4KABA

Focal adhesion kinase catalytic domain in complex with 3-methyl-1,4-dihydro-pyrazolo[4,5-c]pyrazole
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
255
Chain Sequence
TRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Focal adhesion kinase 1
publication title Fragment-based discovery of focal adhesion kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 255
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kabA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kabA01
5CALA 4O1PA 3EH9A 3AT2A 2VTTA 4QYHA 5HE0A 4TPTA 3ALOA 5JFWA 2XCHA 3C0HA 1BX6A 3RPRA 4NU1A 1G8AA 4U79A 2WPAA 3PZEA 5E4HA 3F2RA 2BZIB 1HOWA 1VR2A 4I92A 4QP1A 3BGPA 2R4BA 5D9HA 4D28A 1XH4A 3HKOA 2C5OA 3TXOA 5KZIA 4RRVA 2XK4A 4MBIA 2W1IA 3W2PA 3EYHA 4DH8A 4RC3A 4MF0A 5ACBC 1LP4A 4D1XA 1MRVA 5HGIA 2XK3A 2ZM3A 3HZTA 1J7UA 2YM5A 1JSTA 1OL2A 3DT1A 4L42A 5IQAA 5C4LA 3QA8A 3OWJA 5M4FA 5HX6A 2CKPA 2VX1A 5L3AA 5AX3A 4NSTA 4I0RA 4MXZA 3D7TA 3LW0A 4U6RA 4J8NA 3RNYA 4EUTA 4JX7A 3NNWA 5AUVA 3ZO4A 2PVKA 5F4NA 5BNJA 2Y6OA 2BRNA 4ENYA 2NPQA 4CEGA 4F7LA 1NY3A 4DAWA 4GK4A 5JGDA 3LFNA 3QAME 4A9RA 4QMSA 3ITZA 4BWPA 4HZRA 4FKUA 3DZOA 4ZJIA 5DWRA 1JBPE 3L8SA 3HLLA 3K3IA 5HLNA 4D4YA 3TJDA 4DEDA 3TWJA 4CZUA 2PE0A 3EFJA 3HV4A 1OMWA 3GCQA 3RPOA 4F63A 3DXPA 4FOBA 3KCKA 3NR9A 5E8YA 4BBFA 5IDPA 4Y83A 3U6IA 4DT9A 4X21A 3QHRA 4ALWA 4E20A 4CLIA 5L2WA 4N6ZA 4D2TA 4QQJA 4EWHA 1LR4A 3LHJA 3BU6A 1PXKA 3E87A 2JITA 3NEWA 4MYGA 4NKSA 5TT7A 1ND4A 2G15A 3C0GA 2GCDA 4BCFA 4D0WA 5HE1A 4EBWA 5IH4A 4O81A 1QPDA 3CQUA 4NM7A 5HICA 4B8LA 4BTMA 3C5IA 4DF3A 5LVLA 4AOIA 3ZC5A 3BX5A 5K0XA 4LI5A 3ZSIA 3FQHA 3LAUA 4C33A 2WHBA 5K5NA 5HCYA 4FIHA 2PVMA 3NIEA 4BYJA 2ZB1A 4FL2A 2G1TA 5AX9A 4RZWA 5JZJA 3R8UA 2A2AA 3Q4TA 4FGBA 5TE0A 2XYUA 1PYEA 2HOGA 5DR6A 3Q60A 3TJCA 3ETAA 4WG3A 4H36A 4X7QA 4YC3A 2QOIA 4P7EA 3U8WA 3BCEA 3KN6A 3E62A 3E63A 2WQBA 1PMEA 4GL9A 1OIQA 4BN1A 3HV6A 3R02A 3SG8A 4GS6A 3EQCA 2J9MA 4ZAUA 4OW8A 3TTIA 4ZSEA 3EQBA 2I0HA 3HP5A 2JBOA 1BL7A 1M2PA 2QONA 2Y4PA 2IVVA 4BWKA 2YWPA 5IH6A 5HG7A 4BKZA 5HNBA 3EFWA 1MRUA 2GQRA 2FA2A 4EHGA 5J5SA 2VTLA 2I1MA 2QOQA 4OT5A 2OXXA 4M69B 4DYMA 3FI2A 4QMOA 4UMRA 3VUKA 5F1ZA 2BALA 4XS2A 1F0QA 5CVFA 5JN2A 3LFDA 4BR3A 2WFYA 4O2ZA 2UZUE 3MV5A 4AGDA 1IASA 5L8KA 2HK5A 5AP6A 2WTVA 3IONA 1M7QA 4W8DA 3FV8A 4UYNA 5CTPA 5C8NA 4ZY4A 3QX4A 4LGHA 2CCHA 4XV3A 3TACA 3PWDA 3ULZA 3BWJA 4PTCA 2HY81 2XKCA 4EQUA 2C3IB 3MFRA 2QOOA 3FMHA 3FLNC 1P5EA 3O0GA 3L9MA 4GK2A 4ZS4A 4MTAA 2J7TA 2NRYA 1GAGA 4IFCA 5I9VA 3A61A 2PZPA 3MW1A 4E26A 1Z9XA 4RZVA 3G6HA 3SX9A 5L4QA 3E7OA 2ITYA 4JDIA 4ONAA 4EH3A 3GXLA 2WD1A 4RWKA 4V05A 4W4VA 4X2JA 3AOXA 4L01A 3QKKA 3PXKA 2C3LA 1WMKA 4NCTC 4PL3A 4B6LA 5C9CA 5D7AA 3ZLYA 4G6OA 4AW0A 3R1QA 4D4VA 2OF4A 3R9DA 2W1DA 3BGQA 4G9CA 2YISA 2BILB 1O6YA 2UW4A 2XIXA 3QRKA 2H8HA 2Y8OA 5CT7A 4X2NA 3K54A 4L46A 4P4CA 5HE2A 5IQIA 4WBBB 2YN8A 5EHLA 3ACJA 3EN7A 4TNDA 2C4GA 3LXPA 4ANOA 3MB6A 3U4UA 4WG4A 3D4QA 1JSUA 4J7BA 3BZ3A 4TWPA 3HDMA 5K0KA 5D10A 3GVUA 4BTFA 1UWJA 3FZSA 4AUAA 3OROA 5GJGA 3F3ZA 2UVXA 3LCOA 3L9PA 3OS3A 4GH2A 4HGTA 3OG7A 5ANOA 4D1ZA 1CDKA 2BAJA 4QTEA 1H27A 2BMCA 2PWLA 4FV8A 3W2RA 1P14A 4IZ5A 1JKTA 5IA1A 3I0OA 5HVYA 5F95A 4E4MA 3UZRA 2GNLA 2WB8A 3NCGA 1BUHA 2WMWA 4IWOA 4CYJA 4K6ZA 4XOZA 1OVEA 1OPLA 3PJ3A 3KREA 2DQ7X 3MTFA 2BPMA 4ALUA 4LUEA 4BCPA 4UWBA 3MN3A 2R0IA 4IZYA 1XHAA 2CKEA 3VWAA 5KHXA 2GS6A 3T9TA 5IF1A 3PFQA 3CKXA 4FSUA 4IE9A 1Q41A 1TQPA 4QP6A 5AA8A 1Q3WA 3GBZA 4C4IA 4EJ7A 3BU5A 3ZSGA 2RG5A 4CMUA 4O0SA 4BCHA 2Z7QA 2PULA 5DOSA 3GC9A 3ZONA 3BGZA 3WZJA 4R5SA 3KL8A 2CNUA 2JKOA 4AE9A 4M66A 2GDOA 3QWKA 3THBA 3RWQA 3FAAA 2XYNA 4EOOA 4FV4A 4FKOA 4KBKA 4DGLC 5CU0A 3ID6C 2WEVA 4XEYA 1YXXA 3C4EA 3DKGA 4FR4A 4HNIA 4MHAA 4MWHA 5AUUA 4HGSA 3FY2A 4PPAA 3A4PA 1L8TA 2J0KA 4BDHA 4AP7A 4LG4A 3MA6A 1T46A 4FV5A 4XLVA 4AT3A 3HUBA 3NX8A 1UNHA 2C6OA 3G33A 3LMGA 3MGYA 3PE2A 3QYWA 1H08A 4U43A 4IEBA 2FSOX 3TV6A 4AWIA 4QYFA 3ORLA 4K2RA 3IK3A 2YITA 3PZHA 3RPYA 3E8EA 4TTHB 4NCTA 3PSDA 3OTUA 3O51A 4E4NA 1WBNA 1J7IA 2XK7A 4FKGA 1YVJA 4APCA 4HJOA 4UWYA 5CEOA 2PZRA 3CC6A 2VZ6A 2P55A 2X7OA 4NTTA 4X3FB 3LLTA 3DJ6A 4KIKB 2AUHA 3OW4A 2CDZA 2BCJA 4OUCA 4EHVA 4O7VA 4R3CA 4YJOA 3AD6A 4QP3A 3PUPA 4JBPA 5AMNA 1H01A 3VHKA 4F9YA 5C8KA 3Q6UA 2IZRA 4DEEA 4IAYA 1CTPE 2O65A 3Q9YA 1Y91A 4HCTA 3CTJA 4IX5A 4YHJA 3VS2A 2CCIA 3DBDA 3NRMA 2X0GA 3QQLA 4I5CA 5CI6A 2XRUA 5HEZA 3TZMA 4ARKA 4C38A 3RP9A 2PVFA 4O2PA 4RG0A 4CTBA 3TV7A 2WQEA 3PXQA 4JI9A 5BUIA 5C26A 3ZLSA 3VBYA 5EYCA 2ZV2A 4IWDA 5CANA 1PXLA 1M2QA 3KRWA 3UIBA 5IA3A 1PF8A 4JRVA 4OTQA 3FZ1A 2F9GA 4IAZA 3VUGA 1UU9A 3DAEA 4Y95A 4PTEA 5IQGA 2YCRA 5HOAA 4EWQA 5DPVA 3OBGA 5GHVA 2YM3A 4GJ2A 4AACA 4H3BA 1W83A 3LLAA 2YCSA 3IG7A 3L8PA 4TL0A 3TT0A 3PPKA 1LUFA 2Z02A 2VO6A 3KXNA 3NZ0A 4PV0A 4XG6A 4LGGA 2O8YA 2FB8A 4YJRA 5L6WL 3T9IA 5JMSA 3P1AA 4L3PA 4C4EA 3FE3A 3TI1A 3HYHA 1E1VA 1W0XC 4NK9A 4II5A 3GCVA 4AZFA 2BRHA 4CFFA 5A9UA 5DEWA 2PZ5A 2XK9A 4C3RA 2XCKA 2RSVA 3QLFA 1WAKA 1E1XA 4IM0A 1PMNA 3AGLA 3IS5A 4YZ9A 3DKOA 5KMIA 3ERKA 4CSVA 3WZDA 3N4UA 3LM0A 1OGUA 3KEXA 