5BVWA

Fragment-based discovery of potent and selective ddr1/2 inhibitors
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
308
structure length
274
Chain Sequence
DFPRSRLRFKEKLGEGQFGEVHLCEVDSHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epithelial discoidin domain-containing receptor 1
publication title Fragment-Based Discovery of Potent and Selective DDR1/2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 274
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5bvwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5bvwA01
4L3LA 2H6DA 3R83A 4QYFA 4AG8A 4YLLA 3OXTA 2P55A 1GZOA 4LRKA 3BYSA 3O96A 5KUPA 2NNWB 3ZM9A 2B53A 3ZFMA 4ZSJA 3PJ8A 3UVPA 1STCE 1NVRA 3QTSA 3F82A 5AP3A 2ITXA 2YIXA 4BCJA 2XVDA 3L8PA 2BHEA 4RWIA 4D1ZA 4QNAA 3DNEA 4U3YA 5B2LA 5J5TA 1K2PA 2XYUA 1UU7A 2GNFA 2VWWA 1XQZA 3V8TA 3T3UA 4G17A 3LXNA 3LW0A 3VF9A 3LFFA 3WYXA 5FUTA 1E9HA 4A07A 2BZHB 4DC2A 1PYEA 4QMZA 3RAHA 4D28A 1WFCA 1NVQA 3DDPA 3ZEPA 2UZBA 4QYGA 4AN2A 2XCHA 5ITAA 1AD5A 4FNYA 4FEXA 2QOQA 5CVGA 3BBTB 3FQHA 3DJ7A 3Q52A 2ITQA 3M42A 3ORXA 1O6LA 4JNWA 4M0YA 3R28A 3IG7A 4XUFA 5EYKA 4OTRA 4ARKA 4CLIA 5JMSA 2PE0A 1Y57A 1JAMA 2YDJA 3QGYA 4XMOA 4BDHA 5JFSA 3KULA 2VO7A 1SNXA 2VWIA 3F3UA 4GK3A 4IX4A 4FE2A 1H24A 4FTOA 2C6DA 3PIXA 2XKDA 2PMNX 5AM6A 2UVYA 4AAAA 1J1CA 3ODYX 5HX6A 4CV8A 4E4MA 2UZDA 2JBOA 2PUIA 4XLVA 2UZOA 5CU3A 3V8WA 4QRCA 3RPSA 3MS9A 3QGWA 1H07A 3ORZA 3R2YA 4O2ZA 4C57A 5L2TA 5CEMA 2P4IA 3TV6A 1PXIA 3UQFA 2ERKA 4F0IA 2WIHA 5JSMA 1GAGA 4BKYA 3UOHA 2WELA 3G6HA 4IANA 4O7NA 3E3PA 3NUNA 4IMYA 1SMHA 1XH4A 2R3HA 3FMHA 2GSFA 4Y95A 4DH8A 2XB7A 3AT2A 4JG6A 4JX3A 3FMLA 4EK8A 1ZOGA 4IVCA 2JKKA 3QQFA 2I1MA 4ANNA 4IAAA 1IA8A 5EQPA 3IW6A 3MPAA 4PTCA 5AP2A 2JAMA 5E1SA 5AJQA 4I1ZA 2GDOA 4BZOA 3EQFA 4OT6A 1YHWA 1OB3A 3RAWA 2JFLA 4Y8DA 4F9BA 1VYZA 5JFXA 4I4EA 5HVKA 3A7FA 1NT2A 2R3GA 4G6LA 2JITA 3UPZA 4L42A 4I3ZA 3WF5A 4UYNA 4BBEA 4RJ5A 5BVNA 4R1YA 5K0KA 4RX5A 3H9OA 4Q9SA 2X39A 2C0OA 2WMUA 3QRJA 3MWUA 1B39A 5FG8A 2ITNA 4EHVA 2Y6OA 4GJ2A 4H3BA 4YC8A 1MP8A 3LFAA 2G15A 3PXYA 3QRTA 3HV5A 4XS2A 4KIKB 2WZJA 3R21A 3OEZA 1P14A 2XJ0A 5JGAA 4DFUA 1KSWA 4UXQA 2PVMA 4TN6A 4WT6A 3CE3A 2J0JA 4FA2A 3GC7A 3NEWA 4D9UA 3R9DA 2EXCX 5CNNA 2YCQA 4F99A 3W8LA 2YM7A 2F2UA 4QMNA 5HORA 1J7LA 3ZYAA 3QCQA 3TNHA 3KL8A 5FBOA 2BAQA 4E4XA 4F9CA 3O50A 3ZZEA 4YZDA 1Q61A 4NW5A 5IQIA 4JI9A 4O0YA 4QMLA 3R8LA 3DK7A 3LFEA 1FPUA 3IO7A 5J87A 4TKSA 4OUCA 4O22A 4BIEA 5CVHA 2YM3A 3MVLA 3NGAA 5HTCA 2PWLA 3D7TB 1W84A 4IQ6A 4EC8A 4HJOA 4FV4A 3EZVA 4GKHA 3SXFA 4NSTA 3KREA 2ITPA 3D0EA 3MA6A 4FSNA 5CU4A 1OKVA 4X2NA 1NVSA 1V1KA 4IVBA 4AFJA 3LJ1A 5H2UA 4WG4A 4IWQA 2OWBA 4H58A 1UNLA 2YZAA 2IVUA 2W1DA 4LI5A 1G8SA 3ENHA 3KCFA 4FTQA 3S2PA 1SVGA 2ONLC 2W1FA 1Z9XA 3HLLA 5EM5A 5ANEA 4FSMA 4KD1A 1XH8A 3UZRA 3SG9A 1YOMA 4HVSA 4QD6A 2AUHA 3AC2A 4PX6A 3Q4ZA 3ZC6A 3C4WA 2O2UA 2R3JA 4EH8A 1YOLA 4FF8A 5HU9A 4Y5HA 4IEBA 1KWPA 1ZYJA 3TNPC 5LVOA 2QKRA 1Y6AA 3V5LA 5F95A 4EUTA 4RGJA 1H1WA 3N51A 1YI4A 2BR1A 4IH8A 2GNJA 3ELJA 1XH7A 3F3ZA 3QKMA 4IACA 4AU8A 3DKCA 2JEDA 1R1WA 2J2IB 5CAPA 2QURA 3LKMA 3A7HA 1APME 4RX7A 2OXXA 4ASXA 5CLPA 4QPMA 1ZAOA 4M13A 3DXPA 4K18A 3W16A 4RJ4A 2PVHA 4NJ3A 1H4LA 1QPCA 2XIYA 5G6VA 5AM7A 1WCCA 3VS7A 4I0TA 5KNJA 4AT4A 4AXAA 1OITA 4YJNA 4XG8A 3EQRA 4C36A 5L2SA 2FSTX 3SOCA 1VZOA 3ZUUA 2KTYA 1A06A 1WBWA 5KZ0A 4GK4A 4R5SA 3UODA 4AZTA 1PHKA 3NAXA 3VBYA 3U54A 2GS6A 3VJOA 4YNEA 2WMRA 3TTIA 3G33A 4IDVA 5JGBA 3WIGA 1REKA 3QRKA 3TZMA 3BZ3A 1PMNA 3FXXA 3A4PA 3UIBA 2B9HA 1JWHA 4FNWA 3QTQA 4D2TA 3UMXA 4I6BA 2FH9A 2W5HA 2QLUA 3UOKA 2HWPA 2JFMA 2Y0AA 4C4JA 3QX4A 4G5JA 1IEPA 3VHEA 3MY5A 3WARA 3E8NA 3MESA 3LJ2A 4ZLZA 5BVDA 5IQAA 5IUIA 4YMJA 4AN3A 3LXPA 3FZPA 5I9ZA 2I0YA 4FV2A 2OO8X 3ERKA 4YTIA 5BQ0A 2G01A 3EL7A 3PUPA 3ATSA 3LLAA 1UKHA 3P78A 2W1HA 5IA5A 3H9FA 1R78A 3GBZA 4ORKA 3R1QA 3EZRA 5LMKC 2H9VA 2ZDUA 4U6RA 4XHKB 4R7HA 4FK6A 3OVVA 4UALA 4KIOA 5A3XA 1ZMVA 4KABA 5KHXA 2CKOA 5TOZA 1IA9A 3LHJA 5L2QA 3DY7A 1ZXEA 4FKVA 2DQ7X 4MX9A 3BGQA 3PPZA 4C35A 2OU7A 3O0GA 3HDNA 3LFCA 3PZHA 3IW7A 4DH5A 4F6UA 3CGOA 2Z60A 1PXJA 3PG3A 4O84A 3G90X 4GUEA 4EKLA 3C4EA 2W1GA 2JC6A 3VVHA 3R7UA 3D14A 3ZZWA 3QHRA 4R8QA 3G15A 3HX4A 2ESMA 1G5SA 2W5AA 4FSQA 2B52A 2PULA 4I0RA 2GHGA 2WGJA 3KRWA 4OTIA 5L3AA 1ZZLA 4CFWA 3TNQB 1AQ1A 2ITUA 4XOYA 4PL4A 4CG8A 1BLXA 4QTCA 4V01A 3L8SA 3F69A 4N57A 4NIFA 3N4VA 3AG9A 2BRBA 4WSQA 3ORTA 4AA4A 3GCQA 3D83A 5E92A 4RJ6A 3W32A 3RZFA 1WAKA 3PVUA 4IAZA 2C5OA 4TT7A 4CFNA 3E62A 1WBPA 3O23A 3ORIA 3OT8A 4H3PA 5EYCA 4D4SA 4QYYA 4RIYA 3BYOA 1SYKA 1BKXA 5AP1A 4EK4A 1ZOEA 3KXMA 4WHZA 2PSQA 2WPAA 2CHLA 3QAME 4TYGA 5CQUA 5B0XA 3RPVA 2F4JA 4HZRA 4CXAA 5HE1A 4GJ3A 4U8ZA 3GCVA 4PP9A 5DLSA 2QNJA 3FLYA 3O71A 2GPHA 3QALE 5FXRA 4DE4A 2XZSA 4IWDA 1U59A 4IWPA 4U45A 2NRUA 5J9YA 4GIHA 3HUBA 5FEDA 4M15A 4PDPA 3U4UA 4B4LA 4S33A 4S31A 3RNIA 1UWHA 5TO8A 1OIYA 5TE0A 2R2PA 5CU6A 4MNEA 2BDJA 5IDPA 5BYLA 5JRQA 3ZSHA 3LCKA 1RE8A 3OWLA 3OS3A 4FIHA 3PPKA 1LUFA 4CSVA 3V5PA 5CSHA 3P1AA 2IPXA 4BDJA 5C8MA 2VUWA 1KE6A 3ZM4A 4FT9A 4BY9E 3E8CA 3FY2A 3FUPA 2YA9A 4FVRA 