4KABA

Focal adhesion kinase catalytic domain in complex with 3-methyl-1,4-dihydro-pyrazolo[4,5-c]pyrazole
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
255
Chain Sequence
TRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Fragment-based discovery of focal adhesion kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 255
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kabA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kabA01
1JLUE 1HCKA 4JI9A 4N0SA 5GNKA 3T9TA 1ZWSA 1YDTE 5BPYA 5E1SA 3B8QA 2CNVA 1SZMA 3MFTA 3LCTA 4UMTA 3RVGA 1PMNA 3V5WA 4FKQA 3W55A 4ANOA 4EH5A 4O7VA 2WU6A 4C4JA 3ORTA 4GT3A 2XIYA 2WB8A 5ANIA 4XLIA 2VX0A 4TZRA 5HX8A 3TJCA 1XBAA 4XRJA 4HW7A 5IA2A 4UX9A 4NW5A 5HCZA 4IM0A 3WZKA 2O63A 4O0WA 3I6UA 3DJ5A 3MB6A 3NZ0A 4LV8A 5C27A 3VW8A 3MPTA 3QD0A 4M0YA 5AUYA 3R73A 4XBRA 3VS4A 3NUSA 4EWHA 4BCJA 2V7AA 4G2FA 3FLQA 5EOBA 2YDIA 4FTNA 2EWAA 4I3ZA 2IZRA 4PMTA 4BTJA 3RALA 4EHEA 4OAVB 4O0SA 5HO8A 4RIYA 5IQGA 1Q3DA 3EFWA 3LE6A 4XNEA 2C5NA 3FPMA 3BV2A 3HUCA 3SLSA 2QURA 4KS7A 3OBGA 4FG7A 4JRNA 4TNDA 4U8ZA 3RGFA 3BGPA 3VS1A 2X7GA 4FR4A 4ZTQA 2CCIA 2EXEA 2BCJA 3FMDA 3A7GA 3R1SA 4KIQA 5AP1A 4Y72A 3NGAA 1FOTA 3NUXA 4EYMA 2DQ7X 4Z55A 3ROCA 1ZLTA 4OTIA 4U79A 4R3PA 5CVGA 3UDBA 3VIDA 1OB3A 2JAVA 3HUBA 2CGVA 4GVAA 5ANOA 5CAQA 4OGRA 4B8MA 1PKDA 4C36A 5CYIA 4UV0A 5L3AA 4LG4A 3ZDIA 4M66A 1TKIA 5DNRA 4A4XA 4Y85A 1XBBA 5BVNA 4PDYA 1UKHA 4BDBA 1AGWA 4TWPA 1OL7A 5JN2A 1TVOA 3A8XA 3QYWA 4BCMA 5L4QA 3EQHA 1DI8A 4V01A 4XG8A 3ZM4A 3IW7A 4AA0A 1XO2B 1UU3A 4O7ZA 2WGJA 3QGWA 4OW8A 4R77A 3NNXA 2X1NA 1Q99A 1H1WA 5ACBC 5T6KA 3DQXA 3FJQE 5G1XA 1JWHA 3FLNC 4MBLA 5CF4A 2CNQA 1M7NA 2YM6A 3O17A 3C4CA 3G9LX 2VWYA 3NCZA 2VTPA 1BMKA 2C5OA 4C4FA 2C6IA 4DH8A 4FOCA 3ODZX 4Q5HA 3POOA 4M8TA 2BRMA 4Q5EA 4RFYA 2XNOA 3B2WA 1IRKA 5KMMA 5D9HA 1I44A 4AZWA 4FSWA 4WOVA 5AA9A 3QHWA 2G2HA 4A4OA 3PYYA 1SVGA 4ZK5A 3QA0A 5LCKA 3RWQA 2WMRA 3MFSA 5I9ZA 3O2MA 5CWZA 4UMPA 3NW7A 3Q32A 2JKQA 5DEWA 3IW8A 4O1PA 3RPYA 2QG5A 2WMSA 5AA8A 3BYSA 3LJ1A 4BDKA 3GU4A 4ACDA 4H3BA 2PVRA 2Y0AA 4GFOA 5LVMA 4L68A 2OIBA 4NM5A 3E87A 3F5XA 3HRFA 5C1QB 5AX3A 5IDNA 1VYZA 3QYZA 4KSQA 4TTHB 3BWJA 5L2IA 2PZ5A 2WTCA 5GJGA 2XP2A 4GG5A 3RKBA 1OM1A 2WTKB 4APPA 3VC4A 2BDWA 5DE2A 5CEIA 3R7VA 3IS5A 2BRNA 4WRGA 1A06A 4RIYB 3UJGA 5F20A 3LXKA 5GZAA 1U54A 4F09A 2WKMA 3FSFA 2GS6A 3MFRA 1F0QA 4BCKA 2YLEA 2QO2A 3D0EA 3MDYA 5B2MA 4NL0A 2OH4A 3O96A 4B7TA 3MY5A 3PRIA 2R9SA 3PZHA 3TT0A 3SXFA 2F2UA 2YCQA 2GMXA 4V05A 5HKMA 3FMMA 1PMUA 2F57A 1JOWB 4YU2A 4IBMA 4O7LA 3SHEA 3UNZA 4K6ZA 2OJJA 5CENA 1G5SA 4FTQA 2V0DA 4XS2A 3WYYA 5C26A 3PA4A 3IOPA 3QD2B 3AC4A 5IEXA 5J9LA 3EHAA 5HCXA 3F66A 3EN9A 2YAAA 3EQIA 4JDHA 3PY0A 3LQ8A 2XRUA 5AWMA 1B38A 5CEQA 2OGVA 4NM3A 2C0TA 4GJ2A 5AAFA 3OY1A 4XG7A 3GVUA 2B53A 3UYSA 2W1DA 5GHVA 2XNPA 4WNOA 5DA3A 4MK0A 2W1CA 4GW8A 1QPDA 3BYUA 1H07A 1SYKA 4HOKA 2JIIA 2R5TA 3O0GA 4FSUA 4UWCA 4N70A 3R7GA 4IB1A 5J95A 5L8LA 2RIOA 5LMKC 4WKQA 2WMXA 5IH5A 4PTEA 3LFEA 3QTIA 3ZUUA 2B0QA 4BYIA 2JIVA 2Z7SA 2CGXA 3QQFA 3DKFA 2Z60A 3NIEA 2PVNA 4NIFA 2UZLA 5IUGA 4MD9E 4K9YA 4UYAA 3W2OA 4D55A 4F9BA 5F95A 4IAYA 1REJA 1OL6A 3GUBA 3ZRMA 3NCGA 3V6RA 3F2NA 2ITWA 3IOKA 4AT3A 4NWMA 4L45A 2WMQA 5C8MA 1OVEA 4TYIA 1V0PA 4IHPA 4RFZA 3UZPA 4Y5QA 5L6WL 2XBJA 2XMYA 4AZEA 4EH9A 3VBQA 3FPQA 4BKZA 2YZLA 5E92A 2WMAA 3K3JA 2XH5A 1PF8A 4C33A 5BQ0A 4RMZA 4IX4A 5LOHA 3HA6A 2P0CA 3JVRA 1QMZA 3KMUA 3Q6WA 5AV4A 2OFUA 1WZYA 4Y46A 2YACA 3POZA 2GHMA 2YITA 5D7VA 3ZEPA 4E20A 2BRGA 5E8ZA 4EKLA 2QNJA 3CD3A 4GEOA 2BAKA 4JT3A 4IWQA 4KRDA 4M3QA 2WEVA 4TW9A 4H3QA 1KE7A 3RZBA 2VGOA 4F1TA 4QYFA 2BHEA 2OZOA 4WG4A 4DITA 1U54B 1LP4A 4LL0A 3TIZA 2B1PA 3AG9A 1XH4A 1OECA 2GS7A 4FIGA 5L2TA 4RGJA 2XB7A 4UBAA 4WNKA 4FT0A 4U43A 2F2CB 4AXAA 4BCGA 1IG1A 5CQUA 5EOLA 4YJOA 1GIHA 4RJ5A 5EW9A 4TYHA 4IM2A 3W33A 3SDJA 3UVPA 4YZ9A 2RFNA 3P86A 2CNUA 3FY2A 4HCUA 3SXSA 4JQ7A 3IGGA 1REKA 2B7AA 3E62A 3KN6A 1PY5A 5AP6A 2W05A 4ZJJA 4I41A 4EOIA 3Q9ZA 4CYJA 3QWKA 1ZY5A 3OT3A 4NM7A 3K54A 3TL8A 4ANLA 1OPJA 3UIXA 4QD6A 4CEGA 2ERKA 1IA9A 5J5TA 3RJCA 2PYWA 4QRCA 4QTCA 3R2YA 4CCBA 4XMOA 5ANJA 4DGGA 4A4LA 4YLKA 1BI7A 4I4FA 3QRIA 2J0IA 5KO1A 1GY3A 3DT1A 3ORNA 5LMKA 5M44A 2DS1A 3JPVA 4V04A 4XOYA 1Q61A 2WTJA 4EK4A 3KF4A 4KKHA 4RA5A 4BGHA 3ID6C 4J53A 2J2IB 3DTCA 1H4LA 3QZGA 2R64A 4LV5A 4NIFB 1WVXA 3PIZA 4K11A 2X8IA 3CPBA 4BBEA 3RHXA 4FV9A 3QAME 4QMMA 4YJRA 5EHYA 4FT9A 4ZZOA 1PYEA 5HLPA 1LEWA 4RZWA 3P08A 2C4GA 4WO5A 3EN4A 4GIIA 4P7EA 1YVJA 2RSVA 1MQ4A 2G2IA 3R1QA 5HIEA 1Y57A 3I79A 3MJ1A 4WT6A 2GTNA 1OKWA 5CS6A 3RK7A 4USDA 3FE3A 3MV5A 3I7CA 4IM3A 5E91A 3AT3A 3KRXA 1E1XA 5BYYA 2V7OA 2C6KA 4RVTA 3QZHA 4YJQA 2AUHA 4PPBA 1XJDA 4EZ3A 4FTUA 4FT5A 5K4JA 2C6OA 3NIZA 2IW6A 4PP7A 4FV3A 4PMSA 2YWPA 2XNGA 4L3LA 4CRLA 1IR3A 3OFMA 3EQPA 3E3PA 3MB7A 4O0VA 3PPZA 5HTIA 3DJ6A 4K1BA 5AX9A 1J1CA 3E8CA 3L9NA 1OKYA 4LUEA 4CTBA 3WZJA 3E8EA 2JKMA 3KXXA 4FV0A 5AM6A 2WNTA 4IX5A 3R7IA 5IQAA 3CBLA 2XCHA 4MQ2A 3TIYA 4ANNA 2A4LA 4EK5A 4DE4A 2PUPA 3ZLYA 1P4FA 2GDOA 2WELA 3UVQA 3R0TA 3MIYA 5IG1A 3N4UA 4ALUA 