4O1OA 4ALVA 1A48A 4O0XA 1SVGA 4WSQA 2PVNA 4C7TA 3F5UA 2OU7A 3IDPA 5A14A 1JSVA 3IDCA 3OF0A 4FEQA 5LVPA 4HGLA 5AAFA 2ITXA 4BVUA 3EQHA 4MX9A 2PTKA 4J97A 3ORIA 2QOBA 5HNGA 2QD9A 2Z7RA 3D2KA 4KIKA 2HCKA 3LFCA 2UW5A 3SXSA 4DTBA 5LOHA 1OL5A 2UZNA 5DFPA 3WOWA 2ZOQA 1R39A 2UZVA 3AG9A 4PDYA 4AG8A 3EN6A 3ZO1A 4X6RA 4A9TA 5HQ0A 4EI4A 5EQYA 4F0IA 3O8PA 4M67A 4QMVA 3L8XA 4ANLA 3SLSA 3NLBA 3QHWA 4Q5EA 4F65A 2W4JA 5E8WA 2EB3A 4YZNA 5EW3A 1W7HA 2VX3A 1GZOA 2R3PA 2ZMCA 4RVMA 2BAQA 3ZXTA 2R3NA 4U81A 4ZEGA 4QP8A 4RLLA 3FQEA 4FKVA 4QYYA 5AV2A 1JOWB 4OBOA 5M51A 4AT5A 1PMVA 2V22A 4XLIA 4QYEA 4CLJA 3QTUA 3NUYA 1Z57A 1F5QA 2BRMA 1CKIA 4AZEA 2BUJA 1YWRA 3BEAA 4XUFA 1KV1A 5HU9A 3KMMA 3OWKA 2VTRA 4AA0A 1PHKA 3LMHA 2QI8A 5TOZA 2PUNA 3KQ7A 4L68A 1A9UA 2CHLA 2WTJA 1TQMA 4AFEA 4B9DA 1IA8A 2GQGA 5CEIA 2WKMA 4PRJA 5J7BA 4CQGA 2YABA 4FTQA 2GS2A 3QCXA 4R5YA 3A7IA 3OD6X 2AC5A 3FLZA 3G2FA 4R3RA 2XK8A 3LQ8A 5FLFA 2BTRA 4WNPA 3U9CA 4HVDA 4GJ3A 1OL7A 3II5A 3M11A 2WAJA 4YHTA 2Q0NA 1SNXA 3RZBA 3NVKI 1IR3A 4ZXTA 4GYIA 4UN0C 1J1CA 1RW8A 3IOPA 2Y6MA 4YNEA 4H58A 4XOYA 1H1RA 3V5QA 3PLSA 4F4PA 5IISA 3P78A 4I3ZA 2C5XA 4ANQA 5AP2A 4FV7A 1ZOEA 2XM8A 4YUQA 4DCAA 3D5UA 1UU8A 4EKKA 4AOJA 3DK3A 3COMA 3COKA 4UBAA 4RWIA 3ZS5A 4LOOA 1ZARA 4BYIA 4WUAA 4X2KA 3P79A 4BBMA 3UP2A 3SXFA 5G1XA 3IW7A 2OGVA 3KF7A 3PE1A 5IA4A 4CGAA 3AD5A 5K4IA 5IG1A 1XBAA 2RFNA 3UO4A 4MBLA 3PXZA 4I93A 5LVNA 4KNBA 5CS6A 2IVUA 2HENA 4M12A 4OR5A 2BFYA 2R3OA 2VN9A 3MVHA 4JQ8A 4I6QA 5A4CA 4I5PA 4M13A 4I6BA 4KSPA 3ROCA 4E6CA 2OG8A 2OIQA 2X6DA 4ZTSA 5CZIA 5E8VA 3R63A 2ITWA 4E3CA 3UMWA 3KKVA 3CSVA 3OWLA 3QTSA 2NRUA 2X7GA 3OTVA 3QYZA 5HG5A 5TO8A 4KS8A 4UMQA 2ITZA 4DFYA 2JFMA 3BIZA 5AR8A 4AW2A 4QYGA 2VTPA 4OAVB 3LQ5A 4CV9A 3G0EA 1GZ8A 1Y6BA 4FEXA 2W06A 5EKOA 4OGRA 1OPJA 4ACHA 3ZYAA 1M17A 4Y5HA 5F94A 5LMAA 4E4XA 2WU7A 3MIAA 4RIWB 4ASDA 3EZRA 1OL6A 3ALNA 3HL7A 2BRBA 2CJMA 3P0MA 2CGXA 4FV0A 3KFAA 1BI8A 1YHWA 4ZP5A 2C6IA 1PXMA 3DLSA 3V5TA 3QL8A 4YGAA 3NW7A 4JXFA 3ANRA 3FZRA 3JVRA 4A4OA 2XKFA 4O0YA 2WNTA 4FUXA 4X2GA 3I0QA 3ACKA 4QTBA 3S2PA 1REJA 1OBDA 3EWHA 3BPRA 1ZOHA 2BROA 2O2UA 3FLQA 5D12A 2ITTA 3OZ6A 4V04A 5K5XA 5FUTA 3BYUA 2C0IA 4CZTA 2E9VA 5DG5A 2XB7A 4RFMA 1YDRE 3AT3A 3A62A 2YJSA 2X1NA 2ZB0A 5HBEA 3KXGA 4FSQA 2C6DA 4M84A 3C4XA 3TEIA 3QX2A 5A4EA 5FRIA 3TNPC 4FSMA 3HMNA 3PA4A 3OW3A 2I0VA 4I5HA 3QRIA 3P9JA 5HBJA 2PU8A 3SGCA 1YXUA 3BLQA 4E5AX 3NIZA 2X8DA 4JBOA 5AUYA 3AMBA 4JQ7A 4EOIA 2O3PA 4FX3A 5ANIA 1KOAA 4FG8A 4KINA 3QKLA 4QTDA 4Z55A 1DI9A 3CJGA 4S2ZA 5LVMA 4KUJA 3LCSA 2ITVA 2XNOA 4MXYA 3OEZA 1GJOA 4IM3A 1KE9A 3A60A 2BFXA 1OITA 3QD3A 2ZJWA 5JGAA 2VWWA 3DFAA 2FSLX 4I6FA 2HAKA 4B8MA 2E9OA 4G3GA 3AC3A 2I7QA 4G1WA 4EKLA 3MBLA 1R3CA 2OWBA 3EN5A 4G17A 4YJVA 2C6MA 3SW7A 2F7XE 2QO2A 4FT3A 3R7IA 5IA2A 4BC6A 3V5PA 5J7HA 4FSNA 3FLYA 1M14A 3KGAA 2PMIA 1MUOA 2XP2A 4FVQA 3WZEA 1FPUA 1CM8A 1LEWA 3S4QA 3UQCA 3HV7A 3NWWA 4GUEA 1Q3DA 2XIRA 2ZV9A 5J1WA 1Z5MA 5FM2A 4YTFA 4DEBA 5EQEA 2VTAA 3BHTA 2WEIA 1JVPP 3PTGA 1J91A 2VWYA 3EMGA 3KB7A 3E8DA 2X2KA 3ELJA 5I9ZA 3MI9A 4RIWA 3O8TA 2I0EA 2YEXA 3L8VA 1WCCA 3QQGA 3ZUTA 4C59A 1JLUE 4NIFA 3PLAE 2R3GA 5IUGA 4Y8DA 3ZEWA 3G9LX 4QPSA 3TN8A 2WTIA 1AD5A 3EYGA 3LFAA 5JKGA 1XQZA 5FTQA 4YZCA 5M53A 3U55A 4L7SA 4U9AA 3DNDA 3FZTA 3UPZA 3NGAA 4QQ5A 1XKKA 3E3PA 4ZJJA 3GNIB 3MVMA 4PX6A 3U54A 4RFZA 4EQCA 1VEBA 1Q24A 3UOKA 3KY2A 4EONA 3HV5A 4QMZA 4YO6A 2QURA 3DAJA 3UNJA 4DA5A 4QMXA 5DN3A 2B9FA 1EH4A 3EQFA 4BHZA 4IC8A 4Y73A 5JGBA 3CPBA 3UIXA 4F9BA 2X2MA 1YQJA 3NUUA 3W2OA 1FINA 3R7GA 5C1QB 4Q2AA 2C6TA 3NW5A 3R00A 4MKCA 4AGUA 4F6UA 4HVHA 3PYYA 2B53A 2PUIA 3PVUA 4YJUA 5AR2A 4GKHA 3PIYA 3BYMA 3MPAA 4F0GA 4FKIA 2IG7A 1FMOE 5DR9A 4WRSA 3JS2A 5IU2A 5AR4A 2X9FA 2OZAB 3WE8A 1CSNA 3GU7A 2GNIA 1OPKA 2OKRA 1AGWA 3A7JA 3LFEA 4JBQA 3V6RA 5KZ0A 2EU9A 3UZPA 2XA4A 2YLEA 2ESMA 3UQGA 4QMWA 3ZLXA 5ICPA 5JH6A 1OECA 4IB3A 4MK0A 5AUWA 3RWPA 1G5SA 3LFBA 3QZHA 4F70A 1W84A 3SAYA 1X8BA 3LOKA 3KMWA 3OP5A 3RVGA 2QU6A 3ZFMA 2OICA 3P08A 3NYOA 3QFVA 3NNXA 1PXNA 2PUUA 2QLQA 4RA4A 2BVAA 4XJ0A 4M14A 2YDKA 3DXNA 4RWLA 2F4JA 3QU0A 4TT7A 5TKDA 3V01A 1FBNA 3OCTA 3HVCA 3RHKA 2REIA 5AV3A 3PPZA 4EC8A 4O7NA 4QP7A 2VTSA 1OKYA 3HA8A 3GU6A 4EH4A 1O9UA 3WE4A 2UZOA 2XNMA 4U44A 3OC1A 4EH5A 5JFXA 4R6VA 4AA5A 5CF4A 3M1SA 4MNEB 4J96A 1GZKA 5CZHA 5HNIX 2H9VA 5FG8A 3R9NA 4C4HA 1Q8UA 4PDSA 5I9YA 5KKRC 3EQIA 4ANSA 3P7CA 3ZTXA 4XP0A 5AP1A 2CMWA 3UC3A 4GK3A 1U46A 2HELA 4GFOA 2IVSA 3DU8A 1GIHA 3QBNA 4PP9A 4RIYA 3WYYA 5A6OA 5J9LA 2PPQA 1JWHA 2XNGA 3OMVA 4KKGA 5DLSA 5FEQA 3ZM4A 5A4QA 5IZFA 5KKRB 2ITUA 5KBQA 4KWPA 5AUZA 3T3VA 4IM2A 3UG1A 3SDJA 3VF9A 2GFSA 3H30A 4WHZA 5EI6A 5AR7A 2EXEA 2XJ2A 5GINE 4C35A 3DXQA 2W05A 4IHPA 3FKLA 4FT0A 5KMNA 1QCFA 5I0BA 5ANEA 3ENMA 3K3JA 3VAPA 3ZO2A 5EM5A 2OIBA 4IVCA 5FXRA 1V0BA 3R2YA 4L00A 4XP2A 4L53A 3P86A 2R3JA 3LIJA 3PVBA 4U40A 5C03A 5DRBA 4CKJA 3GFEA 4ZOGA 5J8IA 3DPKA 4U3ZA 1KOBA 3LFSA 1BKXA 3QC4A 2ETRA 3V5JA 5L2IA 5DT3A 5IEXA 2GHLA 3DQWA 2X4FA 5HZNA 4YP8A 2OZAA 4Y72A 3ZBFA 2GPHA 5J79A 3Q04A 5IH5A 2WELA 1XBCA 1Q8WA 3W33A 3ZFYA 4KA3A 3EQDA 1K2PA 