1CMKE 4MBJA 3MDYA 3CPBA 5DOSA 2O5KA 2C0TA 2H96A 2JIUA 4QP8A 4BDCA 2UW4A 4KKHA 4CQGA 3FSFA 4E8AA 5LJJA 4Q5HA 4DGOA 5A4TA 3VNTA 5CEQA 3VUIA 3PXQA 4FL2A 2YM6A 3FI3A 4KSQA 3A2CA 5GHVA 5HO7A 4AZWA 4CEGA 1T45A 4M69B 2C4GA 3GFEA 4ZSLA 1YQJA 3FI4A 4WRGA 4E7WA 3IPHA 3TJDA 3S1HA 3AXWA 1ZOHA 5FTGA 4OTHA 3LAUA 4F9WA 1OZ1A 5HG5A 3UGCA 3C4ZA 3I7BA 3QZHA 5DPVA 2WU7A 4YTHA 3MJ2A 4YP8A 5M4UA 3MVJA 3U6JA 2QOKA 3Q2MA 1GJOA 3RWPA 3I7CA 4FNZA 1M7NA 4EK6A 3OCTA 1PKDA 5I9YA 4BTKA 3HV7A 4AE6A 3C0IA 1Q8YA 3CKXA 4LOQA 2UV2A 4YPSA 4UZHA 4FODA 5LVNA 4PUZA 4L44A 4MQ2A 5IA1A 3BV3A 3P79A 4GKIA 3GU6A 5EOBA 4PTGA 2UZUE 5I3RA 2G2IA 3LXKA 4R7IA 3K3JA 1IRKA 1RQQA 2GTNA 3V5TA 1Q3WA 5ACKA 4HVDA 3L9LA 3KXXA 1OIQA 4J95A 3F7ZA 4RIWA 3DK6A 5HO8A 3LFNA 1UKIA 2XEZA 2ZJWA 3FMKA 3R30A 3G6GA 3EQBA 4RJ3A 3BLHA 4YZBA 2C6IA 4E5BA 2YIWA 1XR1A 3SRVA 5IEVA 4C3RA 2XKCA 2OI4X 3EQHA 4FSUA 4HVGA 2H8HA 5IEYA 3DJ5A 4EK5A 5J9LA 2YABA 4ONAA 4GW8A 4GFMA 2J4ZA 2JGZA 3EFJA 3QA8A 5DVRA 5ETAA 4C3PA 2E9UA 2V55A 4AGUA 2JIIA 2WD1A 3EOCA 2G2HA 5AAGA 3H10A 5A14A 3R9HA 4UMRA 3ZRLA 3BX5A 4XJ0A 2YAKA 4YO6A 3EHAA 3ZONA 1ZARA 3QD3A 4UWBA 1Q8WA 3QTIA 4G34A 4YJPA 3GVUA 4ZK5A 3I6UA 1KOAA 1FGKA 3HDMA 3HV6A 1ZWSA 5CWZA 5JQ8A 1PW2A 3BV2A 4UMQA 4KB8A 3ZDUA 4DF3A 2YISA 3R1SA 4QO9A 1GZ8A 1ZMWA 4J53A 4TYHA 5ANKA 4EBVA 3RK7A 4QP1A 3AGMA 4C4IA 2GQGA 5E8YA 4U81A 5AUWA 4YJUA 2WMWA 4EZ3A 5CEIA 4EH3A 3EN5A 3ENMA 4RZWA 3EIDA 3DXQA 3HZTA 4FX3A 4EJNA 2C6OA 1MRVA 1M17A 3BRBA 1PMEA 2BROA 2PL0A 1Q99A 2UZTA 3DBEA 2Q83A 3G9LX 3KN6A 4IFGA 3RBWA 1TQPA 3MVMA 3I6WA 1UNHA 3ORNA 2ONLA 1P4FA 2GHMA 4XG9A 5L6WL 5E1EA 4QPSA 5DR9A 3ZLWA 2YZLA 2Y8OA 2W1ZA 1WVYA 3PXRA 3QCXA 4C8BA 5HLWA 5M4FA 3F66A 5CAVA 3DJ6A 3IGOA 4XP2A 3MFRA 4FTMA 2WTKB 3O17A 4QMTA 1O6YA 4IM2A 4BDIA 4AFEA 1GIIA 3S4QA 3VUDA 5K9IA 2P2HA 4W4WA 3AC8A 3BQCA 4G6NA 4PDSA 4W9WA 4EZ5A 2CLXA 3PA4A 2XKFA 3VHKA 1PF8A 2ETKA 3F6XA 1YW2A 2Z2WA 3TXOA 3VS4A 2Z02A 4FTUA 3MIAA 4JRNA 2CLQA 4AE9A 3PWYA 4L67A 1KE9A 3OF0A 3W10A 3U87A 4EWQA 3NNVA 4L6QA 5L4QA 5EG3A 3PG1A 4FEUA 2QG7A 3HV4A 3LXLA 3PY1A 5EKNA 4O1OA 3C0GA 4E5AX 4J7BA 3BLQA 1XBAA 3QKLA 2BALA 5KCVA 3ANRA 4DLIA 4X3FB 2XH5A 3F5PA 1MQ4A 1K9AA 1OIRA 2YIYA 3PXFA 4IZ5A 5F1ZA 4ZTHA 4FKJA 4Q9ZA 4M14A 4L8MA 4NKAA 1UU3A 1BI7A 3ZRMA 1GIJA 4JBVA 4L3JA 3O7LD 4RVLA 3ZMMA 5J5SA 4EJ7A 4USDA 4FL3A 4AACA 4JRVA 3F3TA 5DEWA 2DWBA 3FQSA 3I81A 5IH6A 2WU6A 3C13A 4ASDA 4FOCA 5DR2A 2B7AA 4XYFA 2IZSA 2X8IA 4UYAA 3FY0A 4TNBA 3QC4A 4V0GA 5F4NA 4FG8A 4TPTA 3GB2A 2QOCA 1GNGA 1UU9A 3O8UA 5JZNA 5HBEA 4P2KA 3ZSIA 1CKJA 4FT5A 4RG0A 2PVKA 3K2LA 4FTIA 2C68A 4IAIA 4Z3VA 2O64A 3E64A 4PNKA 2VGPA 1ZRZA 2QR8A 3BHUA 5D11A 4YU2A 3D5VA 4R5YA 4O7YA 3AT4A 1B38A 2BTRA 3QQHA 4CMTA 2YJSA 4NKSA 2G2FA 3HV3A 2PMOX 2YDIA 3CQUA 3ZS5A 4TWOA 4QQCA 4QTBA 3KVWA 1OL6A 3U6HA 5DT4A 1FVVA 3NUXA 2IW8A 4ALVA 5F20A 3HA8A 4IX6A 5HHWA 4K77A 5C8NA 4LGHA 4J1RA 3OEFX 3GCUA 2EXMA 2Y4PA 3Q60A 1YKRA 4I41A 4NW6A 4C61A 3GOPA 4I24A 2PUUA 3BE2A 4RIXB 4IW0A 3Q9YA 1JKSA 2HCKA 4F7JA 3AOXA 3W8QA 4DGGA 4DGLC 2HZ4A 4YO4A 2CGWA 3NYVA 3IDCA 4Z9LA 5E8TA 3CPCA 4AQCA 1URWA 4W8DA 4CLJA 2X2LA 5HQ0A 4AGDA 5J1VA 4ZS4A 4WG5A 4FKUA 4EOMA 1H01A 5HBHA 3KKVA 2A2AA 3COIA 4OGRA 3VS5A 4MAOA 1I09A 4LOOA 2ITZA 3GU7A 1VJYA 4EOIA 1DS5A 2EUFB 2QONA 4O83A 3C4FA 3FE3A 3DGKA 4KIQA 4N6ZA 4CCUA 2O8YA 2QI8A 2FSOX 3PFQA 3F3VA 4HPTE 2ZV9A 3LVPA 4GK2A 4HNFA 2BZKB 4FOBA 4I5MA 5ETIA 5KBRA 4DTAA 4LRMA 2Z7RA 4J98A 4XRLA 4L46A 2VTMA 2O65A 5CU2A 1RDQE 2VTOA 4FBXA 4CGAA 3A99A 2ZM4A 1JVPP 2GNHA 3NVMB 4DFXE 4GCJA 3TG1A 4FGRA 3O7LB 1CKIA 4YJRA 4FZDB 1W98A 4EQCA 2Y4IC 5AX9A 5FXSA 3EMGA 1JSUA 2A1AB 2XUUA 4BICA 4C4FA 4EH2A 4QP2A 4DTBA 4BCHA 2JD5A 1PY5A 3KEXA 4BCKA 3LMHA 2QCSA 3EN9A 3SHEA 2IO6A 3MSSA 5BYZA 4I5CA 4TW9A 3PIZA 4A9SA 1ZY4A 2J0IA 5C03A 4P5ZA 3D5WA 4TWCA 5CYIA 1EH4A 4PNIA 1YDSE 3ALOA 3RHXA 5ETCA 3LJ0A 5DNRA 3R04A 1F3MC 1YWRA 5EHLA 5HG8A 3ZBFA 4CZTA 1ZYLA 5KMNA 3UO4A 4WUNA 3NW7A 4UV0A 4NFMA 5JRSA 2BRNA 3COHA 1H26A 4QYHA 2Q0BA 1H27A 4M66A 5IISA 5M51A 5HVJA 3ZO1A 4FTRA 2I0EA 2Y9QA 5AR3A 5A9UA 5M57A 4G1WA 5AAEA 2CN5A 2CKEA 3LCDA 3Q5IA 3N4UA 4IADA 3UO5A 2P3GX 4ZTNA 1YHVA 2VNYA 3VUHA 4O2PA 4UEUA 3TWJA 4CD0A 3CY2A 3FKOA 4FR4A 3S0OA 3THBA 1H1SA 2QOLA 3RHKA 4WNMA 3PJ1A 1JSVA 4CZUA 4BCQA 2B54A 3Q53A 1S9IA 3CIKA 4UBAA 4USFA 5CANA 4QOXA 3ZDIA 3OOMA 3SVVA 1M2RA 4D2WA 2XMYA 4RLKA 4XG2A 4D0WA 3FMEA 3DCVA 4JXFA 4QQJA 3E87A 3ZC5A 5JZJA 4BZDA 1Y8GA 3RKBA 2ITYA 4C7TA 2YJRA 4EC9A 5D7VA 2VTNA 3NVKI 4JDIA 5DBXA 3PVGA 1AGWA 4I21A 4TWNA 3JPVA 3E8EA 3SW7A 1XBBA 4A4LA 1GZNA 4F65A 5KMJA 4E6CA 5KX8A 3KB7A 4FZ6A 4C0TA 1J91A 2VTLA 3VRYA 3WE8A 1OL5A 4HCUA 4I6QA 4LGDA 4C58A 4U79A 5H8EA 2OF4A 4TRLA 4FL1A 2CKPA 3SAYA 2AC5A 3DZQA 4IWOA 4NTSA 5K4JA 3MB7A 2HXQA 4OT5A 4O91A 4XG6A 2R0IA 3GEQA 2QU6A 5GNKA 3VS3A 3K5UA 3R00A 2QD9A 1OKWA 4IE9A 4WNKA 2WHBA 4BKZA 5GIOE 4ZS0A 4DCEA 5M53A 2XJ1A 5DN3A 4O81A 1U4DA 1YXTA 4K11A 3RM7A 3Q2JA 3DS6A 5C8KA 2ZB1A 5HNBA 4K33A 4HGTA 2ERZE 4FKRA 5IQGA 4AA0A 2VV9A 2IZUA 4FK3A 4DH7A 4R3PA 2X9FA 4BCNA 2OW3A 3HMOA 4EL9A 3SGCA 2O0UA 1IAJA 4PPBA 2XM8A 4FTAA 4A4OA 4DFYA 