AP5A 4IWDA 1QPEA 4LMNA 2HWOA 1STCE 3ERKA 3ORXA 5HCXA 1YQJA 4G3FA 4F70A 2ZV7A 4FG9A 3Q2MA 4J8MA 4AUAA 1WVYA 2BFYA 2FSLX 3CSVA 4I5HA 5B7VA 3MIYA 4MAOA 3Q96A 4K2RA 5K0XA 1AGWA 4IBMA 1OKWA 3CE3A 4YSMA 5DOSA 5EFQA 3BKBA 3CY3A 4CKIA 3D14A 4JQ8A 3Q04A 4XBUA 4MNFA 3FHIA 2PVLA 3TNQB 4MYGA 3NZ0A 4JVGA 2P4IA 4DGLC 3VUKA 2F49A 2XNPA 3U55A 3F3WA 4FTKA 3ZRMA 4CTBA 5AP6A 5DT3A 2PVHA 4KA3A 4FEWA 2UZTA 5HLWA 2UZBA 2OGVA 2QOCA 3FXWA 4IH8A 2I0YA 3GCPA 4J98A 4YJRA 5AV0A 3UMXA 4E6CA 4I22A 5E1EA 3NUYA 4CLJA 5KZIA 5BVEA 2W5HA 4BL1A 4DH5A 1Q4LA 3MA3A 4XOZA 3VWAA 3QZGA 5D7AA 4C02A 2J50A 2QG7A 4G6NA 3SAYA 3EN9A 3ZFXA 2VX1A 4EHGA 3FL4A 4FSMA 4BCKA 4IIRA 3R01A 4GU6A 1XH6A 3DXNA 3H4JA 4FG7A 4BDGA 4YBJA 4XUFA 4KRCA 4C4EA 2RFDA 4DGOA 4HYHA 5HNIX 4N6YA 1Y8YA 3MI9A 2B7AA 2V7OA 3QLFA 3GENA 5FXSA 5L2SA 4EOLA 3TIYA 4RZVA 4NH1A 1JVPP 4G16A 3IW4A 3UNZA 4W9XA 3G6GA 2C6LA 5LCKA 1SZMA 2NO3A 4P2KA 4QMMA 1H07A 3FUPA 4YO6A 3U8WA 5AUXA 4FK3A 3DFCB 2WTDA 3MSSA 3UQCA 5HIDA 2F57A 3E8CA 2BAJA 2BZKB 3KC3A 4L6QA 4QMTA 3R63A 2XEZA 3DZQA 1MRYA 3DLZA 3S00A 2DYLA 2OU7A 5K3YA 2B53A 4X2JA 5CF8A 5EK7A 2WO6A 5DBXA 3KVXA 4Y73A 3MDYA 2GFCA 4JRNA 4J95A 3I0OA 5FGKA 4ZSEA 4EK8A 3HMMA 5K9IA 4WUAA 5IDNA 5G1XA 3F3TA 1O6LA 4I0SA 4DAWA 4Z16A 4FIGA 4FIIA 3LQ8A 1DM2A 4II5A 1ZY4A 3VUIA 1WBTA 4A07A 5CVHA 4QMNA 4OTRA 1CKPA 4FTLA 3E7VA 4KWPA 4ZSJA 3F5XA 1JSVA 4LUDA 3SDJA 5AA9A 2YDKA 2JKKA 3JYAA 2F4JA 2JIIA 2YITA 3I60A 5DR9A 2HCKA 5F95A 5J9LA 1YHVA 1PHKA 4D1ZA 2ZB0A 4IDVA 4XLIA 4PX6A 2VWZA 4AX8A 3MPAA 2RFNA 3GCQA 4OTIA 4JBVA 4PTGA 4NZWB 5ETAA 1ZZLA 4GK2A 4RWJA 4ZZNA 3EN7A 3BYMA 4YPDA 3NSZA 5ANDA 5M55A 5CSPA 3VBXA 5EYMA 1Q8WA 4C37A 4EKLA 5CVFA 3D5XA 2PVNA 4RIXB 4BCJA 4GT3A 2XNBA 2H9VA 3ZSGA 4K0YA 4YZCA 1QMZA 4AU8A 4V01A 5DFPA 5FXQA 4RJ7A 2PMNX 4F9CA 4QTEA 4OTGA 4GKIA 2PZYA 2WGJA 5ANOA 3FQSA 1S9IA 4U3YA 4X2KA 4IQ6A 5JKGA 1OL2A 3VS6A 4BWKA 3P86A 3NWWA 2XZSA 4FTUA 3UOKA 3HRCA 3EN4A 5HOAA 3RZBA 4B0GA 5ANEA 3F9NA 4BZDA 2QKRA 3EQGA 3G2FA 3PP0A 5CZHA 2GNIA 2QO2A 4AXAA 3PSCA 4DBNA 4DTAA 2W17A 1PKDA 2DUVA 4UZDA 3DK6A 4QYEA 2BDJA 3LMGA 4IVCA 3C7QA 1H28A 3G51A 3U9NA 4X2FA 1PXLA 3ALOA 3O8UA 3PXFA 5JH6A 3QC9A 4G17A 4K33A 3I1AA 2RF9A 4AWIA 2W1IA 4CCBA 4EC9A 4QP4A 5JGDA 3KMMA 3QD4A 4DE4A 5E9EA 4FZ7A 5DE2A 3TIZA 4I21A 2YABA 4L3LA 1G3NA 4G9CA 4D1XA 5C1QB 2E9VA 4ZTSA 3SX9A 5J1VA 4XHKB 3P79A 5J87A 1PXMA 4DA5A 4UBAA 4ZTLA 2YM5A 3LOKA 1Q24A 3C0GA 5FTQA 3LKMA 4CRLA 4ENYA 1PXNA 2QU6A 3IONA 3MVHA 3F2NA 4U7ZA 4RGJA 4L68A 3ZC5A 4O7YA 2BCJA 4F6WA 3F7ZA 1FVVA 4C2WA 4AT4A 3ORKA 2EWAA 3FXXA 2V55A 3QRTA 2C3JA 3P0MA 4O0YA 3MTFA 5A6OA 1FBNA 1IG1A 2Z2WA 3QKLA 5KBRA 1H0VA 3TV6A 1KUTA 3ORPA 2HW6A 4L3JA 5JN2A 3S3IA 4FTQA 2ITZA 3BV3A 1XBCA 4CKRA 1QCFA 2OIDA 3BU3A 1YHWA 2PMIA 2RFSA 3FLYA 5BQ0A 5L2TA 4ZOGA 3FZOA 3W2SA 2XM8A 4N0SA 2AC5A 5AP3A 3WYYA 3T8OA 4KD1A 4BDCA 1OPKA 3H10A 3FI3A 5J9YA 1FINA 3P78A 3GC7A 2P2HA 3D7ZA 3BQRA 4XG2A 4AW1A 4FKLA 3PYYA 3UG1A 3DQWA 5CI6A 1YOJA 1Z57A 3R2BA 3P9JA 3ZBFA 3Q32A 5A4QA 3F5UA 3QD2B 5H9BA 4DYMA 1PXOA 4ANOA 3FAAA 4IZ7A 5BNJA 2JFMA 4PUZA 3MH1A 5CX9A 5D10A 2VV9A 3HDMA 5EW8A 2PE0A 3RJCA 3MVJA 1LP4A 3AT4A 1J3HA 3L8PA 4GYIA 2J0IA 5J95A 2HWPA 1R0EA 3FY2A 2A27A 3OTUA 2LAVA 4BI1A 1RE8A 3BYSA 3QFVA 3HMNA 3S1HA 3QZHA 4R3CA 5CAOA 2VTQA 5L2WA 2Y8OA 4LI5A 5EQPA 2XVDA 3ODYX 3QD0A 4D28A 1H1WA 1G8AA 4PMPA 4RRVA 3ZONA 5IUHA 4JBOA 3LFSA 1H4LA 2XNGA 4YNEA 3R2YA 4CFNA 5HORA 4RWLA 4ZP5A 2WMVA 3UOLA 5T6KA 4U45A 5KMLA 1LR4A 3FQHA 3W33A 4D2TA 3WE8A 1FOTA 3W2QA 4IX6A 2JD5A 3SC1A 2QOQA 3A7IA 1U4DA 3FMKA 4ACGA 4BIBA 3WARA 4BDAA 3KXGA 5BMSA 2PY3A 4MX9A 2WPAA 2XMYA 4JX7A 4ZXTA 4ZY6A 3WYXA 3VULA 1I44A 4RX7A 2YIYA 1YI3A 3KY2A 5DHJA 4CFUA 3BEGA 5EOLA 4FKRA 4BZOA 1YOMA 2FYSA 3DBFA 3POZA 4WIHA 1Q62A 3ZEPA 5ETFA 4A4XA 4M7IA 4RIYB 4EBWA 5A9UA 5IISA 5L8LA 4IM0A 3N4TA 2YWVA 4Q5EA 5LMAA 4E8AA 4R5YA 3ZRLA 1ZRZA 3N4VA 4FV0A 4BKJA 2C3IB 4O0WA 3SV0A 4EJNA 2PSQA 3VBYA 4IADA 5CAUA 1E9HA 4FTAA 4ITHA 3RWPA 5J1WA 4NUSA 3UC3A 3BYVA 2X6EA 1OIUA 3WBLA 5B2LA 4EWHA 3LM5A 5HNBA 1ZOHA 5T3QA 3EFLA 2C6EA 3R71A 5J79A 2OIBA 3CPBA 2IW8A 4UMUA 1I09A 3MFRA 2ZV8A 2C1BA 