5IQFA 2LAVA 4CV8A 3Q3BA 4MF1A 4ACDA 4D1SA 4MNFA 4D4RA 2ETKA 4A06A 4AAAA 1NVRA 4GKIA 3DQXA 1GNGA 3OUKA 3ZU7A 3C0IA 1OKZA 3G5DA 2R3QA 4AE6A 4BGQA 2UZEA 4XG3A 4I22A 3F66A 5EOLA 4DHFA 5IQCA 4W9XA 4F64A 4E5BA 4KAOA 1MP8A 3BLHA 3IDBA 3LJ2A 2OJFE 1YHVA 3FHIA 3MWUA 3DS6A 5E92A 2QLUA 3WYXA 2C3JA 3HEGA 3Q4CA 1V0OA 4CQEA 4MEDA 4A9SA 3PSBA 4L52A 4O7ZA 5FXSA 4NH1A 3R8PA 5KUPA 1APME 3PP1A 4LGDA 4LUDA 3F5XA 3IGOA 4LL0A 3SC1A 2B55A 3POOA 5CXZA 5JRQA 2ZV8A 4G6NA 3IQ7A 3QD4A 3KRJA 3WIGA 1Q99A 2YLFA 4CRLA 5HE3A 3CD8A 4O22A 4D5HA 2JGZA 4DH3A 1UA2A 4S31A 4MD9E 3GFWA 3GGFA 3DY7A 2I40A 3COIA 3EL7A 3Q96A 4FSYA 2B7AA 3OCGA 1H4LA 3FZOA 3C50A 4NYEA 5L6OA 2BTSA 4W4YA 3HUCA 3QTIA 3FKOA 3EQPA 3DZQA 1OIRA 1JKKA 4QMUA 3WARA 2VV9A 3FSKA 3UDBA 3SHEA 2Y9QA 1XH6A 3IECA 4MQ1A 2JBPA 4G5JA 5H8BA 4C34A 3MYGA 1F3MC 4FKPA 3PG1A 3RKBA 3FL5A 3OWPA 2BDWA 4BCMA 2OFUA 2HWOA 2VWVA 1UV5A 3UNZA 2YIQA 5CVHA 2OIDA 4XV2A 4IVAA 5AP3A 4DH1A 4IC7A 4AZVA 4G3DA 2DS1A 2EB2A 4PPBA 2JKQA 2PZYA 3JPVA 4EK5A 2IPXA 4LYNA 4JDKA 4F0FA 3KA0A 3UZTA 2C0TA 3GOPA 4DC2A 5GJDA 4YTHA 3H3CA 2PMNX 5FDXA 5KO1A 4K33A 3UNKA 3C5UA 5CENA 4G16A 4J98A 3OUNB 4AF3A 4CFWA 4PMPA 3RK9A 4BTJA 2G9XA 5IDNA 4ZZMA 3ZRMA 3V5WA 1VYZA 4F9CA 1YRPA 1LPUA 1MRYA 4Z7GA 4BKYA 3CY3A 5FM3A 3RMFA 5IQEA 2VTMA 4F7NA 4ZSLA 3POZA 4IQ6A 3B8QA 1Y57A 3ROYA 1PXIA 4P5QA 1H8FA 2BZHB 3A7GA 5BVKA 3FI3A 3VO3A 5FEDA 4FEUA 3DB6A 3F88A 3QRUA 2UW6A 4NM0A 2YM8A 4IWPA 4C2WA 5BVNA 4HZSA 4GFMA 2YDIA 5CSHA 2R0UA 4RX7A 1SNUA 3MB7A 4YO4A 1VJYA 5EI2A 2UZBA 2JDVA 1B6CB 3LCDA 4QMQA 3FXWA 5FXQA 4FBXA 2XNBA 3EKNA 3NAYA 3R28A 4BCJA 4Z3VA 4XV1A 1R0PA 3RM7A 2XMYA 5J95A 1CMKE 5AA9A 3IW4A 3R7UA 1L3RE 3U6HA 4TYHB 4M69A 5A46A 5CT0A 5JFVA 5AAGA 1Q97A 4FTKA 5BUEA 1OZ1A 3CGOA 3FPQA 4HPUE 2C5YA 4FC0A 2X6EA 5HIDA 3LFFA 1U5QA 5CEMA 3RCJA 3GENA 2BIYA 2J5EA 4ITHA 4EZ3A 3IKAA 5E8ZA 5A4LA 4XG2A 3NPCA 3I81A 1QPJA 1XH5A 5IUIA 1Y8GA 4WD5A 1Q62A 3BLRA 4D2SA 1ZZLA 3I5NA 4WRGA 5CAUA 4MAOA 5JQ5A 1QMZA 4NL0A 3WF6A 3HAMA 4K11A 1V1KA 2GNHA 3HRFA 2Z2WA 4HGEA 4YTCA 3R6XA 1ZAOA 2ONLC 4R1YA 3MVLA 4RVLA 4QMNA 4HYIA 2PMLX 2WIPA 4FICA 2BRGA 2PHKA 3A8XA 4FKRA 3FMJA 4PY1A 4F99A 3CD3A 4BDJA 4ZY5A 4UMUA 4YU2A 5AEPA 1ZYLA 4ZTLA 5B2LA 2QQ7A 2GNGA 2PY3A 2BR1A 3R01A 2UW0A 4PDOA 4Y85A 3ZHPC 4BBEA 2YZAA 1PYXA 3UVRA 3QXOA 3FC1X 3N9XA 4KABA 4IZAA 4EK3A 3N4TA 3ZEPA 1OKWA 3QLGA 3DKFA 4J53A 4NT4A 4QP2A 4GYGA 4TN6A 2BZKB 4X3JA 3TIZA 4X3FC 4EL9A 2IWIA 4HPTE 4J95A 5BMSA 5HIBA 5AIRA 3RI1A 4ZTNA 3VIDA 2W17A 3DA6A 4YHFA 3ZH8A 5HD4A 3VHEA 5L6PA 4GRBA 4IB5A 4EOSA 4R7HA 3SRVB 4FIJA 5CSVA 5J9ZA 5LMBA 5JRSA 3PJCA 4JVGA 3C9WA 1DI8A 4U80A 3UMXA 4A9YA 4BZNA 5CSPA 4ACGA 3OXTA 5A3XA 5LJJA 5FTGA 4GVJA 1MQ4A 3FC2A 4ANBA 4FEWA 4EOLA 4J71A 1QPCA 3WF7A 3V5LA 3K5VA 3P7AA 5EM8A 4RBLA 4CZYB 4FSRA 4JAJA 4O0RA 1Q8YA 4AS0A 3GI3A 2FH9A 3CIKA 3A7FA 3G0FA 1AQ1A 3H4JA 4GUBA 4I20A 5IPJA 5AM6A 4TYHA 3E92A 2WMVA 3RINA 3KN5A 2R9SA 4OTDA 4E1ZA 1WBOA 3HAVA 5FDPA 1OIUA 2CGVA 3DOGA 4DLIA 3QD0A 3QQFA 2WTKC 2WOUA 4BL1A 1XBBA 4TXCA 4YLJA 2W9ZB 4JLCA 2HZNA 4ID7A 3R1SA 5AUXA 3SKCA 4C4GA 4S32A 1IA9A 2X8IA 2OLCA 4TY1A 3WF5A 5AR5A 2VWBA 2WTKB 3D14A 1GY3A 1WBSA 3F2AA 3IW5A 4L8MA 2F7ZE 2QG7A 4U42A 4EBVA 3OXZA 1P4OA 2QCSA 3O2MA 5AP7A 2GHGA 2Y7JA 4AN3A 2FVDA 3W16A 2WZJA 2OBJA 4CNHA 3D2IA 2J2IB 4DG2E 2KTYA 3H0ZA 3KXMA 2ONLA 3QQHA 2OW3A 3FDNA 5HO7A 2PE1A 4OBQA 5E7RA 2OH0E 4RJ7A 2PZIA 3VUDA 2GSFA 3FLSA 4Q9SA 4R3PA 1GOLA 1ZYSA 2XKEA 4D4SA 2R3FA 5DT0A 4DGOA 3MPMA 3I7CA 3BWFA 3FJQE 4XG8A 3O50A 3GEQA 2YDJA 4I41A 4JQEA 4GEOA 4BIBA 2VAGA 2E9UA 3F3TA 3VVHA 4NFMA 3VJNA 3F7ZA 3QCYA 4LRMA 3QTQA 3JR1A 5I3OA 3DBEA 2VO7A 5LARA 4FSWA 4JL9A 4CT2A 5DI1A 1PJKA 3TDWA 3HDNA 2RGPA 4X3FA 3D5XA 3RAIA 4CD0A 4O6EA 3O96A 3FYJX 4Z16A 2Y0AA 3DGKA 1BYGA 2YM6A 3ET7A 4G3EA 3GCPA 5CU6A 2RG6A 5LXMA 4YJTA 4Z7HA 5CWZA 4CFNA 3LKMA 1UKHA 4GW8A 4WKQA 3R83A 4EOKA 4ZLOA 5E8TA 3FL4A 5ITAA 2YCQA 4DGMA 3VW6A 4BTKA 3QA0A 3HMPA 3ORNA 3R7YA 4I6HA 4E8AA 3W8LA 2XUUA 3WF9A 4EHZA 4MXCA 2C1BA 4B0GA 4C36A 5BPYA 2JD5A 1UNLA 1ZRZA 3HNGA 3WF8A 5I5ZA 4BDFA 2YAAA 3K2LA 4PMSA 4BZDA 4D58A 4RA5A 4BCIA 4MBJA 4FNZA 4YZBA 3VF8A 2HXQA 2XIYA 1P4FA 1KE5A 2B9JA 5AADA 3DTWA 4FT5A 4JR3A 2QKRA 3KVWA 1PXPA 3OT3A 4GIIA 4O6LA 1QPEA 4PMMA 1CKPA 2WTWA 4OTGA 3W18A 3VUIA 5LVOA 3PY0A 3FHRA 3OBJA 5ANDA 4WNKA 4NTSA 1SM2A 4FV3A 2HYYA 5HO8A 3ZDUA 1KE8A 4FI1A 4W4XA 2R7IA 3RAWA 3U9NA 4B7TA 3S0OA 4IADA 4PPCA 4BZOA 3NSZA 4IIRA 2OZOA 3CKWA 3TZ7A 4EUUA 4H39A 3BQRA 1YDTE 4FSZA 3TKIA 1YI4A 1KUTA 3SW4A 4DH7A 4FV2A 5AP5A 4CFUA 1G8SA 3HMIA 1XH8A 4M68A 3TKUA 3P5KA 3CQEA 4C3FA 3HP2A 5CEQA 2E9NA 2UUEA 2OK1A 3R04A 2R7BA 2B9IA 4N57A 2VD5A 3BYVA 4DTAA 3OEFX 3JXWA 4QT1A 4CMTA 5BYZA 5EDRA 4GU6A 5AR3A 3VUHA 5GIOE 3WI6A 4JNWA 4AN2A 5EDQA 4QTCA 4XRLA 4X6QC 2CLXA 4JIAA 3PP0A 1NVSA 4ZLYA 2R3IA 4OTHA 1T45A 3CPCA 4U3YA 4F09A 5BUJA 4FZAB 5HCXA 1BMKA 3RAHA 3ZSHA 5ANJA 4FVRA 4TW9A 1OUYA 1FGKA 4GT4A 4TWCA 1JKSA 3DBFA 1QL6A 3C4ZA 2WTCA 2R3KA 4XYFA 5AV1A 3OVVA 4ITIA 1GZNA 4BDEA 3ZM9A 3FXZA 4PNIA 4A07A 3EFLA 3AQVA 3V8SA 2I6LA 3RHXA 4DINA 3SV0A 5FBOA 1B39A 4FTIA 3BBWA 3TNWA 