4ZEGA 2RGPA 1Q8ZA 3N4TA 3C4XA 3R73A 3PTGA 3NDMA 4ID7A 4M0ZA 4P7EA 4RC4A 2FA2A 4EH9A 1H28A 5BPYA 4QTDA 2V5QA 4YLJA 2R7BA 4F6SA 5CI7A 1W7HA 3EQCA 5KKRB 4GU9A 2Z7LA 4IJ9A 4J8MA 3CJGA 4UMUA 2X81A 4RZVA 2GS2A 2WTKC 3VF8A 4AW0A 4GV1A 4LFIA 2IJMA 3OOGA 4P5QA 3MFSA 2YIQA 5E9EA 4XH6A 2A19B 2QVSE 1TQIA 5HCYA 5D41A 4GH2A 5TKDA 3QD0A 4BB4A 3EKKA 1R3CA 3LCTA 3ANQA 3OG7A 3LM0A 4U80A 2BUJA 3HL7A 2YAAA 4S32A 2R5TA 4YHJA 1HCKA 3CEKA 3R8UA 5AR4A 3TIYA 2JDOA 3ZXZA 3H0YA 5HIBA 4BCMA 5IA4A 1FBNA 3GQIA 4IVAA 3ZOSA 2BRHA 2HOGA 3PA3A 3MN3A 5FEEA 3WZKA 4YTCA 2GFCA 2X0GA 5HLNA 2WQBA 4ZLYA 2WOTA 1BUHA 2HIWA 5K0XA 3QYZA 4X3FC 5CENA 4CKIA 4DEDA 3QXOA 3SQQA 4WUAA 5E8UA 4LMNA 4M12A 2UW6A 4MWIA 4XV2A 4FKQA 5C26A 5DMZA 2XS0A 3P86A 4M7IA 2DYLA 4BBMA 3CCNA 4OAVB 4XLIA 5A6NA 5F94A 2E9PA 2F57A 3OW3A 3HMMA 3FLZA 3TCPA 4KKGA 5J7HA 2RFEA 3D2IA 4YJQA 5EM6A 3OP5A 2HY0A 2VAGA 2YACA 3QCSA 2C5NA 2QHNA 2OLCA 5CXHA 3MFUA 1Q24A 3CXWA 2B9JA 5EW8A 1MQBA 4I5HA 2C30A 2X7GA 4UWYA 3V3VA 5EW3A 5IMXA 1U46A 5FWKK 3CBLA 4GT5A 5TT7A 2PE1A 1PXOA 1U5RA 2X4ZA 3QBNA 3FPMA 4G9CA 2PVRA 5LVMA 3VS2A 4ZMEA 1RW8A 3WBLA 3HAMA 3PRIA 3PLAE 4XG7A 3FL5A 1BI8A 3U4WA 4EONA 3MB6A 3L8VA 4RMZA 3NYOA 3R9RA 2W1IA 2YN8A 3UP2A 3V6SA 4NM0A 4ZAUA 2PTKA 4Y85A 4BWPA 1ZYCA 4EEVA 3QZIA 3ET7A 4QMVA 4EH6A 4FV5A 3AC4A 3AC1A 2UW9A 2QOFA 1MRUA 3P9JA 4YURA 5I9XA 3E7VA 1VEBA 3QLGA 4HPUE 2V0DA 2O3PA 4JVGA 2BIYA 5EHOA 3RPYA 3BU5A 4ALWA 4AOJA 3ID6C 5IQCA 4U7ZA 4YJVA 5AMNA 3FQEA 5FEQA 1FGIA 4M8TA 4JR7A 3Q4TA 4IAKA 2AC3A 5CI6A 5HE3A 3CR0A 3PE1A 2CMWA 5BUEA 2HK5A 3LMIA 1OKYA 2QOBA 4QMWA 4DG3E 4F1TA 2AYPA 2ZAZA 3VN9A 3PY3A 2J5EA 5HTIA 1OI9A 3EFWA 4JBOA 2B1PA 3NUUA 3KC3A 4JL9A 4L52A 4XV3A 2JKQA 3OT3A 5ANGA 3DBFA 4DEEA 2BILB 3C7QA 2CPKE 5HNGA 4J71A 5A4LA 2CSNA 5IQEA 2FUMA 3OY1A 1XH9A 2VX0A 3F9NA 4D2RA 4IJPA 3HKOA 3OROA 1WVXA 3AD6A 4P90A 2ZYBA 5JH6A 5DGZA 2CJMA 3QTRA 3SDJA 4E1ZA 4C2VA 4ANLA 3DAEA 4OLIA 2A0CX 5IH5A 3KMUA 4O7WA 4TTHB 2HXLA 3D15A 4FEQA 4HVHA 1GY3A 3GNIB 4FGBA 5AUYA 3VBXA 4A9UA 5AA8A 3BKBA 3MY0A 4QMPA 2W5BA 3F2RA 5AR7A 4O82A 3QD4A 3FYJX 4CFMA 2XCKA 4J99A 2WMTA 5AP0A 4ALUA 3FZOA 4ANBA 1W83A 3W2RA 4IC8A 4OR5A 5IMEA 3BWJA 3DZOA 3LQ5A 4L7FA 2XYNA 3GXLA 2QU5A 4O0TA 4I23A 3ZLXA 3RWQA 4JX7A 3W2OA 5K5XA 4RA5A 4OTFA 3NYXA 1TKIA 4MH7A 4RWKA 4D0XA 3PXZA 3Q04A 4I92A 5HD7A 4BFMA 3OTVA 5L6PA 4Q2AA 5I4NA 5CAUA 4ITJA 1I44A 4WO5A 3OZ6A 1E1XA 2OH4A 2DUVA 2XNBA 4GVAA 5FLFA 2I0HA 4FSRA 4C37A 3PSBA 3QHWA 3TEIA 5HG9A 3I60A 3QQGA 2WAJA 4DINA 2RSVA 3DB8A 3EB0A 3EYHA 4DN5A 3BHHA 2PVNA 1YDRE 4KWPA 3MY1A 1H08A 4FTJA 2ZMCA 4MVFA 2C1AA 3SXRA 3R01A 4PPAA 3WF8A 2Z8CA 4B0GA 5K5NA 3UOJA 5EK7A 1JKLA 3LCOA 4M69A 4Z7HA 1HOWA 4E6AA 3HRFA 3AD5A 5KBQA 2RL5A 3NIZA 4CV9A 3AC5A 3PYYA 4MF1A 2VD5A 2WNTA 1BMKA 5IU2A 3QFVA 3ACJA 3Q9WA 4OTGA 4O7VA 4IHPA 3SC1A 4BI0A 2CNVA 3GOKA 2XIXA 3ZO4A 3NMUF 5IDNA 3G0FA 4AGWA 1WBSA 2UW5A 2YWVA 3QYWA 1FVRA 2PMIA 2R3NA 2WMSA 4LL5A 4ZOGA 3UZTA 4R3CA 3D5UA 2HZ0A 2OIDA 1SVHA 3QU0A 2OJFE 1R0PA 4JG7A 1JNKA 4JOAA 3RMFA 3RPRA 4CFVA 1L3RE 4D2VA 1H1RA 4YC6A 5BVEA 2WFYA 2W0JA 5CNOA 5BUJA 5C9CA 4I6FA 4RVTA 4TWPA 5AV0A 4D55A 1M52A 2GCDA 4TY1A 3AMBA 4GIIA 3LE6A 2ETRA 4LYNA 2PUNA 4FZ7A 4WNOA 2W06A 2J90A 3BWFA 1OUKA 5L8KA 1M2QA 4G6OA 4MXCA 4KNBA 2BRMA 2ITOA 2PZPA 3QTZA 5HTBA 5KMLA 3PP0A 3Q96A 4X21A 4F1MA 5FDPA 3TUDA 4BHZA 2X6EA 4NZWB 4DT8A 3R6XA 2OH0E 4W9XA 2W9FB 3A4OX 4I4FA 3ROCA 3SD0A 4ZZOA 4ACGA 1PRYA 2ACXA 3FJQE 3HVCA 3KK8A 5LARA 4BI1A 4R77A 3TKHA 1Y6BA 3A62A 3R22A 2BDWA 3KCKA 4KBKA 2BRGA 2XK3A 2RKUA 3OXZA 2XA4A 3QX2A 4M68A 5EM8A 5FD2A 5HE2A 5IKWA 3R8PA 2ZVAA 2PVLA 4DG0E 4O0XA 4M3QA 4MXYA 5HCXA 4AW1A 4TZRA 4OAUC 3TDWA 3TKIA 3MH3A 2JBPA 3B8RA 4QP6A 5HCZA 3U55A 4GEOA 3CS9A 4G2FA 4QQTA 3V8SA 2WTIA 3DPKA 1OL2A 3DT1A 4BCFA 4BKJA 4UMPA 2XNMA 3VUGA 4KRCA 2EXEA 4FG9A 1KV2A 2WEVA 3F2AA 5CSPA 3Q9XA 1ATPE 4XG4A 3T9TA 2YLEA 4HYIA 3IS5A 4FV9A 3Q5ZA 5FM3A 4YHTA 4ZIMA 3ZFXA 3OWKA 4G9RA 4ZY4A 1CKPA 3TV4A 2HWOA 4K8AA 4DT9A 4YBKA 4FT7A 3BI6A 4MYGA 4O96A 5BYYA 4O27B 3RINA 3TKUA 5K4IA 2I0VA 3DV3A 3WYYA 3ZXTA 4QMOA 3QZGA 4IAFA 1KV1A 3BE9A 4I93A 5HX8A 2YCSA 4R78A 1F0QA 5DH3A 5DE2A 3KVXA 4F0FA 3ACKA 4O7LA 3W33A 3FHIA 2JKMA 4IFCA 1Z5MA 2F9GA 2XP2A 2EWAA 1PJKA 2VZ6A 2GHLA 4OBQA 5M4CA 4S2ZA 5BVOA 2PYWA 4NIFB 4BI2A 1R39A 4IAYA 2VX1A 4EHGA 1SNUA 3O8PA 3TUCA 5AAFA 1QPEA 4OTPA 3W2PA 3RVGA 4CMUA 3ZEWA 2NP8A 5JEBA 4ITHA 3H4JA 1NXKA 3KMMA 4CMOA 4R1VA 1U5QA 2VX3A 5IA3A 3IKAA 4AZEA 5H9BA 4H3QA 4FV6A 5HO6A 2NRYA 3WF7A 4AGCA 5JFVA 1PYXA 4BIDA 1V0BA 2WMAA 4BF2A 1W0XC 3F7WA 4CT1A 1BX6A 4EKKA 1WBNA 3IW8A 3L9MA 4AS0A 4EHEA 4RT7A 3RJCA 1Q62A 3FEGA 1GZKA 1QPDA 4GUBA 4DHFA 1KUTA 3GUBA 4QT1A 4KRDA 2B55A 2OJ9A 2PVFA 2VO3A 3E93A 1CDKA 5EH0A 3GI3A 4RQKA 4H39A 5KE0A 2C3IB 2H34A 2OZOA 3HMNA 4MXZA 4X3FA 4E4LA 5KHWA 3KK9A 2UVXA 3DFCB 3QD2B 1IR3A 1YXSA 2BIKB 3DDQA 2QQ7A 3GGFA 3NW6A 4JIKA 3LZBA 4V05A 5CY3A 5AUUA 4USEA 1UV5A 2C6MA 3AD4A 3NUPA 3R7GA 3FI8A 4G5PA 3UO6A 2WQEA 4HYSA 3VBQA 3QWKA 4EYJA 3VUTA 2VRXA 2PY3A 3DKOA 4WNPA 3HMPA 5DR6A 3FPQA 1PMVA 1SZMA 2RFDA 4MEDA 4O0UA 3TL8A 4F4PA 1BYGA 4L9IA 1DM2A 