4IZYA 5IQEA 1LUFA 1FGIA 3H9FA 2C1AA 5HBEA 4EOIA 3FEGA 1H27A 1DAYA 3NYVA 4GH2A 4ASEA 2YCRA 1WBWA 3CXWA 4KSPA 4E5BA 3FMNA 3SG9A 4XG8A 4AAAA 4PTEA 1APME 3TUCA 3IOKA 3DNEA 3GC0A 3OFMA 1T45A 2CCIA 4KKEA 4QQTA 5IA0A 4USFA 3DK7A 3M2WA 2HOGA 2OXXA 4J53A 5JFVA 3Q2JA 1G8SA 5BVOA 4V04A 1PYXA 2ONLC 2HZIA 4DH8A 3FPQA 3JUHA 3RGFA 4ITIA 3PRFA 4FSWA 2PUPA 4F9AA 2VTAA 3DAEA 3NNUA 3PTGA 4D55A 4FV4A 5LQFA 2HK5A 1U5RA 1XR1A 3SXSA 3BGZA 5DMZA 1VYWA 4J1RA 5L6PA 4ZK5A 4FSTA 4TNDA 3RNIA 3V5WA 4C3PA 3MESA 3I5NA 4KIKB 3I7CA 1O9UA 5FG8A 3AT2A 3TNWA 4C34A 4UX9A 4DT8A 3CKXA 4Y8DA 2O2UA 2CN5A 2BMCA 3H0YA 3TV4A 2GHLA 3IPHA 2WB8A 3VUMA 3LXKA 3I0QA 3JR1A 1M14A 4MWHA 4BCFA 3DBDA 5D9HA 3KRXA 4O1OA 3R8PA 3R7YA 4NWMA 1WBPA 4I41A 5IQGA 3ZUVA 5KKRC 3ZFMA 3COMA 4F9YA 5IA2A 1QL6A 3UPZA 4ASZA 4WSQA 3TXOA 3UNJA 4NM3A 1HCLA 4BICA 2C5OA 3PWDA 4OR5A 2B52A 3KQ7A 4FV8A 1BL6A 4EZ3A 4MH7A 3U6JA 3N51A 3R9OA 2C69A 4LG4A 2X9FA 2XJ0A 4X3FB 2IWIA 3IW8A 3KVWA 4CVAA 4MXAA 2YIWA 4EOMA 4I93A 2W5AA 3FPMA 4PQNA 3IS5A 4FODA 2WQNA 4RWIA 3AOXA 4B99A 2YM3A 3VBVA 3U6HA 3KF7A 1OL7A 2GFSA 2C5YA 3OROA 4CEGA 4NW5A 2C30A 3EFKA 3QCQA 4FL1A 1ERKA 3QU0A 5LMKA 5IQHA 4R77A 2SRCA 2PUNA 1JOWB 3QC4A 2W1DA 2YAKA 4HJOA 2WMTA 5FLFA 4BWXA 3OHTA 4ZTMA 2I6LA 1H1SA 1PMEA 3R02A 4MBIA 2I0EA 3VUTA 2PE2A 3EQHA 3DFAA 3U6IA 4C62A 1WVWA 2PL0A 4MK0A 4IB0A 3NUUA 4TY1A 4ASDA 3QCXA 3GXLA 1PF8A 4BKYA 4E4LA 3LXPA 3WZJA 3ORLA 4AZVA 5HZNA 4BGHA 2XM9A 4R7IA 5HVKA 5AIRA 4CT2A 2GS6A 2OW3A 4GEOA 1OVEA 3KK9A 1ZLTA 2RG6A 5EM7A 3UO4A 3POOA 3E5AA 3LFNA 2X39A 5GZ8A 4FKTA 3IG7A 1V0PA 1ZOGA 4NFNA 5HCYA 4TYEA 3VN9A 3UVQA 5FM2A 4G3GA 2I1MA 2F9GA 3S2PA 4YZMA 3F3ZA 2ACXA 4LRJA 4MCVA 3AC4A 2ZDUA 3OBJA 5AADA 3DXPA 3F2RA 5CEPA 4H3BA 5LVMA 3V5LA 3V5QA 2PVJA 5A54A 5LVPA 4ACMA 4IM3A 4E5WA 4P5QA 5TO8A 5BYYA 4CSVA 4L42A 4DGGA 1XH7A 4XH6A 2J7TA 3GC9A 3EFWA 3I79A 4FI1A 4V05A 2X6DA 1BI8A 5B0XA 1WZYA 3DAJA 4JQEA 2XBJA 2G9XA 4MD7E 2QLQA 5HO7A 2ITWA 4DTKA 1PMNA 3MFTA 4QP2A 3Q4UA 3W55A 4DITA 3DXQA 3GP0A 4TN6A 4U40A 2JIVA 4QNAA 5HVYA 1OM1A 4JR7A 2ZB1A 4CYJA 3UZRA 5EHYA 1H1QA 4EH6A 3L8VA 4BDHA 5CF5A 3EYHA 2QURA 2XYNA 3BGPA 2FSTX 3ELJA 4J8NA 3RPVA 4F0FA 2WTWA 4CFFA 1GIHA 1U59A 3GNIB 3R22A 3E3PA 4ZSGA 4LL0A 4HNFA 3BELA 4OGRA 3MA6A 3PWYA 4ITJA 4RIXA 4QPAA 4LMUA 5HIBA 3W18A 3V5JA 1H25A 4FL2A 3F66A 4CXAA 3R28A 4NTSA 4EOSA 4WSYA 1OL5A 2W1CA 2ITVA 3DA6A 3BBTB 5HICA 1A48A 3QTSA 5F1ZA 5IA1A 3WF9A 4O91A 5HI2A 1H08A 3R8MA 4KRDA 2C3KA 3EOCA 3RKBA 3ENHA 4FE2A 3HA8A 3NGAA 3OXIA 3DDQA 4FNZA 4DC2A 4K6ZA 4EH7A 3C4CA 5BYLA 4ZEGA 2EUFB 4D0WA 3RNYA 3BZ3A 3LCKA 4IVDA 4NM7A 2XA4A 2YLEA 4LOPA 3ZSIA 3GQLA 2VO7A 1WBOA 3DLSA 1OGUA 3DKGA 3O50A 4AOJA 5AV4A 2JITA 4U79A 3BLQA 4S34A 1M7QA 1KE8A 2PZIA 3WF7A 3SXFA 5M56A 2PMLX 2QONA 5FD2A 1VEBA 5CU2A 2X81A 5CSXA 4G9RA 4ENXA 2X8EA 3B8QA 5BUJA 2G2IA 5IH5A 5ANGA 2X4FA 3KB7A 4QMWA 2WQMA 3ORIA 4CTCA 4CG8A 2ERKA 4A06A 1XQZA 3BE2A 2Z7SA 4HYIA 1JKKA 3O7LB 5GNKA 4EUTA 3ROYA 4FYOA 4FT9A 3O0GA 3K3JA 4NCTC 4U44A 2OIQA 1FMOE 2BIKB 2R7BA 3BV2A 3BCEA 3LJ1A 4QMPA 3VQUA 3LMHA 3FZPA 4I0RA 3ORNA 1EH4A 2X9EA 3C0IA 3WF6A 4WBOA 5DRBA 2BIYA 2NRUA 4BB4A 2JAVA 3DKCA 3QKKA 4MWIA 3L9PA 2RGPA 4TYIA 2JFLA 4BDEA 3UODA 4DFNA 4O7ZA 5K5XA 4FV7A 4AQCA 3T9IA 1BMKA 3AD5A 5CXHA 4NYEA 1V0BA 4EL9A 5JQ5A 3A61A 4O7SA 2BRMA 3M42A 3A7HA 4EYJA 3VJOA 4TZRA 1JKSA 4DEEA 4OAUC 3NMUF 4APCA 4O7RA 1H0WA 5D11A 5K0KA 3IW7A 1BX6A 5AP2A 4XRLA 2UW4A 4AGCA 4YU2A 4I24A 5CTPA 1Z5MA 4YLLA 3ZMMA 5HKMA 1B6CB 4M67A 1MUOA 1M7NA 2R3JA 3CJFA 4RG0A 3FI8A 3WZKA 3FLSA 2QOFA 2OK1A 2IG7A 4DHFA 2WIHA 2OH4A 2YM4A 3B2TA 2IW6A 5KX8A 2W4KA 3KXNA 3UIUA 2XIZA 4I4EA 3OF0A 5AP7A 3E62A 2J5FA 1J1CA 3CC6A 2WEVA 3RPOA 3CD3A 2JKQA 2WMQA 4MF0A 4RIWB 1LPUA 2PVMA 2Y6MA 4QQ5A 3QYWA 4K9YA 3JVRA 3VW6A 4U6RA 3PE2A 5ICPA 5BVKA 3DAKA 5AR5A 5AAFA 3MY1A 2WQOA 5EW9A 1NVQA 5HTBA 3VBWA 4M0YA 4NTTA 4DT9A 4FZDB 2W4JA 4RJ3A 2YHVA 2XF0A 3F6XA 3DBEA 3BLRA 2VNWA 5JEBA 4XV3A 2JKOA 1OUKA 1Q3WA 3PA3A 3WZDA 4AZSA 4E7WA 4EBVA 5EM5A 5CYIA 4GW8A 4TWNA 3A8XA 2XNNA 4DG3E 5C27A 3NYOA 4E20A 5KMMA 1MP8A 4HGSA 2Z60A 5E8WA 2XH5A 2XBAA 2XNOA 3OOMA 2CGWA 4G6OA 