2YZLA 3EN4A 3JYAA 4X0MA 3ORKA 4ERKA 3QCSA 5IQBA 2V5QA 2W5AA 4IAFA 4JT3A 4C02A 3FEGA 4OT6A 4TRLA 2B1PA 3UOHA 1J1BA 4ZK5A 3ORPA 3NS9A 2WTDA 4JJRA 4MD8E 3T3UA 3W8QA 3HMMA 4IBMA 4HVSA 2VWIA 3GU5A 4IW0A 3LQ3A 4QMYA 4XG7A 3GUBA 2JC6A 4J8MA 5GZ9A 4HW7A 4YR8A 4YJQA 3PWYA 5IUHA 3V8WA 2W0JA 4AU8A 4GT5A 4RQVA 4J52A 1WBTA 5FEEA 4FOCA 1FGIA 2W1GA 4XV9A 3VBVA 2VGOA 2V7AA 4F7SA 2JIVA 2PE2A 4HVGA 2FUMA 2VTJA 1H0WA 2RFDA 4NFNA 5I4NA 4WIHA 1ZY4A 5KMKA 5T68A 1UWHA 4OTWA 3PA5A 3R71A 3V8TA 4BDIA 4CKIA 2WIHA 1OIYA 3FLWA 4BGGA 4WNMA 2QOKA 4EH7A 4CVAA 5DMZA 2IW9A 2VUWA 1FVTA 5EW9A 4JS8A 5FP5A 1ZY5A 2B4SB 4DE4A 2OFVA 3FYKX 2ACXA 5TF9A 5D7VA 2X8EA 1WBPA 1G3NA 3HRBA 2O0UA 3HECA 2XJ1A 3PPJA 3PY1A 1IEPA 3QZFA 4DFZE 3N4VA 4D2VA 5K3YA 5L8JA 3M2WA 2C1AA 3BQCA 3QGWA 5AIKA 4DTKA 5C4KA 4YJPA 2IZUA 4I4FA 4V0GB 4CFXA 5DYJA 3AC5A 3QQKA 4ITJA 4MXOA 2V0DA 2B54A 3EJ1A 3B8RA 3RCDA 3FMEA 1UKIA 3OOMA 3TIYA 2W7XA 2QR8A 4C0TA 1UU7A 4IB1A 3BRBA 5DA3A 1ZWSA 4H05A 4BGHA 2J51A 2XBJA 4FZFB 4RQKA 4MXAA 4GCJA 3MFSA 4M15A 4QP9A 4ASXA 3ZOSA 3Q32A 4HNFA 4JX3A 4XG4A 2XZSA 4DN5A 5CEKA 3HRCA 2UV2A 1CKJA 2OJ9A 3I60A 4DLJA 4XRJA 5BQ0A 2J5FA 5E9EA 1H25A 3P23A 4RX8A 3RPSA 3IOKA 2V55A 3MSSA 5IA5A 4FIFA 4DG3E 4PTGA 5JZNA 1H00A 4DT8A 4O84A 1DM2A 4IAKA 1VYWA 3LZBA 3M42A 4D2WA 3R7VA 4RIXB 3BKBA 1H1QA 2C69A 1Q8TA 3VRZA 2OF2A 3CJFA 3G9NA 4H3PA 4FT7A 4IAAA 3Q9ZA 3VQHA 2WMQA 4IJ9A 2WMAA 2C30A 3SOAA 1PY5A 3UO5A 4O7YA 2A27A 3QRTA 4BF2A 4UXQA 5AUTA 3IGGA 4IX3A 5CASA 3NUXA 3Q5ZA 5JT2A 4TYGA 3UE4A 3BBTB 3HV3A 1REKA 3C1XA 1ZLTA 3D83A 4QTAA 1E9HA 3R7EA 4CG9A 4IDVA 1YOMA 5EW8A 3VULA 2PVRA 4AZSA 2JDOA 4TWOA 4PP7A 3MY5A 4U97A 5B7VA 4JG7A 4O7LA 3E8CA 1KE6A 3PSCA 2VRXA 4GT3A 1YOLA 1JKLA 1TQIA 3MY0A 2UW8A 3ENHA 5CY3A 1ZMVA 4E5WA 4BICA 2V62A 4IVBA 2XEZA 2C6KA 2PK9A 3AC1A 4FVPA 4CCBA 3GCSA 3CTQA 2A4LA 2HY0A 2XVDA 4FZ6A 4MH7A 4E4LA 4E73A 4EH9A 5CF5A 5CQWA 4BKJA 3PXRA 3R8ZA 4K9YA 2AYPA 3GT8A 3Q53A 4R1VA 5I9XA 3ZDIA 5CU4A 2LGCA 3EHAA 2PUPA 1J7LA 4CRSA 2OJIA 4K0YA 4GG7A 3R1YA 4QMTA 4FKTA 4V0GA 2JLDA 1ZYDA 4E93A 3U6JA 3DTCA 5DIAA 3VUMA 2W96B 4LMUA 1YI6A 3T8OA 4EZ5A 2XK6A 2XF0A 3GOKA 3ZZWA 1U4DA 3D7ZA 4PMTA 2XBAA 2EWAA 1FMKA 1H1WA 4BCKA 4UMPA 4BCNA 3BYSA 4ZSAA 2KULA 1DAWA 2ITOA 4S30A 3K5UA 3RM6A 5M06A 4NKAA 3UG2A 4JG8A 3W2QA 2C47A 1S9IA 2UZLA 4R8QA 5HHWA 1YXTA 3F3UA 5ANKA 3TTJA 4AGCA 3EN9A 3NUPA 5JFSA 4YLKA 3JVSA 3PG3A 2E2BA 2EXMA 3PJ1A 4RIXA 5EOBA 4ANMA 3I1AA 5CAOA 5KMOA 3Q9XA 1SZMA 1R1WA 2GNJA 2WXVA 2CGWA 3CE3A 1SMHA 2P0CA 4O0VA 3DBQA 5H2UA 2W5HA 4B99A 4J99A 4RVKA 1ZXEA 1JQHA 3EQRA 3LXLA 2OJJA 5ACKA 5B0XA 4BDGA 4FE2A 3PDTA 4CYIA 4O7SA 3MVJA 3O71A 3MJ1A 3CQWA 3MH1A 3TM0A 5GJFA 3R9HA 2QO7A 4I21A 5HIEA 3H9FA 4LMNA 4RX9A 4EOPA 2DUVA 3DK7A 2J0MB 3PVGA 5EHOA 1WZYA 4F1OA 3GU4A 1ZYJA 2GFCA 2J0JA 3NUSA 2CNQA 5BVEA 4YMJA 4FG7A 4QPMA 2ERKA 5BVDA 3AGMA 3CXWA 3PRIA 4DH5A 4OAUC 2UW9A 4N6YA 4FNXA 4ZIMA 4D55A 2EVAA 3PY3A 4DBNA 5BVOA 1YDSE 2OH4A 4DFNA 3C4FA 5LQFA 1DS5A 3CLYA 2X7FA 4DG0E 2QODA 4IH8A 4QPAA 3VBXA 4AN9A 4FL3A 5B2MA 4RPVA 3W2SA 3CEKA 2ITQA 5LCJA 4RJ8A 5I9UA 4O7TA 4UYAA 3QZGA 1UNGA 4CXAA 1FOTA 2QNJA 2HZIA 3ODZX 4BY9E 3BHYA 2E9PA 4RWJA 4DEIA 4N4SA 4P2KA 3ZFXA 4ENXA 3PRFA 4U7ZA 3RJCA 3SOCA 4RJ6A 5AV0A 3LJ0A 1STCE 2VWXA 3S1HA 4PF4A 4NJ3A 1OBGA 4KBCA 4W8EA 4R7IA 4BDAA 5F9EA 1YI3A 2UW7A 2W1ZA 1H1SA 3BV3A 4KB8A 4UY9A 3EOCA 4E6QA 3EIDA 3W2CA 4ANNA 4C57A 3NMUF 3NDMA 2CNVA 1U54B 4O0TA 4F6WA 5KNJA 1W98A 3UODA 5A6NA 3Q52A 2O64A 3QXPA 4KS7A 3KCFA 3LXNA 1JNKA 2EXCX 3LCTA 4FTNA 2F2UA 2UZWE 4QMPA 1TVOA 3V6SA 2QOHA 4I5MA 1R0EA 3DB8A 3NCZA 2QOFA 1WVYA 3DNEA 3VS4A 4YJSA 4TYEA 4A7CA 4FV6A 5IKWA 4PWNA 2ZVAA 3C7QA 4BIDA 5HVKA 4YTIA 5AM7A 1Q61A 1W8CA 5M55A 2YJRA 4AXAA 3SA0A 3AC2A 2BHHA 2F7EE 4E6AA 4G31A 3CR0A 4LFIA 3Q6WA 1U59A 1XR1A 3KRLA 3U4WA 3F61A 2C5NA 4ZZOA 5IMXA 3CCNA 4MNEA 5CAQA 4JAIA 2XKDA 2C3KA 3DBCA 5EFQA 4S34A 4FEVA 3O7LD 4L44A 3B2TA 2VNYA 4MQ2A 3NYXA 3E8NA 3GP0A 3KVXA 5T6KA 3ZC6A 3CS9A 3AD4A 1FQ1B 1YHSA 4JDHA 4YBKA 1Q5KA 4ZY6A 2OXDA 2OXYA 2BZJA 3JY9A 4G6LA 2JKMA 4BRXA 3AC8A 4H1JA 4EH6A 3UO6A 4YJNA 5ETFA 1XWSA 2P2IA 4CG8A 1KE7A 4AFJA 3BV2A 3RK5A 3FMLA 5HO6A 2WMRA 2X4ZA 5CU2A 5CSXA 4CFMA 4FMQA 2QVSE 2I0YA 3VJOA 4FZ7A 1RJBA 2GNFA 4L3LA 3VQUA 1W82A 3PIXA 3MTLA 1ERKA 4MXXA 4IX4A 4ACMA 2QC6A 2YWVA 3OCBA 3LVPA 4FYNA 4DCEA 3GQIA 4K77A 3UYTA 4HVIA 1ZMWA 1KV2A 3ZCLA 2J50A 2OO8X 3ZLWA 2YCFA 2HIWA 3OFMA 4TZRA 5H9BA 2PSQA 4C2VA 4BWXA 3NYNA 3G51A 4BDCA 1H28A 3BU3A 1IRKA 3F69A 4G3CA 3F3WA 4FTMA 4QP4A 5ETIA 4W4WA 4JBVA 4NZWB 5GZ8A 1OKVA 5CAPA 5K9IA 3KRRA 3A99A 3KXHA 1M52A 2RKUA 3EKKA 4D0XA 3AMAA 3FQSA 3MFUA 4RJ4A 4O82A 3OY1A 1U54A 4KKHA 3HMOA 4LRJA 2WOTA 4EZ7A 2W1CA 4OTPA 2WQOA 3DJ5A 3VS0A 4W9WA 3UOLA 4QNYA 4AW5A 4XBUA 4RX5A 2JIUA 5DBXA 4FTJA 1PKDA 2YA9A 3MIYA 2W1EA 4BHNA 3ZXZA 3PXYA 4NWMA 5M57A 3Q2JA 4NM3A 3TNQB 2Z7SA 3MS9A 4K18A 5FBNC 5KE0A 4A4XA 5L2SA 2GMXA 3QTRA 4O0UA 4KIPA 5EM6A 4A4LA 4QRCA 4BDKA 4ORKA 3UYSA 5CU3A 2W1FA 4TKSA 2A1AB 3KF4A 4KIQA 3A4OX 4UXLA 4YPDA 4JG6A 2G2IA 3VC4A 4ASEA 3SG9A 2R3HA 4USEA 2IZTA 4IANA 4PQNA 3EB0A 4YLLA 3F82A 4QD6A 