5BVWA

Fragment-based discovery of potent and selective ddr1/2 inhibitors
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
308
structure length
274
Chain Sequence
DFPRSRLRFKEKLGEGQFGEVHLCEVDSHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epithelial discoidin domain-containing receptor 1
publication title Fragment-Based Discovery of Potent and Selective DDR1/2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 274
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvwA01
4X2KA 3KF7A 3NUUA 1B38A 1OL6A 4V04A 3TV6A 2ZB1A 2O64A 2W5AA 4EH4A 2Z7SA 2E9PA 5EDRA 2CNUA 4LOPA 3R73A 2VTQA 1V0PA 3E3PA 2QODA 3CD3A 2UUEA 1H1SA 4G16A 5TE0A 3R8PA 1RW8A 3FZSA 1W7HA 3UYTA 5AP1A 5E8WA 5FRIA 3R8UA 2VWWA 4R1YA 4QMQA 3EZVA 2C5OA 5A6OA 4NM0A 3EQDA 1QPEA 5BQ0A 2XIRA 5CZIA 3HYHA 3BYOA 2IO6A 5CF4A 3MFTA 3QX2A 2G1TA 3ZO1A 4D1SA 3CTJA 3BHTA 4GG7A 2A0CX 4KBAA 4MH7A 3DV3A 1FGIA 3K5VA 4AE9A 4CGAA 3HZTA 4DFZE 3EN5A 5FEDA 4QRCA 4EC9A 4BCGA 3ALNA 2H6DA 4ANSA 4R5SA 4EH2A 1OGUA 4AT4A 1MRYA 3PJCA 4ZSLA 3UGCA 4EQCA 3Q4UA 3E8NA 2RG6A 3CQEA 2VN9A 3PY0A 5IEVA 2PU8A 4YJQA 4ZTSA 3MTFA 3R7VA 3AG9A 4DEDA 4FTLA 1ATPE 4U81A 4U80A 4KUJA 5M51A 4ZZOA 3UMWA 4J99A 4YSJA 1JWHA 1ZYLA 4CXAA 5FM3A 5IQEA 4QTAA 5KMMA 2ONLC 4IVCA 5HE2A 5ANOA 4OTFA 4F7LA 2CN5A 4D4RA 4DBXA 4XG8A 5BVEA 1W0XC 3OFMA 4RVTA 5AUXA 3TZMA 3HVCA 4L01A 3PRFA 4B6LA 4CTCA 4QP1A 3FI4A 4UMRA 2E2BA 1H00A 2ZAZA 3K5UA 4RJ7A 3GQLA 4FG8A 3I5ZA 4Q9ZA 4JIAA 1NW1A 2ITNA 4X7QA 3FLYA 5D7VA 4H3QA 5M53A 4FIIA 2X7GA 3NW5A 2W96B 4OW8A 3R9NA 3QQHA 5JT2A 4BTFA 3CGOA 4OTIA 2VRXA 2OGVA 3RALA 4CZUA 5DR6A 1Y57A 4ZTMA 3KY2A 2Y7JA 1VYWA 4ZY4A 3CD8A 2WO6A 4F1TA 2BVAA 4OTRA 4F0FA 3V5QA 5A6NA 4YJPA 4F99A 3FHIA 1IASA 4QP6A 5EM8A 3UP7A 2XIYA 4CNHA 3U4WA 3VS3A 2QQ7A 3A7HA 3OOMA 1G3NA 1G5SA 3C4EA 4O27B 4DH3A 3NUAA 4F9CA 3R21A 3UQFA 3L8PA 2OIQA 2VGPA 4QNYA 2WFYA 3I79A 3P4KA 2Y0AA 3ID6C 3F6XA 4IVDA 4DCEA 2GHGA 4UX9A 4RFZA 3CPBA 5HG9A 2W1IA 1WZYA 4GVJA 2O5KA 2RF9A 3R7IA 5FXRA 4QMZA 3QGYA 4F0IA 4DCAA 1YDTE 1JBPE 1E9HA 3IGOA 1Y8GA 2YJSA 2Z60A 3HRCA 4AWIA 3EN4A 3GCUA 3ZUUA 4BDGA 2QHMA 4CKIA 3Q4TA 3POZA 3BLQA 3BRBA 2BALA 5H8BA 3F69A 3BQCA 3O23A 2J0MB 5T68A 4BZDA 1IA8A 4V0GB 5IU2A 2JKOA 4FTTA 3O8UA 4GMYA 2PMLX 4NTTA 1JKTA 3GCPA 2UW9A 2E9OA 4O0VA 4WHZA 4C3FA 1H07A 4GK4A 3VS0A 4LMNA 2CJMA 3KXZA 1H1WA 3FMKA 4AGCA 4FIHA 2X9EA 3GCSA 3LFBA 2WMBA 3LFAA 4J1RA 5F94A 3MIAA 4C4IA 4LV8A 5HBHA 4ZIMA 5CALA 1W82A 4H58A 3PVBA 2BZIB 2IVUA 2ZMDA 1Q61A 4U0IA 4GUBA 4IX4A 5AP4A 4RBLA 5JRSA 4JR7A 4QT1A 3LMGA 2ITTA 4CG8A 1HOWA 4NIFB 1JAMA 4QTCA 1O6YA 4X2FA 3ZLSA 3GU7A 4GKIA 1XJDA 3KN6A 3UO6A 4YJRA 4CTBA 3OW3A 4ZSGA 4IJ9A 4IB3A 4E5WA 3PJ3A 3ALOA 4M3QA 3BYUA 3R9HA 3JY9A 5JK3A 2ITUA 5EOLA 2XKFA 3UOLA 4NM3A 1SVEA 3D5UA 4BCNA 5KMJA 4RRVA 4HOKA 4ZTNA 3HLLA 3BGPA 3CQWA 4BVUA 1J7IA 5CANA 4FT0A 5IG1A 4FX3A 4NH1A 4ZS0A 2H34A 4OTGA 3VJNA 1H1RA 3UG1A 2BKZA 1UU8A 3FSFA 4P5QA 5ANIA 3PXFA 4HZRA 3TL8A 5TKDA 3CXWA 2GQRA 2LAVA 3N9XA 4QYFA 5LWNA 5IQCA 5D9HA 3A8WA 3EFKA 5F9EA 2LGCA 4FSQA 1UU3A 5HOAA 2Z2WA 4ZJVA 3MVMA 4XH6A 4AXAA 5BVFA 3S2PA 2B54A 3OHTA 4AE6A 4FGRA 4EONA 4L44A 5DT4A 2W5HA 5DVRA 4AA5A 2R9SA 3IW7A 3W2CA 5CEPA 3IOPA 3Q4ZA 5HU3A 3ZXTA 1Y91A 4K0YA 2ZDTA 3GQIA 4U7ZA 1XH8A 5K4IA 5HIEA 4BCMA 1JSTA 3R04A 3PY1A 4GU6A 5G1XA 3LPBA 4NUSA 3BHHA 4BWXA 1GIIA 5KMNA 2FGIA 2OH0E 5L6PA 3ORLA 3KVWA 5I9WA 4QMPA 3KVXA 4QMTA 2OZOA 4JQ8A 3SOCA 3QCQA 5AP2A 4KINA 3BHYA 4DG2E 2XJ1A 3BBWA 4FVRA 3UVQA 1J1BA 5FM2A 2G01A 3OT3A 5AR8A 3TKHA 1DAWA 3P79A 4FTKA 5CQUA 3R01A 3EKKA 1PXNA 2DQ7X 4K6ZA 1BMKA 4PQNA 4BB4A 3MTLA 4XOZA 4EWQA 1TKIA 4AGWA 5AX3A 4UWBA 1JQHA 3QKMA 4R3CA 4BDCA 3Q53A 4C37A 5FEEA 4APPA 4ZLOA 4WNKA 5IQIA 4ZTLA 4FSTA 4KBCA 4NKAA 2X2KA 3QTXA 4CCBA 3IGGA 1KE7A 1Z9XA 4LMUA 3V04A 3SQQA 3TWJA 3QALE 4CFMA 2OJIA 3BQRA 1T46A 5I3OA 4DH1A 4ERKA 2B9FA 3A2CA 3HA6A 3EQHA 2OBJA 5JFVA 3CQUA 3GOKA 2ZV7A 4JDHA 4QMLA 2PPQA 2GCDA 4IFCA 4MF0A 4EOLA 3LLAA 4ACDA 3MGYA 4YZ9A 4YR8A 3OROA 4WNMA 1KV2A 3TG1A 3MPMA 1REJA 4CG9A 5EG3A 2J5FA 4FNXA 5LMKC 4DGMA 4MD9E 4XP3A 2YLFA 2B4SB 1PXLA 2FSMX 4I5MA 4KKHA 2PMNX 3QGWA 5HNGA 4YC3A 3RK9A 4R77A 3CR0A 2F2CB 3KRLA 5KZ0A 5AJQA 3GB2A 2QLQA 3QKKA 4FL3A 4YU2A 5E8ZA 4IDVA 5BVWA 3FZ1A 5AAFA 2XCKA 5HO7A 5ANKA 4WG3A 2BZJA 5IQDA 2JDOA 2PZRA 2Y6OA 3PZEA 3H9RA 5J95A 5EW8A 3IQ7A 4QYYA 1PXIA 3Q60A 4O7NA 4D58A 5HESA 4FSUA 4I0SA 2GQSA 3LJ0A 1U54A 4ZSJA 4CV8A 3LFFA 3FL4A 2ITPA 4WUAA 5C4KA 3WF9A 2B1PA 3GU6A 3VUKA 4Z16A 3BIZA 2Z7RA 4YC8A 2UW6A 4TWOA 2J4ZA 4U43A 3UNJA 2F9GA 1CKPA 2UW7A 3IS5A 3R8MA 2H9VA 3UNKA 1Q8WA 4MNEB 1WBWA 4YLJA 4YBJA 4L43A 3SG8A 2BFXA 3L1SA 5L4QA 4JDJA 4FNWA 5DBXA 4F65A 3PDTA 3QLFA 5HVJA 5AMNA 4QPAA 4G3GA 3EN6A 3M1SA 3SD0A 2VWXA 4TW9A 4GT4A 4MEDA 3II5A 4FSZA 5HTCA 4CFWA 4FV5A 1NXKA 5DHJA 4ONAA 5HE1A 2FSOX 5TT7A 2WMAA 2VNWA 4GJ3A 5LVMA 4PPCA 2HY0A 3FC1X 3ORKA 4WBBB 4EH5A 1YXXA 2NNWB 3R9OA 5GHVA 3W55A 3KULA 5AP7A 2EXCX 3FLZA 4Y5QA 2VWIA 3MVJA 5CF6A 4I21A 2X6DA 4TWNA 4XRLA 4RPVA 5IA1A 2RFNA 2BKKA 1U54B 4JG6A 4N57A 4R1VA 2OO8X 3DAKA 5HVKA 3LQ8A 3IK3A 4EHGA 4AS0A 2BFYA 3A4PA 