3RAWA 3AC2A 2JAMA 1YXSA 3OC1A 2J6MA 4H58A 2XS0A 4AGWA 3R9NA 2W99B 2UZOA 3L8PA 4FIHA 4GRBA 4TYHB 2OI4X 4GT5A 1KE5A 4FTIA 4K2RA 1ZOGA 2C3JA 3F5GA 5K5XA 4FSZA 1M52A 3GCSA 3UIBA 4FKVA 4L53A 5A14A 3HAMA 3UC3A 3S2PA 3OS3A 4TN6A 4O1OA 1BI8A 4JBPA 3ULIA 3LCKA 4YP8A 4XP0A 2PVHA 2PZYA 4O96A 1Y6BA 4S2ZA 2Q0BA 3UIMA 1ZMUA 4IZ5A 4I0RA 1UA2A 1ZRZA 3ODYX 4ASEA 4HYSA 3C9WA 3R8ZA 3S4QA 3HLLA 2BRBA 4JLCA 3DK3A 4XG6A 4FTRA 3L8VA 4YTHA 4KIKA 3C7QA 4KBAA 3K5UA 5FEDA 3VBYA 2X81A 4I0SA 1OPLA 3AC1A 3LHJA 5EM7A 4C4HA 5J87A 3H10A 3OXZA 1JKSA 5CXHA 4TWNA 1QL6A 3G15A 2GNJA 4FTJA 4L8MA 4JDIA 1YXXA 3Q4ZA 3PWYA 4YZBA 5AAGA 3HV3A 2GFSA 3PY3A 4L9IA 2HWPA 3CJFA 4ITHA 4A06A 4F70A 4IAZA 4O0RA 3QCQA 4CKIA 5L2WA 4DFNA 4DAWA 5BUEA 3DCVA 4A9YA 4MD8E 3NVMB 2BMCA 4PNKA 4Y73A 3I81A 3VUHA 4RWJA 2J0LA 3EN6A 4GFGA 3PPJA 4DH1A 2BVAA 3QHRA 5IA1A 3UYTA 4D2TA 2WTDA 3D83A 2AYPA 5AUXA 3KXMA 2Y6MA 4I1ZA 4EC8A 4KABA 2JDRA 3HMPA 1K2PA 4PY1A 1BL6A 3HV4A 5IA4A 4R7BA 3EFJA 3F5UA 3D4QA 1U4DA 2X2KA 4DEIA 3ZONA 5FTQA 3A8WA 4DG3E 2PSQA 1O6LA 1YWRA 3OVVA 4GFMA 4X2GA 5D12A 4DTBA 4E6AA 4OTFA 4TWOA 1M2PA 4AZVA 2G1TA 3FLWA 4UB7A 4AACA 2BROA 4WSQA 5HD4A 3BHVA 4EH3A 1KE6A 3VF9A 3CQUA 1V1KA 4JQ8A 3EKNA 4QMLA 3D5WA 3ZO2A 5M4UA 4F7NA 4YO6A 3GT8A 3ZYAA 3ZCLA 2PUIA 3NNVA 2ZDTA 4FKJA 4PTCA 3VW6A 3GU7A 5K3YA 2ZMCA 2QO9A 1FGIA 4I0TA 4EHVA 1I09A 2YLFA 2Z2WA 2X4ZA 2OWBA 2BALA 2C5YA 4L6QA 4UMQA 4ZIMA 4DH3A 3ELJA 3TZMA 3D7ZA 5AP3A 5EHLA 4HZSA 3KRRA 1Y6AA 5IA5A 2WU7A 4CMTA 4O27B 2P2IA 2NRUA 2YIRA 3G6HA 4OUCA 4N4SA 5IA3A 2WTWA 5A4QA 1A48A 2GS2A 3F3WA 3CEKA 5CEMA 4MEDA 3EFKA 3E93A 1OBGA 3RNYA 4O7RA 1ZOHA 2VX3A 1ND4A 2GNGA 5AR3A 3TV4A 4RQKA 4RC3A 3SRVA 3OTUA 4LMUA 5E8VA 3DJ7A 4E3CA 2BHHA 2J5FA 3PZEA 4AW0A 3EQDA 3GOKA 5JRQA 4E5AX 3BIZA 2XKDA 4KBKA 4IVBA 4DFLA 4ZEGA 5IQDA 4XOZA 3PE1A 4M84A 3ZLWA 3N9XA 4KIKB 3FXZA 3KMWA 4U41A 3LCDA 1TQIA 3QTZA 4U44A 3LCSA 4LOPA 4C4EA 2C1BA 4ZSJA 2E9PA 5LMAA 4FL2A 4D5HA 3H4JA 5DVRA 3F3ZA 4EH8A 5HE2A 3IQ7A 4ZSEA 4BBMA 3ORMA 2R4BA 4OTWA 3QQLA 4BDFA 1LR4A 4JNWA 5AADA 4DEGA 5CNOA 3VO3A 5KHXA 1W83A 3LMGA 4AF3A 1L8TA 4C37A 4D58A 4FV8A 3LFCA 4NEUA 1WMKA 3FXWA 4XP3A 5FWKK 5CSVA 4M13A 4UWBA 4DF3A 2UW9A 4IXPA 4FTMA 3U55A 2XKFA 4JL9A 4ALVA 1EH4A 4ORKA 3H30A 5JZJA 3FC2A 4FV7A 3R6XA 3UG1A 1K9AA 3AMAA 5C4KA 2ZB0A 2RL5A 1OI9A 2C6MA 2VO6A 2VWBA 2JDVA 3F7ZA 5FBOA 4ZJIA 4J7BA 3U9NA 2X6DA 5JH6A 4JBOA 2FGIA 4AZSA 5A54A 3DDPA 3FXXA 3OCTA 4OTHA 3IECA 2QCSA 3FHRA 2PHKA 3HMOA 3PA3A 4FNWA 2WMBA 1IEPA 4FSNA 3GU5A 2B55A 3UG2A 3VS7A 2BDJA 1OMWA 2HW6A 5CF5A 4FOBA 4K18A 3Q5ZA 1BYGA 4J99A 4QP3A 2FVDA 2IZTA 1CDKA 3I0OA 5CZHA 1J91A 2OF2A 2YAKA 4I94A 4G17A 3FL4A 3EN5A 4M0ZA 2PK9A 2QHMA 4DEAA 1PW2A 2VTIA 3FKOA 4QQ5A 4W4XA 3V5QA 1R3CA 4DFYA 1WCCA 5HICA 1FINA 1G3NA 1JAMA 2WOUA 3MVJA 3ORLA 4FBXA 1GZ8A 3R01A 4AA4A 5KBRA 5IQBA 5JQ8A 3HNGA 5KUPA 2JFMA 2W4OA 2YIWA 3R7EA 4DCEA 5JGAA 2O3PA 3TDWA 2I1MA 3R7OA 3TKHA 5C01A 1W98A 3AD5A 4FEUA 3LJ0A 4DFUA 3LCOA 4QYHA 4G6NA 5AUWA 4BDGA 4TYGA 5FDPA 1OGUA 4CQGA 2OXYA 4IC8A 1STCE 3QRUA 2ZV8A 2BKZA 3QUDA 2BDFA 4I5PA 1PXOA 4L67A 2XA4A 2C3LA 3TG1A 3ZLXA 3BHUA 1BX6A 2VTAA 2YCFA 4HGLA 2H96A 4ZTSA 4C58A 5ANKA 3FWQA 4MX9A 4BCQA 2ITPA 1E1VA 4U3ZA 5HO6A 3KA0A 5F94A 3KF7A 3H0ZA 4ACMA 1W8CA 4AW1A 4ERWA 4EUTA 2W1ZA 5KMOA 5HHWA 3SRVB 1JSTA 1NVSA 3ENHA 4O0YA 2I0VA 4G3EA 3WZDA 1LPUA 3LFAA 1YI3A 4NTTA 5H8EA 1V0OA 3DLSA 5FEQA 3EQRA 4EBWA 3QCSA 3U4UA 2I40A 3LAUA 3RM6A 1WBOA 4YUQA 4AA5A 1PKGA 4CLJA 3A7FA 3QLFA 3VBXA 2A2AA 3FSKA 5CEKA 3AGLA 5T68A 2BAQA 4U6RA 3SG9A 2CDZA 1OUYA 3AC8A 4P2KA 4KIPA 5CSPA 4OR5A 4MNFA 4NKAA 5HU3A 2FYSA 4CRSA 5TT7A 3QGYA 2RFEA 4D4RA 3DA6A 1U5QA 2YA9A 3OWJA 2BTSA 5BMMA 2OJFE 4L7SA 5DOSA 2PVYA 4OTRA 3QTSA 4CGAA 2PE1A 2XK3A 2NO3A 2UZBA 3BHYA 4FIEA 4I23A 1IAJA 5ICPA 1IAHA 3AXWA 3P4KA 3OF0A 4R6VA 3PUPA 4EH7A 4ANBA 1OZ1A 5HO7A 3AT4A 4XV1A 5TKDA 2X6EA 3KULA 5CU0A 3FI3A 2HY0A 2CLQA 5EG3A 4FK6A 3VWAA 4F7LA 4KBCA 3PVUA 2ITUA 4JDJA 3S95A 3ZSIA 3ZXZA 5C8NA 3PE2A 5H8GA 4PDSA 3BKBA 2OFVA 1P5EA 3VS0A 3ZC6A 3PXZA 1DI9A 3CGOA 3KY2A 3ZDUA 4QMYA 3ZRLA 4D2RA 2VV9A 5AIRA 2GNHA 4IADA 2ZDUA 2ZV2A 4UY9A 2F7ZE 3HV6A 3COHA 5GZ8A 4AU8A 4YSMA 2WQBA 5EW8A 4CFVA 2FH9A 4I5HA 4S34A 3TKIA 3FHIA 5E8YA 4DGNA 4FKTA 2HZ0A 2C0OA 2VTLA 1XHAA 4QNYA 4QYYA 2WHBA 4C3FA 4IVDA 4HPTE 3FMEA 4PNIA 2VTQA 3E3BX 3LFSA 4YR8A 5CT0A 1FVRA 1P4OA 3OOGA 3R1NA 3NEWA 4IW0A 3MESA 4I5MA 5EI8A 3QKMA 3C5UA 5HBJA 4Y5HA 4B6LA 2JFLA 4M68A 3QQGA 4YC6A 2IZSA 3LM0A 2Z8CA 4JJRA 4MH7A 5L8KA 3R8LA 5FUTA 1XH7A 5E8SA 4AGUA 4GIHA 3GP0A 5CAVA 4EOOA 4LGGA 2EXMA 2FSTX 2ITVA 2A1AB 3Q4TA 3COMA 1XR1A 4IDTA 3HV5A 4R1YA 3F88A 2UZUE 3D2IA 4H1MA 4CV8A 3UOJA 4KSPA 5HD7A 5EI6A 3HMNA 4F9AA 3MS9A 3CLYA 4MKCA 2QOLA 4CMOA 5K9IA 4WNMA 1CTPE 2VTHA 4DTAA 4X2NA 4BZOA 4AS0A 4IE9A 4FKSA 5DIAA 2F9GA 2JKKA 2HZNA 1OL2A 3EMGA 2R0IA 4LGHA 2YIYA 4PX6A 4L00A 3TNPC 3BU5A 4IAIA 3FZOA 4XUFA 3QRJA 5AR5A 2CKQA 1CMKE 3BHHA 3IW6A 5CTPA 1Z5MA 3LIJA 4QPSA 3ZSGA 4RIWA 4JR3A 5HVKA 5J79A 1R1WA 2F7EE 3R00A 4F0GA 4C35A 2C47A 2FSOX 3NW6A 4QPMA 4U80A 1V0BA 4Q9ZA 4ZY4A 3UQFA 3PVBA 3PLAE 4C7TA 