3TL8A 4EC9A 4GSBA 5F20A 3OT8A 4L45A 3UIUA 4C61A 2O63A 5DE2A 2RF9A 5IEYA 3KK8A 4L67A 5BYYA 3RZFA 1NT2A 2HZ0A 3NYVA 2GU8A 2QHNA 2IVTA 3C4WA 4Z9LA 3UGCA 4CCUA 2PMOX 4V01A 4O21A 3NAXA 3C51A 2XEYA 2W9FB 4QQCA 3PXFA 5B2KA 2JKKA 1RDQE 2UVZA 1O6LA 2FSMX 3TUDA 3ODYX 5E90A 2QU5A 5KCVA 5M4UA 5HG8A 3DFCB 2QO9A 3JUHA 1H07A 1NXKA 4XHKB 1FVRA 3PVWA 5TR6A 4E6DA 5L2QA 4IZ7A 5BVWA 3BYOA 3UPXA 2IZSA 3N51A 4RJ3A 3BEGA 5E1EA 3PA3A 5D11A 5AV4A 2QOLA 4HCUA 3MY1A 3TNIA 1HCKA 2OJGA 3OOGA 4JOAA 3Q4ZA 4E7WA 2H96A 4EOQA 3W32A 4C4JA 5CVGA 4CFVA 2GS7A 4R7BA 1WBWA 3RBWA 5GZAA 3VS1A 3UOJA 5AAEA 3VS7A 3FMDA 5G6VA 4IACA 4C58A 2AC3A 2C6EA 2V7OA 5DNRA 2FO0A 5ANGA 1WVXA 3ZRKA 3GCUA 4O27B 2WQNA 1UVRA 2Z8CA 5FD2A 4I24A 4ZJVA 4FK6A 4USFA 5J1VA 3GC7A 5J5TA 3MFTA 4UB7A 3R8MA 2CKQA 2X81A 2C0OA 2PVLA 2YIYA 5AFVA 4AQCA 2YERA 4IX6A 3OY3A 4FV1A 4FA2A 3ZRLA 4YURA 3JY0A 3ORTA 4O7WA 2VTQA 4WNOA 3FBVA 3UVQA 4I0SA 4M7IA 5CX9A 1PXOA 2GTMA 4FL1A 4BCQA 5IQDA 4D2RA 4BCGA 3QQJA 4AZTA 4HYUA 3UQFA 3FMMA 3EFKA 1PXJA 2VO3A 3F5PA 4TYJA 5CEPA 5CF6A 4XCUA 5I9WA 4IMYA 3DDPA 3VS3A 1BLXA 2JIIA 2OI4X 5CXHA 1WVWA 2FYSA 4GIHA 4AA4A 5E91A 3BELA 3A7HA 1O6KA 3H0YA 3ORXA 3DKCA 1ATPE 3OXIA 4YC8A 4EK6A 2GQSA 3MESA 3VS6A 5J9YA 3QALE 5BVFA 4U45A 5AJQA 2BAKA 3PJ2A 3H10A 4A9UA 2G2FA 1DAYA 3E7VA 2Y4IC 4I4EA 4DFXE 3MH0A 3EL8A 2XS0A 4OBPA 2WU6A 3BI6A 5HI2A 2IW6A 3MDYA 3R1NA 2J4ZA 4I23A 4YSMA 5HTCA 5I3RA 3D5VA 2HWPA 2HW6A 4RLKA 2Y4IB 5T3QA 3QZIA 2XNEA 4BDBA 4APPA 3QC9A 4JIKA 5ETCA 3QUEA 4BB4A 4FTRA 3TNHA 5DRDA 4QNAA 1PW2A 3Q5IA 2YACA 2ZMDA 2G2HA 4WBOA 2JFLA 2RL5A 2YM7A 4FF8A 3DK6A 3HX4A 3I6UA 4IAIA 4M0YA 5IA0A 5HX8A 1Y8YA 4JRNA 1PRYA 2UVYA 2BDJA 3AXWA 1ZMUA 4WO5A 2SRCA 4WUNA 3R9RA 3QWJA 2C68A 3RGFA 3FMKA 3NNVA 4FT9A 4QQTA 4J1RA 2UZDA 4I94A 5EK7A 3GQLA 5FWKK 3F3VA 2WO6A 2F2CB 5BX0A 4GMYA 4FKWA 2R3RA 2G01A 4FYOA 4TWNA 5M4IA 1HCLA 3VBTA 5KMLA 4XMOA 4UWCA 1H24A 2R5TA 3BHVA 4NJDA 5DH3A 2A19B 5K4JA 2WMUA 3LJ1A 3TZ8A 4XBRA 5AP4A 4F08A 2R3LA 3QQUA 3ULIA 3I7BA 3R0TA 3R8VA 2J90A 2W5BA 5J87A 4R78A 2HW7A 4C8BA 3FI8A 3UIMA 1KSWA 3GU8A 3TKHA 3UBDA 2X39A 3H9RA 4FTTA 4QMLA 5HVJA 3KU2A 4D9UA 3GC0A 3HA6A 4G34A 4PL4A 3NUNA 3A8WA 1WBVA 5AWMA 3SRVA 4C62A 3O23A 1GIIA 1ZOGA 5KHWA 2ZYBA 2UW3A 3QTXA 2ZM4A 4EHEA 3QGYA 4ZZNA 3O17A 4OLIA 5CSWA 2CN8A 4QO9A 4RT7A 4BFMA 4XP3A 5HU3A 2P3GX 2Q0BA 3LPBA 4XH6A 5D41A 4ZTRA 4RMZA 4ZMEA 3A2CA 5HESA 3L9NA 3R8LA 5EYMA 3ZMMA 1WFCA 4WT6A 1P2AA 2WGJA 4G5PA 4DEHA 3PIZA 3EQGA 3FPMA 1KWPA 4KSQA 3U87A 3GC8A 5HG9A 5HKMA 4K1BA 3S3IA 5A54A 3FI4A 4MWIA 5IQHA 2X2LA 3BE9A 2CPKE 3OCSA 5H8EA 1YWVA 4FZDB 2J0IA 2NP8A 2QG5A 4WOVA 4YZDA 3VRYA 4M0ZA 4ERWA 5A4TA 3FXXA 3QKMA 1BL6A 3IW8A 4O38A 4WSYA 4AGWA 4M97A 1NW1A 1H0VA 5AP0A 4TYIA 5CLPA 5C01A 3R22A 2YFXA 5EH0A 3S95A 3UJGA 4EK8A 3TCPA 2F49A 2VTNA 2VTOA 5EDPA 4Y46A 1A06A 3P4KA 2Z7LA 4LOPA 5HBHA 4UX9A 4ZTMA 4JR7A 1NA7A 4L7FA 5GIPE 5FP6A 4UALA 3F7WA 3DV3A 3Q4UA 3Q2MA 3AC4A 4R77A 2CN5A 3E5AA 3MH3A 1OL1A 2UZTA 2CSNA 4PL5A 5FQDC 4S33A 4RVTA 5L8LA 4RFYA 4RIOA 3RPVA 3I6WA 3FZPA 2A0CX 3LCKA 4NEUA 3W10A 3DCVA 1Y6AA 4YZMA 3QUDA 4HYSA 5LMKC 5DGZA 3E88A 3DAKA 3BHHA 5GNKA 3F6XA 1V0PA 3BHUA 3ORZA 2W4OA 2ZM1A 4YC6A 3HGKA 2WMTA 5EYDA 2EUFB 4LRKA 5HLPA 3R7OA 1YXVA 3EZVA 3DDQA 4RC2A 2FGIA 2ZAZA 3OHTA 4U0IA 2W4KA 3C4CA 4X2FA 2IW8A 4BDDA 3RALA 3ANQA 3COHA 2PVYA 2JEDA 4O96A 3KULB 3NW6A 3VN9A 3QF9A 2XM9A 2QR7A 3QTZA 5JEBA 1H26A 2RIOA 1RE8A 2PL0A 4IWQA 3MH2A 2O5KA 4LQMA 4FTAA 1OM1A 4KRCA 4WA9A 5DEYA 5DHJA 5EI8A 3V3VA 3QTWA 3E64A 3VBWA 4G2FA 4C3PA 1K3AA 2VNWA 4GU9A 2RFEA 3KXXA 5L2TA 1BI7A 2RFSA 2YHVA 2BKZA 4N70A 3LMIA 2CLQA 4DGGA 3SXRA 4IB0A 4G3FA 1B38A 1SYKA 5D1JA 4O91A 3VNTA 4RSSA 5BYLA 3CP9A 2WMSA 3NVMB 3L9LA 3E3BX 4FNWA 4D5KA 3G15A 2QHMA 4UV0A 3VS5A 5JQ8A 4O83A 2VTIA 3D94A 2NO3A 2YM4A 2PVJA 4U41A 3ZUUA 3ORMA 4UZHA 3MJ2A 1IAHA 4HYHA 4ASZA 2BIKB 4FTUA 3DLZA 4IDTA 2X9EA 5HTIA 3SVVA 2W1HA 4DEAA 3QD2B 5EKNA 2F57A 4K8AA 3UVPA 1OI9A 3FWQA 3V51A 3L1SA 3CTHA 5HLWA 3KC3A 1MQBA 2BHEA 5E8XA 5IEVA 4M3QA 4Y5QA 2Q83A 3R9OA 1H1PA 4AT4A 4FSTA 4PUZA 1R78A 3QRJA 4KIOA 4OTRA 2ERZE 5KMJA 1XJDA 3MA3A 4BI0A 4D2PA 4DEGA 2XNNA 5JSMA 4PNKA 2JDRA 3D0EA 2DYLA 2VO0A 4I0TA 4QOXA 5DR2A 4ZSJA 3UC4A 4P90A 4AOTA 4FIIA 4L43A 4OTIA 3I79A 3R2BA 3V04A 4EQMA 3F2NA 5LMKA 4C4FA 3D9VA 3QCQA 2J0LA 1PKGA 2HXLA 4FKQA 4NIFB 3O7LB 3PJ8A 5KMMA 5LWNA 3W55A 2J6MA 3RTPA 5C8MA 2GTNA 1UU3A 2YIWA 1TKIA 4ACCA 2QKWB 4RJ5A 2IO6A 1Q4LA 3KULA 4LV5A 1RQQA 4M8TA 1JAMA 4YSJA 2CGUA 4LL5A 4EOMA 1YWNA 1ZYCA 4EOJA 4FGRA 2ZDUA 1M7NA 1YXSA 2B9HA 1PMUA 4YNOA 3AT4A 4MCVA 2WQMA 3R21A 4EYMA 3D5WA 4F1TA 5DT4A 2FSTX 4WG5A 1URCA 5M44A 2ZDTA 3R30A 4EH8A 5CNOA 1IG1A 5CQUA 2JDTA 2YIXA 4G9RA 3WZKA 3FSFA 3TUBA 2R64A 2JDSA 5M07A 4P5ZA 5HTBA 4NW6A 5M4CA 4D9TA 4DFUA 2BDFA 3NNUA 1U5RA 2H34A 2XIKA 5H8GA 4HCVA 4USDA 5HORA 5M08A 2ITNA 4XNEA 4UEUA 4KKEA 4NUSA 3VBQA 5KX8A 3SQQA 4H1MA 4DFBA 3ZUVA 4LM5A 3H9OA 1ZZ2A 4ZLZA 5LWMA 4DBXA 4UZDA 4EEVA 4RC4A 2IJMA 4JDJA 1GIJA 4NM5A 3RNIA 3QUPA 4ZS0A 4EORA 5C27A 1J3HA 1SVEA 3E93A 4YBJA 4U5JA 3UTOA 3TV4A 2WMXA 2P4IA 3O8UA 4NW5A 2VWUA 1LEZA 