2W06A 2IZTA 2GNIA 3FMLA 1CSNA 3OXZA 1H4LA 4BI0A 1PMVA 3SA0A 5CVHA 3S1HA 3MA3A 5M57A 4ANBA 1UNLA 2QI8A 4FV9A 1JPAA 5CY3A 3NIEA 1GZ8A 1QPDA 4XG3A 3GFEA 5CEKA 5J7HA 3VF9A 2YDKA 2R3RA 1UKIA 5KMIA 4FK3A 2A2AA 3PJ2A 3QRUA 4YJSA 3W2PA 4MXYA 3WYXA 4FV2A 2GNLA 4DGNA 3RINA 5HLWA 3LQ3A 4IIRA 4ZJIA 2GPHA 2F7XE 2PE2A 3FZPA 3SW7A 4CFNA 2BDWA 1XWSA 3F3ZA 3H30A 2JIIA 4KS7A 3OWJA 1IAJA 3PIYA 3F3UA 2OKRA 2W1GA 2A19B 3K2LA 3LFEA 4AGDA 4UB7A 5CVFA 5EHOA 5AAEA 4UMPA 2UVYA 4QQ5A 3GC7A 5IDPA 3FQSA 2CN8A 4NT4A 4W8DA 5CXZA 2ACXA 4RVMA 5M06A 3L9PA 4C4JA 2IZSA 1ZWSA 3ZZEA 3G15A 5HCYA 5I9UA 2WB8A 4L7SA 3KA0A 3ZRKA 4MBLA 2W1HA 3E8EA 1JOWB 5CSPA 4EZ5A 5LJJA 3F7ZA 1ZMVA 4MXOA 3I7BA 3H3CA 4RIWB 3PE1A 4PV0A 5LCKA 4EJNA 3AC1A 3C4CA 1B6CB 4H3PA 3GT8A 4ITJA 2HELA 4LUEA 3H0ZA 2GMXA 4O7ZA 2YIQA 4ACHA 3GI3A 3TJCA 3ZTXA 3PA4A 4IM3A 4D28A 2YN8A 2UV2A 3QZIA 4LV5A 4E20A 4Y46A 2B55A 4ZZNA 4TWCA 4DH5A 5FTOA 3ZC5A 4EOMA 1H28A 1V0OA 4EH3A 4PMPA 3MY0A 4E8AA 3FSKA 3ORMA 2WMRA 4FKOA 1WAKA 3MPTA 5F1ZA 5T6KA 4BWPA 2IPXA 4OUCA 4E1ZA 4GIHA 4KSPA 4IAFA 4LGHA 4PTEA 3QCYA 2QCSA 1SYKA 3COMA 5M4UA 2X81A 3D5VA 5E90A 4IW0A 2OXYA 5L8LA 2QC6A 4EORA 3IO7A 3DXNA 5AUYA 2R3JA 3DAEA 4QPSA 4N6YA 4FTUA 2X1NA 5HQ0A 5AUZA 4KRCA 3KK9A 5IA0A 3DCVA 3HDNA 2GNFA 5DOSA 2HCKA 2XM8A 3VF8A 4IZ5A 4TYEA 3SLSA 1PKDA 1XBAA 5CSXA 4UYAA 3RVGA 1F3MC 5A9UA 4A9TA 3QX4A 4O0TA 4IZ7A 4FTMA 3AC3A 4WOVA 4LRMA 3RCJA 4ZY6A 2VTJA 3NYNA 4QO9A 4CD0A 3TNPC 1SVGA 2CNVA 3BLRA 4H36A 2XK7A 2XIZA 3WE8A 1H0VA 5IA3A 4QP4A 3F5GA 4AT3A 4BFMA 1XQZA 1XO2B 4IX5A 4KA3A 4WO5A 3DBEA 4EH6A 4PDSA 4AAAA 4BCIA 3GC8A 2VD5A 3EQPA 2XF0A 3P0MA 4RSSA 4YJTA 4YO4A 4RQVA 2JLDA 3MWUA 5H8EA 1I44A 2I1MA 5AUUA 3HECA 3RWQA 4L7FA 4EOOA 3ZM9A 4XS2A 3DDPA 2QKWB 4TNDA 5CZHA 4CKRA 2W1EA 5H8GA 3Q9YA 4WUNA 4E6QA 3NYXA 4AZEA 1ZYSA 4IB5A 4JBOA 4YHJA 4NFMA 3LW0A 3U6HA 2A4LA 3FMDA 4E4XA 1R3CA 1AD5A 4LGDA 1YXUA 2FSTX 4PMTA 1G8SA 4XRJA 4CVAA 3F3WA 2VO0A 4XP0A 3FMHA 3NLBA 4S34A 5KX8A 1Y6BA 3FPQA 4FTJA 4I1ZA 3RBWA 2W4KA 3UOHA 5G6VA 5HO8A 5EI6A 4CRLA 4O84A 1BI8A 2W0JA 4HCUA 4LUDA 4FZDB 4NCTA 4J95A 4EBVA 4JAIA 3GP0A 3NRMA 3TKIA 3MV5A 3QLGA 4M14A 1LEWA 4M66A 1H0WA 4E5AX 3CS9A 3R7UA 2VTMA 3NZ0A 5LARA 3NUPA 3WOWA 3T3UA 2OZAA 3VHEA 1PXMA 2YLEA 3ORIA 1JKSA 2GNHA 4IMYA 4QYEA 3VO3A 3C7QA 4I92A 5E8SA 1BL7A 5GJDA 1V0BA 3BCEA 5I9XA 4TZRA 3NAXA 1FMKA 2P2IA 4ZSAA 4BIBA 2WMTA 2QNJA 4F9WA 4S30A 5I5ZA 4IAAA 4JXFA 4FTOA 2OSCA 4JBVA 1Q97A 3GEQA 4G34A 2WTJA 3DKGA 4DBNA 3UO5A 3EN9A 3LXNA 4FYOA 5AV3A 5AWMA 4DT8A 4RVKA 3PWYA 3M11A 3OBJA 3ZZWA 3OUKA 4DEEA 1T45A 3MVHA 3ZSHA 3QUEA 3ODZX 1W8CA 1OMWA 3F2NA 4FV1A 4IBMA 3E87A 5M07A 4ACGA 3Q9XA 5EM6A 4U40A 4XV9A 4J71A 1M14A 4FOCA 4D4YA 5K4JA 3OF0A 2W9ZB 4BKZA 5DEWA 5ETFA 1P2AA 2YZAA 3OCTA 2YDJA 2C6OA 2NP8A 3CC6A 3BPRA 3PRIA 3VHKA 2J5EA 3GBZA 2OZAB 5CT7A 4KBKA 3RK7A 3U4UA 4WIHA 3ZFMA 3U8WA 3GOPA 4TYGA 3TNIA 4GKHA 3WF7A 3SVVA 5HVYA 5J9ZA 4BCKA 2VWZA 4QQJA 2QOCA 3ZFXA 3OZ6A 4IAIA 5HE0A 2IW6A 5IDNA 2OJFE 3D9VA 4BBEA 5AV4A 3V5JA 3D2IA 2OJGA 4NW6A 5BYYA 3M2WA 3REPA 4V01A 4B8MA 4H3BA 4GYGA 3NGAA 5EDQA 5KBQA 2I0VA 3C1XA 4FMQA 4AFEA 4GCJA 3D7ZA 1FGKA 4EOIA 1OUYA 4WG5A 4XG6A 5DGZA 2XEYA 4BDFA 3LCTA 4MNFA 2I0HA 3FL5A 3MH3A 4O96A 4ZZMA 4AW2A 4XG4A 4CYJA 5B7VA 1AGWA 1A48A 4F70A 3NUSA 2PWLA 4FL1A 2R5TA 4W4XA 4BGHA 4O1PA 3WZDA 4FSNA 4HCVA 4AX8A 3VS7A 4ZEGA 4DITA 2JDSA 4GYIA 4EKLA 3DB6A 1OBGA 3LOKA 3MFUA 5IH5A 4EKKA 3TZ8A 1OIYA 3SC1A 4R6VA 2JGZA 1URCA 2WMXA 4ID7A 4CMTA 4ALVA 3FMNA 2OXDA 3VW8A 2BRGA 4IX3A 4WG4A 1P14A 5ANJA 5E8VA 5CSVA 2W1CA 3U87A 3OW4A 4JX3A 3W8QA 2RG5A 3DBFA 1L3RE 5JFXA 2YCQA 5GJGA 1MUOA 2QD9A 2XCHA 3HAMA 3LXKA 4N6ZA 4JIKA 1XBBA 4C36A 3ETAA 3L9LA 4TYHB 4L53A 3AT3A 3CCNA 4RX7A 5EFQA 3DBCA 4L9IA 4MCVA 4QMWA 3D83A 3NNVA 3VIDA 4CZYB 5LVOA 3R2YA 1KUTA 5HLPA 4DN5A 5E4HA 3FKNA 5KZIA 2VAGA 3BEGA 3Q32A 4Y72A 1UWJA 4RLKA 1YDSE 2YHVA 4I4EA 4BIEA 3CJGA 3ZMMA 4BC6A 4H1JA 3SOAA 5ITAA 4Y95A 3OUNB 3DAJA 2XK4A 1GAGA 3GGFA 1OL1A 2Y4IC 4HPTE 3MESA 4BIDA 1VZOA 2XKEA 4Y8DA 3TIZA 4FV0A 2JDTA 3ET7A 4W4YA 3VS5A 4EOJA 5AFVA 3PXQA 1IR3A 2XNGA 4NSTA 3HV4A 3UQGA 4ASZA 4QQCA 1H24A 3LCOA 2PE0A 5IZFA 1TQIA 3IECA 3NPCA 1VJYA 1ZLTA 3PA5A 4AA4A 4GJ2A 4GH2A 4CT1A 4QQTA 1JVPP 4BCQA 3H9FA 4P4CA 2V7AA 2FSLX 5E8XA 4P2KA 3C4XA 3ANQA 2I6LA 3D2KA 3IDPA 1K2PA 2ITWA 3E62A 1SNUA 4IB1A 1Z57A 1F5QA 4PTGA 4GL9A 4F9YA 2BAQA 2DS1A 2F7ZE 4AGUA 2XNNA 3BBTB 3Q2JA 4D9UA 4YZCA 3NYOA 1UVRA 4DTBA 4AACA 2BILB 4RIYB 4BICA 3EB0A 2QR8A 2X4ZA 4UALA 4YHFA 1PW2A 4D0XA 3VUDA 3OWLA 4K11A 4RC2A 4PX6A 2XZSA 4YGAA 4B4LA 2R3HA 2WELA 4IX6A 4S32A 5EW3A 3DY7A 4L42A 4C2VA 3Q96A 2RFDA 2YITA 2GQGA 2YM3A 4KIKB 4YPDA 3UTOA 4Q5EA 4QTBA 5CLPA 4I41A 4YZBA 2J0IA 3ZH8A 5AP0A 1RJBA 4ACCA 2PSQA 4G31A 2BAKA 2JDRA 1DM2A 4ZK5A 2WIPA 3RM7A 5GZ8A 4HNFA 3OXTA 2QU6A 3DK7A 2HW7A 4RT7A 4QMNA 3TDVA 2I0EA 2UZLA 3N51A 3RPOA 2GS7A 3K54A 2QVSE 2C6MA 4O6EA 3L8XA 4IWDA 4K33A 4XG7A 1PYEA 4IM2A 3BZ3A 3DZQA 3PG3A 4CEGA 3HMOA 4HJOA 4WA9A 3NWWA 4FT9A 1L8TA 3KCKA 1M2RA 3TI1A 5JGBA 2I40A 4F9BA 5EM7A 4BBFA 5CQWA 4FEUA 2BMCA 4OT5A 1PMNA 4FI1A 3SXFA 4K18A 2WEIA 3NS9A 