1H00A 3FC2A 4YHFA 4WBBB 4ASZA 2YM4A 4X2KA 4CNHA 3GQLA 4C4HA 2NO3A 2CCHA 3P5KA 3QKKA 4LV5A 4BDEA 3G9NA 3IW4A 3OUNB 4FEWA 4APCA 3R2BA 4C62A 2PVJA 3QZFA 2ZMDA 3IDPA 4BYJA 2GNIA 4MQ1A 1GOLA 5FTQA 4D9TA 3DQXA 3D7ZA 5HI2A 3OMVA 3FXWA 4JT3A 3FKNA 4X2GA 4IX5A 1ZZ2A 4JQ7A 3VUMA 3ZRKA 5E8XA 3Q4UA 2XNGA 3PP1A 2R3KA 2IZRA 5CF6A 5ETFA 1XHAA 5E8VA 4B6LA 5JKGA 3H3CA 3RCDA 4A9RA 1O6KA 1QMZA 1U54A 3EFKA 4QP7A 4ANQA 2YERA 3TIZA 4CVAA 2PU8A 2OXYA 3VQHA 1LPUA 3R9OA 4GS6A 2BPMA 3E5AA 4KIPA 5FRIA 1M2PA 1GIHA 2QO9A 4FUYA 5FM2A 5EQYA 3KU2A 3F88A 2V7OA 3C50A 4U9AA 5GZ8A 3UQCA 4O0VA 3PJ2A 3I5ZA 4DITA 1ERKA 1UA2A 3LCSA 5HLPA 2C3KA 3COMA 3IDBA 4RIWB 4BWKA 5I9UA 4ZSEA 4C2WA 2IG7A 2CGXA 2XBAA 3KMWA 3A8XA 3KXHA 5D7AA 3TTJA 3V51A 3ULZA 4AX8A 3FMNA 3PIYA 3ZO2A 4IZYA 3SRVB 4C38A 3F2NA 1J1BA 5JFWA 4H05A 5EQEA 1PXLA 3JVSA 5EKOA 2G9XA 3R8VA 4CRSA 5CQWA 2BTSA 2IVVA 4PQNA 4PPCA 5AADA 4YC3A 4ZLOA 1YWVA 4JIAA 5G1XA 3G51A 3A8WA 3SLSA 4FTNA 2A4LA 5AP4A 4AOTA 4MHAA 4AP7A 2YFXA 3GU8A 3BGPA 4QMUA 4EI4A 4YTFA 5B7VA 4HYHA 4PL5A 3BELA 5IA2A 4KUJA 1H0VA 2GTMA 2XM9A 2QODA 4BZNA 2WQOA 3AC3A 5AR2A 2BKZA 2BDFA 1TVOA 3EQGA 5BVWA 1PXMA 2EB2A 3FZTA 3T3VA 3W2QA 1JQHA 2OXDA 4FC0A 5CT7A 5FTOA 4TYHB 2J50A 4LUEA 3ZUTA 5KMOA 4K9YA 3VRZA 1H8FA 3FV8A 4QMSA 2UZWE 3AGLA 2ETMA 4BDBA 1BL7A 3P4KA 4FKPA 4AZFA 2J6MA 2F7ZE 3K5VA 1SM2A 3R8ZA 3QUPA 5B2MA 1OBDA 4IM0A 5BVFA 3VO3A 2YHVA 2F7EE 5DIAA 2CGVA 3JUHA 4L01A 4NCTC 4YR8A 4CKJA 3P23A 2OBJA 4RFYA 2R4BA 4JAJA 4A06A 3VBTA 1JKTA 4U97A 1OVEA 1OGUA 2R3LA 3NWWA 2BMCA 3VIDA 2BAJA 2BHHA 1PMUA 2R3PA 3MFTA 4FSZA 4OTQA 3UPXA 3LMGA 4J8NA 4A9YA 3MJ1A 3NNUA 1IAHA 4GFOA 3BEGA 3BGZA 3C0HA 5D9HA 5HIEA 5IG1A 1ZY5A 2FSMX 4II5A 2P0CA 2W1CA 4BVUA 3ALNA 4YJOA 5E91A 4FEVA 1DI9A 2E9NA 2VTRA 4KINA 3MH2A 4MCVA 2XRWA 4MD8E 4RJ8A 3SKCA 2EB3A 4DLJA 1F5QA 5CALA 3W2CA 2JKOA 1OECA 3QTUA 4QMMA 2VTJA 3AMYA 4W8EA 4L45A 5EDPA 3EFLA 4B8MA 3R71A 4G3FA 5CEPA 1WBOA 3ZH8A 4PMTA 4U3ZA 2XJ2A 3MYGA 4QMYA 3BQRA 4EH4A 4E4NA 3I0OA 3LM5A 4HNIA 3Q9ZA 5DRDA 3VQUA 1YXUA 3NZ0A 1YVJA 4FKLA 5AR8A 3R7YA 4HVIA 5ANDA 1K3AA 3PVWA 4DA5A 2QLQA 3EYGA 2VWUA 1H0WA 1Y91A 4LRJA 3UG2A 4DCAA 4PDOA 2YM5A 2GU8A 3UBDA 3FLSA 4G3DA 4DH3A 1DAWA 4MK0A 4F9AA 2QOOA 4BGHA 1T46A 3C5IA 4JDJA 2V7AA 4QTEA 2OZAB 3RK5A 2B4SB 3HA6A 1J7IA 4DFBA 4CFFA 2ZV7A 5AP7A 5AFVA 4PMMA 4MKCA 5E8ZA 4HGEA 4MF0A 2QR7A 5HEZA 4K1BA 3FWQA 2VTTA 4C02A 4PTEA 5M07A 3NUYA 1IG1A 3DB6A 1W8CA 4JS8A 4F64A 5J9ZA 3II5A 4WSYA 5HIDA 3C1XA 5GZ9A 4BDKA 5AA9A 3PZEA 1W82A 4UY9A 1JBPE 3ZBXA 4C34A 2W17A 2R3IA 2B9FA 4FIJA 4BTJA 3U6IA 3FZRA 3KRJA 4FTKA 1JPAA 3RI1A 3VUKA 4FKWA 4XG3A 5FDXA 4BCGA 5D12A 3ORKA 4GT4A 2WTJA 4ERKA 4YSJA 4PRJA 3PWDA 5J8IA 3RAIA 2R64A 3QQJA 4KAOA 3BU6A 3TJCA 4FIFA 3D4QA 2Q0NA 3CD3A 2PPQA 4FSWA 4CZYB 3KGAA 2Y6MA 2BCJA 4OBPA 3T8OA 2UZEA 2VTSA 2W9ZB 5M06A 3DA6A 4HZSA 2HW6A 3RPOA 4NU1A 3R02A 4CTBA 3NSZA 4IVDA 3D9VA 5LCJA 4NFNA 4RQVA 4R7BA 5AR5A 4FV0A 1WBTA 3NR9A 5IQFA 1TQMA 5E8SA 5EI8A 5FXQA 1MRYA 4FT3A 4ZJJA 2PE2A 5F9EA 5HBJA 1OBGA 1OM1A 4C33A 3VS6A 2BKKA 4U40A 4B9DA 4JQEA 4BR3A 5CSWA 3UOLA 4O7ZA 3SOAA 2VTPA 2QHMA 1QPJA 4KKEA 4W4XA 4APPA 3U8WA 4DAWA 3IECA 3EJ1A 2CCIA 1G3NA 3R1NA 4O6EA 2OJGA 3FMDA 4KIKA 3KXGA 4RBLA 4RLLA 1VYWA 3OC1A 5E90A 5IQDA 5AP6A 4NTTA 3ORPA 3P7CA 4E3CA 2ZB0A 4RWJA 2I7QA 1XO2B 3POOA 4G31A 4FTCA 5K3YA 4D4YA 5LVPA 4HGLA 3SW4A 3DFAA 2I6LA 2NPQA 3CKWA 4BWXA 3F5XA 4HYUA 4XV9A 5BX0A 2YCRA 3FXZA 2PVYA 3TNIA 4C4GA 3FAAA 3MIYA 4FV7A 4XEYA 2UUEA 4CRLA 4EH7A 3RAKA 4I0SA 1XBCA 4AF3A 4KSPA 4QYEA 2C1BA 5H8BA 2GNGA 2X2MA 2QG5A 4CYIA 4ZSAA 1OPJA 4U44A 1YI3A 4EHZA 2WMQA 4KBAA 2XK4A 5AUZA 4FIEA 3FMJA 2QKWB 4E5WA 4LMUA 5DT0A 3TT0A 5IF1A 5M44A 5DRBA 3DBCA 3D7TA 2C5YA 2V22A 3BU3A 3RP9A 5I0BA 2Z7QA 4EYMA 4AN9A 4BYIA 3M11A 2OFUA 2IZTA 3R1YA 3HP2A 5LOHA 4L43A 4YZMA 3ATTA 4GL9A 2W96B 3QXPA 4OW8A 4MBIA 4JR3A 5CSXA 4G16A 3EN4A 3KA0A 4IXPA 3JXWA 2V62A 4EOLA 3OWPA 4ZZNA 4FUXA 1KE5A 3K3IA 3LFDA 1PXNA 2IVSA 3UC3A 3T9IA 4ERWA 2BZJA 4N0SA 3SX9A 3WF6A 4AUAA 4BC6A 5JQ5A 4YLKA 2WQNA 3TDVA 2W4JA 3PY0A 4X7QA 5ANJA 4QP4A 3CTJA 4MXOA 3ORMA 3KXNA 3C5UA 2FSLX 1UWJA 3UNJA 4RFMA 5E8WA 5GJFA 3CC6A 2CN8A 4ZJIA 4NEUA 4UXLA 2C47A 3PJ3A 2I40A 3KRRA 2W99B 3DLSA 5BNJA 4HCVA 2DS1A 3B2TA 3I5NA 4MXAA 2QO7A 3REPA 4JG8A 3LFQA 4NM7A 4RIOA 2FYSA 4RA4A 4DEAA 4K2RA 3UQGA 4GMYA 3DAKA 5M08A 1P4OA 4D1XA 1CTPE 3SV0A 4F0GA 4DEHA 1J7UA 2J7TA 5CX9A 3DK3A 4IC7A 3LPBA 4E20A 4D2PA 2BFYA 3S3IA 3PE2A 2BZIB 3U9NA 4IM3A 3RTPA 5AUTA 3FYKX 2ZM3A 4AW2A 3V6RA 4NK9A 2BFXA 5DEYA 2W1EA 5J1WA 2VWXA 3G2FA 5L2WA 2PUPA 2HYYA 3HYHA 3V5QA 2C3LA 3QF9A 3S95A 3LLTA 4BTFA 2OIBA 4BCPA 1P5EA 3BYUA 2QOIA 3I0QA 3HMIA 3UG1A 3KULB 4X3JA 3LOKA 3B2WA 4L7SA 1Q5KA 5E7RA 5EYMA 5AV3A 4TL0A 2XBJA 1JKKA 5KMKA 3VW6A 4CT2A 4TNDA 2OK1A 5BVKA 4IZ7A 4E93A 4E73A 5C01A 4W4YA 1YWNA 4F7NA 3AMAA 4DYMA 3OW4A 4O21A 3OBJA 1Z57A 4ZTRA 3BHYA 4TXCA 5IZFA 2YLFA 1KOBA 4MTAA 1FMOE 2R0UA 3IONA 5EFQA 3QTXA 4ZY6A 4J96A 3MTLA 2HENA 5AIKA 4ACMA 4DH1A 4B7TA 5IA0A 3DTCA 3QUDA 4FV3A 5AUXA 4ACDA 1UVRA 4Q5EA 3CTQA 2RG5A 4OTWA 1OIUA 4FMQA 5IUHA 5DHJA 1H25A 4O0WA 4S34A 3FLQA 