2JKMA 4FKSA 4IX4A 5A46A 4OUCA 2BKZA 1KV1A 1G5SA 4OLIA 5M53A 1NY3A 2GPHA 2KULA 3AQVA 3VS0A 1REJA 2XS0A 2YEXA 3JXWA 3O51A 4Q9ZA 5KKRB 4RIYA 3EQIA 5LCJA 4IAAA 4EQUA 4RFYA 2JDTA 4MF1A 4TYHB 3OW3A 3QZFA 3UP2A 3DQXA 5DYJA 4BTMA 4YJSA 1TQMA 4DEGA 5IQCA 3PFQA 5DA3A 4QMUA 4X2NA 3AMYA 3ZXTA 3AC3A 4FSRA 4QPSA 1YOLA 4F6SA 1IAJA 3EQCA 4G3EA 2J9MA 5I9UA 4U81A 3L9LA 2UZVA 3HRBA 2P3GX 2BILB 4IZ5A 5KHXA 3CJGA 2PVYA 3K5VA 4CZTA 4L45A 3QALE 4BVUA 5C01A 4CCUA 4YURA 2XCKA 4FNWA 4JRVA 2BFXA 4YLKA 4F7JA 2C6MA 3KRRA 5FBOA 4M68A 4L67A 3QRKA 4BIEA 4ALVA 3LQ5A 4YZBA 1QPCA 4QQJA 4CQGA 4IAZA 4JLCA 2JBPA 1W7HA 1P4FA 3Q9XA 2QODA 2OJFE 2OFUA 4RLKA 5DI1A 4FIHA 3ULZA 4CZUA 4RX5A 3MPTA 5C03A 2ITUA 3MY5A 3LAUA 4FKWA 3COKA 1YWNA 4FVQA 2QI8A 1ZYDA 3QUEA 3R1YA 5A14A 4EHEA 4QP7A 4D2RA 4OT6A 3DKOA 5J8IA 3V3VA 4KIKA 2XUUA 4BYJA 5AAGA 5CAQA 3ZH8A 2XIYA 4UMTA 4I20A 5CQUA 4FR4A 4PF4A 3DV3A 3QQFA 4FV1A 3MH3A 4CFVA 2R9SA 4FT5A 2R3PA 4GMYA 4QMVA 4XJ0A 3HMPA 5TT7A 3PJCA 1CKIA 2YCSA 2YIXA 3HX4A 2CDZA 1NVRA 4OAVB 2C5VA 3C1XA 4IC7A 4R3PA 4AW0A 3OP5A 3QRJA 4KB8A 4XP2A 5CT0A 4BBFA 4FGBA 3TZ9A 3QHRA 2Y4IC 4HNIA 2Z7QA 1BI7A 4S31A 3TG1A 1Q97A 4ANLA 3ZS5A 4X3FA 1R39A 3OUKA 2HZ4A 3FMJA 3RCJA 2ITPA 2EXMA 2YM6A 3RHKA 3L9NA 2VO3A 3KFAA 3PJ2A 4PMSA 2IZUA 3D5UA 2X8DA 3Q5ZA 3K3IA 4GCJA 4O7WA 3DNDA 5B2KA 3FKOA 4F6UA 4BZNA 3Q6UA 3LFBA 3PPZA 2QC6A 2C6OA 3KEXA 3PJ8A 3B8RA 3FMLA 5K5NA 4GVJA 3UNKA 3CLYA 4L46A 5EQYA 4PRJA 3VF9A 2WQBA 4FT0A 2UVYA 2G15A 2J51A 1JPAA 4Z7GA 3EQDA 5GIOE 3SOCA 3KMWA 1H1RA 2PVKA 3OUNB 3R0TA 5I3RA 5M4CA 4U9AA 5IH6A 5CEIA 3TNPC 4XG3A 4EZ5A 3EHAA 2XIKA 3FYJX 4YJTA 4KS8A 5HD7A 4YBKA 4CV9A 4ZMEA 4IAKA 4A7CA 4BCMA 1UU7A 2PVRA 3EYGA 5AV2A 3NUNA 3RP9A 4FF8A 2WFYA 3KREA 4FZAB 4AZEA 2GNLA 3QTWA 3BHHA 4XP0A 3W2OA 3D83A 4R8QA 4J71A 5J7HA 3OWPA 5FDPA 4PNIA 4EWQA 3UDBA 3UOJA 5FEDA 5IQFA 2OKRA 4AE6A 4DINA 5E8XA 4ZTNA 5E90A 2V7AA 3OC1A 3QA8A 4FTMA 2JDVA 3DB6A 3MN3A 2WEIA 3C4EA 5A4TA 1IAHA 4FEQA 3ZTXA 1JAMA 3CCNA 4QMSA 3PRIA 1NXKA 3MFSA 4QP8A 4WOVA 3VS7A 2CPKE 2NPQA 2UV2A 1KE5A 1FQ1B 1NA7A 5JRQA 5CSWA 4QYFA 2VWUA 3OWJA 3EL7A 2YZAA 1J1BA 4ANQA 2OLCA 3I4BA 1UKIA 3BHUA 4F1TA 5M4IA 4IEBA 2GU8A 1BKXA 1BUHA 2CKEA 1FVTA 3BQCA 1F3MC 3PE1A 2BAQA 4FSUA 3FKLA 2QHMA 1M17A 4JG8A 4D4SA 2Z02A 1OKVA 4Q5HA 2B55A 4QOXA 3TN8A 2QLUA 5JFSA 2QHNA 4GK3A 2OXDA 4FIEA 2DS1A 3GCSA 4U3ZA 1YI6A 1DAWA 4PWNA 4X6QC 4YJUA 1KWPA 4ZZOA 4TKSA 3BIZA 3ZBXA 3E63A 5H2UA 3PXKA 5FWKK 4HCUA 1V1KA 2Y0AA 2VX3A 4BDFA 1OPLA 4D5KA 4TWPA 2OFVA 4LOOA 2OF4A 4UZHA 4OTDA 4GT4A 1H01A 2O8YA 4F1MA 5EHLA 1GY3A 3NR9A 4RJ8A 4YZDA 3RAKA 1U54B 4EZ7A 3R9HA 4QO9A 1PW2A 1FMKA 1WMKA 1XH8A 4L52A 4FBXA 2OH0E 4CGAA 2O5KA 2BRBA 4AP7A 2VWWA 1V0OA 5CVGA 2R3MA 4IVBA 1W0XC 3A62A 2UUEA 3PY0A 4YP8A 5EQEA 2UZUE 5JFWA 1URCA 2VO6A 1B39A 3EIDA 3NW7A 4E4MA 3A4PA 1B38A 4RT7A 2XK4A 3LFEA 3TEIA 2VTJA 4USEA 4FICA 4ID7A 3FWQA 5L8JA 5AM7A 4H1JA 4CNHA 2OJGA 3DCVA 4CD0A 4EONA 5HTCA 5M4UA 3P08A 4OW8A 2EVAA 4IDTA 3JPVA 1UKHA 1PJKA 2H96A 3C13A 3GCVA 3QYZA 1W98A 4OT5A 5T68A 4AF3A 2JAMA 3IW6A 3AC2A 2WOUA 3QZIA 5LWNA 3C4ZA 3TZ8A 3ZDUA 2WOTA 4KIQA 5DWRA 3QTZA 4S33A 5HBJA 3DJ5A 4HVDA 3LHJA 3U4UA 3PIYA 1OIRA 4FTTA 3VRYA 1UA2A 2HYYA 3G6HA 4AN2A 4AT3A 4L7SA 4EJ7A 3TNIA 3KXHA 4EH8A 3BLHA 2WU6A 3OCBA 4XOYA 3HV5A 5CAVA 1H26A 4O7TA 3TKUA 4UYNA 5CANA 3E3BX 2YN8A 3T3VA 1Q61A 4XV9A 3FLZA 4F09A 2OJIA 4DGMA 4M69B 3UZPA 5CAPA 2C4GA 2JGZA 2YAAA 5AV3A 3WF5A 3RM7A 4OTQA 3H9OA 4FYNA 2VN9A 2W96B 1JQHA 3EKNA 3NUAA 3SD0A 3OD6X 4KBKA 4APPA 3NVMB 4J96A 4BGQA 3HUCA 4BDKA 5CEMA 4KIPA 4R1VA 2DQ7X 4U41A 3LJ2A 1JLUE 4FT7A 4NIFB 4D4YA 4QD6A 5EM6A 2UW9A 2R3RA 1L3RE 4BTJA 1YDRE 2EB2A 1J7UA 3F82A 1IASA 4F08A 2UW8A 4CMTA 1CMKE 4W8DA 3Q4CA 3W16A 4D2WA 3NNXA 4E5AX 2BRGA 3HLLA 1UNGA 3V8SA 5HE3A 2W5BA 5H8EA 4GVAA 4MNEB 2EXCX 4QTCA 5AUVA 2B9IA 4EK4A 4FVPA 2XK7A 4HYUA 4IANA 4RIWA 3RK9A 5J5TA 4FK6A 2XK6A 4JJRA 4IHPA 3C50A 5A6NA 1M2QA 2A19B 2J2IB 3SKCA 4D2VA 1GIJA 4XG6A 3R83A 3SG8A 4TNBA 3NRMA 2R2PA 4WHZA 3ANRA 5EHOA 1K2PA 2E9OA 2OJ9A 2BRNA 2J0MB 3BHTA 1GNGA 4E73A 4FTRA 3BBWA 2ONLA 4DG0E 4YGAA 3ZZWA 2QO7A 3FMDA 1CM8A 