1Q3DA 3EQCA 4XX9A 3VBQA 4BBMA 3MJ2A 5ETCA 2ERKA 4A9UA 2H96A 3TNWA 4GK3A 4M13A 4ENYA 2O65A 1JSUA 5EHLA 3RAKA 3C5IA 2CLXA 5DH3A 2XJ2A 1RE8A 4K1BA 3PXZA 4O1OA 1JKKA 4FT3A 4WNPA 2XNPA 3QA0A 4QYGA 4XJ0A 2WTDA 2KULA 4FT7A 4M15A 3RTPA 4MBIA 3V5TA 5K9IA 1QCFA 3FEGA 2QU5A 3QTIA 4NJ3A 4YJOA 2QONA 5L2WA 1H1PA 4G6LA 2OICA 2C0TA 3HKOA 3ORXA 1XKKA 4HPUE 3WF8A 2Z7QA 3AGLA 3BYMA 3HV6A 3KRXA 2I7QA 5LCJA 2YA9A 5AV0A 5AX9A 1OITA 2BRBA 4A4XA 3NNWA 4HGSA 4ZY5A 2GTMA 5AEPA 3UPZA 5HICA 2CCHA 3PA3A 1M17A 4IJPA 4OT6A 4LL5A 2YERA 1U5RA 2IN6A 4AG8A 4QMYA 4F6SA 2ZM3A 4JS8A 3SAYA 2CGVA 3UZPA 2BHEA 3PPJA 4FA2A 4O0WA 4FOBA 1H26A 3LFQA 4ZTHA 2BROA 4PDOA 2B9JA 1YOLA 5M55A 3WILA 2UZUE 4M7IA 2VTPA 1CMKE 4UZHA 5BYLA 3F2AA 4HGTA 3CTHA 5E9EA 3QHWA 4G9RA 4YLLA 5HU9A 4D5HA 4GT5A 1Q24A 3A7IA 4DH8A 3E8DA 4IC8A 3MJ1A 4HGLA 3W2QA 1UNHA 3RZBA 2W1DA 1RQQA 2XA4A 3A62A 3P08A 5D12A 3EYGA 1Q8YA 4X3JA 2Y4IB 4AA0A 4FE2A 4FYNA 3KRJA 3AGMA 4DEBA 4N0SA 3OG7A 1ZYCA 3ZSIA 5EYDA 2ZM4A 4DFNA 4FODA 4M0YA 4D9TA 2Q83A 4J7BA 2GNJA 4PMMA 3W8LA 4EHEA 5AA8A 3UIMA 2SRCA 4A9RA 4Z7HA 2V5QA 4WNOA 4UXLA 4IAYA 5HG5A 4KAOA 2BDJA 2J2IB 1NA7A 3R0TA 3SRVA 2GU8A 4ZTRA 4P7EA 3WZJA 1YHSA 2WMWA 3OOGA 4XP2A 5KMOA 1FPUA 1STCE 4MD7E 3FLWA 4PDPA 3UYSA 5DEYA 4I6QA 2PVHA 3DB8A 4IEBA 5HGIA 2WMQA 3EL7A 1FQ1B 2EUFB 1NVQA 1Q99A 1IA9A 1MP8A 3KN5A 4FZ6A 2V7OA 5FD2A 5M44A 4E93A 3HEGA 3N4VA 4W4VA 4C2WA 4C61A 1NT2A 1XHAA 3QZFA 1CKIA 2PTKA 4F1MA 3S4QA 5AV1A 2GFSA 3TACA 1M7NA 5BUIA 2DYLA 4YZDA 2X2LA 3ZLXA 2ITXA 4GK2A 3F3VA 4FZ7A 5GIOE 1KE8A 1ZMUA 4UWYA 4JX7A 5AP6A 2YCFA 2GSFA 4NWMA 5K5NA 1YWNA 3FBVA 2BIYA 4OTPA 3LQ5A 5LOHA 1WBTA 2IZRA 4KIPA 5ACKA 3C9WA 5D11A 4E4LA 1ZRZA 1YI6A 2R4BA 5DRBA 4GFMA 2XB7A 3SRVB 4Q9SA 4E26A 3DXQA 1YOMA 1K3AA 4LOQA 4CT2A 4EOKA 5I3RA 2ZDUA 3ZM4A 5ICPA 5AUTA 5J9LA 5BNJA 3HNGA 5AM7A 4FICA 4BL1A 4ZAUA 1FVRA 3DT1A 3EFJA 2UZOA 4MK0A 5EKNA 3PJ1A 2CPKE 3BYSA 1ZOHA 5IKWA 5CNOA 1V1KA 4EHVA 2FVDA 3C4FA 4FUXA 2WMVA 1E1VA 4R3RA 2VWUA 4F6UA 4PPBA 4E6AA 3H10A 3DBQA 3QWKA 1NVRA 3EOCA 3A7GA 2CKOA 2WOUA 3IDCA 4HYHA 3JR1A 4G5PA 5DNRA 2C3JA 4EQUA 1KOBA 4IWQA 5A4TA 3ZYAA 4WD5A 3DQWA 3KXNA 2XK8A 3R02A 3IG7A 2C5XA 2CDZA 1LUFA 3VBXA 5B0XA 2X8EA 1HCLA 5C9CA 3O50A 1ZYDA 4O82A 3PXYA 2R7IA 2VV9A 2ZM1A 3O8TA 3QAME 4I0RA 1I09A 3LXLA 4E5BA 3ZONA 3NAYA 2W17A 5DYJA 2WQEA 3EQGA 4X2GA 3UOKA 3O8PA 4O91A 1OPKA 1U5QA 4FIFA 2ZV8A 1PXOA 4I4FA 2W4OA 4U5JA 3AC2A 4QTEA 3U6IA 3PTGA 4L00A 4CCUA 5J1VA 2F7EE 5ETIA 3R7EA 2IVTA 2WQOA 5FXSA 2NRYA 3QTSA 4ACMA 3DNEA 3G6GA 3S95A 2HOGA 4QP8A 5J87A 3ZSGA 5EYMA 1P5EA 3GNIB 4C57A 4D2RA 2VGOA 2QOOA 2WTWA 4XEYA 3A7JA 3AMYA 3RHKA 2F57A 4FVPA 4IAKA 4BDJA 5IQAA 2C3LA 3U51A 3D5WA 4IADA 2J7TA 3NNXA 3E63A 4GW8A 3AOXA 5E1SA 3R7GA 2W05A 3VULA 3NUXA 4ZTQA 5IQHA 3KC3A 4U6RA 3U55A 2BIKB 2Z8CA 4KKGA 5CU4A 3UIBA 4WKQA 2ZJWA 1OM1A 3COKA 4YZMA 5KMKA 2WHBA 5L6WL 5K0KA 1ZMWA 4X6QC 2A1AB 2V0DA 2PZPA 3LAUA 3H4JA 4FIJA 3COIA 2WQBA 4GFGA 2R0IA 2XM9A 3MB7A 4LRJA 3ROCA 2QR7A 5K5XA 2JD5A 4E6CA 4L8MA 2J9MA 4Z9LA 4GU9A 4USEA 3R30A 4ANMA 4XYFA 1ZXEA 3ZEPA 3ZCLA 5IH6A 3A60A 4I94A 2IWIA 4RJ8A 4YSMA 3GVUA 3FKOA 3O2MA 3VBTA 4RVLA 1KE5A 1W84A 2PY3A 3NYVA 4JQEA 1H27A 4MXXA 1XBCA 3EQFA 3LCKA 3R00A 3AC4A 3KCFA 5EQPA 1UU9A 5J7BA 3ORZA 4FTIA 1PKGA 3BU6A 2PULA 5C4LA 2VNYA 3VQUA 4CKJA 4ZS4A 5J79A 5IUIA 2BUJA 5CI7A 2JITA 4V05A 3MVLA 4EUUA 3V5PA 4TNBA 4XBRA 4PY1A 5FBNC 1YXVA 5BMMA 5CAOA 3HL7A 3CKXA 5FQDC 2G2FA 4QP7A 1H8FA 3MY5A 5TOZA 4DHFA 4O38A 2XEZA 5C27A 5HX6A 3P86A 1OIRA 4D4SA 3R1NA 2OW3A 2W7XA 5KE0A 5DMZA 1OBDA 1B39A 2HZNA 3FY0A 4LL0A 3P9JA 4X0MA 2YWVA 2WQMA 4RX5A 5HBJA 3OY3A 3TCPA 2CSNA 1YRPA 4HGEA 4BCHA 4G6NA 2C1AA 2UZEA 2WAJA 2UZVA 4Y73A 5CX9A 3E5AA 4CFFA 4ERWA 4AOJA 4IC7A 3BU3A 2BRNA 3W2RA 4FTCA 2WMUA 3EZRA 2BZHB 4AOIA 5ETAA 3P23A 3NCZA 5F20A 2XS0A 3I5NA 4AUAA 4FKPA 4IANA 3EMGA 2QOBA 4EH7A 2V62A 4FEVA 4JI9A 3W10A 4PTCA 3BGQA 5CT0A 3FYKX 3FZRA 4RZVA 4AT5A 4DE4A 2A27A 3KXXA 4GS6A 4F63A 3CBLA 3KL8A 3KULB 4ANOA 5HNBA 2UZWE 3VN9A 2WGJA 4FTAA 4O6LA 4MHAA 3CTQA 4RJ6A 3HRBA 4RMZA 4GFOA 3PVWA 2I0YA 4E73A 4RGJA 3SXSA 3KU2A 4XCUA 4EC8A 4D4VA 1Q62A 4I22A 4NCTC 5AA9A 4QNAA 3KFAA 4FSYA 4RIOA 3FQEA 5AR5A 1H08A 4O7WA 3LM5A 1P4OA 3CSVA 3DJ5A 2J0LA 4UXQA 3OEFX 3LMIA 5IA4A 1K9AA 4FK6A 3FZTA 3QD4A 5FTQA 3ODYX 1Q4LA 3SV0A 4EL9A 2HK5A 2REIA 3C0GA 3D5XA 4JJRA 3FI8A 1ZZ2A 2OU7A 3D7TA 4F64A 2E9UA 2CKEA 2R3MA 3HA8A 3DDQA 3QBNA 4BZNA 2QOKA 4TTHB 4U8ZA 5M4IA 4FKSA 2EXMA 2PUNA 3FZOA 2C30A 2R3KA 1O6LA 5BPYA 5E8TA 4IH8A 4CFXA 4MVFA 3HV7A 4RQKA 3IONA 4WRSA 4HW7A 4DFBA 1EH4A 4F0GA 4RA4A 3FJQE 3H9OA 5HTBA 4D2TA 4NTSA 3GU8A 5I9YA 4XV1A 4Z7GA 2W1ZA 4FC0A 2JKMA 1ZY5A 3TZ7A 2W1FA 2HAKA 2RL5A 3BWJA 4PL5A 2XNMA 3HMNA 5D41A 2R3LA 3C13A 2C5VA 3QD2B 3DJ7A 5LVLA 4JBPA 1JSVA 2OJ9A 5IQBA 4ZLYA 4NL0A 4DLJA 2J6MA 4FUYA 1CM8A 3ZRLA 2OLCA 5HBEA 3LIJA 3UC3A 4F4PA 3R8VA 5LMBA 2IVVA 4FTRA 4BGGA 3A8XA 5A4QA 5E8YA 5CEQA 3TT0A 3E3BX 3QTQA 2YIWA 4WRGA 4QMXA 4YPSA 1IEPA 2RFEA 2YM5A 3W16A 1R0EA 4BCPA 2BTSA 4HVDA 3QXOA 2X39A 3D14A 2NO3A 2XUUA 2QKRA 5JQ5A 2PL0A 3DOGA 4DTKA 3MIYA 1DI8A 1PRYA 4ITHA 