4F08A 4RVMA 1OMWA 1ZYSA 4XP0A 4NT4A 4CFXA 5L2IA 3VBVA 4FV1A 1BL6A 5GJGA 1OL1A 3BCEA 3GC0A 3HUCA 4RX8A 1ZLTA 4Z7GA 1KE7A 1R0EA 1ZYDA 3FHRA 4PMSA 4EK3A 3D94A 3MBLA 2JLDA 3WE4A 3VC4A 1LEWA 2ZV2A 2CDZA 4D58A 2CKQA 3TM0A 3KRXA 3DBDA 2VTQA 3P0MA 4LUDA 4MXXA 1XWSA 4X6QC 1S9JA 2YCFA 1OKZA 4UMTA 2WTVA 4AT5A 2XNEA 3PSDA 2FB8A 3U9CA 4O7RA 5H3QA 3TI1A 5C4KA 1QCFA 1FVTA 3CQEA 4YGAA 3CLYA 5A4EA 2R3RA 4FTLA 2CNUA 2YM8A 3A60A 3HGKA 4JJRA 5HVYA 3O8TA 4H1MA 4O7SA 3FKLA 2GNLA 3QA0A 4RC3A 3FLWA 4FKSA 5E4HA 4K0YA 4ZY5A 3ZO3A 1ND4A 5FP5A 3OTUA 4IBMA 3EQIA 2VTAA 3P08A 2R3FA 3NCGA 4NCTA 3Q6UA 2G1TA 3HRCA 5J79A 3BEAA 3POZA 2GMXA 3HNGA 4RSSA 4BRXA 4TYIA 3SA0A 3G0EA 4AA5A 2X8DA 3HP5A 4C3FA 5IQBA 4AZVA 3DTWA 3L8XA 3WZJA 1PXPA 5JN2A 3D5XA 2HW7A 4F1OA 4N6YA 3SG8A 3BHVA 3ZCLA 3OHTA 4G3CA 1H1QA 1PXKA 3MPTA 1Q41A 4ANOA 4QP3A 2PHKA 2XK7A 3CP9A 3DKFA 5AIRA 2RIOA 4ANSA 5IH4A 4ITIA 3F5GA 5IPJA 5DT3A 4XCUA 4I22A 4WKQA 5J95A 3NAYA 4ZMFA 4BGQA 3VBWA 3ITZA 1URCA 4JDKA 4L53A 4TYJA 5GIPE 1YXXA 4MNFA 3QRIA 5HICA 5CASA 2IWIA 5I5ZA 3KQ7A 4X0MA 2ITWA 1WVWA 4JBPA 3OCGA 2VWYA 3RK9A 5D10A 5HU3A 3TNWA 3VULA 3A7GA 2PZYA 2OGVA 3WI6A 4BBFA 2GS7A 2JDSA 4GRBA 4F70A 1HCLA 2UW7A 3K54A 3GU5A 2UW8A 1JSTA 4ANMA 4RJ7A 4CG9A 4NJDA 3CQWA 3UP7A 3EQPA 4E6QA 2LGCA 2X7OA 5FP6A 3R63A 4MWHA 2J0MB 3ZSGA 4YZNA 3MGYA 3NNXA 4FZAB 4BGGA 2PMLX 2W7XA 4GYGA 3UC4A 5CF4A 3PLSA 3L9PA 3QC9A 2C6EA 2JDVA 4I6HA 4DBXA 4WOVA 2E2BA 1JOWB 5CSVA 4FICA 5IEXA 4YJTA 4B99A 2VN9A 3OCSA 3QTWA 3GCSA 3ZLSA 2WMVA 2VTIA 3I4BA 2ZV8A 3JY0A 3L9NA 3W1FA 3KY2A 4FKOA 5TR6A 4N70A 2HELA 3QUEA 4LGGA 5ANIA 3DBQA 3UYSA 4AOIA 5LVLA 1OPKA 1XH6A 3DKGA 5L8JA 4A7CA 3GCPA 5CTPA 3PSCA 2IN6A 4DGNA 1YDTE 3CGFA 5JK3A 5GJDA 4DFZE 5LMBA 5T6KA 1H1PA 4RVKA 4XOZA 5JGDA 2XNOA 4IB1A 2PZRA 4EBWA 5GZAA 4JAIA 5TF9A 4DEIA 4EOOA 3A61A 2F2CB 5CEKA 1L8TA 2C6KA 3UJGA 2UVZA 4PDYA 3V5JA 1M7QA 1OPLA 3R0TA 4PP7A 4I20A 4Y5QA 2OKRA 3R7EA 3VAPA 3E88A 4QMQA 4H1JA 1NY3A 3UTOA 1X8BA 4M67A 4ASEA 3I1AA 3I79A 3QQKA 4LL0A 4UWCA 5EI6A 2XNNA 2C6LA 2HZNA 4UZDA 2WKMA 3NCZA 5FGKA 3Q6WA 5KZIA 1LP4A 3R7IA 1KE8A 4L00A 3DU8A 4MD7E 4D4RA 5AEPA 2JAVA 2WIPA 2J9MA 3OXIA 4F9YA 4EH5A 2ZDTA 5HZNA 3ZU7A 3RM6A 1XKKA 4YBJA 3NRMA 3BYMA 4HCTA 2QOHA 3NUAA 4YSMA 5IQHA 4YNOA 5GINE 3UMWA 4GVJA 4YUQA 5KMIA 4DFLA 5L6OA 4RFZA 4DEBA 4O86A 3PDTA 3E7OA 4X2JA 4GYIA 3IK3A 3DXNA 4MD9E 3ETAA 3VWAA 2VU3A 4S30A 3RCJA 5LWMA 1XH5A 5KKRC 2Y4IB 2PZ5A 2UW3A 4LOPA 1JLUE 5LMAA 4EOQA 2EVAA 4FT0A 3KF7A 2P2IA 4L3PA 4CYJA 3NX8A 4P4CA 3QCYA 3CSVA 4PMPA 1Y8YA 2F7XE 5AV1A 4I5PA 3JS2A 4PY1A 3B8QA 4Y73A 3U51A 4XP3A 5DFPA 2R3OA 4V04A 3ULIA 4ZXTA 2Y7JA 1WMKA 4Y72A 4FIIA 1Q4LA 1DAYA 4KA3A 3UDBA 4NUSA 3H30A 4XX9A 5CEOA 2O63A 4PF4A 4D2SA 4EOSA 4EOPA 4NM5A 2WEIA 4O1PA 4RPVA 3E63A 4IZAA 5A4QA 4Y83A 5M4IA 5CAOA 2X1NA 5BMMA 2RF9A 2YIRA 4GU6A 4FI1A 3EL8A 3FL4A 3TZ7A 3UIMA 4LQMA 3W18A 1CSNA 3QWJA 4FSTA 4J97A 2JIVA 5T68A 3R7VA 5LWNA 2E9VA 2OICA 3WZEA 4FNXA 5EM7A 3MW1A 1NW1A 4RIYB 5HGIA 4HW7A 3FSKA 4Z55A 3KRLA 3HECA 5LCKA 2JDRA 4IIRA 4WG3A 3TUBA 1G8AA 5HG7A 2A27A 3OWJA 3BYVA 3A7IA 4D4VA 4NWMA 3V04A 3PXKA 3WOWA 2ITVA 4ZTMA 4QMXA 1Q3DA 2PZIA 1YI6A 5I3OA 4AZSA 3ZLYA 3WZUA 4PWNA 4A9TA 3EWHA 4KS8A 5A46A 3OD6X 3Q32A 1CM8A 2X2KA 5B2KA 3UVQA 5CF5A 4DBNA 3RALA 3M2WA 4ACCA 3TZ9A 5ANOA 3LQ3A 4MNEB 4FKTA 2IVTA 4LG4A 3OBGA 3A7JA 1J3HA 2OJJA 3NIEA 4LV8A 4OBOA 2C69A 3Q3BA 2ZOQA 4BCOA 2VO0A 2VO6A 3PRFA 4HGSA 3QL8A 2REIA 4ENYA 3DAJA 1V0PA 5DG5A 4XRJA 4C59A 4FYOA 3P7BA 4F6WA 2P33A 5CS6A 3LIJA 1E1VA 1O9UA 3IGGA 3MI9A 4C4EA 1Q97A 4EQUA 2C0IA 3FZSA 4O38A 1A48A 2J0LA 2WTDA 3ZHPC 3UYTA 5C27A 3JVRA 4TYEA 3GC8A 4FZFB 4FVQA 3CTHA 2YDKA 2WQMA 5IUGA 3UNKA 3BLRA 2CNQA 2UZVA 4U0IA 2C5XA 4O0SA 4UB7A 4U43A 4D5HA 4PV0A 5CF8A 4JQ8A 4XV1A 3O51A 3WZDA 2X6DA 2KULA 3CY3A 4FVPA 4WD5A 3RNYA 2XRUA 3COKA 5CU0A 3QRUA 5M56A 3PPJA 2C3JA 3VS1A 5I9WA 2WB8A 3G5DA 4H36A 1M14A 5H8GA 3CD8A 4QNYA 3CJFA 4G3GA 4CCBA 4J52A 2HZIA 4KBCA 3Q4CA 4PL3A 3KF4A 5CT0A 4RIXA 1V0OA 3C4CA 3VJNA 3TN8A 2YITA 4XBRA 4QP9A 4AW5A 3W2SA 3R8MA 5BUIA 2IW9A 4IDTA 5D1JA 2OIQA 4L68A 3BHTA 3MVHA 4RRVA 4U5JA 3NS9A 3ZFYA 2C5VA 4BIBA 4ZJVA 4CQEA 4ZSGA 4XBUA 4YZCA 5A4CA 5ACBC 3C9WA 1RJBA 4LM5A 4BDAA 4BHNA 1REJA 3DQWA 3MA3A 4HOKA 3WILA 1MUOA 3EN6A 4IX3A 4EQMA 3NNWA 4NYEA 5CVFA 2C6TA 2XKEA 5CZIA 5EI2A 3SXSA 3VW8A 5AV2A 2XIZA 4UX9A 1LEZA 2VWBA 4YZ9A 3P7AA 1SVEA 3V01A 1P2AA 2UW0A 5JT2A 4EZ7A 1YRPA 4ZTSA 1LR4A 4CTCA 1UNGA 2E9OA 2FGIA 3FI2A 4QQ5A 4Y46A 1PKGA 4R6VA 5A6OA 1OL7A 5CAQA 2IW6A 3F3WA 3NW5A 2JDTA 2XIKA 4F09A 2RFSA 3PVBA 4W4VA 3H0ZA 1VR2A 3D2KA 4IB0A 5HD4A 3F61A 2F49A 2ITTA 2XK9A 4K6ZA 3VS0A 2X4FA 5HKMA 5EDQA 1YXVA 4GG5A 3EH9A 5AP5A 4Z16A 1NA7A 4RX9A 3ZUVA 2OZAA 2WXVA 3UNZA 2HY81 3RGFA 3N9XA 3GENA 3BPRA 4O6LA 2X8EA 4FG7A 2VWVA 4OTDA 5A54A 2GQRA 3MH0A 4KS7A 1A9UA 4GT3A 2OJIA 4BDDA 4D1SA 5J7BA 4BN1A 5FBNC 3MH1A 4QTAA 2YEXA 3W55A 3R9NA 1FINA 2OG8A 4EOKA 2UZNA 2XK6A 1YHSA 4X2FA 3IW5A 4CKRA 4DGMA 3ROYA 4F7LA 4O0RA 1XJDA 4WRSA 4FV8A 3OY3A 2QC6A 3AQVA 3BBWA 5HE0A 2EU9A 4UN0C 1UU8A 4FTTA 1OUYA 5CZHA 4FKGA 5DI1A 3JYAA 3OCBA 1YOJA 2OSCA 