2WELA 4RA4A 2V62A 3QWKA 3UG2A 4HZSA 3NDMA 1OITA 3S95A 2GNJA 3RPYA 2CKPA 4FEXA 4S32A 4DCAA 1PXKA 3FV8A 3C5UA 2OWBA 3LZBA 2WAJA 2ZM4A 2UZLA 3C0HA 4FG8A 2XKDA 2PMOX 4KBCA 3SW4A 4AG8A 4KNBA 3FKNA 3HRFA 4RLLA 4X2GA 1JSTA 2ITQA 3TUBA 5IQAA 4PPCA 2GNFA 2XK8A 4FV3A 4M15A 4QYGA 4YR8A 3M1SA 4D2SA 3ROCA 4ACDA 1OKZA 3V8WA 3R7OA 3TJCA 5BUEA 4AA5A 2J90A 3ZC6A 5KMKA 4D5HA 5HQ0A 3O8TA 5CZIA 5TOZA 1BYGA 4IWQA 4AGWA 4TYHA 2B1PA 3HL7A 3OEFX 2A2AA 4KKHA 5BVFA 2Y4IB 4DEAA 1KE9A 5DEYA 5IUIA 4LUEA 3FYKX 5AJQA 5FTOA 4C61A 2A0CX 4G34A 3UMWA 4YC3A 3RAWA 2W1ZA 4BGGA 1MQ4A 3EL8A 5IDPA 4QMQA 4KINA 3IW5A 3I6WA 4C0TA 2XCHA 4L9IA 5A4CA 3PDTA 2ZMDA 3FMEA 4U43A 1WVXA 2R3QA 2CJMA 4F0IA 4DN5A 1R78A 2E9PA 2ESMA 5IA4A 3F61A 2CNVA 3VNTA 2ZM3A 4PMTA 4I92A 4WBBB 3AD6A 4BWPA 1SNUA 4G6LA 4NT4A 4FKPA 4E4XA 5JK3A 5KNJA 3EB0A 3UVRA 3AMAA 1IRKA 4GIIA 4O0TA 1ZARA 1M2PA 1XKKA 1GOLA 3FSKA 4LGGA 3ZM9A 3GU8A 3ZHPC 4WT6A 4YJPA 3MIAA 3PJ3A 2NP8A 4F9BA 4WO5A 1BL7A 5CU3A 4BDBA 2W06A 4XLVA 4JS8A 4C3FA 4IMYA 5CEOA 2KTYA 1WCCA 3RK5A 3CTHA 4JXFA 1Y57A 2VGPA 4Z55A 3ENMA 2QNJA 4NL0A 2WNTA 4XG9A 4ZIMA 5CU0A 5HIEA 2W1FA 2I0HA 3GFWA 3KRWA 1E1VA 4WNPA 1H1PA 4KKGA 4D1SA 2CNUA 1PMUA 4IX5A 2WMWA 4GK4A 2CHLA 4QMOA 3LXLA 3QA0A 4IJPA 4AZTA 2YACA 4UY9A 3P23A 1ZYSA 4JDKA 2PVFA 2HY81 4JAIA 4FIFA 5ACKA 4BDIA 2J0JA 3PA4A 3D2KA 3I7BA 2J5EA 5IKWA 2RKUA 2E2BA 2R5TA 4QP3A 2BZHB 3QQGA 4YLJA 2IVSA 4EH2A 4WD5A 3AG9A 4AT5A 4TL0A 5JGAA 3O96A 2R3IA 2BRHA 5FBNC 1CSNA 2EXEA 3HZTA 5HBHA 5EOBA 3NS9A 4NM5A 4AN3A 4D2PA 3F5GA 1KSWA 3GB2A 3VUHA 3A60A 3G9NA 4I5CA 4BCOA 4GFGA 4MD9E 1IEPA 4I4FA 1YVJA 4O96A 5HLNA 2F2UA 4QTAA 3DKFA 4AGUA 3A4OX 3PY3A 2GTNA 3DS6A 3SOAA 2QR8A 1IR3A 3QCSA 5AV1A 4EH5A 4K77A 3VUDA 4BFMA 3TZMA 3CD8A 4CMOA 3C51A 3UC4A 4BCNA 2XYUA 3BEAA 2J0KA 3ZO2A 4IZAA 4OTWA 4U97A 4ERKA 2BR1A 3HAMA 4U80A 3EJ1A 2QKWB 3PG3A 2HIWA 3GOKA 3NIZA 5L2QA 2WTJA 4F0GA 3PZEA 4RJ5A 3WZEA 4F9WA 1RDQE 1ZMVA 2FH9A 4J7BA 4YJVA 4DFLA 3OZ6A 4YTHA 2QOIA 4BI0A 4YHJA 4FNXA 3RHXA 4A9UA 4C2VA 5HX6A 3MJ2A 3ZLWA 2YCQA 1JKTA 3VUGA 3HMIA 4B7TA 4GG7A 5CASA 3LFAA 4DFUA 2Z7LA 5ANKA 1YXXA 3PVWA 5HEZA 4FA2A 4LV8A 2W05A 3OT8A 3TCPA 4CFMA 4PNKA 3CPCA 4BYIA 4BCQA 5FP5A 4GUBA 3LQ3A 2WMAA 3OCGA 3QTRA 5I9WA 4WG3A 1TQPA 5J7BA 5L8KA 5C4KA 2WMUA 3IDBA 2R7IA 1W84A 3QGWA 5HE0A 3D2IA 5JZJA 3OWKA 4YJQA 4C7TA 3QUPA 4I94A 2WTVA 4BCGA 2HAKA 4C36A 5M09A 5DPVA 2QR7A 2Q0NA 4IAIA 4JBPA 4QTDA 3SLSA 4E6AA 4Y72A 3MYGA 1NVSA 1ZXEA 3ZLYA 3DPKA 1YKRA 2V0DA 3T9TA 2Y7JA 4PDYA 4LYNA 2VTSA 4IW0A 3R9RA 2I0VA 4NCTA 4W9WA 4YC8A 4I6FA 5ETCA 5J5SA 3FZ1A 5BMMA 1ZZ2A 3KN5A 2ITNA 4R6VA 3DGKA 4PP7A 4BN1A 4W4XA 2XJ2A 5CT7A 3IKAA 3RM6A 5I3OA 2WTIA 4NSTA 1T46A 4RC3A 5CLPA 5LMKC 3QRUA 5IMXA 3RVGA 3HKOA 1Y6AA 1REKA 3ZO4A 1ZOEA 4A9SA 2W9ZB 2VU3A 4TTHB 2Y9QA 4BY9E 4FKGA 4M0ZA 3MWUA 3ACKA 3PZHA 2QVSE 2YDJA 2WMRA 1U54A 2Y4PA 4RFZA 4DH7A 5AA8A 2V22A 3ZO3A 3NLBA 4GKHA 2WMXA 3LFFA 4FOCA 4ZY4A 3GCUA 3HV4A 3DTCA 1RQQA 4UALA 4BTKA 4O7NA 2WZJA 3AD4A 3VO3A 3AT3A 5EYKA 1XO2B 3QGYA 5IZFA 2UVZA 1YXTA 4G31A 2R4BA 4RVMA 4CFWA 2YISA 5L2IA 5F94A 1FVRA 1PXIA 3FDNA 4GU9A 4ONAA 2C5NA 3P4KA 4GUEA 4DH3A 4G5PA 2HELA 2R3OA 3NNVA 3PLSA 1UWJA 4Y5QA 5CQWA 3VBTA 2JDOA 4BDJA 5A4LA 4A9TA 3KK8A 2UW7A 3MVLA 4IM2A 4QTBA 3WF8A 2X7FA 2ZVAA 4R1YA 1VYZA 2WXVA 5C26A 3A7FA 3FLQA 4F64A 1QPJA 4ACCA 4IE9A 3RALA 3TWJA 5IU2A 3ATSA 3K5UA 5I9ZA 2NNWB 3IGOA 3CBLA 4RVTA 2XKEA 4QMZA 3DY7A 3WILA 3KKVA 3MB6A 3IOPA 3R9DA 5IUGA 4O0SA 3HVCA 4HW7A 4FX3A 3F88A 3R1SA 4AA4A 4JOAA 3N4UA 4HOKA 2XK9A 3TJDA 5JQ8A 3HP5A 4OTHA 4QMLA 3FC1X 3FZTA 3WOWA 5DRDA 2CGUA 3ZUTA 4CLIA 5HX8A 3G0FA 4IWOA 4M69A 5LARA 3R8UA 1XH9A 2AYPA 2IVVA 4L44A 5E8SA 1WBSA 4TXCA 2O65A 3A7GA 4GYGA 3LCOA 4EQMA 5AR2A 5L3AA 3QD3A 3RK7A 3R1NA 5DR2A 4QYYA 3LLAA 5LWMA 1VR2A 4O6EA 4FZFB 4UWCA 4C4GA 4ERWA 4NIFA 3U51A 3EKKA 2AUHA 4XNEA 1PKGA 5JT2A 4EOKA 2X2MA 4IWPA 5EDRA 4E4NA 2QO9A 2OICA 5IEXA 3P7AA 5HG7A 4B9DA 3OG7A 4O84A 1SVGA 3GVUA 4M12A 4BIDA 4J97A 5ITAA 4ZTRA 1AQ1A 5AUYA 3IQ7A 4TYGA 4MNEA 2Q0BA 2ZV9A 3ZLSA 4A4OA 1ZWSA 5K4JA 2IZSA 2BZIB 2PU8A 3LLTA 1ZMUA 4M3QA 1MRUA 2F7EE 3DJ6A 3PJ1A 4MXOA 