4BHNA 2IW9A 3GUBA 2CGXA 2X0GA 4FL2A 5HKMA 3JS2A 4HZSA 4RWKA 4Z55A 2R7BA 4A9SA 3Q6WA 3G90X 2WTIA 5IQGA 4M69A 2HWPA 2ZMCA 1O9UA 4O0RA 5EI2A 3BWFA 5GZAA 3MH1A 4TYJA 3TZ9A 1YI4A 3MY1A 3RGFA 1Y6AA 2EWAA 1GZNA 2WPAA 5EQEA 3R9DA 3HV3A 3QXPA 1OKWA 1J7LA 1YXTA 5M56A 4D2PA 3SX9A 4BDDA 2O0UA 5KO1A 3JVRA 2GS2A 1R0PA 4UZDA 4MD8E 2YIYA 4CYIA 3DA6A 4IWPA 3C50A 2W9FB 3CEKA 3F5UA 4B8LA 4EBWA 5IMXA 3PPZA 1GZOA 1ND4A 3KK8A 1ZY4A 3KGAA 3KMWA 3BI6A 4GEOA 4F9AA 3ENMA 3ZDUA 2CCIA 1OKVA 3V5LA 2C6LA 4FV3A 4B99A 5A4EA 5DT3A 4DGOA 5HNIX 2G2HA 4DFYA 1Z5MA 3FPMA 4C4HA 2X7FA 3W33A 3QUDA 4AZFA 2PUPA 3ZLWA 2OFVA 3F66A 3T3VA 2UVZA 3U9NA 3RZFA 5B2LA 1OECA 4F1OA 3R1QA 3PUPA 2PVYA 3AXWA 2YM6A 1FMOE 2FH9A 3QQJA 4QMVA 3ZO3A 3N4UA 1DAYA 2VWBA 1DI9A 4QMSA 3R22A 3SHEA 5CEMA 2WNTA 1WBVA 4AU8A 2OK1A 4J8NA 2C5YA 2WTKC 4YTHA 4JBQA 4BCOA 3GENA 3FLNC 4D1ZA 2V55A 3ZUTA 4C35A 1H25A 3AC5A 3O96A 1BI7A 5AAGA 2C1BA 3TTIA 4FEWA 4UV0A 4QMMA 4FKGA 4R7IA 3AQVA 3VNTA 5IUHA 1ZZLA 2UW3A 4G5JA 3VS6A 3NW7A 2CHLA 2X6EA 2Z7LA 2EXEA 1UNGA 1M2PA 2JKKA 4FNYA 3Q4CA 1YOJA 2XKDA 3DNDA 3BKBA 3EYHA 4X3FA 2OF4A 3RNYA 3MH0A 4DEGA 5HD7A 3HAVA 3IOKA 2QG7A 3D0EA 2BZKB 3VBWA 4CQEA 2P55A 4K2RA 2B9HA 4GV1A 3B2TA 2XP2A 3B2WA 2QLUA 3ACJA 4C59A 2B9IA 3O51A 1LR4A 5D1JA 3BELA 2GTNA 1YWRA 2BHHA 2PZIA 4DT9A 3OTUA 3P5KA 4NFNA 2XK3A 2QG5A 4IHPA 3FHRA 2E9VA 3MH2A 3I6UA 3I6WA 5FP6A 3RM6A 2VTAA 5CTPA 3VBVA 4C7TA 3RHXA 4I20A 3F5PA 2ESMA 4GRBA 3WARA 5KKRB 2WTCA 3QWJA 4O7SA 3OY1A 3W32A 2GFCA 1PYXA 4GVAA 2IVSA 4AW1A 4C3PA 4M12A 1NY3A 2PVLA 1CKJA 3DQXA 4AZSA 3WZKA 3QQKA 3RCDA 1W83A 2JAMA 2BPMA 1VR2A 2XK6A 4BR3A 4BDIA 2ZOQA 3CKWA 5KUPA 2VX3A 1FOTA 4BGQA 4DGLC 3MBLA 4ZMFA 1Q8TA 3EH9A 3UPXA 4EYJA 4C62A 5E91A 3ZRMA 4R8QA 3A61A 2C0IA 2J50A 2ZV2A 4FG9A 5LMAA 3NMUF 3FLSA 4FNZA 4MQ2A 5IEXA 2OXXA 1OI9A 3QD3A 4QOXA 3QL8A 3F3TA 2Y4PA 2VX0A 1SZMA 4EK5A 1PY5A 3UMXA 2YACA 5FBOA 3OT8A 3LKMA 5CENA 2C3KA 4ZOGA 3FI3A 3BU5A 5AP5A 2FUMA 2H8HA 3PVGA 5A3XA 3V6RA 3WF5A 3VC4A 3T9TA 4O0XA 1GIJA 4FKUA 4M0ZA 4N4SA 2VUWA 3CPCA 1OKYA 4RJ4A 4TPTA 4FF8A 4DINA 1OB3A 3BLHA 3PG1A 4OTWA 5KBRA 4FKJA 3TV7A 2XRUA 2C68A 4C34A 2WTVA 2Q0BA 5CI6A 2Q0NA 2UZNA 4A07A 3FXZA 2QOFA 5C26A 3TKUA 3C0HA 5BUEA 4HYSA 3NVMB 2YFXA 4A4LA 4FTQA 4IFGA 2HZIA 5J9YA 2ETMA 2R3PA 4PL3A 3UIXA 4C4EA 1QMZA 3QRIA 3EQRA 3KRRA 4KS8A 4C0TA 4H39A 5LVNA 1S9JA 3FQHA 1KWPA 3LCDA 3AD6A 2QOLA 3BX5A 3KRWA 3D4QA 4I24A 3FMJA 3OTVA 3QUPA 5E92A 3OWPA 4UWCA 3ZHPC 4AW5A 4BI1A 2PZYA 3RMFA 3TUDA 3QTUA 3ZO4A 5AADA 3CE3A 3DGKA 3P1AA 5IA5A 4L3LA 4XLIA 4BRXA 4RC4A 5HLNA 3TM0A 5A4LA 4QP9A 4QTDA 1GZKA 1URWA 4BY9E 2C3IB 3DU8A 4XV3A 2PUIA 3PYYA 3MFSA 4JNWA 4UBAA 2R0UA 3DZOA 4JRVA 2ZB0A 5BYZA 3DFCB 5CU0A 1MRUA 3LFNA 2AC5A 4MX9A 3ULZA 5D7AA 3KF4A 1F0QA 2YDIA 3OD6X 4OBOA 3WI6A 4USFA 4YHTA 1WBSA 2R3OA 5H2UA 4IM0A 2R64A 4ZLZA 3O71A 2C0OA 2WTKB 3G0EA 3S00A 3ORTA 1WBPA 3MN3A 3QQFA 4JDKA 2CNQA 1G8AA 4QPMA 3UBDA 3ELJA 4IVBA 4TXCA 4YO6A 4C4GA 2R3NA 5A4CA 4EWHA 1UWHA 1CTPE 2G9XA 2PUUA 3CGFA 4Y83A 3D94A 2NRUA 1BL6A 1YXSA 4IVAA 4FIEA 3ZU7A 2JDVA 4RJ5A 1WVWA 2ITOA 1M2QA 2WXVA 3QC4A 4O2ZA 4W4WA 1DS5A 5FUTA 3KXMA 1GNGA 4G3DA 3WZEA 4EZ3A 3O17A 4XMOA 5K3YA 5BUJA 2OG8A 1GOLA 5DFPA 4APCA 4UMQA 3OBGA 4LM5A 3FMMA 3M42A 3EQIA 5CSWA 3BV3A 2X9FA 3LHJA 3HV5A 4J98A 4GG5A 3WF6A 4OAVB 1FBNA 3C5UA 2C4GA 5ANGA 4XHKB 3HUBA 3ORPA 3ZBXA 3R2BA 4I0TA 2XNOA 5FEQA 4UMTA 4DAWA 4IWOA 5LXMA 3ZDIA 2XH5A 3VUHA 4RFMA 4W9XA 3ANRA 2C5NA 2P2HA 4X21A 3FLQA 3P7BA 1UV5A 3GFWA 2PYWA 4A9YA 1OIUA 1A06A 3NCGA 4PNIA 4XOYA 4D2SA 3I0QA 3I1AA 3KMUA 4TT7A 4BN1A 3ZFYA 5J5TA 2XNEA 4I93A 3I81A 3L8SA 3QCXA 3QZHA 4FEXA 2UW4A 2UW0A 4ALWA 1YQJA 2ITVA 3ATSA 3C51A 2PK9A 2J0KA 3EN7A 4R7HA 4BZOA 3IPHA 1WBOA 4YMJA 5HORA 2Y6MA 3TUCA 3ZS5A 1PJKA 4C38A 4OR5A 4CZTA 1XH5A 4E6DA 5J5SA 5L8KA 2VTTA 1FVVA 4OLIA 1ZARA 4EOSA 1SVHA 3U9CA 2HIWA 3HGKA 3PSBA 4QD6A 2C6KA 3O7LD 4YC6A 5DRDA 4H05A 1WCCA 5KMLA 4ORKA 5IF1A 2XBJA 4XG9A 4BYJA 3UZRA 3C0IA 4MWIA 2JIUA 2R3QA 4FG7A 2EB3A 2YIXA 4JL9A 5FLFA 4V0GA 4LYNA 5EK7A 4RX8A 2YIRA 4DG0E 3AMBA 3GCVA 4JRNA 4LGGA 2Z02A 3DTWA 2C69A 3PPKA 5CU3A 1IAHA 2YM7A 2IG7A 5EW9A 2OH4A 3LE6A 4X2JA 5BVKA 4D2WA 5AUVA 1PXKA 2X7OA 2VZ6A 4JVGA 1WBNA 3TNQB 2PVNA 1OIQA 4WSYA 5AR3A 4BDHA 3IW4A 5TO8A 4L46A 1IG1A 1J1CA 5KNJA 2QURA 3FUPA 4U41A 4NIFA 2UW5A 3G33A 5CF5A 2OWBA 3VS4A 5FXQA 2WOTA 5L8JA 1MQ4A 4R5YA 2OJJA 5C8MA 1WVYA 5CEIA 4W8EA 2ZVAA 4NW5A 2RIOA 4DTAA 2VTNA 2WKMA 3IDBA 5CAVA 3KEXA 1WFCA 3Q5IA 4U3ZA 4O21A 4DH7A 4ZMEA 2XMYA 1MRVA 4BCFA 3NW6A 4RWIA 5FG8A 3TIYA 3RPYA 4J96A 3HUCA 4C33A 5C03A 3I0OA 4O22A 3R63A 2P3GX 3I4BA 2ZV9A 3PSDA 3SW4A 4EOPA 1BKXA 4G3EA 4DFLA 5LWMA 5EYKA 4MTAA 4BTJA 2C47A 2WEVA 3UODA 4NEUA 5C8NA 5CAUA 3VAPA 5HE3A 3H0YA 4FSRA 3G9LX 3Q6UA 2ITZA 4G6OA 5CXHA 3ULIA 1LP4A 4BI2A 4M67A 1E1XA 4NJDA 5HCXA 1X8BA 5I0BA 3KXHA 4OTQA 1PF8A 4ASXA 2CKPA 5IMEA 2VO7A 3DK3A 3U6JA 3FAAA 2G2IA 4AZWA 1BX6A 5E7RA 2CGWA 4AZVA 2PMIA 4B7TA 4NYEA 3JYAA 4ZP5A 3QQLA 4Q5HA 5K0XA 4FSWA 1OUKA 4NM5A 4P5ZA 5FP5A 3G2FA 3E92A 4C02A 5GINE 3TXOA 3UVRA 5EI8A 5DR2A 3ZOSA 4ANQA 2CLQA 1XH7A 4D1XA 3LLTA 