1S9IA 1FGKA 3NUUA 4RIXA 1ZYSA 4U0IA 5HG5A 1Q8YA 2B54A 2W5BA 3LPBA 4YJPA 5E7RA 3QC9A 3VBTA 1XH6A 2VAGA 2XJ2A 4M69A 3EIDA 3FI4A 4TKSA 4TYEA 4AW5A 2Y6OA 4NM0A 4NYEA 3LLAA 3KULB 4HZRA 4WG3A 2BKKA 3T8OA 4RLLA 3CKXA 2BR1A 4JXFA 2ITZA 4AAAA 3DNDA 2JDOA 4F4PA 4G3FA 2WQOA 1R78A 5EKNA 4I93A 5BUIA 4F1MA 1F3MC 3NR9A 4RQVA 1NW1A 4R78A 2GNLA 5IH4A 3DS6A 4OBQA 3ZRKA 3R22A 2G9XA 4AE6A 2BIYA 4FV5A 4GV1A 4EZ7A 3QTWA 5CNNA 3UGCA 3TDVA 1WBVA 2O8YA 2QG7A 3ZEWA 2OK1A 4N6ZA 4RWKA 4D5KA 2XM8A 3F2RA 3G90X 5HLNA 3FQSA 5H8BA 3UNJA 2VWZA 2PVLA 2QLUA 2YIXA 4O0XA 5ETCA 4DG0E 2XNBA 4CT2A 1H01A 3L1SA 3DKCA 4FZ6A 4PV0A 1GJOA 4R8QA 5CF8A 4KUJA 2X0GA 4BTMA 1GIIA 4O22A 4KINA 5AMNA 3Q9YA 2YABA 2WMTA 4IX6A 4F0FA 4J52A 4YNOA 4JIKA 4FKUA 2XEZA 2B4SB 3IDPA 3KVWA 2ONLC 2P4IA 3CD8A 3EZRA 2X2MA 4BFMA 1U46A 2WD1A 3PXFA 5HVYA 4DEDA 3KGAA 2ZB1A 4UEUA 4C02A 4E4LA 5M06A 2OJGA 2VO0A 4TT7A 3QTUA 2BUJA 4I24A 2YHVA 1X8BA 4YTIA 3D9VA 4WSYA 3OWLA 3R9HA 5EKOA 5ETFA 1ZMWA 3FQEA 5FTGA 3EQBA 5EM5A 5L8JA 4LGDA 3E7OA 3ZFXA 3WF7A 4KKGA 1Q4LA 4X3FC 5D41A 4BCOA 3IK3A 3LFDA 2AC3A 5L6OA 3ATTA 2I0YA 4GVJA 4K33A 2F4JA 4RIWB 3W1FA 3VUMA 2QVSE 3E8DA 2XJ0A 1NXKA 2W9ZB 3H3CA 5D7AA 2UW7A 5CU4A 5IQIA 3KL8A 3T9IA 3REPA 5HG8A 4RIXB 5L2SA 3OOMA 2J5EA 3CR0A 1R0EA 1H00A 2REIA 3HGKA 5HIDA 2YJSA 3PDTA 3G2FA 4I22A 4M69B 5HCYA 1S9JA 4HCTA 4W9XA 1BKXA 4JQEA 4U40A 4QTDA 3MY0A 4C3RA 2IO6A 3PXQA 2YCRA 4WRSA 5DBXA 3VQUA 3NAYA 3F61A 3PTGA 5I9XA 4OTQA 3IW5A 5KE0A 5LVNA 2C3KA 2O5KA 4LL5A 4QOXA 4BCPA 2IWIA 5F9EA 2BRHA 3DDQA 1UU9A 1KOBA 3QD3A 2J0KA 3WF8A 5CAPA 4FTOA 2GQSA 3VS6A 3E88A 4N57A 4IFCA 4BYJA 2R3GA 3LOKA 3M1SA 4D28A 1YOMA 2E2BA 4DFZE 5CU3A 4HVGA 2CKEA 2JGZA 3OXIA 5TR6A 1OL1A 2R3NA 5CSHA 1Q41A 1M14A 4P5QA 4MYGA 2JITA 3TTJA 4B8LA 2ZM4A 2JKOA 4KA3A 4F08A 3R9RA 4QMVA 5E8UA 4RVLA 4ZLZA 1FVTA 4O82A 3C4XA 4RX9A 3R7YA 3UO6A 4EQUA 4ZMFA 1YI6A 1BUHA 2QODA 4RA4A 5JZNA 1Q62A 3PXRA 2ONLA 3GFWA 1NVQA 3DB8A 5IUIA 3L8SA 2W1IA 3EYGA 4C4GA 4S30A 2E9VA 3C4ZA 3RAIA 3WF6A 2ITXA 5IUHA 2XK4A 1BL7A 4XP2A 3DBQA 3HDNA 5KNJA 5KMJA 4RJ6A 3ZFMA 2YJRA 3QRTA 5DHJA 3HYHA 3GC9A 3Q52A 4YJUA 4BDCA 4R7HA 3SQQA 4EK6A 4OTPA 5DWRA 5JK3A 4PL3A 5DEYA 2BILB 5F4NA 5HIBA 3R21A 2VTTA 3UO5A 2I7QA 3OMVA 2W0JA 4S31A 4MWIA 2RGPA 3WBLA 4X3FA 3FBVA 4CNHA 5EDRA 2X8EA 2G2FA 5AP4A 4FL3A 4EC9A 2OF4A 5JQ5A 3DB6A 3MN3A 4W9WA 3VNTA 4GSBA 3FZPA 1PMEA 4IB0A 5AV3A 4EK8A 4OT6A 5I9VA 1XQZA 4YZCA 3B8RA 3ORZA 1H24A 2ZV7A 1YHWA 3U6JA 2WAJA 3QX4A 3EB0A 3UZRA 5GZ9A 1JKTA 4FSQA 4F9WA 2XKCA 3HV7A 2R2PA 2WXVA 5H3QA 1GIJA 5J5SA 3AD6A 2RFDA 3UMWA 2H8HA 1JSUA 2OXXA 3OTVA 4DEEA 3ROYA 5CANA 3LM5A 3OCSA 4PDOA 3OCGA 4GUEA 4WA9A 2GSFA 1H1PA 5HBHA 3A60A 3RZFA 3JYAA 4O91A 3DBFA 2GQGA 2XNNA 3VS2A 4GKIA 2WMWA 2X7OA 4ACCA 3UQCA 2E9NA 4ZTMA 2ITQA 2C69A 3WE4A 5DR6A 3A2CA 5DT0A 1PXMA 2X9FA 3MH1A 4KAOA 2OLCA 2FUMA 5JGBA 4MAOA 3BCEA 3I4BA 4LRJA 4Q2AA 3BYVA 3IDBA 2GCDA 4Y8DA 3DAJA 1WBWA 4X21A 3CP9A 4FI1A 3QLGA 3W2RA 3NLBA 1ZYCA 3MYGA 3W8QA 4AZFA 3RI1A 3HZTA 3WI6A 3HX4A 3BELA 4ZZMA 5AR2A 2CHLA 3RCDA 1FBNA 5HVJA 2FB8A 3PWDA 1UU8A 2HIWA 2HW7A 3S1HA 3DLZA 4GH2A 1WFCA 2Q0NA 2UW4A 4PPAA 4II5A 5JT2A 1H0WA 3ATSA 3LVPA 1U59A 5AUUA 3IW4A 4QQTA 3CSVA 1Q97A 3LJ2A 5FLFA 5TO8A 2ZOQA 3ZO1A 1G8SA 2NNWB 4D2VA 5K0KA 2H9VA 4U9AA 2CKOA 4C8BA 4BN1A 3FYKX 3PXYA 5KHWA 2QOHA 2EUFB 5E8TA 4ZZNA 3VULA 5A3XA 3R71A 3GC7A 1A9UA 5HE0A 4XV9A 3BU3A 2RKUA 3O7LB 2I0EA 4O0UA 3GEQA 3IKAA 3NNWA 3F3UA 1W84A 4IQ6A 3MVLA 1W0XC 5CX9A 5D1JA 5FM2A 5I9WA 1DAWA 3HP2A 4PQNA 4L01A 4AWIA 2GNIA 5LVPA 4HYIA 5CY3A 5K0XA 3SA0A 3ZM9A 2YZAA 4NJDA 3BEAA 1H27A 5T3QA 4GK3A 4DT9A 3FUPA 5AP2A 3UP2A 5LARA 2VWXA 4XCUA 3R8MA 3EN7A 2I6LA 3CXWA 3CY2A 2OICA 4X3FB 3TXOA 3ZO4A 2FA2A 3E7VA 5CZIA 2RG6A 3UZTA 4G9CA 3BE2A 4FC0A 2XUUA 2W1GA 4GK4A 5A4LA 2XZSA 5AAEA 4HGEA 3DTWA 3F5PA 3C5IA 4FV1A 4OBPA 4C62A 1H1RA 1YWNA 3D5XA 4R1VA 3TV6A 2YM7A 4EJ7A 3MA6A 4ERKA 2QU6A 3RPVA 3KB7A 3QTRA 4BWXA 2WTVA 3OP5A 3Q3BA 2ZAZA 3PSBA 4JR7A 2BTRA 5HEZA 2XYUA 5LCJA 2X2LA 3NVKI 4WHZA 2UZNA 5DR2A 4ZXTA 4MBJA 3PJ3A 4WIHA 5AR4A 4O7YA 2DYLA 1GZNA 5JFSA 1H0VA 4X2KA 3RTPA 3U87A 3LXPA 3ORXA 1Z9XA 5M09A 1P14A 3DPKA 2R3LA 5B0XA 4RX7A 3OHTA 4PTGA 1DM2A 2ESMA 4B9DA 2R3QA 5IZFA 3ZBXA 4IB3A 5EI2A 5FGKA 2Y8OA 3UMXA 4CT1A 3QKKA 2HYYA 3R9DA 4G6OA 3U8WA 4YZDA 4AOJA 3PSDA 4ASZA 4AT4A 3HEGA 4AE9A 3C4WA 3F69A 2HK5A 2IJMA 1JKKA 2NRYA 5EDQA 5CEOA 4W4YA 4DINA 2XIZA 2ZM3A 3DXQA 4M97A 3ZH8A 3D15A 4C4IA 2YM5A 1RJBA 4M15A 5EFQA 4J1RA 4FZAB 4OTGA 5JEBA 5DYJA 3UBDA 4F64A 2JDTA 3UTOA 1BLXA 2UZVA 3E92A 1GOLA 1ZOEA 5J1WA 3NUAA 1FMKA 1TQPA 2QHNA 2IVTA 4YNEA 4RVKA 3FZ1A 2R3KA 2VTSA 4FKGA 5ETIA 4YGAA 3PLSA 3QU0A 3QUPA 2Z02A 5AV2A 4A9TA 4DEBA 5J9ZA 3TUDA 5I4NA 4BWKA 1PXKA 3MH2A 2ETRA 2BZHB 4FTAA 1ATPE 4FV2A 2QC6A 3V3VA 2VO7A 5BX0A 5GINE 5E90A 1GAGA 3I5NA 3GCVA 4YHFA 5M4IA 4KD1A 2QOBA 4FZDB 3H9FA 2G01A 5CU2A 4H39A 3K3IA 4AGCA 3SKCA 3U9CA 4EL9A 4IIRA 4TL0A 3FMJA 2WMUA 1OKZA 1CKPA 4LFIA 2P55A 5M55A 2OBJA 4JAIA 5M56A 2OIDA 1RDQE 3DAEA 4I6FA 4IANA 4MXAA 4F9CA 5DFPA 4ANMA 1Y8GA 1ZMVA 1Q8ZA 4QMPA 3M2WA 4TWCA 5D10A 4G3GA 4WNPA 