4G1WA 4NJ3A 5CEKA 5IPJA 4GRBA 3NAYA 4Y5HA 1YXVA 3VS2A 4E1ZA 1OBGA 4OBPA 3V8TA 5EG3A 4I3ZA 4DTBA 3HDNA 4U8ZA 2C0IA 3R1QA 4AACA 4ALWA 4D0XA 5TKDA 2B9JA 3QUDA 5M44A 1YWVA 2OZAB 2R0UA 4FL3A 5FDXA 5J9ZA 5L6OA 4BDDA 1Q8YA 1XHAA 4C33A 2B0QA 5IQDA 2IVTA 3UO6A 3DTWA 4RBLA 3ZRKA 3CQUA 2UVXA 3ZM4A 3ORMA 4O21A 4RA5A 3GFEA 2OSCA 3EQFA 4YZNA 3W1FA 4F1OA 5KMIA 3CIKA 1CDKA 2UW5A 4WNMA 3I6UA 4LFIA 1LEWA 3TTIA 4Y83A 4FKIA 4RQVA 5BVNA 3CGFA 1KOAA 4BBMA 5AMNA 2WD1A 3I5ZA 3GEQA 3VHKA 3V01A 2BDFA 2VTMA 3OCTA 2WKMA 4KIOA 4UWYA 4W4WA 4WRSA 5L4QA 5BX0A 4EK6A 2YIRA 3ORZA 3OXZA 4MXXA 3R7IA 3ANQA 3BHVA 5FEEA 1U46A 4L53A 3KA0A 3NEWA 4JX3A 4O0XA 4USDA 4EORA 2W7XA 3MGYA 3VS5A 1WBVA 2V5QA 2XK3A 3E92A 2XB7A 4AW5A 1OZ1A 4DEBA 2C0TA 3D7TB 2UZOA 4O0UA 3RTPA 5KMJA 3OT3A 3Q5IA 4PDSA 4X21A 1Q8TA 2QOBA 2WTCA 2CLQA 3LCDA 2VNYA 2X4ZA 4LRKA 3TNHA 1GZ8A 2I40A 3P7CA 3PXYA 4I5PA 1Y6BA 4U0IA 5DN3A 1DI8A 3ZO1A 5BPYA 2PZRA 5I9YA 4I5MA 4GJ3A 2BROA 5AUTA 3BE9A 1PYEA 2C47A 5AUUA 3DB8A 1HCKA 5I0BA 3LJ0A 5CNNA 4IXPA 4S30A 4V0GB 5FRIA 1URWA 2JEDA 1A9UA 5AP4A 5HNGA 4MQ1A 2UW6A 2YM8A 2Q83A 5G6VA 4BHNA 2GTMA 3DT1A 5IG1A 5HO6A 3BWFA 4HVHA 2ZAZA 2VTPA 3NUXA 4O86A 3D0EA 3TKHA 1BLXA 4LQMA 2IJMA 3V51A 4QPMA 3EH9A 4RX8A 2CLXA 2CSNA 2FVDA 2ZMCA 3LCTA 4EHZA 1OUYA 1W82A 3ZYAA 3R9NA 3E8EA 3E88A 2E9UA 1M52A 4XP3A 5M4FA 5DT0A 3OOGA 4PPAA 4W8EA 2VWIA 4RC2A 4NK9A 2XKCA 3Q60A 3SQQA 5LJJA 4PL4A 5FXRA 4OBOA 4O83A 2BZJA 5E8TA 3AC8A 1P5EA 3ZCLA 3NW6A 4YZ9A 4BKZA 4D9UA 1MQBA 4ZS4A 5CF4A 4QNYA 5M08A 5AEPA 4FSZA 4FT3A 4LGHA 4YMJA 3PA5A 3FLWA 1Q3DA 3OXTA 4PL5A 4C59A 3LW0A 3Q4ZA 5IEYA 3C4XA 1K3AA 2X1NA 3OS3A 4G3DA 4FV6A 4ZLZA 4WUNA 5BVWA 3ZLXA 3NUPA 4C4HA 4KABA 3S4QA 5EI2A 4I23A 3A8WA 1TKIA 4JQ7A 4ASXA 3UQGA 4F7NA 3HA6A 3WIKA 4F7SA 4E26A 2ZYBA 3PY1A 4O2PA 5CSHA 3AXWA 5M06A 2YIQA 5GHVA 3SXRA 3OCSA 3VS1A 4UMQA 2R3HA 5AR8A 2C0OA 4EOQA 3CKWA 3EFJA 5AUWA 3FMHA 5LVNA 3UZTA 3R00A 4RX9A 4UYAA 3TACA 1UNLA 4TW9A 3RMFA 4K1BA 2BKKA 2JLDA 3KULB 1X8BA 3NCZA 5IQBA 4QP6A 4R5SA 2BVAA 3THBA 2R64A 4XMOA 4IVAA 2IW9A 2HXQA 3COIA 4NM0A 3QQJA 3G0EA 3RBWA 2G01A 2JBOA 3LFDA 4RPVA 3S0OA 2OG8A 1RW8A 1OIQA 1F5QA 4YTCA 1KE6A 3KCKA 4N6ZA 3U87A 2OBJA 3G33A 4J52A 4J99A 4RVKA 5AWMA 5C9CA 5I9VA 2CKOA 3PXZA 4HGEA 1WBNA 2IZRA 2BALA 2VGOA 3FHRA 3LCSA 3NYNA 3GQIA 4H36A 2WU7A 4JNWA 3TTJA 4Q9SA 3MH0A 2UZEA 5CALA 4DH1A 5I9XA 2ZJWA 3AGMA 3WE4A 5AUZA 3FZSA 4DFBA 4MQ2A 4MKCA 4O7LA 3LVPA 3FMMA 4HCTA 3JVSA 4JDJA 1FGKA 5KCVA 2UZWE 2E9NA 5CS6A 1WFCA 4G5JA 3ETAA 1SM2A 2XRWA 1XH5A 3CGOA 2VWBA 4U5JA 2GHGA 3RINA 3RPSA 3UTOA 2WTKC 4JDIA 4CRSA 2P2IA 3TM0A 4N4SA 2VTHA 3FY0A 3MVMA 3C4FA 2R3NA 1JWHA
chains in the Genus database with same CATH superfamily
3IGGA 4UEUA 1Q99A 5JMSA 5LOHA 3TT0A 4YTFA 4OTPA 4K8AA 3A99A 2LGCA 3L8XA 3SGCA 2W4OA 3UIMA 3E64A 4ZLYA 4YHFA 2PTKA 5C8KA 4MVFA 2UW0A 5E8UA 5C4LA 3QTUA 4KBAA 4FKVA 3EN6A 3GI3A 3KXZA 5K4IA 1SMHA 2FA2A 4I1ZA 2OF2A 5HTIA 4IJ9A 2HY0A 4X3FC 3UYSA 1VLRA 3OVVA 4O0VA 5HCZA 4LV7A 2JC6A 4IB3A 2JIUA 3V5PA 2VTOA 4HYSA 3BU5A 3GUBA 4JG7A 4XS2A 4FTJA 3V6RA 2PZPA 3VS3A 4E6DA 4FKJA 1O6YA 5JSMA 3GBZA 5KHWA 4B8LA 5L6WL 5BV3A 2GQSA 2R3FA 4AFEA 2CNQA 4AOIA 2PUUA 5DH3A 4MXCA 3G90X 5DIAA 4C4IA 3COHA 3VC4A 4CMUA 2XRUA 4GG5A 1UVRA 2CKQA 5EI6A 4FV5A 4ANBA 4M97A 2PZ5A 1UNHA 4DFZE 2PHKA 5KBQA 3KRLA 5AR7A 5HU9A 5I4NA 1TQIA 2B54A 3O17A 3ZU7A 3BRBA 3LPBA 5EH0A 3LM0A 4HVGA 4L01A 3ULIA 2FB8A 1JBPE 3PSBA 3TZ7A 2CN8A 5H8BA 3IECA 3DDPA 3QRIA 4L8MA 5A3XA 4FTCA 4E93A 4JR3A 2C6KA 3Q3BA 4L43A 4RMZA 2OI4X 3FZRA 1CKJA 2PE1A 2XIRA 3IDCA 3AC5A 4JBQA 4BCIA 3HV3A 3GU4A 2ZM1A 4XEYA 4GV1A 3V6SA 4N57A 1KOBA 2RL5A 4GS6A 3R73A 3P5KA 3GU5A 3CTJA 2PPQA 3AGLA 4EOOA 3MBLA 4Z3VA 1YW2A 4C3RA 2O63A 3BYUA 4AGDA 2YDIA 3Q9WA 4NW6A 3QHWA 3C4WA 5EDPA 2QCSA 4JG6A 4IC8A 5FEQA 4IFCA 4AA0A 4ORKA 2GHMA 5CU6A 3QXOA 5FP6A 2YWPA 2REIA 3TI1A 4MBJA 3BYOA 4JIAA 2GDOA 4IFGA 5GJGA 2ERZE 5EKNA 1YI4A 2B4SB 3W0SA 4FTNA 3QQUA 1GZOA 1H24A 4AS0A 4KUJA 4DBXA 3DBCA 3W0RA 2YJRA 3ML1A 1QPDA 3QL8A 3GC8A 2FO0A 4EOJA 2ETRA 4I6QA 2OJJA 4XBRA 2PUIA 1Y91A 3JY0A 1UU8A 1J7IA 1PXJA 4PDOA 4QP1A 1Z9XA 3P1AA 5CENA 