4U41A 2LAVA 4RC2A 4WIHA 2R3MA 4NH1A 5HESA 4BCIA 3GT8A 3DLZA 4FSYA 4WBOA 2R9SA 5EHYA 2RG6A 3EKNA 1Q8UA 4ACHA 4EUUA 3DOGA 1ZMUA 3KN5A 3TACA 5LMKA 3LFSA 2BAKA 4ZTQA 4D5KA 3S00A 1U54B 3AT3A 3NPCA 3L1SA 2WTCA 4ZTLA 4DFNA 3EN7A 4M84A 4YJSA 4EOJA 5I9VA 3EQDA 4ZP5A 5LQFA 3FC1X 4FIGA 4BL1A 2J5FA 5EW9A 3KFAA 3TV7A 4BDFA 3NUSA 2XEYA 3C51A 4MBLA 5T3QA 4CFUA 3ORLA 2XF0A 3TZ8A 4F63A 5M09A 3MTFA 2RFNA 2X9EA 3V5WA 2WMXA 2WTWA 4GSBA 3UIXA 2QO2A 3FZ1A 3QQUA 4ZZMA 3GU4A 1WBVA 3PA5A 3UZPA 2GFSA 5L8LA 3OUKA 4JBQA 2VGOA 3UVRA 4I94A 1Q8TA 2VWZA 4AT3A 2BVAA 3LQ8A 4BDGA 3HRBA 2WMBA 2R7IA 3IQ7A 5AX3A 2WOUA 4E26A 3UIUA 2XNPA 3IOPA 4E6DA 4EWHA 2OFVA 4XNEA 4F7SA 3HAVA 2W05A 3WIKA 3FDNA 4JLCA 4EORA 2CGUA 3LFBA 4IB5A 4JDHA 3KXZA 4U42A 1FMKA 3E3BX 2B0QA 5DWRA 5AWMA 3NLBA 5ICPA 4GG7A 3MPMA 3R7OA 3FBVA 3RZBA 4O7TA 3H9RA 2ZM1A 5DYJA 3E8DA 3GFWA 4R3RA 4DEGA 2W4KA 4RWLA 3M1SA 2UZLA 3O2MA 4M97A 5M55A 3E92A 5EYDA 1FOTA 2J0KA 2PK9A 4NM3A 4QPAA 4V0GB 4NL0A 2B9IA 5HNIX 3F5UA 4IB3A 4AWIA 2YWPA 5LXMA 4WA9A 3QQLA 1IASA 1DI8A 2FO0A 2GQSA 3ODZX 3PJCA 2Z7SA 5AUVA 3JR1A 2W4OA 4ENXA 5EDRA 4FYNA 5AV4A 5CXZA 5KMMA 3GC9A 3NYNA 5FQDC 5DA3A 3MV5A 3JY9A 1QL6A 4X6RA 3FMMA 3OFMA 4G3EA 4YPDA 2WO6A 2VNWA 2R3QA 2XK8A 5HOAA 3UE4A 3BIZA 4DG2E 2FVDA 2J51A 3HEGA 5BMSA 4BTMA 3FLNC 3QLFA 2X7FA 4A4XA 2SRCA 3WF9A 4B8LA 5C1QB 4DTKA 5C4LA 5KO1A 2HAKA 2XIRA 1B6CB 1WZYA 1FQ1B 2OF2A 3GP0A 2VTHA 4FKIA 5EOLA 3ZTXA 4GFGA 3IOKA 4N4SA 3DNDA
chains in the Genus database with same CATH superfamily
4L3LA 2H6DA 3R83A 4QYFA 4AG8A 4YLLA 3OXTA 2P55A 1GZOA 4LRKA 3BYSA 3O96A 5KUPA 2NNWB 3ZM9A 2B53A 3ZFMA 4ZSJA 3PJ8A 3UVPA 1STCE 1NVRA 3QTSA 3F82A 5AP3A 2ITXA 2YIXA 4BCJA 2XVDA 3L8PA 2BHEA 4RWIA 4D1ZA 4QNAA 3DNEA 4U3YA 5B2LA 5J5TA 1K2PA 2XYUA 1UU7A 2GNFA 2VWWA 1XQZA 3V8TA 3T3UA 4G17A 3LXNA 3LW0A 3VF9A 3LFFA 3WYXA 5FUTA 1E9HA 4A07A 3UDSA 2BZHB 4DC2A 1PYEA 4QMZA 3RAHA 4D28A 1WFCA 1NVQA 3DDPA 3ZEPA 2UZBA 4QYGA 4AN2A 2XCHA 5ITAA 1AD5A 4FNYA 4FEXA 2QOQA 5CVGA 3BBTB 3FQHA 3DJ7A 3Q52A 2ITQA 3M42A 3ORXA 1O6LA 4JNWA 4M0YA 3R28A 3IG7A 4XUFA 5EYKA 4OTRA 4ARKA 4CLIA 5JMSA 2PE0A 1Y57A 1JAMA 2YDJA 3QGYA 4XMOA 4BDHA 5JFSA 3KULA 2VO7A 1SNXA 2VWIA 3F3UA 4GK3A 4IX4A 4FE2A 1H24A 4FTOA 2C6DA 3PIXA 2XKDA 2PMNX 5AM6A 2UVYA 4AAAA 1J1CA 3ODYX 5HX6A 4CV8A 4E4MA 2UZDA 2JBOA 2PUIA 4XLVA 2UZOA 5CU3A 3V8WA 4QRCA 3RPSA 3MS9A 3QGWA 1H07A 3ORZA 3R2YA 4O2ZA 4C57A 5L2TA 5CEMA 4JMQA 2P4IA 3TV6A 1OGYA 3W0SA 1PXIA 3UQFA 2ERKA 4F0IA 2WIHA 5JSMA 1GAGA 4BKYA 3UOHA 2WELA 3G6HA 4IANA 4O7NA 3E3PA 3NUNA 4IMYA 1SMHA 1XH4A 2R3HA 3FMHA 2GSFA 4Y95A 4DH8A 2XB7A 3AT2A 4JG6A 4JX3A 3FMLA 4EK8A 1ZOGA 4IVCA 2JKKA 3QQFA 3VONA 2I1MA 4ANNA 4IAAA 1IA8A 5EQPA 3IW6A 3MPAA 4PTCA 5AP2A 2JAMA 5E1SA 5AJQA 4I1ZA 2GDOA 4BZOA 3EQFA 4OT6A 1YHWA 1OB3A 3RAWA 2JFLA 4Y8DA 4F9BA 1VYZA 5JFXA 4I4EA 5HVKA 3A7FA 1NT2A 2R3GA 4G6LA 2JITA 3UPZA 4L42A 4I3ZA 3WF5A 4UYNA 4BBEA 4RJ5A 5BVNA 4R1YA 5K0KA 4RX5A 3H9OA 4Q9SA 2X39A 2C0OA 2WMUA 3QRJA 3MWUA 1B39A 5FG8A 2ITNA 4EHVA 2Y6OA 4GJ2A 4H3BA 4YC8A 1MP8A 3LFAA 2G15A 3PXYA 3QRTA 3HV5A 4XS2A 4KIKB 2WZJA 3R21A 3OEZA 1P14A 2XJ0A 5JGAA 4DFUA 1KSWA 4UXQA 2PVMA 4TN6A 4WT6A 3CE3A 2J0JA 4FA2A 3GC7A 3NEWA 4D9UA 3R9DA 2EXCX 5CNNA 2YCQA 4F99A 3W8LA 2YM7A 2F2UA 4QMNA 5HORA 1J7LA 3ZYAA 3QCQA 3TNHA 3KL8A 5FBOA 2BAQA 4E4XA 4F9CA 3O50A 3ZZEA 4YZDA 1Q61A 4NW5A 5IQIA 4JI9A 4O0YA 4QMLA 3R8LA 3DK7A 3LFEA 1FPUA 3IO7A 5J87A 4TKSA 4OUCA 4O22A 4BIEA 5CVHA 2YM3A 3MVLA 3NGAA 5HTCA 2PWLA 3D7TB 1W84A 4IQ6A 4EC8A 4HJOA 4FV4A 3EZVA 4GKHA 3SXFA 4NSTA 3KREA 2ITPA 3D0EA 3MA6A 4FSNA 5CU4A 1OKVA 4X2NA 1NVSA 1V1KA 4IVBA 4AFJA 3LJ1A 5H2UA 4WG4A 4IWQA 2OWBA 4H58A 1UNLA 2YZAA 2IVUA 2W1DA 4LI5A 1G8SA 3ENHA 3KCFA 4FTQA 3S2PA 1SVGA 2ONLC 2W1FA 1Z9XA 3HLLA 5EM5A 5ANEA 4FSMA 4KD1A 1XH8A 3UZRA 3SG9A 1YOMA 4HVSA 4QD6A 2AUHA 3AC2A 4PX6A 3Q4ZA 3ZC6A 3C4WA 2O2UA 2R3JA 4EH8A 1YOLA 4FF8A 5HU9A 4Y5HA 4MUQA 4IEBA 1KWPA 1ZYJA 3TNPC 5LVOA 2QKRA 1Y6AA 3V5LA 5F95A 4EUTA 4RGJA 1H1WA 3N51A 1YI4A 2BR1A 4IH8A 2GNJA 3ELJA 1XH7A 3F3ZA 3QKMA 4IACA 4AU8A 3DKCA 2JEDA 1R1WA 2J2IB 5CAPA 2QURA 3LKMA 3A7HA 1APME 4RX7A 2OXXA 4ASXA 5CLPA 4QPMA 1ZAOA 4M13A 3DXPA 4K18A 3W16A 4RJ4A 2PVHA 4NJ3A 1H4LA 1QPCA 2XIYA 5G6VA 5AM7A 1WCCA 3VS7A 4I0TA 5KNJA 4AT4A 4AXAA 1OITA 4YJNA 4XG8A 3EQRA 4C36A 4I6LA 5L2SA 2FSTX 3SOCA 1VZOA 4QDEA 3ZUUA 2KTYA 1A06A 1WBWA 5KZ0A 4GK4A 4R5SA 3UODA 4AZTA 1PHKA 3NAXA 3VBYA 3U54A 2GS6A 3VJOA 4YNEA 2WMRA 3TTIA 3G33A 4IDVA 5JGBA 3WIGA 1REKA 3QRKA 3TZMA 3BZ3A 1PMNA 3FXXA 3A4PA 3UIBA 2B9HA 1JWHA 4FNWA 3QTQA 4D2TA 3UMXA 4I6BA 2FH9A 2W5HA 2QLUA 3UOKA 2HWPA 2JFMA 2Y0AA 4C4JA 2IF8A 3QX4A 4G5JA 1IEPA 3VHEA 3MY5A 3WARA 3E8NA 3MESA 3LJ2A 4ZLZA 5BVDA 5IQAA 5IUIA 4YMJA 4AN3A 3LXPA 3FZPA 5I9ZA 2I0YA 4FV2A 2OO8X 3ERKA 4YTIA 5BQ0A 2G01A 3EL7A 3PUPA 3ATSA 3LLAA 1UKHA 3P78A 2W1HA 5IA5A 3H9FA 4FRFA 1R78A 3GBZA 4ORKA 3R1QA 3EZRA 5LMKC 2H9VA 2ZDUA 3PUFC 4U6RA 4XHKB 4R7HA 4FK6A 3OVVA 4UALA 4KIOA 5A3XA 1ZMVA 4KABA 5KHXA 2CKOA 5TOZA 1IA9A 3LHJA 5L2QA 3DY7A 1ZXEA 4FKVA 2DQ7X 4MX9A 3BGQA 3PPZA 4C35A 2OU7A 3O0GA 3HDNA 3LFCA 3PZHA 3IW7A 4DH5A 