3QA8A 4LRMA 1OIYA 2QOFA 1CKIA 4MBIA 3ACKA 3R9OA 1O6KA 2CKPA 4FTTA 4Z7HA 3D7TA 3QC4A 4G31A 4F6SA 4EOLA 3WIKA 3KK8A 4U81A 4ZY6A 3HVCA 4MD7E 4J8NA 4M14A 4XV3A 4EYJA 3NPCA 3W32A 3D5UA 3IPHA 3ZMMA 3PSCA 3RM7A 1JNKA 3RPRA 2R3RA 3CY3A 2VNWA 2XK8A 5DT3A 3RK9A 1O9UA 4QPAA 3EYHA 1JQHA 2ZJWA 3I1AA 5J7HA 4MXZA 2CN5A 3FLYA 3BU6A 3GGFA 3W2QA 5IDPA 4E4XA 3PVGA 2PE2A 2EB3A 3QQJA 1H1SA 4L7FA 4HNFA 3SOAA 4BRXA 4UALA 4D0XA 4F9YA 3CPCA 4FE2A 5A4CA 4F6WA 2C5XA 4GCJA 4QT1A 4ALWA 2GFCA 4J98A 4HYUA 4LOOA 4IACA 3QF9A 3RCJA 3TZ8A 4E1ZA 2VU3A 3RWPA 2XEYA 1NY3A 3SXRA 4O86A 4O81A 4F6UA 4NKSA 2XF0A 2W17A 4QMNA 5KCVA 3V5JA 5M51A 2HXQA 2XYNA 2Z7LA 4O84A 2C0IA 4QMZA 4YTFA 4XLVA 3PIXA 2BIKB 3PJCA 4MXYA 3TKUA 2CLXA 2VWWA 4RIOA 5AJQA 1YOLA 4O2ZA 2V5QA 1XH5A 3VHKA 3OWKA 4I20A 5TOZA 1Q24A 5JSMA 5IEYA 1F5QA 1JBPE 3O8TA 4PUZA 3SD0A 5CVHA 2VD5A 5M08A 4IH8A 2QR7A 3GC0A 2HENA 3VHEA 1KSWA 2G15A 3ALNA 4IWDA 4CV9A 4HNIA 3ET7A 3HRCA 3KRLA 3PPKA 4H1JA 3AC3A 3UOLA 4W4VA 5AM7A 1ZARA 2XM9A 3DK6A 4A9SA 3II5A 4DHFA 2VTJA 4RWIA 4WUAA 4EOSA 2X7FA 4GUBA 3RAKA 5DGZA 5DN3A 5IISA 3T3VA 3HECA 5KKRC 1ZZ2A 3K2LA 2W96B 4I4EA 2C30A 2WTIA 4JX3A 1DAYA 4LYNA 3V5LA 4FTCA 4EZ5A 4HVHA 3PIYA 4PF4A 4AN3A 4QP9A 3OBJA 4CLIA 4EQMA 4E6CA 2IVVA 4JG6A 2J4ZA 4F7JA 4YC3A 5AUVA 4FA2A 2RFSA 4S32A 4BIBA 2PWLA 3QL8A 3TTIA 5HBEA 4DFXE 4QP6A 3EFLA 3OWPA 3V6SA 3HDMA 4DTKA 4EHZA 3D7TB 1G8AA 3MGYA 4V0GA 1VEBA 3ZFYA 2B52A 2VWUA 4BDHA 2XJ1A 4W8EA 4UXLA 3TV7A 1MRVA 3OUKA 2OW3A 3QQKA 5LWMA 1UVRA 3C50A 4CFWA 5M07A 5EQYA 4A7CA 4HGTA 4NFMA 3BZ3A 2OO8X 5DI1A 3ACJA 5FRIA 1OIQA 4RVMA 4YJTA 3WF9A 4EOMA 3KC3A 5HTCA 4AZTA 4FTLA 2PPQA 1R0PA 3WARA 3H9OA 2ACXA 3KXNA 3TUCA 4BIDA 2PY3A 1MUOA 4APCA 2C68A 5GJFA 3EQCA 3P7AA 3KEXA 4R7IA 3KXHA 5J8IA 2A27A 4C61A 3QTXA 4FV6A 2IVSA 1OKVA 5AUTA 3K5VA 3ETAA 3R63A 4P90A 4WBOA 1RQQA 5DR9A 4BDAA 4BDJA 4BY9E 4AN2A 4FF8A 3IGOA 1NA7A 3O8PA 4WBBB 4OAUC 3NW5A 4HJOA 3KXGA 2CGUA 2B9IA 3NSZA 2ITTA 3ZS5A 4F1OA 3FI2A 3EQGA 1VJYA 2R3OA 2VGPA 3GFEA 4O83A 4B4LA 3VN9A 2I0HA 3FL5A 3FLSA 3Q60A 5EK7A 5I9UA 3CE3A 4I5CA 4L52A 2VZ6A 5BYLA 4IFGA 1APME 1CKJA 2HCKA 3ZLSA 2CJMA 1J1BA 1YXTA 4G3CA 1OIUA 4UN0C 1U5RA 4FSRA 4QQJA 3SAYA 3V04A 2BZKB 5IU2A 4CG9A 1ZY4A 3F3TA 4GS6A 2R7IA 5HE1A 5KMLA 5I3RA 4CKJA 2O2UA 1JKLA 2YERA 4UMRA 5CSXA 4FVPA 3WF5A 1YDRE 3COKA 2PL0A 4QNAA 3DXNA 2P33A 1Q3WA 3EWHA 3MTFA 4IWOA 3WZUA 2UW8A 1E9HA 4NJ3A 3V51A 2W9FB 4FNYA 4MVFA 4DH5A 4UMUA 2ITYA 3PFQA 4HGSA 4RLKA 4EJNA 2UW5A 1T45A 3CKWA 5I0BA 4IVCA 4B99A 4D2WA 1KUTA 2W1HA 3B2TA 1L3RE 1B39A 3BBTB 4IC7A 2BFYA 2ZVAA 4IJPA 4XV2A 4E6QA 4RWLA 4IB5A 3V8WA 4YPDA 3R83A 2BPMA 3TJDA 2PTKA 3P78A 1YHVA 4MTAA 4C57A 3ANRA 2WO6A 4ACGA 5A6OA 1K3AA 4RC4A 4QTAA 3RPOA 3WYXA 3TM0A 4JAJA 4QP4A 4QP8A 3NUNA 3RK5A 3RPSA 4RJ8A 3S3IA 2W5HA 3U6IA 4E6DA 4V0GB 1YI4A 4PMPA 3F2AA 4RPVA 4HPUE 4BHZA 3Q4UA 1YWVA 1PXIA 1YOJA 4I6BA 2PZIA 3VUGA 5KBQA 2R0UA 1PXNA 1Y8YA 4MHAA 4XX9A 2WIHA 3NDMA 1OIRA 4KIOA 4EH2A 4FL1A 2IPXA 3HMMA 3VBWA 3C13A 2JEDA 1H28A 4FEQA 4TNBA 5C4LA 2XIRA 5JRSA 4ZS4A 1JPAA 3SC1A 3IG7A 4PP9A 4USEA 5EYDA 1KV2A 4YZMA 4PRJA 4YSJA 4RZVA 5FTOA 1VYWA 1H26A 5FP6A 5FXSA 3ZC5A 4AGDA 5AIKA 1H8FA 4CFXA 4GYGA 1KE9A 3A61A 4PL5A 1YXUA 4IJ9A 3P1AA 1SVHA 3DFAA 4QMUA 3QX2A 2QR8A 2YM3A 4FIJA 5EM8A 4JBQA 3CQWA 3VS5A 5HZNA 2W7XA 4K0YA 3UOHA 5CASA 5CALA 4J97A 2CSNA 4R5YA 3GI3A 3FV8A 3RNIA 3NYVA 4EUUA 5HX6A 2P2HA 2YDKA 2FSMX 3OEZA 3O23A 3ZO3A 1ZZLA 4FKRA 4J96A 5FXRA 4Y83A 3NUYA 1XH8A 3RINA 1DS5A 4D1SA 5I9YA 3UPXA 2GHGA 3Q9XA 5CXZA 3BYOA 3DXPA 3FMHA 2E9UA 1FPUA 1M2QA 3PG1A 4U97A 4CVAA 2PVKA 4FKWA 2UW0A 3MTLA 4ITJA 3VF8A 2GQRA 3R8UA 2WEIA 3BLRA 4X6RA 4YLLA 3A4OX 2Y9QA 4D2PA 3TCPA 3EJ1A 4EH4A 4YHJA 4ID7A 3MWUA 4PDPA 3P5KA 5HG7A 4KKEA 2J0JA 5AR7A 1QPCA 1PHKA 1JVPP 4ANSA 4EONA 3PP0A 3D94A 3ORPA 2O0UA 3KRWA 2WQMA 4MWHA 4RFMA 4Z7GA 4G3DA 5IMEA 5KKRB 2WZJA 3PXKA 4QP1A 2CCHA 3U6HA 4I21A 3UP7A 5LVLA 4J8MA 4ACHA 3EKKA 3VUKA 3S0OA 4O7NA 3G6GA 3KVXA 4ZY5A 1NVRA 2ERZE 2EB2A 2YM4A 3A4PA 4ENXA 2UVYA 1FMOE 3QBNA 3CS9A 4IWPA 4L3JA 1IA8A 3HL7A 2PZRA 3P9JA 4G1WA 3TWJA 4ZTRA 4EORA 2X39A 2OKRA 4W8DA 2HXLA 1YRPA 3BBWA 3CTQA 3C0GA 3WE8A 4DGOA 3Q04A 3CC6A 4ZTNA 5CAUA 2CPKE 3KK9A 4UXQA 3KREA 4DC2A 3E5AA 4S33A 3QD4A 4NCTC 3WILA 4AOIA 3QKLA 2Y4IC 5JMSA 4X2JA 3U51A 1Q5KA 4JS8A 3VAPA 2OH0E 3KRJA 4CZTA 2ITNA 2KULA 2HZIA 2VWIA 5JKGA 1LUFA 1URWA 4RJ3A 2IW8A 5M53A 3ZZWA 3JXWA 4QMQA 2O64A 1UNHA 5HNIX 4RSSA 2NPQA 4YJSA 5LMBA 4ONAA 5HE3A 5CF6A 1RE8A 3AC5A 3LKMA 2UZTA 5ANDA 3AQVA 4QMSA 3JS2A 5KX8A 3RHKA 4E73A 2FO0A 2JBOA 3NYXA 4AX8A 4L3PA 4L43A 3VJNA 5A9UA 5BVEA 3EZVA 3A7IA 2WQEA 3P79A 4FICA 3VUDA 3HAVA 2OG8A 2IN6A 2X8DA 3PA5A 4JBVA 5TF9A 3HP5A 3MIAA 2Y7JA 5FG8A 3G9NA 4EQCA 4BKYA 2J0MB 4CFMA 2C3IB 2LGCA 2VX1A 4QO9A 2QO7A 4YZNA 4CTCA 3U4WA 4G34A 4QMXA 2IZUA 3RP9A 5CSWA 3C0HA 5AP0A 4A9UA 4BCHA 3UODA 3V01A 4CKRA 2OIQA 4QYGA 4O0TA 2C6DA 3MPMA 4F99A 3AMYA 4D1XA 5AEPA 1YW2A 5J9YA 4GK2A 1QCFA 4DG2E 3ORIA 4FEXA 4MF1A 3SOCA 2C6EA 4BGGA 4FEWA 4NSTA 4U3YA 4ZOGA 5DRBA 3TUBA 3ZBFA 1KE8A 5LVOA 2GNFA 4IX3A 4OBOA 4ZJVA 4XJ0A 2YIQA 2R7BA 