4DFXE 3EMGA 3KXXA 2I7QA 1PXPA 4FKUA 4DGNA 3K2LA 3UP7A 4A4LA 4B8MA 3BPRA 4H1MA 3RAHA 4PL3A 3NAXA 4W4YA 5HO8A 5HU3A 5KUPA 4DHZA 4GJ2A 1Q41A 1YWRA 3DBQA 3MFUA 3QXPA 4Z9LA 4ZJVA 4CQEA 5TE0A 3CR0A 3SHEA 4XV2A 1IA8A 4EQCA 4UMPA 2RFEA 4FSNA 2P55A 2ETMA 2QOLA 3SRVB 1HOWA 5JRSA 3PLAE 4X6RA 4F65A 5FM3A 4FVRA 4KSQA 4XG4A 4O6LA 5CU4A 1Q5KA 4GIHA 4EH4A 3F5PA 4GFMA 4I6HA 4JIKA 4R3RA 5E8VA 2EB3A 2OXYA 3HUBA 5LVLA 3SA0A 3R21A 3ITZA 2QG5A 4F4PA 1DS5A 2Z8CA 2VAGA 5DNRA 2RSVA 2UZDA 5DG5A 2C6TA 3UIXA 3V5TA 4QMXA 2OZAA 2XP2A 3DK3A 4FTIA 5CWZA 3QQLA 3TKIA 3NUSA 2VUWA 3ODZX 4EYMA 3R30A 5ACBC 3C5IA 2A1AB 2WIPA 2J4ZA 2YFXA 4RFMA 4BCPA 5JZNA 3TDWA 1GZNA 4CZYB 2QD9A 5CI7A 4EI4A 1RJBA 3ZUUA 3UYTA 4AXFA 1Q8ZA 1CTPE 2VTIA 1WAKA 3ET7A 5D1JA 3HAVA 1E1XA 2XAMA 4RSSA 1OECA 4FV2A 4BF2A 4RJ6A 2J6MA 5F4NA 3E8DA 3BHYA 3EQPA 4XX9A 2G2FA 2VTLA 3HGKA 3MTLA 4O82A 1ZY5A 4Y46A 4QQCA 5F20A 5CY3A 4NKAA 3ORTA 4FEVA 1OMWA 3VQHA 4O38A 2VTRA 4YHTA 3CP9A 3F7WA 4EC8A 5AFVA 4MD8E 1OIYA 5DEWA 2GSFA 4PMMA 2BDWA 3UPXA 4D4VA 3OW4A 4PP9A 1YXUA 3TL8A 4BHZA 4BRXA 4UMRA 1XMLA 4UN0C 4FUXA 4AOTA 2F2CB 4OBQA 3HYHA 3EZRA 3II5A 5CF6A 2B9FA 3KL8A 3TDVA 4HGLA 2R3GA 1TFFA 4O0RA 4ZMFA 1R3CA 3O71A 3D7TA 5KE0A 4HZRA 2R3KA 4P7EA 1XWSA 3QCYA 1MRVA 3WZUA 4P5ZA 4C58A 3EQBA 5EM8A 1OBDA 4LL5A 5IQIA 4TT7A 3D94A 3QWJA 4UXLA 4PPBA 2YZLA 4AW2A 3Q52A 1O6KA 3BI6A 4X3JA 2IVUA 4V0GA 2X8IA 3VIDA 5BVDA 4XYFA 4CYIA 3QLGA 4GT5A 4RC4A 4DF3A 3HMOA 5AM6A 4IB1A 4WA9A 3KN6A 4YSJA 3ZSHA 4XG7A 3V04A 4C4FA 4M13A 2BHEA 4AFJA 3M11A 2ZOQA 1GZKA 1R0PA 5AR4A 5DT4A 4KAOA 3UJGA 3UIBA 1ZYJA 2X2KA 3MPMA 3H30A 4Y95A 3Q9YA 4B4LA 3W0NA 1OKYA 2YA9A 2OZOA 2DWBA 2WQEA 4RZWA 4ANMA 3GOPA 4K18A 5F9EA 5IA3A 5TR6A 5HVJA 2CGXA 2O64A 2JDSA 3OTVA 5AIKA 3EQRA 3UO5A 1XJDA 5HG8A 4DLJA 3K54A 3O2MA 3VJNA 3Q6WA 3ZXZA 4O7VA 3VHEA 5FUTA 3U9CA 2IO6A 2FGIA 3Q53A 4L7FA 2WTKB 1FPUA 3R7GA 2CCHA 1GJOA 2OO8X 2VRXA 3D9VA 3NX8A 4H3QA 3W2CA 3NIEA 1YRPA 2VO0A 1L8TA 3R8LA 4WG4A 5HLPA 1JNKA 3E7OA 4L00A 5C8NA 1VZOA 1PMVA 4YPSA 2PULA 2VD5A 1XBAA 4ZTQA 4ANNA 4EKKA 3VBQA 5AR3A 1Y8GA 4EEVA 4HVIA 2F7ZE 3W2RA 2VX0A 2G2HA 4YC6A 4ZSLA 4FNYA 3BX5A 2X0GA 5GZAA 2B9HA 1YHSA 5GJDA 1ZYLA 4FUYA 4F99A 4TPTA 2YCFA 4F7LA 3FLNC 1AD5A 5KO1A 2BTSA 4EK3A 4ZTHA 2VZ6A 4TYJA 3SW7A 4BR3A 3PVGA 3KULA 1XBBA 2BAKA 4LM5A 5E8ZA 5DR6A 5EI8A 1M2RA 5AP0A 4AE9A 2FSMX 3HNGA 4RWKA 5CSVA 2PYWA 1P14A 3GT8A 1J91A 3FXZA 4DFYA 5GIPE 2XALA 5A4EA 4BJJA 2VTNA 4YJOA 3PP1A 2BUJA 4HCVA 2Y6OA 2BTRA 1R1WA 2ITOA 3AMBA 3C9WA 4JAJA 2C6DA 2P33A 5BYZA 3F3UA 1PY5A 4ZSAA 2H6DA 4EH3A 4NEUA 3QX4A 2GS7A 2VWXA 4WNKA 5HGIA 3PUFC 4O81A 4LV5A 2X7OA 4ZLOA 1W83A 1GIIA 3UBDA 3W8LA 4TRLA 5CNOA 1PRYA 4FJVA 3CQWA 4R78A 1H8FA 3VAPA 2W9FB 3G15A 3L1SA 4PTCA 3RI1A 4H39A 2CGVA 4G2FA 2RIOA 4N70A 3REPA 3W32A 3MH2A 4FMQA 5I5ZA 4H58A 4S2ZA 2GS2A 3D5WA 3FBVA 3QQHA 3W8QA 4O22A 4CG9A 3QQKA 1H00A 4AZWA 2W1HA 4RQKA 3MW1A 4FOBA 3ZDIA 3NYXA 5HG9A 3VS4A 2X0OA 4I0TA 3LFCA 5LMBA 4WRGA 4ZAUA 3UOHA 4ZZMA 1U5QA 3BGQA 3GGFA 4H3PA 1KV2A 2BHHA 2F7XE 4RIOA 5GJFA 3W2PA 5ANIA 4ANSA 3D4QA 4PY1A 2P0CA 3QKMA 4M8TA 5D7VA 5FQDC 2YJSA 3LIJA 4GSBA 2XJ1A 3ZOSA 4WNOA 5AP1A 4HPTE 4NU1A 2WHBA 2Z7RA 4A9RA 1JSUA 2J0LA 4DG2E 2C5XA 3OY1A 4IAYA 2FSOX 3CTQA 4GL9A 4D4RA 4M66A 5HESA 4JMQA 3QTIA 2ITYA 1KE7A 3H0ZA 4IX3A 5DGZA 3RWQA 3O23A 4LRMA 1LEZA 2O3PA 4R7BA 4MHAA 4X0MA 3NFGB 4W4VA 2W0JA 2W1GA 1ZAOA 5KZ0A 2R0IA 2YERA 4FKOA 2EU9A 3I81A 3D15A 3MS9A 2ETKA 4MBLA 4EK5A 3R04A 3H3CA 5E92A 2QOHA 2GCDA 2QOOA 5FTGA 2AC3A 2ITTA 4ACHA 5D41A 4C35A 4F63A 2VTTA 4FSQA 4EHVA 5M51A 5GINE 2QU5A 3N9XA 5B2MA 3VF8A 1Q8UA 3BU6A 4I6BA 4FEUA 3ID6C 3Q4TA 1SVEA 4Y85A 2ZDTA 3RPRA 4LOQA 3E93A 2HZ0A 3SVVA 3QTQA 3PXQA 5HE2A 3LXNA 3TUDA 3PIXA 3D5VA 3MV5A 3PVUA 4QRCA 3CEKA 3UVPA 4CV8A 5LVOA 3U54A 5DLSA 4HPUE 5E91A 3R7VA 5D12A 3HECA 1OB3A 5IMEA 4UV0A 4AAYA 3L8SA 4ARKA 2XEYA 3QX2A 5EW3A 4MEDA 4XV1A 3ZFYA 3Q9ZA 5E4HA 3GU6A 5JGBA 2ZFYA 1SNXA 4IAFA 3FE3A 4P4CA 3NVKI 1DI9A 2ITXA 4UWBA 1ZMWA 2XKFA 3FJQE 5H3QA 2A4LA 4FSYA 4EUUA 1UV5A 2HZNA 4CFXA 4UXQA 5HHWA 3LE6A 4NJDA 3MJ1A 5AX3A 3H9RA 1VJYA 4FTOA 4EH9A 4H05A 4BBEA 