4F6UA 3CGOA 2Z60A 1PXJA 3PG3A 4O84A 3G90X 4GUEA 4EKLA 3C4EA 2W1GA 2JC6A 3VVHA 3R7UA 3D14A 3ZZWA 3QHRA 4R8QA 3G15A 3HX4A 2ESMA 1G5SA 2W5AA 4FSQA 2B52A 2PULA 4I0RA 2GHGA 2WGJA 3KRWA 4OTIA 5L3AA 1ZZLA 4CFWA 3TNQB 1AQ1A 2ITUA 4XOYA 4PL4A 4CG8A 1BLXA 4QTCA 4V01A 3L8SA 3F69A 4N57A 4NIFA 3N4VA 3AG9A 2BRBA 4WSQA 3ORTA 4AA4A 3GCQA 3D83A 5E92A 4RJ6A 3W32A 3RZFA 1WAKA 3PVUA 4IAZA 2C5OA 4TT7A 4CFNA 3E62A 1WBPA 3O23A 3ORIA 3OT8A 4H3PA 5EYCA 4D4SA 4QYYA 4RIYA 3BYOA 1SYKA 1BKXA 5AP1A 4EK4A 1ZOEA 3KXMA 4WHZA 2PSQA 2WPAA 2CHLA 3QAME 4TYGA 5CQUA 5B0XA 3RPVA 2F4JA 4HZRA 4CXAA 5HE1A 4GJ3A 4U8ZA 1TFFA 3GCVA 4PP9A 5DLSA 2QNJA 3FLYA 3O71A 2GPHA 3QALE 5FXRA 4DE4A 2XZSA 4IWDA 1U59A 4IWPA 4U45A 2NRUA 5J9YA 4GIHA 3HUBA 5FEDA 4M15A 4PDPA 3U4UA 4B4LA 4S33A 4S31A 3RNIA 1UWHA 5TO8A 1OIYA 5TE0A 2R2PA 5CU6A 4MNEA 2BDJA 5IDPA 5BYLA 5JRQA 3ZSHA 3LCKA 1RE8A 4AQKA 3OWLA 3OS3A 4FIHA 3PPKA 1LUFA 4CSVA 3V5PA 5CSHA 3P1AA 2IPXA 4BDJA 5C8MA 2VUWA 1KE6A 3ZM4A 4FT9A 4BY9E 3E8CA 3FY2A 3FUPA 2YA9A 4FVRA 1CMKE 4MBJA 3MDYA 3CPBA 5DOSA 2O5KA 2C0TA 2H96A 2JIUA 4QP8A 4BDCA 2UW4A 4KKHA 4CQGA 3FSFA 4E8AA 5LJJA 4Q5HA 4DGOA 5A4TA 3VNTA 5CEQA 3VUIA 3PXQA 4FL2A 2XAMA 2YM6A 3FI3A 4KSQA 3A2CA 5GHVA 5HO7A 4AZWA 4CEGA 1T45A 4M69B 2C4GA 3GFEA 4ZSLA 1YQJA 3FI4A 4WRGA 4QEBA 4E7WA 3IPHA 3TJDA 3S1HA 3AXWA 1ZOHA 5FTGA 4OTHA 3LAUA 4F9WA 1OZ1A 5HG5A 3UGCA 3C4ZA 3I7BA 3QZHA 5DPVA 2WU7A 4YTHA 3MJ2A 4YP8A 5M4UA 3MVJA 3U6JA 2QOKA 3Q2MA 1GJOA 3RWPA 3I7CA 4FNZA 1M7NA 4EK6A 3OCTA 1PKDA 5I9YA 4BTKA 3TYKA 3HV7A 4AE6A 3C0IA 1Q8YA 3CKXA 4LOQA 2UV2A 4YPSA 4UZHA 1G8KA 4FODA 5LVNA 4PUZA 4L44A 4MQ2A 5IA1A 3BV3A 3P79A 4GKIA 3GU6A 5EOBA 4PTGA 2UZUE 5I3RA 2G2IA 3LXKA 4R7IA 3K3JA 1IRKA 1RQQA 2GTNA 3V5TA 1Q3WA 5ACKA 4HVDA 3L9LA 3KXXA 1OIQA 4J95A 3F7ZA 4RIWA 3DK6A 5HO8A 3LFNA 1UKIA 2XEZA 2ZJWA 3FMKA 3R30A 3G6GA 3EQBA 4RJ3A 3BLHA 4YZBA 2C6IA 4E5BA 2YIWA 1XR1A 3SRVA 5IEVA 4C3RA 2XKCA 2OI4X 3EQHA 4FSUA 4HVGA 2H8HA 5IEYA 3DJ5A 4EK5A 5J9LA 2YABA 4ONAA 4GW8A 4GFMA 2J4ZA 2JGZA 3EFJA 3QA8A 5DVRA 5ETAA 4C3PA 2E9UA 2V55A 4AGUA 2JIIA 2WD1A 3EOCA 2G2HA 5AAGA 3H10A 5A14A 3R9HA 4UMRA 3ZRLA 3BX5A 4XJ0A 2YAKA 4YO6A 3EHAA 4AXFA 3ZONA 1ZARA 3QD3A 4UWBA 1Q8WA 3QTIA 4G34A 4YJPA 3GVUA 4ZK5A 3I6UA 1KOAA 1FGKA 3HDMA 3HV6A 1ZWSA 5CWZA 5JQ8A 1PW2A 3BV2A 4O4CA 4KB8A 4UMQA 3ZDUA 4DF3A 2YISA 3R1SA 4QO9A 1GZ8A 1ZMWA 4J53A 4TYHA 5ANKA 4EBVA 3RK7A 4QP1A 3AGMA 4C4IA 2GQGA 5E8YA 4U81A 5AUWA 4YJUA 2WMWA 4EZ3A 5CEIA 4EH3A 3EN5A 3ENMA 4RZWA 3EIDA 3DXQA 3HZTA 4FX3A 4EJNA 2C6OA 1MRVA 1M17A 3BRBA 1PMEA 2BROA 2PL0A 1Q99A 2UZTA 3DBEA 2Q83A 3ML1A 3G9LX 3KN6A 4IFGA 3RBWA 1TQPA 3MVMA 3I6WA 1UNHA 3ORNA 2ONLA 1P4FA 2GHMA 4XG9A 5L6WL 5E1EA 4QPSA 5DR9A 3ZLWA 2YZLA 2Y8OA 2W1ZA 1WVYA 3PXRA 3QCXA 4C8BA 5HLWA 5M4FA 3F66A 5CAVA 3DJ6A 3IGOA 4XP2A 3MFRA 4FTMA 2WTKB 3O17A 4QMTA 1O6YA 4IM2A 4BDIA 4AFEA 1GIIA 3S4QA 3VUDA 5K9IA 2P2HA 4W4WA 3AC8A 3BQCA 4G6NA 4PDSA 4W9WA 4EZ5A 2CLXA 3PA4A 2XKFA 3VHKA 1PF8A 2ETKA 3F6XA 1YW2A 2Z2WA 3TXOA 3VS4A 2Z02A 4FTUA 3MIAA 4JRNA 2CLQA 4AE9A 3PWYA 4L67A 3NFGB 1KE9A 3OF0A 3W10A 3U87A 4EWQA 3NNVA 4L6QA 5L4QA 5EG3A 3PG1A 4FEUA 2QG7A 3HV4A 3LXLA 3PY1A 5EKNA 2AEGA 4O1OA 3C0GA 4E5AX 4J7BA 3BLQA 1XBAA 3QKLA 2BALA 5KCVA 3ANRA 4DLIA 4X3FB 2XH5A 3F5PA 1MQ4A 1K9AA 1OIRA 2YIYA 3PXFA 4IZ5A 5F1ZA 4ZTHA 4FKJA 4Q9ZA 4M14A 4L8MA 4NKAA 1UU3A 1BI7A 3ZRMA 1GIJA 4JBVA 4L3JA 3O7LD 4RVLA 3ZMMA 5J5SA 2AQXA 4EJ7A 4USDA 4FL3A 4AACA 4JRVA 3F3TA 5DEWA 2DWBA 3FQSA 3I81A 3UDZA 5IH6A 2WU6A 3C13A 4ASDA 4FOCA 5DR2A 2B7AA 4XYFA 2IZSA 2X8IA 4UYAA 3FY0A 4TNBA 3QC4A 4V0GA 5F4NA 4FG8A 4TPTA 3GB2A 2QOCA 1GNGA 1UU9A 3O8UA 5JZNA 5HBEA 4P2KA 3ZSIA 1CKJA 4FT5A 4RG0A 2PVKA 3K2LA 4FTIA 2C68A 4IAIA 4Z3VA 2O64A 3E64A 4PNKA 2VGPA 1ZRZA 2QR8A 3BHUA 5D11A 4YU2A 3D5VA 4R5YA 4O7YA 3AT4A 1B38A 2BTRA 3QQHA 4CMTA 2YJSA 4NKSA 2G2FA 3HV3A 2PMOX 2YDIA 3CQUA 3ZS5A 4TWOA 4QQCA 4QTBA 3KVWA 1OL6A 3U6HA 5DT4A 1FVVA 3NUXA 2IW8A 4ALVA 5F20A 3HA8A 4IX6A 5HHWA 4K77A 5C8NA 4LGHA 4J1RA 3OEFX 3GCUA 2EXMA 2Y4PA 3Q60A 1YKRA 4I41A 4NW6A 4C61A 3GOPA 4I24A 2PUUA 3BE2A 4RIXB 4IW0A 3Q9YA 1JKSA 2HCKA 4F7JA 3AOXA 3W8QA 4DGGA 4DGLC 2HZ4A 4YO4A 2CGWA 3NYVA 3IDCA 4Z9LA 5E8TA 3CPCA 4AQCA 1URWA 4W8DA 4CLJA 2X2LA 5HQ0A 4AGDA 5J1VA 4ZS4A 4WG5A 4FKUA 4EOMA 1H01A 5HBHA 3KKVA 2A2AA 3COIA 4OGRA 3VS5A 4MAOA 1I09A 4LOOA 2ITZA 1W2DA 3GU7A 1VJYA 4EOIA 1DS5A 2EUFB 2QONA 4O83A 3C4FA 3FE3A 3DGKA 4KIQA 4N6ZA 4CCUA 2O8YA 2QI8A 2FSOX 3PFQA 3F3VA 4HPTE 2ZV9A 3LVPA 4GK2A 4HNFA 2BZKB 4FOBA 4I5MA 5ETIA 5KBRA 4DTAA 4LRMA 2Z7RA 4J98A 4XRLA 4L46A 2VTMA 2O65A 5CU2A 1RDQE 2VTOA 4FBXA 4CGAA 3A99A 2ZM4A 1JVPP 2GNHA 3NVMB 4DFXE 4GCJA 3TG1A 4FGRA 3O7LB 1CKIA 4YJRA 4FZDB 1W98A 4EQCA 2Y4IC 5AX9A 5FXSA 3EMGA 1JSUA 2A1AB 2XUUA 4BICA 4C4FA 4EH2A 4QP2A 4DTBA 4BCHA 2JD5A 1PY5A 3KEXA 4BCKA 3LMHA 2QCSA 3EN9A 3SHEA 2IO6A 3MSSA 5BYZA 4I5CA 4TW9A 3PIZA 4A9SA 1ZY4A 2J0IA 5C03A 4P5ZA 3D5WA 4TWCA 5CYIA 1EH4A 4PNIA 1YDSE 3ALOA 3RHXA 5ETCA 3LJ0A 5DNRA 3R04A 1F3MC 1YWRA 5EHLA 5HG8A 3ZBFA 4CZTA 1ZYLA 5KMNA 3BLAA 3UO4A 4WUNA 3NW7A 4UV0A 4NFMA 5JRSA 2BRNA 3COHA 1H26A 4QYHA 2Q0BA 