4IXPA 3LE6A 3AMYA 4KRDA 4BIEA 4L9IA 4DITA 3WILA 3BE2A 3ZZEA 2QOCA 5E8SA 3ATTA 4FKSA 3VUTA 5KBRA 4YPSA 3NUAA 3ZO3A 4BCOA 2WMBA 5HD7A 5EHYA 5M09A 2C6LA 4EJNA 2VWZA 1JPAA 2ITPA 2B52A 1VZOA 3I4BA 3R73A 2IN6A 4HOKA 4F6SA 4GG5A 1URWA 2JAMA 4IFGA 5FGKA 3SD0A 4KBAA 4IJPA 2HZ4A 4TNBA 4ZSGA 1K9AA 3Q9WA 5BMMA 3RAKA 4DFLA 3WIKA 4LOQA 5E8UA 3P7BA 4MVFA 4BI1A 3LXKA 4FKJA 2R3MA 4LV8A 4F9WA 2P2HA 2XJ0A 4O86A 5ETAA 1I09A 3TZ9A 2H6DA 3G6GA 4Q5HA 5IMEA 1I44A 4FTCA 4L6QA 4FTOA 1YKRA 1XH9A 4F7JA 2XRWA 5EQPA 3CGFA 3LFQA 4FIEA 5DVRA 2VGPA 4OTFA 4ZMFA 3ZBXA 4FK3A 2VU3A 4Q9ZA 3I5ZA 4DGNA 4GVAA 5EG3A 1YOJA 2XNPA 4EYJA 4QMMA 4F1MA 5CAVA 1Q8ZA 4AW1A 3F9NA 4RIYB 5CF8A 1SVHA 3B2WA 3KRXA 4PDPA 5M56A 2Z60A 3D7TB 3IW6A 5HCZA 2CKOA 2OSCA 4RGJA 4B4LA 2B0QA 4GV1A 2JAVA 3WBLA 4FTLA 4FKLA 4FNYA 4ZTHA 5LCKA 2W99B 3U51A 4FUYA 4AX8A 4FV9A 2P33A 2VX0A 4O0WA 3DJ7A 1XH7A 3F5GA 4BI2A 3IO7A 3LM5A 2NNWB 1M2RA 4XG9A 5FTOA 3IPHA 4CKRA 5EYKA 3C13A 4ZTQA 4CT1A 5CYIA 2BKKA 3G90X 3FY0A 2C5VA 3CBLA 3TG1A 4EK4A 1S9JA 4FG9A 4AZWA 1XO2B 2XH5A 2GHMA 3UP7A 4O7RA 4CMOA 2PVHA 4MD7E 4U8ZA 1IAJA 5E1SA 3TDVA 3FMNA 3KXZA 4EH2A 3CY2A 3W1FA 4H3QA 4C37A 5CNNA 1OUKA 3GB2A 3TUCA 4FIGA 3VW8A 2YAKA 4N0SA 2YIRA 4L3JA 3S00A 3D15A 3FUPA 3RK7A 1YW2A 2XIZA 1NVQA 4CTCA 2R2PA 2PYWA 4UMTA 4GFGA 3KK9A 4XX9A 1OB3A 3MPTA 4I1ZA 4KD1A 4FODA 5CI7A 5H3QA 5EM7A 4IVDA 3REPA 3WZUA 2VTHA 4F9AA 2ETMA 2ZV7A 5JK3A 3KMUA 1FVVA 3ATSA 3FKNA 2DWBA
chains in the Genus database with same CATH superfamily
5CALA 4O1PA 3EH9A 3AT2A 2VTTA 4QYHA 5HE0A 4TPTA 3ALOA 5JFWA 2XCHA 3C0HA 1BX6A 3RPRA 4NU1A 1G8AA 4U79A 2WPAA 3PZEA 5E4HA 3F2RA 2BZIB 1HOWA 1VR2A 4I92A 4QP1A 3BGPA 2R4BA 5D9HA 4D28A 1XH4A 3HKOA 2C5OA 3TXOA 5KZIA 4RRVA 2XK4A 4MBIA 2W1IA 3W2PA 3EYHA 4DH8A 4RC3A 4MF0A 5ACBC 1LP4A 4D1XA 1MRVA 5HGIA 2XK3A 2ZM3A 3HZTA 1J7UA 2YM5A 1JSTA 1OL2A 3DT1A 4L42A 5IQAA 5C4LA 3QA8A 3OWJA 5M4FA 5HX6A 2CKPA 2VX1A 5L3AA 5AX3A 4NSTA 4I0RA 4MXZA 3D7TA 3LW0A 4U6RA 4J8NA 3RNYA 4EUTA 4JX7A 3NNWA 5AUVA 3ZO4A 2PVKA 5F4NA 5BNJA 2Y6OA 2BRNA 4ENYA 2NPQA 4CEGA 4F7LA 1NY3A 4DAWA 4GK4A 5JGDA 3LFNA 3QAME 4A9RA 4QMSA 3ITZA 4BWPA 4HZRA 4FKUA 3DZOA 4ZJIA 5DWRA 1JBPE 3L8SA 3HLLA 3K3IA 5HLNA 4D4YA 3TJDA 4DEDA 3TWJA 4CZUA 2PE0A 3EFJA 3HV4A 1OMWA 3GCQA 3RPOA 4F63A 3DXPA 4FOBA 3KCKA 3NR9A 5E8YA 4BBFA 5IDPA 4Y83A 3U6IA 4DT9A 4AXCA 4X21A 3QHRA 4ALWA 4E20A 4CLIA 5L2WA 4N6ZA 4D2TA 4QQJA 4EWHA 1LR4A 3LHJA 3BU6A 1PXKA 3E87A 2JITA 3NEWA 4MYGA 4NKSA 5TT7A 1ND4A 2G15A 3C0GA 2GCDA 4BCFA 4D0WA 5HE1A 4EBWA 5IH4A 1G8KA 1QPDA 3CQUA 4NM7A 5HICA 4B8LA 4BTMA 3C5IA 4DF3A 5LVLA 4AOIA 3ZC5A 3BX5A 5K0XA 4LI5A 3ZSIA 3FQHA 3LAUA 4C33A 2WHBA 5K5NA 5HCYA 4FIHA 2PVMA 3NIEA 4BYJA 2ZB1A 4FL2A 2G1TA 5AX9A 4RZWA 5JZJA 3R8UA 4DDGA 2A2AA 3Q4TA 4FGBA 5TE0A 2XYUA 1PYEA 2HOGA 5DR6A 3Q60A 3TJCA 3ETAA 4WG3A 4H36A 4X7QA 4YC3A 2QOIA 4P7EA 3U8WA 3BCEA 3KN6A 3E62A 3E63A 2WQBA 1PMEA 4GL9A 1OIQA 4BN1A 3HV6A 3R02A 3SG8A 4GS6A 3EQCA 2J9MA 4ZAUA 4OW8A 3TTIA 4ZSEA 3EQBA 2I0HA 3HP5A 2JBOA 1BL7A 1M2PA 2QONA 2Y4PA 2IVVA 4BWKA 2YWPA 5IH6A 5HG7A 4BKZA 5HNBA 3EFWA 1MRUA 2GQRA 2FA2A 4EHGA 5J5SA 2VTLA 2I1MA 2QOQA 4OT5A 2OXXA 4M69B 4DYMA 3FI2A 4QMOA 4UMRA 3VUKA 5F1ZA 2BALA 4XS2A 1F0QA 5CVFA 5JN2A 3LFDA 4BR3A 2WFYA 4O2ZA 2UZUE 3MV5A 4AGDA 1IASA 5L8KA 2HK5A 5AP6A 2WTVA 3IONA 1M7QA 4W8DA 3FV8A 4UYNA 5CTPA 5C8NA 4ZY4A 3QX4A 4LGHA 2CCHA 4XV3A 3TACA 3PWDA 3ULZA 3BWJA 4PTCA 2HY81 2XKCA 4EQUA 2C3IB 3MFRA 2QOOA 3FMHA 3FLNC 1P5EA 3O0GA 3L9MA 4GK2A 4ZS4A 4MTAA 2J7TA 2NRYA 1GAGA 4IFCA 5I9VA 3A61A 2PZPA 3MW1A 4E26A 1Z9XA 4RZVA 3G6HA 3SX9A 5L4QA 3E7OA 2ITYA 4JDIA 4ONAA 4EH3A 3GXLA 2WD1A 4RWKA 4V05A 4W4VA 4MUQA 4X2JA 3AOXA 4L01A 3QKKA 3PXKA 2C3LA 1WMKA 4NCTC 4PL3A 4B6LA 5C9CA 5D7AA 3ZLYA 4G6OA 4AW0A 3R1QA 4D4VA 2OF4A 3R9DA 2W1DA 3BGQA 4G9CA 2YISA 2BILB 3W0OA 1O6YA 2UW4A 2XIXA 3QRKA 2H8HA 2Y8OA 5CT7A 4X2NA 3K54A 4L46A 4P4CA 5HE2A 5IQIA 4WBBB 2YN8A 5EHLA 3ACJA 3EN7A 4TNDA 2C4GA 3LXPA 4ANOA 3MB6A 3U4UA 4WG4A 3D4QA 1JSUA 4J7BA 3BZ3A 4TWPA 3HDMA 5K0KA 5D10A 3GVUA 4BTFA 1UWJA 3FZSA 4AUAA 3OROA 5GJGA 3F3ZA 2UVXA 3LCOA 3L9PA 3OS3A 4GH2A 4HGTA 3OG7A 5ANOA 4D1ZA 3W0MA 1CDKA 2BAJA 4QTEA 1H27A 2BMCA 2PWLA 4FV8A 3W2RA 1P14A 4IZ5A 1JKTA 1W2DA 5IA1A 3I0OA 5HVYA 5F95A 4E4MA 3UZRA 2GNLA 4DHIB 2WB8A 3NCGA 1BUHA 2WMWA 4IWOA 4CYJA 4K6ZA 4XOZA 1OVEA 1OPLA 3PJ3A 3KREA 2DQ7X 3MTFA 2BPMA 4ALUA 4LUEA 4BCPA 4UWBA 3MN3A 2R0IA 4IZYA 1XHAA 2CKEA 3VWAA 5KHXA 2GS6A 3T9TA 5IF1A 3PFQA 3CKXA 4FSUA 4IE9A 1Q41A 1TQPA 4QP6A 5AA8A 3W0RA 1Q3WA 3GBZA 4C4IA 4EJ7A 3BU5A 3ZSGA 2RG5A 4CMUA 3PUFC 4O0SA 4BCHA 2Z7QA 2PULA 5DOSA 3GC9A 3ZONA 3BGZA 3WZJA 4R5SA 3KL8A 2CNUA 2JKOA 4AE9A 4M66A 2GDOA 3QWKA 3THBA 3RWQA 3FAAA 2XYNA 4EOOA 4FV4A 4FKOA 4KBKA 4DGLC 5CU0A 3ID6C 2WEVA 4XEYA 2XAOA 1YXXA 3C4EA 3DKGA 4FR4A 4HNIA 4MHAA 4MWHA 5AUUA 4HGSA 3FY2A 4PPAA 3A4PA 1L8TA 2J0KA 4BDHA 4AP7A 4LG4A 3MA6A 1T46A 4FV5A 4XLVA 4AT3A 3HUBA 3NX8A 1UNHA 2C6OA 3G33A 3LMGA 3MGYA 3PE2A 3QYWA 1H08A 4U43A 4IEBA 2FSOX 3TV6A 4AWIA 4QYFA 3ORLA 4K2RA 3IK3A 2YITA 3PZHA 3RPYA 3E8EA 4TTHB 4NCTA 3PSDA 3OTUA 3O51A 4E4NA 