3KGAA 5AX9A 3EWHA 1K9AA 4ZY5A 2W1EA 3G9LX 4Z7HA 5M57A 3UQFA 3JS2A 3G5DA 2HENA 4ZS0A 4P90A 3E8NA 4C4JA 3OWLA 3LMIA 3PPKA 2UZNA 1XH4A 4XRJA 3T3UA 3ATTA 5H8GA 3A2CA 4M84A 1S9JA 3FQEA 3IO7A 3NCGA 3WIGA 5E7RA 2UW3A 4DEIA 4EOPA 1YDTE 2QQ7A 2C68A 4O1PA 5TF9A 1NW1A 5IF1A 3QAME 4DCEA 1W8CA 3F2AA 3KMUA 2XIXA 5HD4A 3NW5A 5IH4A 3UE4A 2IF8A 4OTFA 4HGTA 1UU3A 4JDHA 4UB7A 3VW8A 2H34A 3SRVA 2JDRA 1UU9A 5EDQA 3F69A 3F3VA 5HE1A 4TWOA 3VRZA 2GMXA 1YXSA 3E87A 5GZ9A 4MXZA 5AAEA 1ND4A 3UGCA 4CKJA 3FL5A 2VWVA 2WMSA 3ACJA 4QYHA 4U42A 1UWHA 4MXYA 4DDGA 3A7JA 4E6QA 4KS7A 3KRJA 1SYKA 3HV6A 2C3LA 1YDSE 3FI2A 3PUPA 1OL1A 5ETIA 3R8ZA 3FSFA 3PIZA 5EKOA 3CY2A 4IACA 2CMWA 2PWLA 3IK3A 4YNOA 3ZZEA 3PXRA 4B6LA 2YM7A 3KXMA 5KMOA 4FV9A 4PV0A 1GAGA 2IPXA 3HV7A 4ZJIA 3VVHA 2X7GA 3NPCA 2GNGA 2PK9A 4RJ4A 3HP2A 1NT2A 2WMBA 1OI9A 1P2AA 4K11A 3DU8A 3RAIA 4HVSA 5HG5A 2XARA 4NKSA 4JI9A 4DEDA 2BPMA 3R6XA 4NFMA 4YO4A 1F0QA 4O2ZA 3W10A 5BUIA 2FUMA 4WKQA 3R7EA 4X7QA 4BCHA 4FGRA 3HEGA 2VWYA 3PSDA 4FKQA 2C6IA 4TWCA 2G1TA 4Q2AA 5EYDA 3NNWA 2HXLA 4QMYA 4QT1A 3R7UA 3OEZA 3WI6A 3PPJA 2XNMA 3DOGA 4RVLA 3U4WA 3PVBA 4L3PA 3L9MA 3MY0A 3RCDA 5E8YA 4WG5A 2H8HA 2YLFA 4FZ6A 4R7HA 4M14A 3JY9A 3DZOA 4D9TA 3CS9A 3BWJA 2X2LA 3OBGA 4D58A 3QF9A 2O0UA 4O27B 1J7LA 4YTIA 2IN6A 2QOKA 4YJNA 3LFQA 4PDPA 3FI4A 4LGDA 2NRYA 4DLIA 2HW7A 4C8BA 5LXMA 1P4OA 3EZVA 5DVRA 5IEVA 2GQRA 2IZTA 1JKLA 1OPJA 3KCFA 1OL6A 4G3CA 4BI2A 2GNHA 4BTFA 4XCUA 2RG5A 4A9YA 3PG1A 5M07A 3KU2A 3R8VA 3UDZA 2GQGA 1ZYCA 5E1SA 2XNEA 3QBNA 3O8PA 4FC0A 3ALNA 3GU7A 5IA5A 3ZEWA 4BC6A 3OY3A 3FC2A 4C38A 4IB5A 4ZJJA 4QP9A 3P7BA 4E3CA 3QTXA 3EN5A 4DEHA 4JL9A 1TVOA 3TV7A 3DJ7A 2W99B 3AC1A 3OMVA 3O7LD 4JT3A 4ALUA 5CEQA 2R3LA 4C57A 4GFOA 1IA9A 1SVHA 4YUQA 2A98A 3CQEA 3IDPA 4MTAA 5ANJA 4AZFA 2ZV2A 3RZFA 3B2WA 4AN9A 5CXZA 4FIJA 4CT1A 5KMNA 1A06A 5JFXA 5C8MA 3MB7A 5EYCA 3KF4A 1ATPE 5AP5A 4IWDA 1QPEA 4LMNA 2HWOA 1STCE 3ERKA 3ORXA 5HCXA 1YQJA 4G3FA 4F70A 2ZV7A 4FG9A 3Q2MA 4J8MA 4AUAA 1WVYA 2BFYA 2FSLX 3CSVA 4I5HA 5B7VA 3MIYA 4MAOA 3Q96A 4K2RA 5K0XA 1AGWA 4IBMA 1OKWA 3CE3A 4YSMA 5DOSA 5EFQA 3BKBA 3CY3A 4CKIA 3D14A 4JQ8A 3Q04A 4XBUA 4MNFA 3FHIA 2PVLA 3TNQB 4AXDA 4MYGA 3NZ0A 4JVGA 2P4IA 4DGLC 3VUKA 2F49A 2XNPA 3U55A 2X0PA 3F3WA 4FTKA 3ZRMA 4CTBA 1OGYA 5AP6A 5DT3A 2PVHA 4KA3A 4FEWA 2UZTA 5HLWA 2UZBA 2OGVA 2QOCA 3FXWA 4IH8A 2I0YA 3GCPA 4J98A 4YJRA 5AV0A 3UMXA 4E6CA 4I22A 5E1EA 3NUYA 4CLJA 5KZIA 5BVEA 2W5HA 4BL1A 4DH5A 1Q4LA 3MA3A 4XOZA 3VWAA 3QZGA 5D7AA 4C02A 2J50A 2QG7A 2X0QA 4G6NA 3EN9A 3SAYA 2VX1A 3ZFXA 4EHGA 2XAOA 3FL4A 4FSMA 4BCKA 4IIRA 3R01A 4GU6A 1XH6A 3DXNA 3H4JA 4FG7A 4BDGA 4YBJA 4XUFA 4KRCA 4C4EA 2RFDA 4DGOA 4HYHA 5HNIX 4N6YA 1Y8YA 3MI9A 2B7AA 2V7OA 3QLFA 3GENA 5FXSA 5L2SA 4EOLA 3TIYA 4RZVA 4NH1A 1JVPP 4G16A 3IW4A 3UNZA 4W9XA 3G6GA 1G8JA 2C6LA 5LCKA 1SZMA 2NO3A 4P2KA 4QMMA 1H07A 3FUPA 4YO6A 3U8WA 5AUXA 4FK3A 3DFCB 2WTDA 3MSSA 3UQCA 5HIDA 2F57A 3E8CA 2BAJA 2BZKB 3KC3A 4L6QA 4QMTA 3R63A 2XEZA 3DZQA 4O4EA 1MRYA 3DLZA 3S00A 2DYLA 2OU7A 5K3YA 2B53A 4X2JA 5CF8A 5EK7A 2WO6A 5DBXA 3KVXA 4Y73A 3MDYA 2GFCA 4JRNA 4J95A 3I0OA 5FGKA 4ZSEA 4EK8A 3HMMA 5K9IA 4WUAA 5IDNA 5G1XA 3F3TA 1O6LA 4I0SA 4DAWA 4Z16A 4FIGA 4FIIA 3LQ8A 1DM2A 4II5A 1ZY4A 3VUIA 1WBTA 4A07A 5CVHA 4QMNA 4OTRA 1CKPA 4FTLA 3E7VA 4KWPA 4ZSJA 3F5XA 1JSVA 4LUDA 3SDJA 5AA9A 2YDKA 2JKKA 3JYAA 3O5AA 2F4JA 2JIIA 2YITA 3I60A 5DR9A 2HCKA 5F95A 5J9LA 1YHVA 1PHKA 4D1ZA 2ZB0A 4IDVA 4XLIA 4PX6A 2AEGA 2VWZA 4AX8A 3MPAA 2RFNA 3GCQA 4OTIA 4JBVA 4PTGA 4NZWB 5ETAA 1ZZLA 4GK2A 4RWJA 4ZZNA 3EN7A 3BYMA 4YPDA 3NSZA 5ANDA 5M55A 5CSPA 3VBXA 5EYMA 1Q8WA 4C37A 4EKLA 5CVFA 3D5XA 2PVNA 4RIXB 4BCJA 4GT3A 2XNBA 2H9VA 3ZSGA 4K0YA 4YZCA 1QMZA 4AU8A 4V01A 5DFPA 5FXQA 4RJ7A 2PMNX 4F9CA 4QTEA 4OTGA 4GKIA 2PZYA 2WGJA 5ANOA 3FQSA 1S9IA 4U3YA 4X2KA 4IQ6A 5JKGA 1OL2A 3VS6A 4BWKA 3P86A 3NWWA 2XZSA 4FTUA 3UOKA 3HRCA 3EN4A 5HOAA 3RZBA 4B0GA 5ANEA 3F9NA 4BZDA 2QKRA 3EQGA 3G2FA 3PP0A 5CZHA 2GNIA 2QO2A 4AXAA 3PSCA 4DBNA 4DTAA 2W17A 1PKDA 2DUVA 4UZDA 3DK6A 4QYEA 2BDJA 3LMGA 4IVCA 3C7QA 1H28A 3G51A 3U9NA 4X2FA 1PXLA 3ALOA 3O8UA 3PXFA 5JH6A 3QC9A 