5AR2A 4EH8A 3OS3A 3IKAA 4CLIA 3GCQA 2R2PA 2ONLA 2P4IA 4L68A 3R7YA 4C58A 3KREA 3RP9A 3ERKA 2KTYA 1PHKA 3AT4A 1M7QA 4NZWB 4PWNA 5FGKA 5IA2A 4ZXTA 2P0CA 5BMSA 4N70A 4FKRA 2O2UA 5C1QB 5CAQA 2JBPA 1UU7A 4U9AA 5ANEA 1OL5A 5GZ9A 4CRSA 3FYJX 4F7SA 3S3IA 2G15A 2X2MA 3FY2A 4D0WA 5DA3A 1YDRE 3NSZA 5EHYA 2CMWA 4ZJJA 3HP5A 3LXPA 3BE2A 4G3FA 4NM7A 5LVPA 1J91A 3VVHA 3QD0A 3RAIA 3ZLYA 3NR9A 3E88A 3MW1A 3OVVA 4E4MA 5L2TA 2R3IA 3R6XA 1CDKA 2XRWA 4MXZA 3V8TA 3BHVA 3DTCA 3VJOA 2F49A 5HD4A 1KV1A 2XVDA 4LG4A 3WIGA 4J52A 3PY3A 4JG7A 1Q41A 2BRHA 3QCSA 5IPJA 3EFWA 2ETKA 2YM4A 2VTOA 3OCSA 3VBYA 4BTMA 3NVKI 4FKTA 5FDPA 3Q5ZA 2YAAA 3Q04A 4O7TA 5BVNA 4E4NA 2JIVA 2O63A 5CS6A 4O0UA 4C3RA 4O7RA 3QHRA 2R3GA 1KE6A 1Y8YA 2PE1A 3SKCA 1YHVA 3VUGA 3TNHA 2PVRA 2XIXA 3QYZA 4FT5A 4I23A 4FZAB 5IUGA 4YTCA 4WBOA 2HXLA 4E3CA 3W1FA 2YABA 3HP2A 3I60A 2UZTA 2JAVA 3P7AA 3UC4A 2VWYA 3PXRA 3QTRA 3F7WA 4S2ZA 1Q8ZA 3MS9A 3K3IA 5CWZA 2YAKA 3MA6A 3MI9A 2B53A 3CY2A 3R28A 4DFUA 4DEIA 5JMSA 3QRTA 1LEZA 4RWJA 4XG2A 3QYWA 2PVMA 4OTHA 4XUFA 4R7BA 5JKGA 1SM2A 3Q2MA 1YKRA 5EDPA 5IEYA 4RFYA 3F61A 5EKOA 3ZUVA 3L9MA 4ARKA 3R8LA 1XH4A 2PVKA 5FWKK 4U97A 3DKOA 3VW6A 3VUIA 5TR6A 4IQ6A 5CU6A 3T8OA 1FINA 4HVIA 3EIDA 3VRZA 4R3PA 4LFIA 3CP9A 4KABA 1FVTA 4AN9A 5T3QA 4FEQA 4I3ZA 3PP0A 4LOOA 3UZTA 2UZBA 3EKNA 3IW6A 4O0SA 5AR7A 3U54A 3FC2A 3LFDA 4I6FA 3V6SA 5HG7A 4BTKA 3IW8A 1TQPA 4CFVA 3MPAA 5HX8A 3BEAA 3EHAA 4AN3A 3PLAE 4QMUA 3WIKA 1OPJA 4RJ3A 3SG9A 4J97A 4MKCA 3GU5A 3W2SA 4YJUA 4EK8A 3V51A 5CYIA 3B8QA 2XIKA 4FVQA 3GXLA 3N4TA 2VX1A 3VWAA 4OBPA 3POOA 3MSSA 4K77A 4U44A 5A54A 2BCJA 2YCSA 3DBDA 3PFQA 5I9VA 4PNKA 2GHLA 4HVSA 4BDKA 5DIAA 5J8IA 4DA5A 3G6HA 4O2PA 3KMMA 2QOHA 4Y85A 3RJCA 2X8DA 4D5KA 4AW0A 2PZ5A 2EB2A 3D15A 2IJMA 5EYCA 1R39A 2W99B 4J8MA 4IZAA 3RAHA 4NK9A 1QL6A 4L52A 4U42A 3DLSA 4MQ1A 4WSQA 5H3QA 3UDBA 5E1EA 3A7FA 5BVOA 4F7JA 3OCGA 4G1WA 1U4DA 2OFUA 4MBJA 3FXWA 2XJ0A 5I9ZA 3DFAA 2GDOA 3CIKA 4BWKA 2DUVA 1Q8UA 3L8VA 1P4FA 1MQBA 1R78A 3NIZA 3R71A 4RIXA 3TJDA 4DLIA 4UMUA 3QRKA 3HMMA 4OAUC 3NDMA 2FO0A 4IDTA 5JZNA 3UE4A 4ANLA 3R9RA 5DG5A 4JQ7A 2XK9A 5AUWA 4JLCA 4BKYA 5ANDA 4CMOA 4I5PA 1S9IA 3QC9A 5LQFA 1OVEA 3CLYA 4IB0A 4RLLA 4KKEA 5IH4A 1UKHA 2XKCA 2V22A 1JLUE 3R1YA 4YNEA 1ZYJA 3ORNA 5KHXA 3ENHA 3FXXA 3GC0A 4S31A 5ACBC 3ZBFA 4J53A 5IQFA 1VEBA 2QO7A 2RKUA 3RAWA 5EOBA 3RWPA 4DFXE 4Z3VA 3OMVA 1AQ1A 4FKWA 1OKZA 4ASEA 3SDJA 5JFWA 5AM6A 4PF4A 3F9NA 5DPVA 3RPRA 3QFVA 4RIWA 3AT2A 3ZO2A 2J51A 4HYIA 3VQHA 1REKA 1GIHA 5L2QA 4A06A 1U59A 2O3PA 2OF2A 3E7OA 4GSBA 4IAZA 2JFLA 1M52A 2ERZE 4NKSA 4NU1A 1JKLA 2ITQA 5HO6A 3PWDA 4PL4A 3QQGA 2WD1A 3LM0A 4MAOA 2J90A 3BV2A 5JQ8A 4RIXB 4E7WA 3PXKA 3C4ZA 3OWKA 4ASDA 4F08A 5KKRC 3KXGA 5H9BA 5LMKA 4BDBA 3LJ2A 3L9NA 4PPAA 2J0JA 4EJ7A 2XYUA 1GY3A 4KRDA 5AP3A 4U45A 1VYZA 4DF3A 5CAPA 2QOIA 4FV7A 3ITZA 3QTWA 4IXPA 3P78A 1YW2A 2Y8OA 3EL8A 4EK6A 3PE2A 4KNBA 2GS6A 3ACKA 3V8SA 4O7LA 4X3FC 2BRMA 2RGPA 3B8RA 2OIDA 4UY9A 4EHZA 1WVXA 4JG8A 4LI5A 4ANNA 4QP3A 4EYMA 1O6KA 5C8KA 4B9DA 4YUQA 3UO4A 3UNZA 2ITYA 4JOAA 1WMKA 4USDA 1BLXA 2W4JA 2VO3A 2OI4X 2WU7A 3RPVA 4BF2A 3CY3A 3E8CA 3FV8A 4CFUA 5B2MA 1PMUA 2Y9QA 4XNEA 5HTIA 3LMHA 3F82A 4DC2A 5BX0A 1ZOGA 2EU9A 3VS2A 5KHWA 5FTGA 2XYNA 4QYHA 3T9IA 3UG2A 4DGGA 3PP1A 3FI2A 3D7TB 4YLKA 3C4WA 4M68A 5J1WA 3BE9A 5DI1A 1U46A 2HYYA 3DJ6A 3MB6A 1QPJA 3PZHA 3R1SA 5HHWA 3EJ1A 3VS1A 4G17A 2VTIA 2RFSA 3F5XA 3K3JA 2HZ4A 3DK6A 3UJGA 5CEOA 4O81A 4HVGA 3TDWA 4FV4A 4BDAA 3F88A 2FB8A 4UN0C 3Q52A 3COHA 1W98A 5CVGA 4FV8A 3EQBA 5HI2A 3W2OA 3KQ7A 2YZLA 1BUHA 5EH0A 2PVJA 4OGRA 2GHMA 4LQMA 5AV2A 5EQYA 2E9NA 2BR1A 3Q9ZA 5JGAA 3W18A 4M8TA 4OBQA 5AIKA 4OTDA 4GIIA 4PUZA 4BKJA 1YI3A 4XLVA 3RPSA 2VTHA 4TKSA 4RA5A 5F4NA 1PXJA 3PSCA 5C01A 5HCZA 3QQUA 2X8IA 3FE3A 2FA2A 4JDIA 3JY0A 3RKBA 4EEVA 4EZ7A 4KSQA 3OC1A 4M97A 4L45A 1OPLA 2JC6A 3R83A 5DN3A 4O86A 4AQCA 3S0OA 2X4FA 2PMOX 2RSVA 3A4OX 3QZGA 4HYUA 5DLSA 5TF9A 5L2SA 3UIUA 3R7OA 3QKLA 3VUMA 3HRFA 5IISA 4YNOA 5CNNA 3QRJA 3DS6A 4JR3A 5HIBA 5DR9A 2PHKA 4PRJA 4CSVA 3RI1A 4BHZA 4X6RA 3E93A 1SNXA 4RC3A 4AP7A 4FR4A 2OIBA 4H1MA 5CF8A 5L6OA 1RDQE 2YJRA 2WZJA 4M69B 4L6QA 1PMEA 1JNKA 2AUHA 3JUHA 4L3JA 5JRQA 2B7AA 4ALUA 5M09A 3AD4A 4FIGA 4TN6A 3V8WA 1GJOA 4F6WA 4ZSEA 3A99A 4C4FA 4CV9A 3SGCA 3CJFA 4FBXA 4EI4A 3TTJA 3AMAA 5M4FA 4HCTA 3LJ1A 3I7CA 5GJFA 5EM5A 4EOQA 3DKFA 4C8BA 3G9NA 4F7NA 4DG3E 3WZUA 4HVHA 1BYGA 2C6DA 1J3HA 3RNIA 4O7VA 2C6TA 4YJNA 3AD5A 5GNKA 1PXPA 5L3AA 3EFLA 4II5A 2IW8A 3R8ZA 3V5WA 4FZFB 1OZ1A 2NPQA 1UA2A 2UW8A 4RZWA 4Y5HA 3VRYA 4Q2AA 3F2RA 3HMIA 4W9WA 3VUTA 4EK3A 4D55A 4EUTA 1SMHA 2JKQA 4XBUA 4YTIA 5JSMA 2BDFA 2CKQA 1NVSA 3EWHA 3DKCA 3ATTA 3JPVA 4FV6A 1ZOEA 4FKIA 2VTLA 3E7VA 4TY1A 3QF9A 3QTZA 2EVAA 4R78A 2YEXA 2R3FA 4FKQA 2C6IA 3PJ8A 2YWPA 2F2UA 2UZDA 3DPKA 3NEWA 3QU0A 4JAJA 3V3VA 3ZXZA 2B0QA 2W5BA 2DWBA 2HZ0A 2QHNA 4MYGA 3LFCA 4UYNA 2QOQA 3THBA 4IACA 4L67A 3KB7A 4FKVA 3LVPA 4MWHA 2XNBA 3PLSA 4WT6A 3FMEA 1ZAOA 4IZYA 1OL7A 4TRLA 4IE9A 3WYYA 2WIHA 5CU2A 5F95A 5B2KA 3JVSA 2C6EA 1IRKA 3LZBA 4XV2A 3V01A 4KB8A 3ZC6A 5JGDA 4FKLA 1XH9A 4P90A 