1WBNA 1J7IA 2XK7A 4FKGA 1YVJA 2NYAA 1ST4A 4APCA 4HJOA 4UWYA 5CEOA 2PZRA 3CC6A 2VZ6A 2P55A 2X7OA 4NTTA 4X3FB 3LLTA 3DJ6A 4KIKB 2AUHA 3OW4A 2CDZA 2BCJA 4OUCA 4EHVA 4O7VA 4R3CA 4YJOA 3AD6A 4QP3A 3PUPA 4JBPA 5AMNA 1H01A 3VHKA 4O4BB 4F9YA 3Q6UA 2IZRA 5C8KA 4DEEA 4IAYA 1CTPE 2O65A 3Q9YA 1Y91A 4HCTA 3CTJA 4IX5A 4YHJA 3VS2A 2CCIA 3DBDA 3NRMA 2X0GA 3QQLA 4I5CA 5CI6A 2XRUA 5HEZA 3TZMA 4ARKA 4C38A 3RP9A 2PVFA 4O2PA 4RG0A 4CTBA 3TV7A 2WQEA 3PXQA 4JI9A 5BUIA 5C26A 3ZLSA 3VBYA 5EYCA 2ZV2A 4IWDA 5CANA 1PXLA 1M2QA 3KRWA 3UIBA 5IA3A 1PF8A 4JRVA 2X0QA 4OTQA 3FZ1A 2F9GA 4IAZA 3VUGA 1UU9A 3DAEA 4Y95A 4PTEA 5IQGA 2YCRA 5HOAA 4EWQA 5DPVA 3OBGA 5GHVA 2YM3A 4GJ2A 4AACA 4H3BA 1W83A 3LLAA 2YCSA 3IG7A 3L8PA 4TL0A 3TT0A 3PPKA 1LUFA 2Z02A 2VO6A 1W2FA 3KXNA 3NZ0A 4PV0A 4XG6A 4LGGA 2O8YA 2FB8A 4YJRA 5L6WL 3T9IA 5JMSA 3P1AA 4L3PA 4C4EA 3FE3A 3TI1A 1XMLA 3HYHA 1E1VA 1W0XC 4NK9A 4II5A 3GCVA 4AZFA 2BRHA 4CFFA 5A9UA 5DEWA 2PZ5A 2XK9A 4C3RA 2XCKA 2RSVA 3QLFA 1WAKA 1E1XA 4IM0A 1PMNA 3AGLA 3IS5A 4YZ9A 3DKOA 5KMIA 3TYKA 3ERKA 4CSVA 3WZDA 3N4UA 4BJJB 3LM0A 1OGUA 3KEXA 4O1OA 4ALVA 1A48A 4O0XA 1SVGA 4WSQA 2PVNA 4C7TA 3F5UA 2OU7A 3IDPA 5A14A 1JSVA 3IDCA 3OF0A 4F78A 4FEQA 5LVPA 4HGLA 5AAFA 2ITXA 4BVUA 3EQHA 5BV3A 4MX9A 2PTKA 3PFYA 4J97A 3ORIA 2QOBA 5HNGA 2QD9A 2Z7RA 3D2KA 4KIKA 2HCKA 3LFCA 2UW5A 3SXSA 4DTBA 5LOHA 1OL5A 2UZNA 5DFPA 3WOWA 2ZOQA 1R39A 2UZVA 3AG9A 4O4FA 4PDYA 4AG8A 3EN6A 3ZO1A 4X6RA 4A9TA 5HQ0A 4EI4A 5EQYA 4F0IA 3O8PA 4M67A 4QMVA 3L8XA 4ANLA 3SLSA 3NLBA 3QHWA 4Q5EA 4F65A 2W4JA 5E8WA 2EB3A 4YZNA 5EW3A 1W7HA 2VX3A 1GZOA 2R3PA 2ZMCA 4RVMA 2BAQA 3ZXTA 4FJVA 2R3NA 4U81A 4ZEGA 4QP8A 4RLLA 3FQEA 4FKVA 4QYYA 5AV2A 1JOWB 4OBOA 5M51A 4AT5A 1PMVA 2V22A 4XLIA 4QYEA 4CLJA 3QTUA 3NUYA 1Z57A 1F5QA 2BRMA 1CKIA 4AZEA 2BUJA 1YWRA 3BEAA 4XUFA 1KV1A 5HU9A 3KMMA 3OWKA 2VTRA 4AA0A 1PHKA 3LMHA 2QI8A 5TOZA 2PUNA 3KQ7A 4L68A 1A9UA 2CHLA 2WTJA 1TQMA 4AFEA 4B9DA 1IA8A 2GQGA 2X0PA 5CEIA 2WKMA 4PRJA 5J7BA 4CQGA 2YABA 4FTQA 2GS2A 3QCXA 4R5YA 3A7IA 3OD6X 2AC5A 3FLZA 3G2FA 4R3RA 2XK8A 3LQ8A 5FLFA 2BTRA 4WNPA 3U9CA 4HVDA 4GJ3A 1OL7A 3II5A 3M11A 2WAJA 4YHTA 2Q0NA 1SNXA 3RZBA 3NVKI 1IR3A 4ZXTA 4GYIA 4UN0C 1J1CA 1RW8A 3IOPA 2Y6MA 4YNEA 4H58A 4XOYA 2AEGA 1H1RA 3V5QA 3PLSA 4F4PA 5IISA 3P78A 4I3ZA 2C5XA 4ANQA 5AP2A 4FV7A 1ZOEA 2XM8A 4YUQA 4DCAA 3D5UA 1UU8A 4EKKA 4AOJA 3DK3A 3COMA 3COKA 4UBAA 4RWIA 3ZS5A 4LOOA 1ZARA 4BYIA 4WUAA 4X2KA 3P79A 4BBMA 3UP2A 4LDTA 3SXFA 5G1XA 3IW7A 2OGVA 3KF7A 3PE1A 5IA4A 4CGAA 3AD5A 5K4IA 5IG1A 1XBAA 2RFNA 3UO4A 4MBLA 3PXZA 4I93A 5LVNA 4KNBA 5CS6A 2IVUA 2HENA 4M12A 4OR5A 2BFYA 2R3OA 2VN9A 3MVHA 4JQ8A 4I6QA 5A4CA 4I5PA 4M13A 4I6BA 4KSPA 3ROCA 4E6CA 2OG8A 2OIQA 2X6DA 4ZTSA 5CZIA 5E8VA 3R63A 2ITWA 4E3CA 3UMWA 3KKVA 3CSVA 3OWLA 3QTSA 2NRUA 2X7GA 3OTVA 3QYZA 5HG5A 5TO8A 4KS8A 4UMQA 2ITZA 4DFYA 2JFMA 3BIZA 5AR8A 4AW2A 4QYGA 2VTPA 4OAVB 3LQ5A 4CV9A 3G0EA 1GZ8A 1Y6BA 4FEXA 2W06A 5EKOA 4OGRA 1OPJA 4ACHA 3ZYAA 1M17A 4Y5HA 5F94A 5LMAA 4E4XA 2WU7A 3MIAA 4RIWB 4ASDA 3EZRA 1OL6A 3ALNA 3HL7A 2BRBA 2CJMA 3P0MA 2CGXA 4FV0A 3KFAA 1BI8A 1YHWA 4ZP5A 2C6IA 1PXMA 3DLSA 3V5TA 3QL8A 4YGAA 3NW7A 4JXFA 3ANRA 4LV7A 3FZRA 3JVRA 4A4OA 2XKFA 4O0YA 2WNTA 4FUXA 4X2GA 3I0QA 3ACKA 4QTBA 3S2PA 1REJA 1OBDA 4DHJA 3EWHA 3BPRA 1ZOHA 2BROA 2O2UA 3FLQA 5D12A 2ITTA 3OZ6A 4V04A 5K5XA 5FUTA 3BYUA 2C0IA 4CZTA 2E9VA 5DG5A 2XB7A 4RFMA 1YDRE 3AT3A 3A62A 2YJSA 2X1NA 2ZB0A 5HBEA 3KXGA 4FSQA 2C6DA 4M84A 3C4XA 3TEIA 3QX2A 5A4EA 5FRIA 3TNPC 4FSMA 3HMNA 3PA4A 3OW3A 2I0VA 4I5HA 3QRIA 3P9JA 5HBJA 2PU8A 3SGCA 1YXUA 3BLQA 4E5AX 3NIZA 2X8DA 4JBOA 5AUYA 3AMBA 4JQ7A 4EOIA 2O3PA 4FX3A 5ANIA 1KOAA 4FG8A 4KINA 3QKLA 4QTDA 4Z55A 1DI9A 3CJGA 4S2ZA 5LVMA 4KUJA 3LCSA 2ITVA 2XNOA 4MXYA 1VLRA 3OEZA 1GJOA 4IM3A 1KE9A 3A60A 2BFXA 1OITA 3QD3A 2ZJWA 5JGAA 2VWWA 3DFAA 2FSLX 4I6FA 2HAKA 4B8MA 2E9OA 4G3GA 3AC3A 2I7QA 4G1WA 2A98A 4EKLA 3MBLA 1R3CA 2OWBA 3EN5A 4G17A 4YJVA 2C6MA 3SW7A 2F7XE 2QO2A 4FT3A 3R7IA 5IA2A 4BC6A 3V5PA 5J7HA 4FSNA 3FLYA 1M14A 3KGAA 2PMIA 1MUOA 2XP2A 4FVQA 3WZEA 1FPUA 1CM8A 1LEWA 3S4QA 3UQCA 3HV7A 1OGYA 3NWWA 4GUEA 1Q3DA 2XIRA 2ZV9A 5J1WA 1Z5MA 5FM2A 4YTFA 4DEBA 5EQEA 2VTAA 3BHTA 2WEIA 3W0QA 1JVPP 3PTGA 1J91A 2VWYA 3EMGA 3KB7A 3E8DA 2X2KA 3ELJA 5I9ZA 3MI9A 4RIWA 3O8TA 2I0EA 2YEXA 3L8VA 1WCCA 3QQGA 3ZUTA 4C59A 1JLUE 4NIFA 3PLAE 2R3GA 5IUGA 4Y8DA 3ZEWA 3G9LX 4QPSA 3TN8A 2WTIA 1AD5A 3EYGA 3LFAA 5JKGA 1XQZA 5FTQA 4YZCA 5M53A 3U55A 4L7SA 4U9AA 3DNDA 3FZTA 3UPZA 3NGAA 4QQ5A 1XKKA 3E3PA 4AAYA 4ZJJA 3GNIB 3MVMA 4PX6A 3U54A 4RFZA 4EQCA 1VEBA 1Q24A 3UOKA 3KY2A 4EONA 3HV5A 4QMZA 4YO6A 4DHZA 2QURA 3DAJA 3UNJA 4DA5A 4QMXA 3ML1A 5DN3A 2B9FA 1EH4A 1W2CA 3EQFA 4BHZA 4IC8A 4Y73A 5JGBA 3CPBA 3UIXA 4F9BA 2X2MA 1YQJA 3NUUA 3W2OA 1FINA 3R7GA 5C1QB 4Q2AA 2C6TA 3NW5A 3R00A 4MKCA 4AGUA 4F6UA 4HVHA 3PYYA 2B53A 2PUIA 3PVUA 4YJUA 5AR2A 4GKHA 3PIYA 3BYMA 3MPAA 4F0GA 4FKIA 2IG7A 4DDIA 1FMOE 5DR9A 4WRSA 3JS2A 5IU2A 5AR4A 2X9FA 2OZAB 3WE8A 1CSNA 3GU7A 2GNIA 1OPKA 2OKRA 1AGWA 3A7JA 3LFEA 4JBQA 3V6RA 5KZ0A 2EU9A 3UZPA 2XA4A 2YLEA 2ESMA 3UQGA 4QMWA 3ZLXA 3AKLA 