5CU6A 4DEHA 2UZEA 3G0EA 2EXCX 3L9PA 2XBAA 3OROA 3R7UA 4E26A 4L42A 4YBJA 1UNGA 1WBTA 3DGKA 2XK9A 4JX7A 5K5NA 2YFXA 4ZMEA 3T3UA 4DA5A 2JLDA 4JIAA 4PL4A 4NUSA 4LM5A 3VUTA 1AD5A 4HYHA 1HCLA 4O7SA 5A6NA 5BVDA 2XRWA 2P3GX 1UWJA 4BI1A 4JG8A 4QMTA 3MH3A 1FQ1B 4FSYA 4ZLOA 3GC8A 4DGLC 5AUZA 3PJ8A 2UZDA 3OW3A 4FT3A 4WUNA 2XKEA 4O7WA 4E7WA 4D4VA 4O21A 1KV1A 4FODA 3UOKA 3V5TA 3NYOA 3UE4A 3JY0A 2GU8A 3L9LA 3QQHA 3TI1A 4A9RA 3KCFA 4GU6A 3D5VA 4RBLA 3NUPA 4TYJA 1J7IA 5DG5A 3G51A 3EL8A 4BB4A 3NMUF 4NCTA 4BC6A 3G5DA 3DFCB 3NYNA 4XH6A 4G5PA 3DY7A 1PRYA 3LFBA 3R30A 4P5ZA 2QD9A 5CAOA 1J7UA 4KWPA 3BYMA 3KCKA 4CG8A 2PVMA 1KOAA 4UZHA 3FEGA 3MJ2A 4FNZA 3H9RA 5DLSA 4Y95A 3NS9A 5DPVA 4XG4A 4LMNA 5TE0A 2V55A 5BYZA 4F7SA 2JC6A 1SMHA 3F6XA 3ZUTA 5E9EA 3UIUA 5IH6A 4AT5A 2O65A 2XNMA 3C4EA 3TEIA 3BHTA 4BIEA 1AQ1A 3I6WA 2W4KA 1W7HA 4FUXA 4K77A 4YJNA 4RX8A 1UWHA 1RW8A 4FZ7A 2V62A 4C2VA 5JFVA 2E9OA 1VR2A 3BRBA 3TNWA 3ORKA 2A19B 4PMMA 3BWFA 4DH7A 4BZNA 4XHKB 2UW3A 3W18A 4BI2A 1Y91A 5AFVA 1HOWA 2OSCA 3UC4A 3Q9WA 3D2KA 5ITAA 2WIPA 5BVOA 2IVUA 3C0IA 3I60A 4M12A 5FXQA 3KFAA 4C59A 3N51A 1PXPA 3DAKA 3LQ5A 2VTOA 4GMYA 4IAAA 4YMJA 3I0QA 5FEEA 4BTKA 3ZTXA 3GB2A 5FM3A 4CCUA 5HESA 4FK3A 4CSVA 4D4SA 2R3FA 1NT2A 3GU6A 4Z9LA 4QQCA 2B9HA 3ENMA 3FZSA 4MNEA 4D9UA 5HNBA 4O38A 5HLWA 3BV3A 3G0FA 4XEYA 4XRLA 5JFWA 2R3PA 4WD5A 1OPKA 4QP7A 5HNGA 3DOGA 4BF2A 4EI4A 5GJDA 5CEPA 3OD6X 3FMNA 4FV4A 4RJ4A 4RX5A 3W8LA 4LQMA 2PUNA 3BI6A 4IAKA 5EW3A 2OJIA 1WBPA 3PP1A 4GYIA 3F9NA 3GENA 3KKVA 3NRMA 2J9MA 3LXNA 4JG7A 4JOAA 3IONA 4AFEA 4X6QC 2A0CX 3R2BA 2JDSA 5DT4A 3FY0A 3F7WA 3H0YA 5G6VA 2PUUA 5IQHA 5AV1A 4O6EA 3R04A 3O51A 5HTBA 1Q8WA 2JIUA 3O7LD 3DV3A 5IQCA 2QU5A 3AMBA 5GIPE 3BLQA 4O7TA 4IDVA 5CLPA 5BVKA 3UPZA 2CGWA 3GOPA 4AN9A 3ZU7A 2DUVA 2XNEA 3KU2A 1YKRA 3N4VA 1FVVA 5H2UA 3LFFA 5EM6A 3FC1X 3DU8A 5JFXA 5CQWA 3PJ2A 4FMQA 4H36A 2IW9A 2QKRA 2Y4IB 3ZSHA 4E93A 1SNXA 3W2CA 5IQEA 3ERKA 5IF1A 3BQCA 4FG8A 3COIA 1UKIA 4X3JA 3SX9A 4M67A 3TN8A 3BX5A 4CFUA 3MI9A 2F49A 4EOQA 3BE9A 3P0MA 3Q2JA 3NX8A 3DZOA 2HOGA 3VJOA 1ERKA 2HY81 3MVHA 3FQHA 5EYMA 1M17A 3ULZA 3AOXA 3ZXTA 3LLTA 5L2QA 4MCVA 1IASA 2VTRA 4R3CA 3TNHA 3W2SA 2ZMDA 4ZTHA 4E5BA 4FT7A 3MSSA 5IA0A 4UWYA 2ITOA 4J71A 4X0MA 5C8KA 4YTCA 2ETMA 4EOJA 3GU8A 4ZS0A 4YPSA 2QOOA 4X7QA 4ZSGA 3RBWA 4BI0A 3QXOA 4ZP5A 4Q9SA 1H08A 2R3HA 4DCAA 5GIOE 5LXMA 3DZQA 4AFJA 3R02A 2XIKA 2GTMA 5K4IA 2PMOX 3ZHPC 3GQIA 1P2AA 4LI5A 3R1YA 1YDSE 3GQLA 4PWNA 1J7LA 4BR3A 1GNGA 4D1ZA 4I92A 1Q8TA 1QPJA 2EVAA 4MNEB 3WIGA 2PMLX 3SVVA 3Q5IA 4TPTA 3D14A 5F1ZA 2ZM1A 2PULA 4XYFA 3A99A 3UQGA 5EH0A 2B9FA 5C9CA 2GHLA 5FP5A 3ZUVA 3LMHA 4C2WA 1CM8A 3A7HA 5BNJA 3JUHA 1H1QA 1QPEA 4NFNA 5AP5A 2BZIB 3MPAA 2PVFA 5FBNC 2VRXA 3EL7A 4BL1A 4DFBA 4J95A 3SG8A 2UVXA 5M4CA 2UW6A 3E8NA 1GZOA 4UYNA 4Z16A 3P23A 5I3OA 4FKIA 4XG3A 4FVQA 3OZ6A 3HMIA 3AD4A 2VTMA 2JBPA 3V8SA 4FNXA 4NZWB 4FZFB 1OBDA 1ZYJA 4FYNA 5I5ZA 4U42A 5HG9A 2UZWE 3L8XA 4AUAA 5KMNA 4GG7A 2H6DA 2OU7A 4IZ7A 4BBFA 2UVZA 3QZIA 2J90A 3MY1A 4TXCA 3W16A 3BQRA 4GL9A 3BPRA 3N4TA 2CN8A 4C0TA 2ZV9A 4IAFA 3Q53A 2WQNA 4OTDA 5ANGA 4BTFA 4EWQA 4QMOA 1XWSA 2PMIA 3CTHA 4TRLA 4DGMA 3HA8A 3LW0A 4FIIA 4DN5A 2YWVA 3FI8A 5E1EA 5A4TA 5ETAA 2BZJA 3M11A 4RRVA 2W5AA 4R5SA 4NW6A 3FMKA 2VWVA 5HGIA 4RG0A 4LUDA 5HU9A 3FYJX 4Z3VA 2WFYA 4NTSA 3FAAA 3BLHA 1Q8UA 4FX3A 4ANQA 4DLJA 1WAKA 1W82A 2XIXA 5C03A 2Z7RA 3V8TA 4FGRA 4H3PA 4DBXA 4IEBA 3R28A 4CXAA 2Q83A 2WMVA 2B9JA 4GKHA 2XK7A 3EH9A 2SRCA 2W4JA 3OT8A 5J1VA 3CIKA 3GNIB 3LXLA 4W4WA 4BDEA 1UNLA 1SM2A 1MRUA 4CFNA 3NNUA 4HVSA 1ZYDA 1H25A 5ANEA 3VVHA 4XG2A 2CMWA 3DKGA 4MQ1A 3BGQA 4EH6A 4EOPA 4YLJA 4G16A 4FSMA 5A4EA 2QI8A 4X2FA 3P7BA 4AG8A 3LZBA 2EU9A 3QWJA 3QXPA 3GBZA 3VBVA 3EQFA 1M7QA 2W1FA 3E63A 4U7ZA 4P4CA 2GPHA 4USFA 4BVUA 2Z7QA 3GCUA 1UV5A 1MQBA 3ALOA 3JVSA 5BVWA 4IZAA 1LEZA 5KMIA 4FEVA 2DWBA 4O2PA 4BHNA 3A7JA 4MF0A 3FZRA 1O6YA 3C4FA 2W1EA 5D11A 5AR8A 4F0IA 4MXOA 5DMZA 2J51A 3DKOA 4E8AA 4QP2A 3TACA 4QTEA 5E8WA 5LQFA 4CYIA 2WOTA 4DYMA 3O50A 2BAJA 3OW4A 4BICA 3WZEA 3MH0A 1OITA 2PMNX 3OXTA 1XKKA 5CI6A 4ZTLA 3TZ9A 4WG5A 4ASXA 1WBNA 2KTYA 1Z57A 4JVGA 3DBCA 3SV0A 2QOKA 4IVAA 3QCXA 2BFXA 2J7TA 4BCNA 4GJ3A 3AT2A 4U45A 4CQEA 2HZ4A 5B2LA 2HAKA 3U54A 5BMSA 4OT5A 2VO3A 3GCQA 2VUWA 4D4YA 2OXDA 4BDDA 4RC2A 4N6YA 1T46A 3C1XA 4I6HA 1VZOA 5EHOA 5HOAA 4FTKA 4G9RA 5DH3A 2C6TA 1XH9A 3FMLA 2QLQA 4EOKA 5HQ0A 1WBSA 1M2RA 4FG9A 5EYKA 3THBA 3FZTA 3DQWA 2OJ9A 4NH1A 4YHTA 4BKJA 3IDCA 4MXXA 2PVJA 3CTJA 3DK7A 4DT8A 3CCNA 1PXJA 1GZKA 3DBDA 4DBNA 4E5WA 2X4FA 2PU8A 3M42A 2J50A 2VN9A 3PJ1A 4I6QA 3QCYA 4C34A 3QTQA 5CT7A 5EYCA 4NT4A 4YC8A 2PZPA 2RG5A 2V22A 4F63A 3OUNB 4YBKA 5B2KA 5IMXA 5KMKA 3TNQB 1PJKA 4JRVA 1MRYA 3DNEA 5KZ0A 2PE0A 4AP7A 3A62A 1JSVA 2LAVA 3TNIA 5DRDA 4FGBA 4MXCA 2R3IA 3V5PA 3OEFX 4FKLA 2C1AA 4RT7A 5EQEA 3KQ7A 4F65A 3FKNA 3Q6UA 3ZZEA 4BWPA 2R3JA 3L9MA 3W10A 2QONA 4IMYA 3O8UA 2VNYA 1WVWA 4EEVA 5BVFA 1R39A 3SGCA 4ZLYA 5HORA 3LFQA 4TY1A 3SW7A 4CZYB 1SVEA 2NP8A 3F3VA 4KS8A 1URCA 2C6LA 2QKWB 3G33A 3LFNA 4E4NA 2OZAA 1ZXEA 4YJVA 5EQPA 5IQFA 3NAXA 1XBCA 