2O8YA 3G51A 3HMPA 2CGUA 4K9YA 4RWLA 4TWPA 4JT3A 4YJVA 4YP8A 3UVPA 4EQMA 5M4CA 1Q5KA 4YTFA 4X3FB 2WMSA 4KIQA 3NX8A 4TYIA 4D2VA 5JZJA 2BAJA 3O7LB 3TN8A 4O83A 1A9UA 4YZNA 4PMSA 2VO6A 1H01A 3WE4A 1KE9A 4I5HA 3GU4A 3IW5A 2YCRA 3UP2A 1XH6A 3G0FA 1XR1A 3BHUA 5JFSA 4DEHA 4A4OA 4FGBA 2FYSA 3DXPA 3MYGA 4AFJA 5A46A 4ITIA 3WBLA 2VU3A 4PP7A 5JH6A 3BYVA 5CSHA 5HIDA 3NUNA 3SXRA 1APME 4MXCA 5AR4A 1OL2A 3LCSA 4EH9A 2GNGA 2ETRA 4TYHA 4I6HA 3HDMA 2HY81 5GIPE 4TL0A 1KSWA 3ZEWA 1YVJA 5AIRA 3UQCA 5JN2A 5HZNA 4DEAA 4ENXA 2IZUA 4S33A 4AF3A 4AOTA 3TEIA 1TQMA 3O0GA 3Q3BA 4O0YA 5A14A 4I6BA 1YWVA 2YISA 3NUYA 3OEZA 3PVUA 4G9CA 5I4NA 4PDYA 2QO2A 5L2IA 5M08A 4PP9A 1KOAA 3PIZA 4UEUA 5BVDA 2PVFA 2WQNA 1LPUA 4FSMA 4AN2A 2HWOA 4AZTA 4LRKA 3PIXA 3NNUA 5FDXA 2YM8A 4KIOA 2B52A 2F4JA 5D10A 3GC9A 3LFSA 2XBAA 3MDYA 3FDNA 2AYPA 4KD1A 5HEZA 4BDEA 4X2NA 4MNEA 4EK4A 4F09A 3FKLA 2BTRA 1Q3WA 3UOJA 4QMOA 5CASA 2JBOA 3KKVA 4GT3A 2QO9A 3Q9WA 4HNIA 5DE2A 2WU6A 2VWVA 4B0GA 3BGZA 3ROYA 3DLZA 3OXIA 5E8UA 4CMUA 1J7UA 2HENA 3RK5A 1YHWA 4DYMA 3HX4A 4L3PA 5DWRA 5DT0A 1TVOA 3QA8A 4RIYA 4CQGA 4MXAA 4U79A 4O7YA 3MFRA 4BCJA 4YURA 4MF1A 3OCBA 4M84A 1H1QA 4FTNA 4K8AA 5JEBA 4I5CA 2JEDA 1QPCA 3G5DA 2VTSA 3FWQA 3OP5A 2P33A 4A7CA 1HCKA 2HW6A 3P7CA 4G3CA 3AC8A 2AC3A 3JXWA 5HG8A 4BYIA 1ERKA 2HXQA 4GUEA 1R1WA 4KIKA 3E64A 4KWPA 3TUBA 2VTRA 4CLJA 5KCVA 4RG0A 3TV4A 4U3YA 4YBKA 2ZYBA 2UVXA 4QP2A 4G2FA 4RX9A 2JFMA
chains in the Genus database with same CATH superfamily
4X2KA 3KF7A 3NUUA 1B38A 1OL6A 4V04A 3TV6A 2ZB1A 2O64A 2W5AA 4EH4A 2Z7SA 2E9PA 5EDRA 2CNUA 4LOPA 3R73A 2VTQA 1V0PA 3E3PA 2QODA 3CD3A 2UUEA 1H1SA 4G16A 5TE0A 3R8PA 1RW8A 3FZSA 1W7HA 3UYTA 5AP1A 5E8WA 5FRIA 3R8UA 2VWWA 4R1YA 4QMQA 3EZVA 2C5OA 5A6OA 4NM0A 3EQDA 1QPEA 5BQ0A 2XIRA 5CZIA 3HYHA 3BYOA 2IO6A 5CF4A 3MFTA 3QX2A 2G1TA 3ZO1A 4QDEA 4D1SA 3CTJA 3BHTA 4GG7A 2A0CX 4KBAA 4MH7A 3DV3A 1FGIA 3K5VA 4AE9A 4CGAA 3HZTA 4DFZE 3EN5A 5FEDA 1G8JA 4QRCA 4EC9A 4BCGA 3ALNA 2H6DA 4ANSA 4R5SA 4EH2A 1OGUA 4AT4A 1MRYA 3PJCA 4ZSLA 3UGCA 4EQCA 3Q4UA 3TMOA 3E8NA 2RG6A 3CQEA 2VN9A 3PY0A 5IEVA 2PU8A 4YJQA 4ZTSA 3MTFA 3R7VA 3AG9A 4DEDA 4FTLA 1ATPE 4U81A 4U80A 4KUJA 5M51A 4ZZOA 3UMWA 4J99A 4YSJA 1JWHA 1ZYLA 4CXAA 5FM3A 5IQEA 4QTAA 5KMMA 2ONLC 4IVCA 5HE2A 5ANOA 4OTFA 4F7LA 2CN5A 4D4RA 4DBXA 4XG8A 5BVEA 1W0XC 3OFMA 4RVTA 5AUXA 3TZMA 3HVCA 4L01A 3PRFA 4B6LA 4CTCA 4QP1A 3FI4A 4UMRA 2E2BA 4LV7A 1H00A 2ZAZA 3K5UA 4RJ7A 3GQLA 4FG8A 3I5ZA 4Q9ZA 4JIAA 1NW1A 2ITNA 4X7QA 3FLYA 5D7VA 4H3QA 5M53A 4FIIA 2X7GA 3NW5A 2W96B 4OW8A 3R9NA 3QQHA 5JT2A 4BTFA 3CGOA 4OTIA 2VRXA 2OGVA 3RALA 4CZUA 5DR6A 1Y57A 4ZTMA 3KY2A 2Y7JA 1VYWA 4ZY4A 3CD8A 2WO6A 4F1TA 2BVAA 4OTRA 4F0FA 3V5QA 5A6NA 4YJPA 4F99A 3FHIA 1IASA 4QP6A 5EM8A 3UP7A 2XIYA 4CNHA 3U4WA 3VS3A 3NFFB 2QQ7A 3A7HA 3OOMA 1G3NA 1G5SA 3C4EA 4O27B 4DH3A 3NUAA 4F9CA 3R21A 3UQFA 3L8PA 2OIQA 2VGPA 4QNYA 2WFYA 3I79A 3P4KA 2Y0AA 3ID6C 3F6XA 4IVDA 4DCEA 2GHGA 4UX9A 4RFZA 3CPBA 5HG9A 2W1IA 1WZYA 4GVJA 2O5KA 2RF9A 3R7IA 5FXRA 4QMZA 3QGYA 4F0IA 4DCAA 1YDTE 1JBPE 1E9HA 3IGOA 1Y8GA 2YJSA 2Z60A 3HRCA 4AWIA 3EN4A 3GCUA 3ZUUA 4BDGA 2QHMA 4CKIA 3Q4TA 3POZA 3BLQA 3BRBA 2BALA 5H8BA 3F69A 3BQCA 3O23A 2J0MB 5T68A 4BZDA 1IA8A 4V0GB 5IU2A 2JKOA 4FTTA 3O8UA 4GMYA 2PMLX 4NTTA 1JKTA 3P5JC 3GCPA 2UW9A 2E9OA 4O0VA 4WHZA 4C3FA 1H07A 4GK4A 3VS0A 4LMNA 2CJMA 3KXZA 1H1WA 3FMKA 4AGCA 4FIHA 2X9EA 3GCSA 3LFBA 2WMBA 3LFAA 4J1RA 5F94A 3MIAA 4C4IA 4LV8A 5HBHA 4ZIMA 5CALA 1W82A 4H58A 3PVBA 2BZIB 2IVUA 2ZMDA 1Q61A 4U0IA 4GUBA 4IX4A 5AP4A 4RBLA 5JRSA 4JR7A 4QT1A 3LMGA 2ITTA 4CG8A 1HOWA 4NIFB 1JAMA 4QTCA 1O6YA 4X2FA 3ZLSA 3GU7A 4GKIA 1XJDA 3KN6A 3UO6A 4YJRA 4CTBA 3OW3A 4ZSGA 4IJ9A 4IB3A 4E5WA 3PJ3A 3ALOA 4M3QA 3BYUA 3R9HA 3JY9A 3W0RA 5JK3A 2ITUA 5EOLA 3O5AA 2XKFA 3UOLA 4NM3A 1SVEA 3D5UA 4BCNA 5KMJA 4RRVA 4HOKA 4ZTNA 3HLLA 3BGPA 3CQWA 4BVUA 1J7IA 5CANA 4FT0A 5IG1A 4FX3A 4NH1A 4ZS0A 2H34A 4OTGA 3VJNA 1H1RA 3UG1A 2BKZA 1UU8A 3FSFA 4P5QA 5ANIA 3PXFA 4HZRA 3TL8A 5TKDA 3CXWA 2GQRA 2LAVA 3N9XA 4QYFA 5LWNA 5IQCA 5D9HA 3A8WA 3EFKA 5F9EA 2LGCA 4FSQA 1UU3A 5HOAA 2Z2WA 4ZJVA 3MVMA 4XH6A 4AXAA 5BVFA 3S2PA 2B54A 3OHTA 4AE6A 4FGRA 4EONA 4L44A 5DT4A 2W5HA 5DVRA 4AA5A 2R9SA 3IW7A 3W2CA 5CEPA 3IOPA 3Q4ZA 5HU3A 3ZXTA 1Y91A 4K0YA 2ZDTA 3GQIA 4U7ZA 1XH8A 5K4IA 5HIEA 4BCMA 1JSTA 3R04A 3PY1A 4GU6A 5G1XA 3LPBA 4NUSA 3BHHA 4BWXA 1GIIA 5KMNA 2FGIA 2OH0E 5L6PA 3ORLA 3KVWA 5I9WA 4QMPA 3KVXA 4QMTA 2OZOA 4JQ8A 3SOCA 3QCQA 5AP2A 4KINA 3BHYA 4DG2E 2XJ1A 3BBWA 4FVRA 3UVQA 1J1BA 5FM2A 2G01A 3OT3A 5AR8A 3TKHA 1DAWA 3P79A 1OGYA 4FTKA 5CQUA 3R01A 3EKKA 1PXNA 2DQ7X 4K6ZA 1BMKA 4PQNA 4BB4A 3MTLA 4XOZA 4EWQA 1TKIA 4AGWA 5AX3A 4UWBA 1JQHA 3QKMA 4R3CA 4BDCA 3Q53A 4C37A 5FEEA 4APPA 4ZLOA 4WNKA 5IQIA 4ZTLA 4FSTA 4KBCA 4NKAA 2X2KA 3QTXA 4CCBA 3IGGA 1KE7A 1Z9XA 4LMUA 3V04A 3SQQA 3TWJA 3QALE 4CFMA 2OJIA 3BQRA 1T46A 5I3OA 4DH1A 4ERKA 4AXCA 2B9FA 3A2CA 3HA6A 3EQHA 2OBJA 5JFVA 3CQUA 3GOKA 2ZV7A 4JDHA 4QMLA 2PPQA 2GCDA 4IFCA 4MF0A 4EOLA 3LLAA 4ACDA 3MGYA 4YZ9A 4YR8A 3OROA 4WNMA 1KV2A 3TG1A 3MPMA 1REJA 4CG9A 5EG3A 2J5FA 4FNXA 5LMKC 