5ICPA 5JH6A 1OECA 4IB3A 4MK0A 5AUWA 3RWPA 1G5SA 3LFBA 3QZHA 4F70A 1W84A 3SAYA 1X8BA 3LOKA 3KMWA 3OP5A 3RVGA 2QU6A 3ZFMA 2OICA 3P08A 3NYOA 3QFVA 3NNXA 1PXNA 2PUUA 2QLQA 4RA4A 2BVAA 4XJ0A 4M14A 2YDKA 3DXNA 4RWLA 2F4JA 3QU0A 4TT7A 5TKDA 3V01A 1FBNA 3OCTA 3HVCA 3RHKA 2REIA 5AV3A 3PPZA 4EC8A 4O7NA 4QP7A 2VTSA 1OKYA 3HA8A 3GU6A 4EH4A 1O9UA 3WE4A 2UZOA 2XNMA 4U44A 3OC1A 4EH5A 5JFXA 4R6VA 4AA5A 5CF4A 3M1SA 4MNEB 4J96A 1GZKA 5CZHA 5HNIX 2H9VA 5FG8A 3R9NA 4C4HA 1Q8UA 4PDSA 5I9YA 5KKRC 3EQIA 4ANSA 3P7CA 3ZTXA 4XP0A 2XAMA 5AP1A 2CMWA 3UC3A 4GK3A 1U46A 2HELA 4GFOA 2IVSA 3DU8A 1GIHA 3QBNA 4PP9A 4RIYA 3WYYA 5A6OA 5J9LA 2PPQA 1JWHA 2XNGA 3OMVA 4KKGA 5DLSA 5FEQA 3ZM4A 5A4QA 5IZFA 5KKRB 2ITUA 5KBQA 4KWPA 5AUZA 3T3VA 4IM2A 3UG1A 3SDJA 3VF9A 2GFSA 3H30A 4WHZA 5EI6A 5AR7A 2EXEA 2XJ2A 5GINE 4C35A 3DXQA 2W05A 4IHPA 3FKLA 4FT0A 5KMNA 1QCFA 5I0BA 5ANEA 3ENMA 3K3JA 3VAPA 3ZO2A 5EM5A 3BL9A 2OIBA 4IVCA 5FXRA 1V0BA 3R2YA 4L00A 4XP2A 4L53A 3P86A 2R3JA 3LIJA 3PVBA 4U40A 5C03A 5DRBA 4CKJA 3GFEA 4ZOGA 5J8IA 3DPKA 4U3ZA 1KOBA 3LFSA 1BKXA 3QC4A 2ETRA 3V5JA 5L2IA 5DT3A 3BL7A 5IEXA 2GHLA 3DQWA 2X4FA 5HZNA 4YP8A 2OZAA 4Y72A 3ZBFA 2GPHA 5J79A 3Q04A 5IH5A 2WELA 1XBCA 1Q8WA 3W33A 3ZFYA 4KA3A 3EQDA 1K2PA 5IQFA 2LAVA 4CV8A 3Q3BA 4MF1A 4ACDA 4D1SA 4MNFA 4D4RA 2ETKA 4A06A 4AAAA 1NVRA 4GKIA 3DQXA 1GNGA 3OUKA 3ZU7A 3C0IA 1OKZA 3G5DA 2R3QA 4AE6A 4BGQA 2UZEA 4XG3A 2IEWA 4I22A 3F66A 5EOLA 4DHFA 5IQCA 4W9XA 4F64A 4E5BA 4KAOA 1MP8A 3BLHA 3IDBA 3LJ2A 2OJFE 1YHVA 3FHIA 3MWUA 3DS6A 5E92A 2QLUA 3WYXA 2C3JA 3HEGA 3Q4CA 1V0OA 4CQEA 4MEDA 4A9SA 3PSBA 4L52A 4O7ZA 5FXSA 4NH1A 3R8PA 5KUPA 1APME 3PP1A 4LGDA 4LUDA 3F5XA 3IGOA 4LL0A 3SC1A 2B55A 3POOA 5CXZA 2AQXA 5JRQA 2ZV8A 4G6NA 3IQ7A 3QD4A 3KRJA 3WIGA 1Q99A 2YLFA 4CRLA 5HE3A 3CD8A 4O22A 4D5HA 2JGZA 4DH3A 1UA2A 4S31A 4MD9E 3GFWA 3GGFA 3DY7A 2I40A 3COIA 3EL7A 3Q96A 4FSYA 2B7AA 3OCGA 1H4LA 3FZOA 3C50A 4NYEA 5L6OA 2BTSA 3O5AA 4W4YA 3HUCA 3QTIA 3FKOA 4QEBA 3EQPA 3DZQA 1OIRA 1JKKA 4QMUA 3WARA 2VV9A 3FSKA 3UDBA 3SHEA 2Y9QA 1XH6A 3IECA 4MQ1A 2JBPA 4G5JA 5H8BA 4C34A 3MYGA 1F3MC 4FKPA 3PG1A 3RKBA 3FL5A 3OWPA 2BDWA 4BCMA 2OFUA 2HWOA 2VWVA 1UV5A 3UNZA 2YIQA 5CVHA 2OIDA 4XV2A 4IVAA 5AP3A 4DH1A 4IC7A 4AZVA 4G3DA 2DS1A 2EB2A 4PPBA 2JKQA 2PZYA 3JPVA 4EK5A 2IPXA 4LYNA 4JDKA 4F0FA 3KA0A 3UZTA 2C0TA 3GOPA 4DC2A 5GJDA 4AXDA 4YTHA 3H3CA 2PMNX 5FDXA 5KO1A 4K33A 3UNKA 3C5UA 5CENA 4G16A 4J98A 3OUNB 4AF3A 4CFWA 4PMPA 3RK9A 4BTJA 2G9XA 3UDSA 5IDNA 4ZZMA 3ZRMA 3V5WA 1VYZA 4F9CA 1YRPA 1LPUA 1MRYA 4Z7GA 4BKYA 3CY3A 5FM3A 3RMFA 5IQEA 2VTMA 4F7NA 4ZSLA 3POZA 4IQ6A 3B8QA 1Y57A 3ROYA 1PXIA 4P5QA 1H8FA 2BZHB 3A7GA 5BVKA 3FI3A 3VO3A 5FEDA 4FEUA 3DB6A 3F88A 3QRUA 2UW6A 4NM0A 2YM8A 4IWPA 4C2WA 5BVNA 4HZSA 4GFMA 2YDIA 5CSHA 2R0UA 4RX7A 1SNUA 3MB7A 4YO4A 1VJYA 5EI2A 2UZBA 2JDVA 1B6CB 3LCDA 4QMQA 3FXWA 5FXQA 4FBXA 2XNBA 3EKNA 3NAYA 3R28A 4BCJA 4Z3VA 4XV1A 1R0PA 3RM7A 2XMYA 5J95A 1CMKE 5AA9A 3IW4A 3R7UA 1L3RE 3U6HA 4TYHB 4M69A 5A46A 5CT0A 5JFVA 5AAGA 1Q97A 4FTKA 5BUEA 1OZ1A 3CGOA 3FPQA 4HPUE 2C5YA 4FC0A 2X6EA 5HIDA 3LFFA 1U5QA 5CEMA 3RCJA 3GENA 2BIYA 2J5EA 4ITHA 4EZ3A 3IKAA 5E8ZA 5A4LA 4XG2A 3NPCA 3I81A 1QPJA 1XH5A 5IUIA 1Y8GA 4WD5A 1Q62A 3BLRA 4D2SA 1ZZLA 3I5NA 4WRGA 5CAUA 4MAOA 5JQ5A 1QMZA 4NL0A 3WF6A 3HAMA 4K11A 1V1KA 2GNHA 3HRFA 2Z2WA 4HGEA 4YTCA 3R6XA 1ZAOA 2ONLC 4R1YA 3MVLA 4RVLA 4QMNA 4HYIA 2PMLX 2WIPA 4FICA 2BRGA 2PHKA 3A8XA 4FKRA 3FMJA 4PY1A 4F99A 3CD3A 4BDJA 4ZY5A 4UMUA 4YU2A 5AEPA 1ZYLA 4ZTLA 5B2LA 2QQ7A 2GNGA 2PY3A 2BR1A 3R01A 2UW0A 4PDOA 4Y85A 3ZHPC 4BBEA 2YZAA 1PYXA 3UVRA 3QXOA 3FC1X 3N9XA 4KABA 4IZAA 4EK3A 3N4TA 3ZEPA 1OKWA 3QLGA 3DKFA 4J53A 4NT4A 4QP2A 4GYGA 4TN6A 2BZKB 4X3JA 3TIZA 4X3FC 4EL9A 2IWIA 4HPTE 4J95A 5BMSA 5HIBA 5AIRA 3RI1A 4ZTNA 3VIDA 2W17A 3DA6A 4YHFA 3ZH8A 5HD4A 3VHEA 5L6PA 4GRBA 4IB5A 4EOSA 4R7HA 3SRVB 4FIJA 5CSVA 5J9ZA 5LMBA 5JRSA 3PJCA 4JVGA 3C9WA 1DI8A 4U80A 3UMXA 4A9YA 4BZNA 5CSPA 4ACGA 3OXTA 5A3XA 5LJJA 5FTGA 4GVJA 1MQ4A 3FC2A 4ANBA 4FEWA 4EOLA 4J71A 1QPCA 3WF7A 3V5LA 3K5VA 3P7AA 5EM8A 4RBLA 4CZYB 4FSRA 4JAJA 4O0RA 1Q8YA 4AS0A 3GI3A 2FH9A 3CIKA 3A7FA 3G0FA 1AQ1A 3H4JA 4GUBA 4I20A 5IPJA 5AM6A 4TYHA 3E92A 2WMVA 3RINA 3KN5A 2R9SA 4OTDA 4E1ZA 1WBOA 3HAVA 5FDPA 1OIUA 2CGVA 3DOGA 4DLIA 3QD0A 3QQFA 2WTKC 4QDEA 2WOUA 4BL1A 1XBBA 4TXCA 4YLJA 2W9ZB 4JLCA 2HZNA 4ID7A 3R1SA 5AUXA 3SKCA 4C4GA 4S32A 1IA9A 2X8IA 2OLCA 4TY1A 3WF5A 5AR5A 2VWBA 2WTKB 3D14A 1GY3A 1WBSA 3F2AA 3IW5A 4L8MA 2F7ZE 2QG7A 4U42A 4EBVA 3OXZA 1P4OA 2X0OA 2QCSA 3O2MA 5AP7A 2GHGA 2Y7JA 4AN3A 2FVDA 3W16A 2WZJA 2OBJA 4CNHA 3D2IA 2J2IB 4DG2E 2KTYA 3H0ZA 3KXMA 2ONLA 3QQHA 2OW3A 3FDNA 5HO7A 2PE1A 4OBQA 5E7RA 2OH0E 4RJ7A 2PZIA 3VUDA 2GSFA 3FLSA 4Q9SA 4R3PA 1GOLA 1ZYSA 2XKEA 4D4SA 2R3FA 5DT0A 4DGOA 3MPMA 3I7CA 3BWFA 3FJQE 4XG8A 3O50A 3GEQA 2YDJA 4I41A 4JQEA 4GEOA 4BIBA 2VAGA 3W0SA 2E9UA 3F3TA 3VVHA 4NFMA 3VJNA 3F7ZA 3QCYA 4LRMA 3QTQA 3JR1A 5I3OA 3DBEA 2VO7A 5LARA 4FSWA 4JL9A 4CT2A 5DI1A 1PJKA 3TDWA 3HDNA 2RGPA 4X3FA 3D5XA 3RAIA 4CD0A 4O6EA 3O96A 3FYJX 4Z16A 2Y0AA 3DGKA 1BYGA 2YM6A 3ET7A 4G3EA 3GCPA