2Y4PA 3CQEA 1CSNA 3Q4CA 4M7IA 4AOTA 3QALE 4QTBA 4FSTA 3CJGA 3VS3A 4U5JA 5J7BA 4KRCA 1KWPA 3QUEA 3JR1A 1PXLA 1PYXA 3O71A 1MP8A 5JGDA 2F7XE 5M4FA 3NWWA 4BGQA 4BCFA 5FQDC 2IG7A 2UUEA 4GT4A 3AGMA 3HKOA 4NK9A 4C3PA 5IPJA 5AP7A 3DBEA 2ZYBA 4H05A 3VRZA 4ZSLA 5B7VA 3QFVA 4L46A 4FIFA 5FDXA 4BZDA 3QZFA 3P7CA 4KNBA 1YXVA 4D9TA 2HWOA 4OLIA 3PG3A 3BGZA 4RJ7A 3HRBA 5E8XA 4QMWA 3VUIA 4AW2A 3ITZA 5ACKA 2RF9A 3E64A 5IKWA 3I7BA 5H9BA 4B0GA 2AC5A 2XCKA 3RMFA 3LMIA 4LOQA 3QRKA 4HCVA 3VRYA 2WTKC 3VQHA 4KB8A 3MFUA 3Q96A 3KN5A 4FKPA 5KZIA 2UV2A 3IO7A 4CD0A 4YURA 4K8AA 4CFFA 3FLZA 4ZAUA 4E4MA 3PY1A 4ZSAA 1B6CB 1SNUA 5IEVA 2HELA 3FDNA 4FYOA 4L44A 3OG7A 2R3MA 1ZYLA 3KMMA 5LWNA 4HVIA 1J3HA 4FKOA 5BUJA 3I5ZA 4ITIA 4G6LA 3BEGA 3GCPA 1UU7A 3SW4A 3FKLA 4EK3A 3C51A 4BCIA 2QQ7A 4EBVA 3UNKA 4AQCA 2XK6A 2C5VA 5A46A 3QQUA 4FUYA 4R3RA 4D0WA 3EOCA 2YEXA 3WOWA 3R8VA 2YDJA 3PRFA 4PPCA 4JDKA 3TZ7A 1OL5A 2QOQA 5FD2A 3MBLA 5CI7A 1WVYA 4EKKA 3GXLA 4FVRA 4XG9A 2QOCA 2W06A 4BDIA 4CZUA 3S00A 3MVMA 3CGFA 3UO4A 4HVDA 2YCSA 3MA3A 3ANQA 4ARKA 4DLIA 1OUKA 4EHGA 2YN8A 2QOIA 2X9EA 3KXZA 4A07A 4ENYA 3JY9A 5AV0A 2YISA 3MW1A 3RAHA 3LQ3A 3OY3A 1PMVA 5LJJA 4XBUA 1ZAOA 3Q2MA 4O6LA 3UVRA 5L6PA 2H34A 3ZOSA 5M57A 2XVDA 4UZDA 4ASDA 4CMUA 1TQMA 4D2SA 4G5JA 5E4HA 2YM8A 3OCBA 3PVWA 1YQJA 2JD5A 2WPAA 4LRKA 4QYEA 5CVFA 3R8PA 2OZAB 4C38A 4NU1A 5EDPA 3W2PA 2VTNA 4IZYA 1YHSA 4YO4A 2ETKA 5HI2A 3F82A 4GU9A 2FSLX
chains in the Genus database with same CATH superfamily
1JLUE 1HCKA 4JI9A 4N0SA 5GNKA 3T9TA 1ZWSA 1YDTE 5BPYA 5E1SA 3B8QA 2CNVA 1SZMA 3MFTA 3LCTA 4UMTA 3RVGA 1PMNA 3V5WA 4FKQA 3W55A 4ANOA 4EH5A 4O7VA 2WU6A 4C4JA 3ORTA 4GT3A 2XIYA 2WB8A 5ANIA 4XLIA 2VX0A 4FJVA 4TZRA 5HX8A 3TJCA 1XBAA 4XRJA 4HW7A 5IA2A 4UX9A 4NW5A 5HCZA 4IM0A 3WZKA 2O63A 4O0WA 3I6UA 3DJ5A 3MB6A 3NZ0A 4LV8A 5C27A 3VW8A 3MPTA 3QD0A 4M0YA 5AUYA 3R73A 4XBRA 3VS4A 3NUSA 4EWHA 4BCJA 2V7AA 4G2FA 3FLQA 5EOBA 2YDIA 4FTNA 2EWAA 4I3ZA 2IZRA 4PMTA 4BTJA 3RALA 4EHEA 4OAVB 4O0SA 2IF8A 5HO8A 4RIYA 5IQGA 1Q3DA 3EFWA 3LE6A 4XNEA 2C5NA 3FPMA 3BV2A 3HUCA 3SLSA 2QURA 4KS7A 3OBGA 4FG7A 4JRNA 4TNDA 4U8ZA 3RGFA 3BGPA 3VS1A 2X7GA 4FR4A 4ZTQA 2CCIA 2EXEA 2BCJA 3FMDA 3A7GA 3R1SA 4KIQA 5AP1A 4Y72A 1G8KA 3NGAA 1FOTA 3NUXA 4EYMA 2DQ7X 4Z55A 3ROCA 1ZLTA 4OTIA 4U79A 4R3PA 5CVGA 3UDBA 3VIDA 1OB3A 2JAVA 3HUBA 2CGVA 4GVAA 5ANOA 5CAQA 4DHZA 4OGRA 4B8MA 1PKDA 4C36A 5CYIA 4UV0A 5L3AA 4LG4A 3ZDIA 4M66A 1TKIA 5DNRA 4A4XA 4Y85A 1XBBA 5BVNA 4PDYA 1UKHA 4BDBA 1AGWA 4TWPA 1OL7A 5JN2A 1TVOA 3A8XA 3QYWA 4BCMA 5L4QA 3EQHA 1DI8A 4V01A 4XG8A 3ZM4A 3IW7A 4AA0A 1XO2B 1UU3A 4O7ZA 2WGJA 3QGWA 4OW8A 4R77A 3NNXA 2X1NA 1Q99A 1H1WA 5ACBC 5T6KA 3DQXA 3FJQE 5G1XA 1JWHA 3FLNC 4MBLA 5CF4A 2CNQA 1M7NA 2YM6A 3O17A 3C4CA 3G9LX 2VWYA 3NCZA 2VTPA 1BMKA 2C5OA 4C4FA 2C6IA 4DH8A 4FOCA 3ML1A 3ODZX 4Q5HA 3POOA 4M8TA 2BRMA 4Q5EA 4RFYA 2XNOA 3B2WA 1IRKA 5KMMA 5D9HA 1I44A 4AZWA 4FSWA 4WOVA 5AA9A 3QHWA 2G2HA 4A4OA 3PYYA 1SVGA 4ZK5A 3QA0A 5LCKA 3RWQA 2WMRA 3MFSA 5I9ZA 3O2MA 5CWZA 4UMPA 3NW7A 3Q32A 2JKQA 5DEWA 3IW8A 4O1PA 3RPYA 2QG5A 2WMSA 5AA8A 3BYSA 3LJ1A 4BDKA 3GU4A 4ACDA 3W0QA 4H3BA 2PVRA 2Y0AA 4GFOA 5LVMA 4L68A 2OIBA 4NM5A 3E87A 3F5XA 3HRFA 5C1QB 5AX3A 5IDNA 1VYZA 3QYZA 4KSQA 4TTHB 3BWJA 5L2IA 2PZ5A 2WTCA 5GJGA 2XP2A 4GG5A 3RKBA 1OM1A 2WTKB 4APPA 3VC4A 2BDWA 5DE2A 5CEIA 3R7VA 3IS5A 2BRNA 4WRGA 1A06A 4RIYB 3UJGA 5F20A 4BJJA 3LXKA 5GZAA 1U54A 4F09A 2WKMA 3FSFA 2GS6A 3MFRA 1F0QA 4BCKA 2YLEA 2QO2A 3D0EA 3MDYA 5B2MA 4NL0A 2OH4A 3O96A 4B7TA 3MY5A 3PRIA 2R9SA 3PZHA 3TT0A 3SXFA 2F2UA 2YCQA 2GMXA 4V05A 5HKMA 3FMMA 1PMUA 2F57A 1JOWB 4YU2A 4IBMA 3NFGB 4O7LA 3SHEA 3UNZA 4K6ZA 2OJJA 5CENA 1G5SA 4FTQA 2V0DA 4XS2A 3WYYA 5C26A 3PA4A 3IOPA 3QD2B 3AC4A 5IEXA 5J9LA 3EHAA 5HCXA 3P5JC 3F66A 3EN9A 2YAAA 3EQIA 4JDHA 3PY0A 3LQ8A 2XRUA 5AWMA 1B38A 5CEQA 2OGVA 4NM3A 2C0TA 4GJ2A 5AAFA 3OY1A 4XG7A 3GVUA 2B53A 3UYSA 2W1DA 5GHVA 2XNPA 4WNOA 5DA3A 4MK0A 2W1CA 4GW8A 1QPDA 3BYUA 1H07A 1SYKA 4HOKA 2JIIA 2R5TA 3O0GA 4FSUA 4UWCA 4N70A 3R7GA 4IB1A 5J95A 5L8LA 2RIOA 5LMKC 4WKQA 2WMXA 5IH5A 4PTEA 4DDGA 3LFEA 3QTIA 3ZUUA 2B0QA 4BYIA 4F78A 2JIVA 2Z7SA 2CGXA 3QQFA 3DKFA 2Z60A 3NIEA 2PVNA 4NIFA 2UZLA 5IUGA 1ST4A 4MD9E 4K9YA 4UYAA 3W2OA 4D55A 4F9BA 5F95A 4IAYA 1REJA 1OL6A 3GUBA 3ZRMA 3NCGA 3V6RA 3F2NA 2ITWA 3IOKA 4AT3A 4NWMA 4L45A 2WMQA 5C8MA 1OVEA 4TYIA 1V0PA 4IHPA 4RFZA 3UZPA 4Y5QA 5L6WL 2XBJA 2XMYA 4AZEA 4EH9A 3VBQA 3FPQA 4BKZA 2YZLA 5E92A 2WMAA 3K3JA 2XH5A 1PF8A 4C33A 5BQ0A 4RMZA 4IX4A 5LOHA 3HA6A 2P0CA 3JVRA 1QMZA 3KMUA 3Q6WA 4O4FA 5AV4A 2OFUA 1WZYA 4Y46A 2YACA 3PUFC 3POZA 2GHMA 2YITA 5D7VA 3ZEPA 4E20A 2BRGA 5E8ZA 4EKLA 2QNJA 3CD3A 4GEOA 2BAKA 4JT3A 4IWQA 4KRDA 4M3QA 2WEVA 4TW9A 4H3QA 1KE7A 3RZBA 2VGOA 4F1TA 4QYFA 2BHEA 2OZOA 4WG4A 4DITA 4BJJB 1U54B 1LP4A 4LL0A 3AKLA 2NYAA 3TIZA 2B1PA 3AG9A 1XH4A 1OECA 2GS7A 4FIGA 5L2TA 4RGJA 2XB7A 4UBAA 4WNKA 4FT0A 4U43A 2F2CB 4AXAA 4BCGA 1IG1A 5CQUA 5EOLA 4YJOA 1GIHA 4RJ5A 5EW9A 4TYHA 4IM2A 3W33A 3SDJA 3UDSA 3UVPA 4YZ9A 2RFNA 3P86A 2CNUA 3FY2A 4HCUA 3SXSA 4JQ7A 3IGGA 1REKA 2B7AA 3E62A 3KN6A 1PY5A 