4DGMA 4MD9E 4XP3A 2YLFA 2B4SB 1PXLA 2FSMX 4I5MA 4KKHA 2PMNX 3QGWA 5HNGA 4YC3A 3RK9A 4R77A 3CR0A 2F2CB 3KRLA 5KZ0A 5AJQA 3GB2A 2QLQA 3QKKA 4FL3A 4YU2A 5E8ZA 4IDVA 3W0NA 5BVWA 3FZ1A 5AAFA 2XCKA 5HO7A 5ANKA 4WG3A 2BZJA 4O4EA 5IQDA 2JDOA 2PZRA 2Y6OA 3PZEA 3H9RA 5J95A 5EW8A 3IQ7A 4QYYA 1PXIA 3Q60A 4O7NA 4D58A 5HESA 4FSUA 4I0SA 2GQSA 3LJ0A 1U54A 4ZSJA 4CV8A 3LFFA 3FL4A 2ITPA 4WUAA 5C4KA 3WF9A 2B1PA 3GU6A 3VUKA 4Z16A 3BIZA 2Z7RA 4YC8A 2UW6A 4TWOA 2J4ZA 4U43A 3UNJA 2F9GA 1CKPA 2UW7A 3IS5A 3R8MA 2H9VA 3UNKA 1Q8WA 4MNEB 1WBWA 4YLJA 4YBJA 4L43A 3SG8A 2BFXA 3L1SA 5L4QA 4JDJA 4FNWA 5DBXA 4F65A 3PDTA 3QLFA 4O4CA 5AMNA 5HVJA 4QPAA 4G3GA 3EN6A 3M1SA 3SD0A 2VWXA 4TW9A 4GT4A 4MEDA 3II5A 4FSZA 5HTCA 4CFWA 4FV5A 1NXKA 5DHJA 4ONAA 5HE1A 2FSOX 5TT7A 2WMAA 2VNWA 4GJ3A 5LVMA 4PPCA 2HY0A 3FC1X 3ORKA 4WBBB 4EH5A 1YXXA 2NNWB 3R9OA 5GHVA 3W55A 3KULA 5AP7A 2EXCX 3FLZA 4Y5QA 2VWIA 3MVJA 5CF6A 4I21A 2X6DA 4TWNA 4XRLA 4RPVA 5IA1A 2RFNA 2BKKA 3NFGB 1U54B 4JG6A 4N57A 4R1VA 2OO8X 3DAKA 5HVKA 3LQ8A 3IK3A 4EHGA 4AS0A 2BFYA 3A4PA 2W06A 2IZTA 2GNIA 3FMLA 1CSNA 3OXZA 1H4LA 4BI0A 1PMVA 3SA0A 5CVHA 3S1HA 3MA3A 5M57A 4ANBA 1UNLA 2QI8A 4FV9A 1JPAA 5CY3A 3NIEA 1GZ8A 1QPDA 4XG3A 3GFEA 5CEKA 5J7HA 3VF9A 2YDKA 2R3RA 1UKIA 5KMIA 4FK3A 2A2AA 3PJ2A 3QRUA 4YJSA 3W2PA 4MXYA 3WYXA 4FV2A 2GNLA 4DGNA 3RINA 5HLWA 3LQ3A 4IIRA 4ZJIA 2GPHA 2F7XE 2PE2A 3FZPA 3SW7A 4CFNA 2BDWA 1XWSA 3F3ZA 3H30A 2JIIA 4KS7A 3OWJA 1IAJA 3PIYA 3F3UA 2OKRA 2W1GA 2A19B 3K2LA 3LFEA 4AGDA 4UB7A 5CVFA 5EHOA 5AAEA 4UMPA 2UVYA 4QQ5A 3GC7A 5IDPA 3FQSA 2CN8A 4NT4A 4W8DA 5CXZA 2ACXA 4RVMA 5M06A 3L9PA 4C4JA 2IZSA 1ZWSA 3ZZEA 3G15A 5HCYA 5I9UA 2ZFYA 2WB8A 4L7SA 3KA0A 3ZRKA 4MBLA 2W1HA 3E8EA 1JOWB 3PUFC 5CSPA 4EZ5A 4DHJA 5LJJA 3F7ZA 1ZMVA 4MXOA 3I7BA 3H3CA 4RIWB 3PE1A 4PV0A 5LCKA 4EJNA 3AC1A 3C4CA 1B6CB 4H3PA 3GT8A 4ITJA 2HELA 4LUEA 3H0ZA 2GMXA 4O7ZA 2YIQA 4ACHA 3GI3A 3TJCA 3ZTXA 3PA4A 4IM3A 4D28A 2YN8A 2UV2A 3QZIA 4LV5A 4E20A 4Y46A 2B55A 4ZZNA 4TWCA 4DH5A 5FTOA 3ZC5A 4EOMA 1H28A 1V0OA 4EH3A 4PMPA 3MY0A 4E8AA 3FSKA 3ORMA 2WMRA 4FKOA 1WAKA 3MPTA 5F1ZA 5T6KA 4BWPA 2IPXA 4OUCA 4E1ZA 4GIHA 4KSPA 4IAFA 4LGHA 4PTEA 3QCYA 2QCSA 1SYKA 3COMA 5M4UA 2X81A 3D5VA 5E90A 4IW0A 2OXYA 5L8LA 2QC6A 4EORA 3IO7A 3DXNA 5AUYA 2R3JA 3DAEA 4QPSA 4N6YA 4FTUA 2X1NA 5HQ0A 5AUZA 4KRCA 3KK9A 5IA0A 3DCVA 3HDNA 2GNFA 5DOSA 2HCKA 2XM8A 3VF8A 4IZ5A 4TYEA 3SLSA 1PKDA 1XBAA 5CSXA 4UYAA 3RVGA 1F3MC 5A9UA 4A9TA 3QX4A 4O0TA 4IZ7A 4FTMA 3AC3A 4WOVA 4LRMA 3RCJA 4ZY6A 2VTJA 3NYNA 4QO9A 4CD0A 3TNPC 1SVGA 2CNVA 3BLRA 4H36A 2XK7A 2XIZA 3WE8A 1H0VA 5IA3A 4QP4A 3F5GA 4AT3A 4BFMA 1XQZA 1XO2B 4IX5A 4KA3A 4WO5A 3DBEA 4EH6A 4PDSA 4AAAA 4BCIA 3GC8A 2VD5A 3EQPA 2XF0A 3P0MA 4RSSA 4YJTA 4YO4A 4RQVA 2JLDA 3MWUA 5H8EA 1I44A 2I1MA 5AUUA 3HECA 3RWQA 4L7FA 4EOOA 3ZM9A 4O4BB 3DDPA 4XS2A 2X0OA 2QKWB 4TNDA 5CZHA 4CKRA 2W1EA 5H8GA 3Q9YA 4WUNA 4E6QA 3NYXA 4AZEA 1ZYSA 4IB5A 4JBOA 4YHJA 4NFMA 3LW0A 4FJVA 3U6HA 2A4LA 3FMDA 4E4XA 1R3CA 1AD5A 4LGDA 1YXUA 2FSTX 4PMTA 1G8SA 4XRJA 4CVAA 3F3WA 2VO0A 4XP0A 3FMHA 3NLBA 4S34A 5KX8A 1Y6BA 3FPQA 4FTJA 4I1ZA 3RBWA 2W4KA 3UOHA 5G6VA 5HO8A 5EI6A 4CRLA 4O84A 1BI8A 2W0JA 4HCUA 4LUDA 4FZDB 4NCTA 4J95A 4EBVA 4JAIA 3GP0A 3NRMA 3TKIA 3MV5A 3QLGA 4M14A 1LEWA 4M66A 1H0WA 4E5AX 3CS9A 3R7UA 2VTMA 4MUQA 3NZ0A 5LARA 3NUPA 3WOWA 3T3UA 2OZAA 3VHEA 1PXMA 2YLEA 3ORIA 1JKSA 2GNHA 4IMYA 4QYEA 3VO3A 3C7QA 4I92A 5E8SA 1BL7A 5GJDA 1V0BA 3BCEA 5I9XA 4TZRA 3NAXA 1FMKA 2P2IA 4ZSAA 4BIBA 2WMTA 2QNJA 4F9WA 4S30A 5I5ZA 4IAAA 4JXFA 4FTOA 2OSCA 4JBVA 1Q97A 3BL9A 3GEQA 4G34A 2WTJA 3DKGA 4DBNA 3UO5A 4O4DA 3EN9A 3LXNA 4FYOA 5AV3A 5AWMA 4DT8A 4RVKA 3PWYA 3M11A 2X0QA 3OBJA 3OUKA 3ZZWA 1T45A 3MVHA 3ZSHA 3QUEA 4DEEA 3ODZX 1W8CA 1OMWA 3F2NA 4FV1A 4IBMA 3E87A 2XANA 5M07A 4ACGA 3Q9XA 5EM6A 4U40A 4XV9A 4J71A 1M14A 4FOCA 4JMQA 4D4YA 5K4JA 3OF0A 2W9ZB 4BKZA 5DEWA 5ETFA 1P2AA 2YZAA 3OCTA 2YDJA 2C6OA 2NP8A 3CC6A 3BPRA 3PRIA 3VHKA 2J5EA 3GBZA 2OZAB 5CT7A 4KBKA 3RK7A 3U4UA 4WIHA 3ZFMA 3U8WA 3GOPA 4TYGA 3TNIA 4GKHA 3WF7A 3SVVA 5HVYA 5J9ZA 4BCKA 2VWZA 4QQJA 2QOCA 3ZFXA 3OZ6A 4IAIA 5HE0A 2IW6A 5IDNA 2OJFE 3D9VA 4BBEA 5AV4A 3V5JA 2XAOA 3D2IA 2OJGA 4NW6A 5BYYA 3M2WA 3REPA 4V01A 4B8MA 4H3BA 4GYGA 3NGAA 5EDQA 5KBQA 2I0VA 3C1XA 4FMQA 4AFEA 4GCJA 3D7ZA 1FGKA 4EOIA 1OUYA 4WG5A 4XG6A 5DGZA 2XEYA 4BDFA 3LCTA 4MNFA 2I0HA 3FL5A 3MH3A 4O96A 4ZZMA 4AW2A 4XG4A 4CYJA 5B7VA 1AGWA 1A48A 4F70A 3NUSA 2PWLA 4FL1A 2R5TA 4W4XA 4BGHA 4O1PA 3WZDA 4FSNA 4HCVA 4AX8A 3VS7A 4ZEGA 4AXDA 4DITA 2JDSA 4GYIA 4EKLA 3DB6A 1OBGA 3LOKA 3MFUA 5IH5A 4EKKA 3TZ8A 1OIYA 3SC1A 4R6VA 3W0MA 2JGZA 1URCA 2WMXA 4ID7A 4CMTA 4ALVA 3FMNA 2OXDA 3VW8A 2BRGA 4IX3A 4WG4A 1P14A 5ANJA 5E8VA 5CSVA 2W1CA 3U87A 3OW4A 4JX3A 3W8QA 2RG5A 3DBFA 1L3RE 5JFXA 2YCQA 5GJGA 1MUOA 2QD9A 2XCHA 3HAMA 2X0PA 3LXKA 4N6ZA 4JIKA 1XBBA 4C36A 3ETAA 3L9LA 4TYHB 4L53A 3AT3A 3CCNA 4RX7A 5EFQA 3DBCA 4L9IA 4MCVA 4QMWA 3D83A 3NNVA 3VIDA 4CZYB 5LVOA 3R2YA 1KUTA 5HLPA 4DN5A 5E4HA 3FKNA 5KZIA 2VAGA 3BEGA 3Q32A 4Y72A 1UWJA 4RLKA 1YDSE 2YHVA 4I4EA 4BIEA 3CJGA 3ZMMA 4BC6A 4H1JA 3SOAA 5ITAA 