4G17A 4K33A 3I1AA 2RF9A 4AWIA 2W1IA 4CCBA 4EC9A 4QP4A 5JGDA 3KMMA 3QD4A 4DE4A 5E9EA 4FZ7A 5DE2A 3TIZA 4I21A 2YABA 4L3LA 1G3NA 4G9CA 4D1XA 5C1QB 3AKLA 2E9VA 4ZTSA 3SX9A 5J1VA 4XHKB 3P79A 3W0QA 5J87A 1PXMA 4DA5A 4UBAA 4ZTLA 2YM5A 3LOKA 1Q24A 3C0GA 5FTQA 3LKMA 4CRLA 4ENYA 1PXNA 2QU6A 3IONA 3MVHA 3F2NA 4U7ZA 4RGJA 4L68A 3ZC5A 4O7YA 2BCJA 4F6WA 3F7ZA 1FVVA 4C2WA 4AT4A 3ORKA 2EWAA 3FXXA 2V55A 3QRTA 2C3JA 3P0MA 4O0YA 3MTFA 5A6OA 1FBNA 1IG1A 2Z2WA 3QKLA 5KBRA 1H0VA 3TV6A 1KUTA 3ORPA 2HW6A 4L3JA 5JN2A 3S3IA 4FTQA 2ITZA 3BV3A 1XBCA 4CKRA 1QCFA 2OIDA 3BU3A 1YHWA 2PMIA 2RFSA 3FLYA 5BQ0A 5L2TA 4ZOGA 3FZOA 3W2SA 2XM8A 4N0SA 2AC5A 5AP3A 3WYYA 3T8OA 4KD1A 4BDCA 1OPKA 3H10A 2IEWA 3FI3A 1FINA 3P78A 3GC7A 2P2HA 3D7ZA 3BQRA 4XG2A 4AW1A 5J9YA 4FKLA 3PYYA 3UG1A 3DQWA 5CI6A 1YOJA 1Z57A 3R2BA 3P9JA 3ZBFA 3Q32A 5A4QA 3F5UA 3QD2B 5H9BA 4DYMA 1PXOA 4ANOA 3FAAA 4IZ7A 5BNJA 2JFMA 4PUZA 3TMOA 3MH1A 5CX9A 5D10A 2VV9A 3HDMA 5EW8A 2PE0A 3RJCA 3MVJA 1LP4A 3AT4A 1J3HA 3L8PA 4GYIA 2J0IA 5J95A 2HWPA 1R0EA 3FY2A 2A27A 3OTUA 2LAVA 4BI1A 1RE8A 3BYSA 3QFVA 3HMNA 3S1HA 3QZHA 4R3CA 5CAOA 2VTQA 5L2WA 2Y8OA 4LI5A 5EQPA 2XVDA 3ODYX 3QD0A 4D28A 1H1WA 1G8AA 4PMPA 4RRVA 3ZONA 5IUHA 4JBOA 3LFSA 1H4LA 2XNGA 4YNEA 3R2YA 4CFNA 5HORA 4RWLA 4ZP5A 2WMVA 3UOLA 5T6KA 4U45A 5KMLA 1LR4A 3FQHA 3W33A 4D2TA 3WE8A 1FOTA 3W2QA 4IX6A 2JD5A 3SC1A 2QOQA 3A7IA 1U4DA 3FMKA 4ACGA 4BIBA 3WARA 4BDAA 3KXGA 5BMSA 2PY3A 4MX9A 2WPAA 2XMYA 4JX7A 4ZXTA 4ZY6A 3WYXA 3VULA 1I44A 4RX7A 2YIYA 1YI3A 3KY2A 5DHJA 4CFUA 3BEGA 5EOLA 4FKRA 4BZOA 1YOMA 2FYSA 3DBFA 3POZA 4WIHA 1Q62A 3ZEPA 5ETFA 4A4XA 4M7IA 4RIYB 4EBWA 5A9UA 5IISA 5L8LA 4IM0A 3N4TA 2YWVA 4Q5EA 5LMAA 4E8AA 4R5YA 3KIOC 3ZRLA 1ZRZA 3N4VA 4FV0A 4BKJA 2C3IB 4O0WA 3SV0A 4EJNA 2PSQA 3VBYA 4IADA 5CAUA 1E9HA 4FTAA 4ITHA 3RWPA 5J1WA 4NUSA 3UC3A 3BYVA 2X6EA 1OIUA 3WBLA 5B2LA 4EWHA 3LM5A 5HNBA 1ZOHA 5T3QA 3EFLA 2C6EA 3R71A 5J79A 2OIBA 3CPBA 2IW8A 4UMUA 1I09A 3MFRA 2ZV8A 2C1BA 4IZYA 5IQEA 1LUFA 1FGIA 3H9FA 2C1AA 5HBEA 4EOIA 3FEGA 1H27A 1DAYA 3NYVA 4GH2A 4ASEA 2YCRA 1WBWA 3CXWA 4KSPA 4E5BA 3FMNA 3SG9A 4XG8A 4AAAA 4PTEA 1APME 3TUCA 4FRFA 3IOKA 3DNEA 3GC0A 3OFMA 1T45A 2CCIA 4KKEA 4QQTA 5IA0A 4USFA 3DK7A 3M2WA 2HOGA 2OXXA 4J53A 5JFVA 3Q2JA 1G8SA 5BVOA 4V04A 1PYXA 2ONLC 2HZIA 4DH8A 3FPQA 3JUHA 3RGFA 4ITIA 3PRFA 4FSWA 2PUPA 4F9AA 2VTAA 3DAEA 3NNUA 3PTGA 4D55A 4FV4A 5LQFA 2HK5A 1U5RA 1XR1A 3SXSA 3BGZA 5DMZA 1VYWA 4J1RA 5L6PA 4ZK5A 4FSTA 4TNDA 3RNIA 3V5WA 4C3PA 1ST0A 3MESA 3I5NA 4KIKB 3I7CA 1O9UA 5FG8A 3AT2A 3TNWA 4C34A 4UX9A 4DT8A 3CKXA 4O4CA 4Y8DA 2O2UA 2CN5A 2BMCA 3H0YA 3TV4A 2GHLA 3IPHA 2WB8A 3VUMA 3LXKA 3I0QA 3JR1A 1M14A 4MWHA 4BCFA 3DBDA 5D9HA 3KRXA 4O1OA 3R8PA 3R7YA 4NWMA 1WBPA 4I41A 3TYKA 3ZUVA 5KKRC 5IQGA 3ZFMA 3COMA 4F9YA 5IA2A 1QL6A 3UPZA 4ASZA 4WSQA 3TXOA 3UNJA 4NM3A 1HCLA 4BICA 2C5OA 3PWDA 4OR5A 2B52A 3KQ7A 4FV8A 1BL6A 4EZ3A 4MH7A 3U6JA 3N51A 3R9OA 2C69A 4LG4A 2X9FA 2XJ0A 4X3FB 2IWIA 3IW8A 3KVWA 4CVAA 4MXAA 2YIWA 4EOMA 4I93A 2W5AA 3FPMA 4PQNA 3IS5A 4FODA 2WQNA 4RWIA 3AOXA 4B99A 2YM3A 3VBVA 3U6HA 3KF7A 1OL7A 2GFSA 2C5YA 3OROA 4CEGA 2AQXA 4NW5A 2C30A 3EFKA 3QCQA 4FL1A 1ERKA 3QU0A 5LMKA 3PFYA 4R77A 5IQHA 2SRCA 2PUNA 1JOWB 3QC4A 2W1DA 2YAKA 4HJOA 2WMTA 5FLFA 4BWXA 3OHTA 4ZTMA 2I6LA 1H1SA 1PMEA 3R02A 4MBIA 2I0EA 3VUTA 2PE2A 3EQHA 1G8KA 3DFAA 3U6IA 4C62A 1WVWA 2PL0A 4MK0A 4IB0A 3NUUA 4TY1A 4ASDA 3QCXA 3GXLA 1PF8A 4BKYA 4E4LA 3LXPA 3WZJA 3ORLA 4AZVA 5HZNA 4BGHA 2XM9A 4R7IA 5HVKA 5AIRA 4CT2A 2GS6A 2OW3A 4GEOA 1OVEA 3KK9A 1ZLTA 2RG6A 5EM7A 3UO4A 3POOA 3E5AA 3LFNA 2X39A 5GZ8A 4FKTA 3IG7A 1V0PA 1ZOGA 4NFNA 5HCYA 4TYEA 3VN9A 3UVQA 5FM2A 4G3GA 2I1MA 2F9GA 3S2PA 4YZMA 3F3ZA 2ACXA 4LRJA 4MCVA 3AC4A 2ZDUA 3OBJA 5AADA 3DXPA 3F2RA 5CEPA 4H3BA 5LVMA 3V5LA 3V5QA 2PVJA 5A54A 5LVPA 4ACMA 4IM3A 4E5WA 4P5QA 5TO8A 5BYYA 4CSVA 4L42A 4DGGA 1XH7A 4XH6A 2J7TA 3GC9A 1XMMA 3EFWA 3I79A 4FI1A 4V05A 2X6DA 1BI8A 5B0XA 1WZYA 3DAJA 4JQEA 2XBJA 2G9XA 4MD7E 2QLQA 5HO7A 2ITWA 4DTKA 1PMNA 3MFTA 4QP2A 3Q4UA 3W55A 4DITA 3DXQA 3GP0A 4QDEA 4TN6A 3UDSA 4U40A 2JIVA 4QNAA 5HVYA 1OM1A 4JR7A 2ZB1A 4CYJA 1W2CA