5AP6A 2W05A 4ZJJA 4I41A 4EOIA 3Q9ZA 4CYJA 3QWKA 1ZY5A 3OT3A 4NM7A 3K54A 3TL8A 4ANLA 1OPJA 3UIXA 4QD6A 4CEGA 4DHIB 2ERKA 1IA9A 5J5TA 3RJCA 2PYWA 4QRCA 4QTCA 3R2YA 4CCBA 4XMOA 5ANJA 4DGGA 4A4LA 4YLKA 1BI7A 4I4FA 3QRIA 2J0IA 5KO1A 1GY3A 3DT1A 3ORNA 5LMKA 5M44A 2DS1A 3JPVA 4V04A 4XOYA 1Q61A 2WTJA 4EK4A 3KF4A 4KKHA 4RA5A 4BGHA 3ID6C 4J53A 2J2IB 3DTCA 1H4LA 3QZGA 2R64A 4LV5A 1OGYA 4NIFB 1WVXA 3PIZA 4K11A 2X8IA 3CPBA 4BBEA 3RHXA 4FV9A 3QAME 4QMMA 4YJRA 5EHYA 4FT9A 4ZZOA 1PYEA 5HLPA 1LEWA 4RZWA 3P08A 2C4GA 4WO5A 3EN4A 4GIIA 4P7EA 1YVJA 2RSVA 1MQ4A 2G2IA 3R1QA 5HIEA 1Y57A 3I79A 3MJ1A 4WT6A 4AQKA 2GTNA 1OKWA 5CS6A 3RK7A 4USDA 3FE3A 3MV5A 3I7CA 4IM3A 5E91A 3AT3A 3KRXA 1E1XA 5BYYA 2V7OA 2C6KA 4RVTA 3QZHA 4YJQA 2AUHA 4PPBA 1XJDA 4EZ3A 4FTUA 4FT5A 5K4JA 2C6OA 3NIZA 2IW6A 4PP7A 4FV3A 4PMSA 2YWPA 2XNGA 4L3LA 4CRLA 1IR3A 3OFMA 3EQPA 3E3PA 3MB7A 4O0VA 3PPZA 5HTIA 3DJ6A 4K1BA 5AX9A 1J1CA 3E8CA 3L9NA 1OKYA 4LUEA 4CTBA 3WZJA 3E8EA 2JKMA 3KXXA 4FV0A 5AM6A 2WNTA 4IX5A 3R7IA 5IQAA 3CBLA 2XCHA 4MQ2A 3TIYA 4ANNA 2A4LA 4EK5A 4DE4A 2PUPA 2XANA 3ZLYA 1P4FA 2GDOA 2WELA 3UVQA 3R0TA 3MIYA 5IG1A 3N4UA 4ALUA 3RAWA 3AC2A 2JAMA 1YXSA 3OC1A 2J6MA 4H58A 2XS0A 4AGWA 3R9NA 2W99B 2UZOA 3L8PA 4FIHA 4GRBA 4TYHB 2OI4X 4GT5A 1KE5A 4FTIA 4K2RA 1ZOGA 2C3JA 3F5GA 5K5XA 4FSZA 1M52A 3GCSA 3UIBA 4FKVA 4L53A 5A14A 3HAMA 3UC3A 3S2PA 3OS3A 4TN6A 4O1OA 1BI8A 4JBPA 3ULIA 3LCKA 4YP8A 4XP0A 2PVHA 2PZYA 4O96A 1Y6BA 4S2ZA 2Q0BA 3UIMA 1ZMUA 4IZ5A 4I0RA 1UA2A 1ZRZA 3ODYX 4ASEA 4HYSA 3C9WA 3R8ZA 3S4QA 3HLLA 2BRBA 4JLCA 3DK3A 4XG6A 4FTRA 3L8VA 4YTHA 4KIKA 3C7QA 4KBAA 3K5UA 5FEDA 3VBYA 4O4CA 2X81A 4I0SA 1OPLA 3AC1A 3LHJA 5EM7A 4C4HA 5J87A 3H10A 3OXZA 1JKSA 5CXHA 4TWNA 1QL6A 3BLAA 3G15A 2GNJA 4FTJA 4L8MA 4JDIA 1YXXA 3Q4ZA 3PWYA 4YZBA 5AAGA 3HV3A 2GFSA 3PY3A 4L9IA 2HWPA 3CJFA 4ITHA 4A06A 4F70A 4IAZA 4O0RA 3QCQA 4CKIA 5L2WA 4DFNA 4DAWA 5BUEA 3DCVA 4A9YA 4MD8E 3NVMB 2BMCA 4PNKA 4Y73A 3I81A 3VUHA 4RWJA 2J0LA 3EN6A 4GFGA 3PPJA 4DH1A 2BVAA 3QHRA 5IA1A 3UYTA 4D2TA 2WTDA 3D83A 2AYPA 5AUXA 3KXMA 2Y6MA 4I1ZA 4EC8A 4KABA 2JDRA 3HMPA 1K2PA 4PY1A 1BL6A 3HV4A 5IA4A 4R7BA 3EFJA 3F5UA 3D4QA 1U4DA 2X2KA 4DEIA 3ZONA 5FTQA 3A8WA 4DG3E 2PSQA 1O6LA 1YWRA 3OVVA 4GFMA 4X2GA 5D12A 4DTBA 4E6AA 4OTFA 4TWOA 1M2PA 4AZVA 2G1TA 3FLWA 4UB7A 4AACA 3AKJA 2BROA 4WSQA 5HD4A 3BHVA 4EH3A 1KE6A 3VF9A 3CQUA 1V1KA 4JQ8A 3EKNA 4QMLA 3D5WA 3ZO2A 5M4UA 4F7NA 4YO6A 3GT8A 3ZYAA 3ZCLA 2PUIA 3NNVA 2ZDTA 4FKJA 4PTCA 3VW6A 2XAOA 3GU7A 5K3YA 2ZMCA 2QO9A 1FGIA 4I0TA 4EHVA 1I09A 2YLFA 2Z2WA 2X4ZA 2OWBA 2BALA 2C5YA 4L6QA 4UMQA 4ZIMA 4DH3A 3ELJA 3TZMA 3D7ZA 5AP3A 5EHLA 4HZSA 3KRRA 1Y6AA 5IA5A 1XMMA 2WU7A 4CMTA 4O27B 2P2IA 2NRUA 2YIRA 3G6HA 4OUCA 4N4SA 5IA3A 2WTWA 5A4QA 1A48A 2GS2A 3F3WA 3CEKA 5CEMA 4MEDA 3EFKA 3E93A 1OBGA 3RNYA 4O7RA 1ZOHA 2VX3A 1ND4A 2GNGA 5AR3A 3TV4A 4RQKA 4RC3A 3SRVA 3OTUA 4LMUA 5E8VA 3DJ7A 4E3CA 2BHHA 2J5FA 3PZEA 4AW0A 3EQDA 3GOKA 5JRQA 4E5AX 3BIZA 2XKDA 4KBKA 4IVBA 4DFLA 4ZEGA 5IQDA 4XOZA 3PE1A 4M84A 3ZLWA 3N9XA 4KIKB 3FXZA 3KMWA 4U41A 3LCDA 1TQIA 3QTZA 4U44A 3LCSA 4LOPA 4C4EA 2C1BA 4ZSJA 2E9PA 5LMAA 4FL2A 4D5HA 3H4JA 5DVRA 3F3ZA 4EH8A 5HE2A 3IQ7A 4ZSEA 4BBMA 3ORMA 2R4BA 4OTWA 3QQLA 4BDFA 1LR4A 4JNWA 5AADA 4DEGA 5CNOA 3VO3A 5KHXA 1W83A 3LMGA 4AF3A 1L8TA 4C37A 4D58A 4FV8A 3LFCA 4NEUA 1WMKA 3FXWA 4XP3A 5FWKK 5CSVA 4M13A 4UWBA 4DF3A 4DDIA 2UW9A 4IXPA 4FTMA 3U55A 2XKFA 4JL9A 4ALVA 1EH4A 4ORKA 3H30A 5JZJA 3FC2A 4FV7A 3R6XA 3UG1A 1K9AA 3AMAA 5C4KA 2ZB0A 2RL5A 1OI9A 2C6MA 2VO6A 2VWBA 2JDVA 3F7ZA 5FBOA 4ZJIA 4J7BA 3U9NA 2X6DA 5JH6A 4JBOA 2FGIA 4AZSA 5A54A 3DDPA 3FXXA 3OCTA 4AXFA 4OTHA 3IECA 2QCSA 3FHRA 3O5AA 2PHKA 3HMOA 3PA3A 4FNWA 2WMBA 1IEPA 4FSNA 3GU5A 2B55A 3UG2A 3VS7A 2BDJA 1OMWA 2HW6A 5CF5A 4FOBA 4K18A 3Q5ZA 1BYGA 4J99A 4QP3A 2FVDA 2IZTA 1CDKA 3I0OA 5CZHA 1J91A 2OF2A 2YAKA 4I94A 4G17A 3FL4A 3EN5A 4M0ZA 2PK9A 2QHMA 4DEAA 1PW2A 2VTIA 3FKOA 4QQ5A 4W4XA 3V5QA 1R3CA 4DFYA 3KIOC 1WCCA 5HICA 1FINA 1G3NA 1JAMA 2WOUA 3MVJA 3ORLA 4FBXA 1GZ8A 3R01A 4AA4A 5KBRA 5IQBA 5JQ8A 3HNGA 5KUPA 2JFMA 2W4OA 2YIWA 3R7EA 4DCEA 5JGAA 2O3PA 3TDWA 2I1MA 3R7OA 3TKHA 5C01A 1W98A 3AD5A 1G8JA 3LJ0A 4FEUA 3LCOA 4QYHA 4DFUA 4G6NA 5AUWA 4BDGA 4TYGA 5FDPA 1OGUA 4CQGA 2OXYA 4IC8A 1STCE 3QRUA 2ZV8A 2BKZA 3QUDA 2BDFA 4I5PA 1PXOA 4L67A 2XA4A 2C3LA 3TG1A 3ZLXA 3BHUA 1BX6A 2VTAA 2YCFA 4HGLA 2H96A 4ZTSA 4C58A 5ANKA 3FWQA 4MX9A 4BCQA 2ITPA 1E1VA 4U3ZA 5HO6A 3KA0A 5F94A 4AXDA 3KF7A 3H0ZA 4ACMA 1W8CA 4AW1A 4ERWA 4EUTA 2W1ZA 5KMOA 5HHWA 3SRVB 1JSTA 1NVSA 3ENHA 4O0YA 2I0VA 4G3EA 3WZDA 1LPUA 3LFAA 1YI3A 4NTTA 5H8EA 1V0OA 3DLSA 5FEQA 3EQRA 4EBWA 3QCSA 3U4UA 2I40A 3LAUA 3RM6A 1WBOA 4YUQA 4AA5A 1PKGA 4CLJA 3A7FA 3QLFA 3VBXA 2A2AA 3FSKA 5CEKA 3AGLA 5T68A 2BAQA 4U6RA 3SG9A 2CDZA 1OUYA 3AC8A 4P2KA 4KIPA 5CSPA 4OR5A 4MNFA 4NKAA 5HU3A 2FYSA 4CRSA 5TT7A 3QGYA 2RFEA 4D4RA 3DA6A 1U5QA 2YA9A 3OWJA 2BTSA 5BMMA 2OJFE 4L7SA 5DOSA 2PVYA 4OTRA 3QTSA 4CGAA 2PE1A 2XK3A 2NO3A 2UZBA 3BHYA 4FIEA 4I23A 1IAJA 5ICPA 4FRFA 1IAHA 3AXWA 3P4KA 3OF0A 4R6VA 3PUPA 1ST0A 4EH7A 4ANBA 1OZ1A 5HO7A 3AT4A 