4Y95A 3OUNB 3DAJA 2XK4A 1GAGA 3GGFA 1OL1A 2Y4IC 4HPTE 3MESA 4BIDA 1VZOA 2XKEA 4Y8DA 3TIZA 4FV0A 2JDTA 3ET7A 4W4YA 3VS5A 4EOJA 5AFVA 3PXQA 1IR3A 2XNGA 4NSTA 3HV4A 3UQGA 4ASZA 4QQCA 1H24A 3LCOA 2PE0A 5IZFA 1TQIA 3IECA 3NPCA 1VJYA 1ZLTA 3PA5A 4AA4A 4QDVA 4GJ2A 4GH2A 4CT1A 4QQTA 1JVPP 4BCQA 3H9FA 4P4CA 2V7AA 2FSLX 5E8XA 4P2KA 3C4XA 3ANQA 2I6LA 3D2KA 3IDPA 1K2PA 2ITWA 3E62A 1SNUA 4IB1A 1Z57A 1F5QA 4PTGA 4GL9A 4F9YA 2BAQA 2DS1A 2F7ZE 4AGUA 2XNNA 3BBTB 3Q2JA 4D9UA 4YZCA 3NYOA 1UVRA 4DTBA 4AACA 2BILB 4RIYB 4BICA 3EB0A 2QR8A 2X4ZA 4UALA 4YHFA 1PW2A 4D0XA 3VUDA 3OWLA 4K11A 4RC2A 4PX6A 2XZSA 4YGAA 4B4LA 2R3HA 2WELA 4IX6A 4S32A 5EW3A 3DY7A 4L42A 4C2VA 3Q96A 2RFDA 2YITA 2GQGA 2YM3A 4KIKB 4YPDA 3UTOA 4Q5EA 4QTBA 5CLPA 4I41A 4YZBA 2J0IA 3ZH8A 5AP0A 1RJBA 4ACCA 2PSQA 4G31A 2BAKA 2JDRA 1DM2A 4ZK5A 2WIPA 3RM7A 5GZ8A 4HNFA 3OXTA 2QU6A 3DK7A 2HW7A 4RT7A 4QMNA 2XARA 3TDVA 2I0EA 2UZLA 3N51A 3RPOA 2GS7A 3K54A 2QVSE 2C6MA 4O6EA 3L8XA 4IWDA 4K33A 4XG7A 1PYEA 4IM2A 3BZ3A 3DZQA 3PG3A 4CEGA 3HMOA 4HJOA 4WA9A 3NWWA 4FT9A 1L8TA 3KCKA 1M2RA 3TI1A 5JGBA 2I40A 4F9BA 5EM7A 4BBFA 5CQWA 4FEUA 2BMCA 4OT5A 1PMNA 4FI1A 3SXFA 4K18A 2WEIA 3NS9A 1Q3DA 3EQCA 4XX9A 3VBQA 4BBMA 3MJ2A 5ETCA 2ERKA 4A9UA 2H96A 3TNWA 4GK3A 4M13A 4ENYA 2O65A 4LDTA 1JSUA 5EHLA 3RAKA 3C5IA 2CLXA 5DH3A 2XJ2A 1RE8A 4K1BA 3PXZA 4O1OA 1JKKA 4FT3A 4WNPA 2XNPA 3QA0A 4QYGA 4XJ0A 2WTDA 4FRFA 2KULA 4FT7A 4M15A 3RTPA 4MBIA 3V5TA 5K9IA 1QCFA 3FEGA 4DDGA 2QU5A 3QTIA 4NJ3A 4YJOA 2QONA 5L2WA 1H1PA 4G6LA 2OICA 2C0TA 3HKOA 3ORXA 1XKKA 4HPUE 3WF8A 2Z7QA 3AGLA 3BYMA 3HV6A 3KRXA 2I7QA 5LCJA 2YA9A 5AV0A 5AX9A 1OITA 2BRBA 4A4XA 3NNWA 4HGSA 4ZY5A 2GTMA 5AEPA 3UPZA 5HICA 2CCHA 3PA3A 1M17A 4IJPA 4OT6A 4LL5A 2YERA 1U5RA 2IN6A 4AG8A 3AKLA 4QMYA 4F6SA 2ZM3A 4JS8A 3SAYA 2CGVA 3UZPA 2BHEA 3PPJA 4FA2A 4O0WA 4FOBA 1H26A 3LFQA 4ZTHA 2BROA 4PDOA 2B9JA 1YOLA 5M55A 3WILA 2UZUE 4M7IA 2VTPA 1CMKE 4UZHA 5BYLA 3F2AA 4HGTA 3CTHA 5E9EA 3QHWA 4G9RA 4YLLA 5HU9A 1G8KA 4D5HA 4GT5A 1Q24A 3A7IA 4DH8A 3E8DA 4IC8A 3MJ1A 4HGLA 3W2QA 1UNHA 3RZBA 2W1DA 1RQQA 2XA4A 3A62A 3P08A 5D12A 3EYGA 1Q8YA 4X3JA 2Y4IB 4AA0A 4FE2A 4FYNA 3KRJA 3AGMA 4DEBA 4N0SA 3OG7A 1ZYCA 3ZSIA 5EYDA 2ZM4A 3KIOC 4DFNA 4FODA 4M0YA 4D9TA 2Q83A 4J7BA 2GNJA 4PMMA 3W8LA 4EHEA 5AA8A 3UIMA 2SRCA 4A9RA 4Z7HA 2V5QA 4WNOA 4UXLA 4IAYA 5HG5A 4KAOA 2BDJA 2J2IB 1NA7A 3R0TA 3SRVA 2GU8A 4ZTRA 4P7EA 3WZJA 1YHSA 2WMWA 3OOGA 4XP2A 5KMOA 1FPUA 1STCE 4MD7E 3FLWA 4PDPA 3UYSA 5DEYA 4I6QA 2PVHA 3DB8A 4IEBA 5HGIA 2WMQA 3EL7A 1FQ1B 2EUFB 1NVQA 1Q99A 1IA9A 1MP8A 3KN5A 4FZ6A 2V7OA 5FD2A 5M44A 4E93A 3HEGA 3N4VA 4W4VA 4C2WA 4C61A 1NT2A 1XHAA 3QZFA 1CKIA 2PTKA 4F1MA 1XMMA 3S4QA 5AV1A 2GFSA 3TACA 1M7NA 5BUIA 2DYLA 4YZDA 2X2LA 3ZLXA 2ITXA 4GK2A 3F3VA 4FZ7A 5GIOE 1KE8A 1ZMUA 4UWYA 4JX7A 5AP6A 2YCFA 2GSFA 4NWMA 5K5NA 1YWNA 3FBVA 2BIYA 4OTPA 3LQ5A 5LOHA 1WBTA 2IZRA 4KIPA 5ACKA 3C9WA 5D11A 4E4LA 1ZRZA 1YI6A 2R4BA 5DRBA 4GFMA 2XB7A 3SRVB 4Q9SA 4E26A 3DXQA 1YOMA 1K3AA 4LOQA 4CT2A 4EOKA 5I3RA 2ZDUA 3ZM4A 5ICPA 5AUTA 5J9LA 5BNJA 3HNGA 5AM7A 4FICA 4BL1A 4ZAUA 1FVRA 3DT1A 3EFJA 2UZOA 4MK0A 5EKNA 3PJ1A 2CPKE 3BYSA 1ZOHA 5IKWA 5CNOA 1V1KA 4EHVA 2FVDA 3C4FA 4FUXA 2WMVA 1E1VA 4R3RA 2VWUA 4F6UA 4PPBA 4E6AA 3H10A 3DBQA 3QWKA 1NVRA 3EOCA 3A7GA 2CKOA 2WOUA 3IDCA 4HYHA 3JR1A 4G5PA 5DNRA 2C3JA 4EQUA 1KOBA 4IWQA 5A4TA 3ZYAA 4WD5A 3DQWA 3KXNA 2XK8A 3R02A 3IG7A 2C5XA 2CDZA 1LUFA 3VBXA 5B0XA 2X8EA 1HCLA 5C9CA 3O50A 1ZYDA 4O82A 3PXYA 2R7IA 2VV9A 2ZM1A 3O8TA 3QAME 4I0RA 1I09A 3LXLA 4E5BA 3ZONA 3NAYA 2W17A 5DYJA 2WQEA 3EQGA 4X2GA 3UOKA 3O8PA 4O91A 1OPKA 1U5QA 4FIFA 2ZV8A 1PXOA 4I4FA 2W4OA 4U5JA 3AC2A 4QTEA 3U6IA 3PTGA 4L00A 4CCUA 5J1VA 2F7EE 5ETIA 3R7EA 2IVTA 2WQOA 5FXSA 2NRYA 3QTSA 4ACMA 3DNEA 3G6GA 3S95A 2HOGA 4QP8A 5J87A 3ZSGA 5EYMA 1P5EA 3GNIB 4C57A 4D2RA 2VGOA 2QOOA 2WTWA 4XEYA 3A7JA 3AMYA 3RHKA 2F57A 4FVPA 4IAKA 4BDJA 5IQAA 2C3LA 3U51A 3D5WA 4IADA 2J7TA 3NNXA 3E63A 4GW8A 3AOXA 5E1SA 3R7GA 2W05A 3VULA 3NUXA 4ZTQA 5IQHA 3KC3A 4U6RA 3U55A 2BIKB 2Z8CA 4KKGA 5CU4A 3UIBA 4WKQA 2ZJWA 1OM1A 3COKA 4YZMA 5KMKA 2WHBA 5L6WL 5K0KA 1ZMWA 4X6QC 2A1AB 2V0DA 2PZPA 3LAUA 3H4JA 1TFFA 4FIJA 3COIA 3W0PA 2WQBA 4GFGA 2R0IA 2XM9A 3MB7A 4LRJA 3ROCA 2QR7A 5K5XA 2JD5A 4E6CA 4L8MA 2J9MA 4Z9LA 4GU9A 4USEA 3R30A 4ANMA 4XYFA 1ZXEA 3ZEPA 3ZCLA 5IH6A 3A60A 4I94A 2IWIA 4RJ8A 4YSMA 3GVUA 3FKOA 3O2MA 3VBTA 4RVLA 1KE5A 1W84A 2PY3A 3NYVA 4JQEA 1H27A 4MXXA 1XBCA 3EQFA 3LCKA 3R00A 3AC4A 3KCFA 5EQPA 1UU9A 5J7BA 3ORZA 4FTIA 1PKGA 3BU6A 2PULA 5C4LA 2VNYA 3VQUA 4CKJA 4ZS4A 5J79A 5IUIA 2BUJA 5CI7A 2JITA 4V05A 3MVLA 4EUUA 3V5PA 4TNBA 4XBRA 4PY1A 5FBNC 1YXVA 5BMMA 5CAOA 3HL7A 3CKXA 5FQDC 2G2FA 4QP7A 1H8FA 3MY5A 5TOZA 2IF8A 4DHFA 4O38A 2XEZA 5C27A 5HX6A 3P86A 1OIRA 4D4SA 3R1NA 2OW3A 2W7XA 5KE0A 5DMZA 1OBDA 1B39A 2HZNA 3FY0A 4LL0A 3P9JA 4X0MA 2YWVA 2WQMA 4RX5A 5HBJA 3OY3A 3TCPA 3UDZA 2CSNA 1YRPA 4HGEA 4BCHA 4G6NA 2C1AA 2UZEA 2WAJA 1VLRA 2UZVA 4Y73A 5CX9A 3E5AA 4CFFA 4ERWA 4AOJA 4IC7A 3BU3A 2BRNA 3W2RA 4FTCA 3PFYA 2WMUA 3EZRA 2BZHB 4AOIA 5ETAA 3P23A 3NCZA 5F20A 2XS0A 3I5NA 4AUAA