1H27A 4M66A 5IISA 5M51A 5HVJA 3ZO1A 4FTRA 2I0EA 2Y9QA 5AR3A 5A9UA 5M57A 4G1WA 5AAEA 2CN5A 2CKEA 3LCDA 3Q5IA 3N4UA 4IADA 3UO5A 2P3GX 4ZTNA 1YHVA 2VNYA 3VUHA 4O2PA 4UEUA 3TWJA 4CD0A 3CY2A 3FKOA 4FR4A 3S0OA 3THBA 1H1SA 2QOLA 3RHKA 4WNMA 3PJ1A 1JSVA 4CZUA 4BCQA 2B54A 3Q53A 1S9IA 3CIKA 4UBAA 4USFA 5CANA 4F78A 4QOXA 3ZDIA 3OOMA 3SVVA 1M2RA 4D2WA 2XMYA 4RLKA 4XG2A 4D0WA 3FMEA 3DCVA 4JXFA 4QQJA 3E87A 3ZC5A 5JZJA 4BZDA 1Y8GA 3RKBA 2ITYA 4C7TA 2YJRA 4EC9A 5D7VA 2VTNA 3NVKI 4JDIA 5DBXA 3PVGA 1AGWA 4I21A 4TWNA 3JPVA 3E8EA 3SW7A 1XBBA 4A4LA 1GZNA 4F65A 5KMJA 4E6CA 5KX8A 3KB7A 4FZ6A 4C0TA 1J91A 2VTLA 3VRYA 3WE8A 1OL5A 4HCUA 4I6QA 4LGDA 4C58A 4U79A 5H8EA 2OF4A 4TRLA 4FL1A 2CKPA 3SAYA 2AC5A 3DZQA 4IWOA 4NTSA 5K4JA 3MB7A 2HXQA 4OT5A 4O91A 4XG6A 2R0IA 3GEQA 2QU6A 5GNKA 3VS3A 3K5UA 3R00A 2QD9A 1OKWA 4O4DA 4IE9A 4WNKA 2WHBA 4BKZA 5GIOE 4ZS0A 4DCEA 5M53A 2XJ1A 5DN3A 4O81A 1U4DA 1YXTA 4K11A 3RM7A 3Q2JA 3DS6A 5C8KA 2ZB1A 5HNBA 4K33A 4HGTA 2ERZE 4FKRA 5IQGA 4AA0A 2VV9A 2IZUA 4FK3A 4DH7A 4R3PA 2X9FA 4BCNA 2OW3A 3HMOA 4EL9A 3SGCA 2O0UA 1IAJA 4PPBA 2XM8A 4FTAA 4A4OA 4DFYA 4ZEGA 2RGPA 1Q8ZA 3N4TA 3C4XA 3R73A 3PTGA 3NDMA 4ID7A 4M0ZA 4P7EA 4RC4A 2FA2A 4EH9A 1H28A 5BPYA 4QTDA 2V5QA 4YLJA 2R7BA 4F6SA 5CI7A 1W7HA 3EQCA 5KKRB 4GU9A 2Z7LA 4IJ9A 4J8MA 3CJGA 4UMUA 2X81A 4RZVA 2GS2A 2WTKC 3VF8A 4AW0A 4GV1A 4LFIA 2IJMA 3OOGA 4P5QA 3MFSA 2YIQA 5E9EA 4XH6A 2A19B 2QVSE 1TQIA 5HCYA 5D41A 4DHZA 4GH2A 5TKDA 3QD0A 4BB4A 3EKKA 1R3CA 3LCTA 3ANQA 3OG7A 3LM0A 4U80A 2BUJA 3HL7A 2YAAA 4S32A 2R5TA 4QDVA 4YHJA 1HCKA 3CEKA 3R8UA 5AR4A 3TIYA 2JDOA 3ZXZA 3H0YA 5HIBA 4BCMA 5IA4A 1FBNA 3GQIA 4IVAA 3ZOSA 2BRHA 2HOGA 3PA3A 3MN3A 5FEEA 3WZKA 4YTCA 2GFCA 2X0GA 5HLNA 2WQBA 4ZLYA 2WOTA 1BUHA 2HIWA 5K0XA 3QYZA 4X3FC 5CENA 4CKIA 4DEDA 3QXOA 3SQQA 2XAOA 4WUAA 5E8UA 4LMNA 4M12A 2UW6A 4MWIA 4XV2A 4FKQA 5C26A 5DMZA 2XS0A 3P86A 4M7IA 2DYLA 4BBMA 3CCNA 4OAVB 4XLIA 5A6NA 5F94A 2E9PA 2F57A 3OW3A 3HMMA 3FLZA 3TCPA 4KKGA 5J7HA 2RFEA 3D2IA 4YJQA 5EM6A 3OP5A 2HY0A 2VAGA 2YACA 3QCSA 2C5NA 2QHNA 2OLCA 2XALA 5CXHA 3MFUA 1Q24A 3CXWA 2B9JA 5EW8A 1MQBA 4I5HA 2C30A 2X7GA 4UWYA 3V3VA 5EW3A 5IMXA 1U46A 3W0NA 5FWKK 3CBLA 4GT5A 5TT7A 2PE1A 1PXOA 1U5RA 2X4ZA 3QBNA 3FPMA 4G9CA 2PVRA 5LVMA 3VS2A 4ZMEA 1RW8A 3WBLA 3HAMA 3PRIA 3PLAE 4XG7A 3FL5A 1BI8A 3U4WA 4EONA 3MB6A 3L8VA 4RMZA 3NYOA 3R9RA 2W1IA 2YN8A 3UP2A 3V6SA 4NM0A 4ZAUA 2PTKA 4Y85A 4BWPA 1W2FA 1ZYCA 3QZIA 3ET7A 4QMVA 4EEVA 4EH6A 4FV5A 3AC4A 3AC1A 2UW9A 2QOFA 1MRUA 3P9JA 4YURA 5I9XA 3E7VA 1VEBA 3QLGA 4HPUE 2V0DA 2O3PA 4JVGA 2BIYA 5EHOA 3RPYA 3BU5A 4ALWA 4AOJA 3ID6C 5IQCA 4U7ZA 4YJVA 5AMNA 3FQEA 5FEQA 4DHIB 1FGIA 4M8TA 4JR7A 3Q4TA 4IAKA 2AC3A 5CI6A 5HE3A 3CR0A 3PE1A 2CMWA 5BUEA 2HK5A 3LMIA 1OKYA 2QOBA 4QMWA 4DG3E 4F1TA 2AYPA 2ZAZA 3VN9A 3PY3A 2J5EA 5HTIA 1OI9A 3EFWA 4JBOA 2B1PA 3NUUA 3KC3A 4JL9A 4L52A 4XV3A 2JKQA 3OT3A 5ANGA 3DBFA 4DEEA 2BILB 3C7QA 2CPKE 5HNGA 4J71A 5A4LA 2CSNA 5IQEA 2FUMA 3OY1A 4BJJB 1XH9A 2VX0A 3F9NA 4D2RA 4IJPA 3HKOA 3OROA 1WVXA 3AD6A 4P90A 2ZYBA 5JH6A 5DGZA 2CJMA 3QTRA 3SDJA 4E1ZA 4C2VA 4ANLA 3DAEA 4OLIA 2A0CX 5IH5A 3KMUA 4AXEA 4O7WA 4TTHB 2HXLA 3D15A 4FEQA 4HVHA 1GY3A 3GNIB 4FGBA 5AUYA 3VBXA 4A9UA 5AA8A 3BKBA 3MY0A 4QMPA 2W5BA 3F2RA 5AR7A 4O82A 3QD4A 4AAYA 3FYJX 4CFMA 2XCKA 4J99A 2WMTA 5AP0A 4ALUA 3FZOA 4ANBA 1W83A 3W2RA 4IC8A 4OR5A 5IMEA 3BWJA 3DZOA 3LQ5A 4L7FA 2XYNA 3GXLA 2QU5A 4O0TA 4I23A 3ZLXA 3RWQA 4JX7A 3W2OA 5K5XA 4RA5A 4OTFA 3NYXA 1TKIA 4MH7A 4RWKA 4D0XA 3PXZA 3Q04A 4I92A 5HD7A 4BFMA 3OTVA 5L6PA 4Q2AA 5I4NA 5CAUA 4ITJA 1I44A 4WO5A 3OZ6A 1E1XA 2OH4A 2DUVA 2XNBA 4GVAA 5FLFA 2I0HA 4FSRA 4C37A 3PSBA 3QHWA 3TEIA 5HG9A 3I60A 3QQGA 2WAJA 4DINA 2RSVA 3DB8A 3EB0A 3EYHA 4DN5A 3BHHA 2PVNA 1YDRE 4KWPA 3MY1A 1H08A 4FTJA 2ZMCA 4MVFA 2C1AA 3SXRA 3R01A 4PPAA 3WF8A 2Z8CA 4B0GA 5K5NA 3UOJA 5EK7A 1JKLA 3LCOA 4M69A 4Z7HA 1HOWA 4E6AA 3HRFA 3AD5A 5KBQA 2RL5A 3NIZA 4CV9A 3AC5A 3PYYA 4MF1A 2VD5A 2WNTA 1BMKA 5IU2A 3QFVA 3ACJA 3Q9WA 4OTGA 4O7VA 4IHPA 3SC1A 4BI0A 2CNVA 3GOKA 2XIXA 3ZO4A 3NMUF 5IDNA 3G0FA 4AGWA 1WBSA 2UW5A 2YWVA 3QYWA 1FVRA 2PMIA 2R3NA 2WMSA 4LL5A 4ZOGA 3UZTA 4R3CA 3D5UA 2HZ0A 2OIDA 1SVHA 3QU0A 2OJFE 1R0PA 4JG7A 1JNKA 4JOAA 3RMFA 3RPRA 4CFVA 1L3RE 4D2VA 1H1RA 4YC6A 5BVEA 2WFYA 2W0JA 5CNOA 5BUJA 5C9CA 4I6FA 4RVTA 4TWPA 5AV0A 4D55A 1M52A 2GCDA 4TY1A 3AMBA 4GIIA 2XANA 3LE6A 2ETRA 4LYNA 2PUNA 4FZ7A 4WNOA 3W0QA 2W06A 2J90A 3BWFA 1OUKA 5L8KA 1M2QA 4G6OA 4MXCA 4KNBA 2BRMA 2ITOA 2PZPA 3QTZA 5HTBA 5KMLA 3PP0A 3Q96A 4X21A 4F1MA 5FDPA 3TUDA 4BHZA 2X6EA 4NZWB 4DT8A 3R6XA 2OH0E 4W9XA 2W9FB 3A4OX 4I4FA 3ROCA 3SD0A 4ZZOA 4ACGA 1PRYA 2ACXA 3FJQE 3HVCA 3KK8A 5LARA 4BI1A 4R77A 3TKHA 1Y6BA 3A62A 3R22A 2BDWA 3KCKA 4KBKA 2BRGA 2XK3A 2RKUA 3OXZA 2XA4A 3QX2A 4M68A 5EM8A 5FD2A 5HE2A 5IKWA 3R8PA 2ZVAA 2PVLA 4DG0E 4O0XA 4M3QA 4MXYA 5HCXA 4AW1A 4TZRA 4OAUC 3TDWA 3UDTA 3TKIA 3MH3A 2JBPA 3B8RA 4QP6A 5HCZA 3U55A 4GEOA 3CS9A 4G2FA 4QQTA 3V8SA 2WTIA 3DPKA 1OL2A 3DT1A 4BCFA 4BKJA 4UMPA 2XNMA 3VUGA 4KRCA 2EXEA 4FG9A 1KV2A 2WEVA 3F2AA 5CSPA 3Q9XA 1ATPE 4XG4A 3T9TA 2YLEA 4HYIA 3IS5A 4FV9A 3Q5ZA