4XV1A 5TKDA 2X6EA 3KULA 5CU0A 3FI3A 2HY0A 2CLQA 5EG3A 4FK6A 3VWAA 4F7LA 4KBCA 3PVUA 2ITUA 4JDJA 3S95A 3ZSIA 3ZXZA 5C8NA 3PE2A 5H8GA 4PDSA 3BKBA 2OFVA 1P5EA 3VS0A 3ZC6A 3PXZA 1DI9A 3CGOA 3KY2A 3ZDUA 4QMYA 3ZRLA 4D2RA 2VV9A 5AIRA 2GNHA 4IADA 2ZDUA 2ZV2A 4UY9A 2F7ZE 3HV6A 3COHA 5GZ8A 4AU8A 4YSMA 2WQBA 5EW8A 4CFVA 2FH9A 4I5HA 4S34A 3TKIA 3FHIA 5E8YA 4DGNA 4FKTA 2HZ0A 2C0OA 2VTLA 1XHAA 4QNYA 4QYYA 2WHBA 4C3FA 4IVDA 4HPTE 3FMEA 4PNIA 2VTQA 3E3BX 3LFSA 4YR8A 5CT0A 1FVRA 1P4OA 4AAYA 3OOGA 3R1NA 3NEWA 4IW0A 3MESA 4I5MA 5EI8A 3QKMA 3C5UA 5HBJA 4Y5HA 4B6LA 2JFLA 4M68A 3QQGA 4YC6A 2IZSA 3LM0A 2Z8CA 4JJRA 4MH7A 5L8KA 3R8LA 5FUTA 1XH7A 5E8SA 4AGUA 4GIHA 3GP0A 5CAVA 4EOOA 4LGGA 2EXMA 2FSTX 2ITVA 2A1AB 3Q4TA 3COMA 1XR1A 4IDTA 3HV5A 4R1YA 3F88A 2UZUE 3D2IA 4H1MA 4CV8A 3UOJA 4KSPA 5HD7A 5EI6A 3HMNA 4F9AA 3MS9A 3CLYA 4MKCA 2QOLA 4CMOA 5K9IA 4WNMA 1CTPE 2VTHA 4DTAA 4X2NA 4BZOA 4AS0A 3NFFB 4IE9A 4FKSA 5DIAA 2F9GA 2JKKA 2HZNA 1OL2A 3EMGA 2R0IA 4LGHA 2YIYA 4PX6A 4L00A 3TNPC 3BU5A 4IAIA 3FZOA 4XUFA 3QRJA 5AR5A 2CKQA 1CMKE 3BHHA 3IW6A 5CTPA 1Z5MA 3LIJA 4QPSA 3ZSGA 4RIWA 4JR3A 5HVKA 5J79A 1R1WA 2F7EE 3R00A 4F0GA 4C35A 2C47A 2FSOX 3NW6A 4QPMA 4U80A 1V0BA 4Q9ZA 4ZY4A 3UQFA 3PVBA 3PLAE 4C7TA 1S9IA 1FGKA 3NUUA 4RIXA 1ZYSA 4U0IA 5HG5A 1Q8YA 2B54A 2W5BA 3LPBA 4YJPA 5E7RA 3QC9A 3VBTA 1XH6A 2VAGA 2XJ2A 4M69A 3EIDA 3FI4A 4TKSA 4TYEA 4AW5A 2Y6OA 4NM0A 4NYEA 3LLAA 3KULB 4HZRA 4WG3A 2BKKA 3T8OA 4RLLA 3CKXA 2BR1A 4JXFA 2ITZA 4AAAA 3DNDA 2JDOA 4F4PA 4G3FA 2WQOA 1R78A 5EKNA 4I93A 5BUIA 4F1MA 1F3MC 3NR9A 4RQVA 1NW1A 4R78A 2GNLA 5IH4A 3DS6A 4OBQA 3ZRKA 3R22A 2G9XA 4AE6A 2BIYA 4FV5A 4GV1A 4EZ7A 3QTWA 5CNNA 3UGCA 3TDVA 1WBVA 2O8YA 2QG7A 2X0QA 3ZEWA 2OK1A 4N6ZA 4RWKA 4D5KA 2XM8A 3F2RA 3G90X 5HLNA 3FQSA 5H8BA 3UNJA 2VWZA 2PVLA 2QLUA 2YIXA 4O0XA 5ETCA 4DG0E 2XNBA 4CT2A 1H01A 3L1SA 3DKCA 4FZ6A 4PV0A 1GJOA 4R8QA 5CF8A 4KUJA 2X0GA 4BTMA 1GIIA 4O22A 4KINA 5AMNA 3Q9YA 2YABA 2WMTA 4IX6A 4F0FA 4J52A 4YNOA 4JIKA 4FKUA 2XEZA 2B4SB 3IDPA 3KVWA 2ONLC 2P4IA 3CD8A 3EZRA 2X2MA 4BFMA 1U46A 2WD1A 3PXFA 5HVYA 4DEDA 3KGAA 2ZB1A 4UEUA 4C02A 4E4LA 5M06A 2OJGA 2VO0A 4TT7A 3QTUA 2BUJA 4I24A 2YHVA 4QDVA 1X8BA 4YTIA 3D9VA 4WSYA 3OWLA 3R9HA 5EKOA 5ETFA 1ZMWA 3FQEA 5FTGA 3EQBA 5EM5A 5L8JA 4LGDA 3E7OA 3ZFXA 3WF7A 4KKGA 1Q4LA 4X3FC 5D41A 4BCOA 3IK3A 3LFDA 2AC3A 5L6OA 3ATTA 2I0YA 4GVJA 4K33A 2F4JA 4RIWB 3W1FA 3VUMA 2QVSE 3E8DA 2XJ0A 1NXKA 2W9ZB 3H3CA 5D7AA 2UW7A 5CU4A 5IQIA 3KL8A 3T9IA 3REPA 5HG8A 4RIXB 5L2SA 3OOMA 2J5EA 3CR0A 1R0EA 1H00A 2REIA 3HGKA 5HIDA 2YJSA 3PDTA 3G2FA 4I22A 4M69B 5HCYA 1S9JA 4HCTA 4W9XA 1BKXA 4JQEA 4U40A 4QTDA 3MY0A 4C3RA 2IO6A 3PXQA 2YCRA 4WRSA 5DBXA 3VQUA 3NAYA 3F61A 3PTGA 5I9XA 4OTQA 3IW5A 5KE0A 5LVNA 2C3KA 2O5KA 4LL5A 4QOXA 4BCPA 2IWIA 5F9EA 2BRHA 3DDQA 1UU9A 1KOBA 3QD3A 2J0KA 3WF8A 5CAPA 4FTOA 2GQSA 3VS6A 3E88A 1W2FA 4N57A 4IFCA 4BYJA 2R3GA 3LOKA 3M1SA 4D28A 3UDZA 1YOMA 2E2BA 4DFZE 5CU3A 4HVGA 2CKEA 2JGZA 3OXIA 5TR6A 1OL1A 2R3NA 5CSHA 1Q41A 1M14A 4P5QA 4MYGA 2JITA 3TTJA 4B8LA 2ZM4A 2JKOA 4KA3A 4F08A 3R9RA 4QMVA 5E8UA 4RVLA 4ZLZA 1FVTA 4O82A 3C4XA 4RX9A 3R7YA 3UO6A 4EQUA 4ZMFA 1YI6A 1BUHA 2QODA 4RA4A 5JZNA 1Q62A 3PXRA 2ONLA 3GFWA 1NVQA 3DB8A 5IUIA 3L8SA 2W1IA 3EYGA 4C4GA 4S30A 2E9VA 3C4ZA 3RAIA 3WF6A 2ITXA 5IUHA 2XK4A 1BL7A 4XP2A 3DBQA 3HDNA 5KNJA 5KMJA 4RJ6A 3ZFMA 2YJRA 3QRTA 5DHJA 2XARA 3HYHA 3GC9A 3Q52A 4YJUA 4BDCA 4R7HA 3SQQA 4EK6A 4OTPA 5DWRA 5JK3A 4PL3A 5DEYA 2BILB 5F4NA 5HIBA 3R21A 2VTTA 3UO5A 2I7QA 3OMVA 2W0JA 4S31A 4MWIA 2RGPA 3WBLA 4X3FA 3FBVA 4CNHA 5EDRA 2X8EA 2G2FA 5AP4A 4FL3A 4EC9A 2OF4A 5JQ5A 3DB6A 3MN3A 4W9WA 3VNTA 4GSBA 3FZPA 1PMEA 4IB0A 5AV3A 4EK8A 4OT6A 5I9VA 1XQZA 4YZCA 3B8RA 3ORZA 1H24A 2ZV7A 1YHWA 3U6JA 2WAJA 3QX4A 3EB0A 3UZRA 5GZ9A 1JKTA 4FSQA 4F9WA 2XKCA 3HV7A 2R2PA 2WXVA 5H3QA 1GIJA 5J5SA 3AD6A 2RFDA 3UMWA 2H8HA 1JSUA 2OXXA 3OTVA 4DEEA 3ROYA 5CANA 3LM5A 3OCSA 4PDOA 3OCGA 4GUEA 4WA9A 2GSFA 1H1PA 5HBHA 3A60A 3RZFA 3JYAA 4O91A 3DBFA 2GQGA 2XNNA 3VS2A 4GKIA 2WMWA 2X7OA 4ACCA 3UQCA 2E9NA 4ZTMA 2ITQA 2C69A 3WE4A 5DR6A 3A2CA 5DT0A 1PXMA 2X9FA 3MH1A 4KAOA 2OLCA 2FUMA 5JGBA 4MAOA 3BCEA 3I4BA 4LRJA 4Q2AA 3BYVA 3IDBA 2GCDA 4Y8DA 3DAJA 1WBWA 4X21A 3CP9A 4FI1A 3QLGA 3W2RA 3NLBA 1ZYCA 3MYGA 3W8QA 4AZFA 3RI1A 3HZTA 3WI6A 3HX4A 3BELA 4ZZMA 5AR2A 2CHLA 3RCDA 1FBNA 1W2DA 2FB8A 3PWDA 1UU8A 2HIWA 2HW7A 5HVJA 3S1HA 3DLZA 4GH2A 1WFCA 2Q0NA 2UW4A 4PPAA 4II5A 5JT2A 1H0WA 3ATSA 3LVPA 3BL7A 1U59A 5AUUA 3IW4A 4QQTA 3CSVA 1Q97A 3LJ2A 5FLFA 5TO8A 2ZOQA 3ZO1A 1G8SA 2NNWB 4D2VA 5K0KA 2H9VA 4U9AA 2CKOA 4C8BA 4BN1A 3FYKX 3PXYA 5KHWA 2QOHA 2EUFB 5E8TA 4ZZNA 3VULA 5A3XA 3R71A 3GC7A 1A9UA 5HE0A 4XV9A 3BU3A 2RKUA 3O7LB 2I0EA 4O0UA 3GEQA 3IKAA 3NNWA 3F3UA 1W84A 4IQ6A 3MVLA 1W0XC 5CX9A 5D1JA 5FM2A 5I9WA 1DAWA 3HP2A 4PQNA 4L01A 4AWIA 3W0PA 2GNIA 5LVPA 4HYIA 5CY3A 5K0XA 3SA0A 3ZM9A 2YZAA 4NJDA 3BEAA 1H27A 5T3QA 4GK3A 4DT9A 3W0MA 3FUPA 5AP2A 3UP2A 5LARA 2VWXA 4XCUA 3R8MA 3EN7A 2I6LA 3CXWA 3CY2A 2OICA 4X3FB 3TXOA 3ZO4A 2FA2A 3E7VA 5CZIA 2RG6A 3UZTA 4G9CA 3BE2A 4FC0A 2XUUA 2W1GA 4GK4A 5A4LA