3VHKA

Crystal structure of the vegfr2 kinase domain in complex with a back pocket binder
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
355
structure length
297
Chain Sequence
DEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
publication title A Back-to-Front Fragment-Based Drug Design Search Strategy Targeting the DFG-Out Pocket of Protein Tyrosine Kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 297
sequence length 355
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vhkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vhkA01
3SKCA 2CJMA 4AAAA 3FEGA 3Q4TA 4FKWA 3EN4A 4U9AA 1TQMA 2XBAA 3REPA 3FSKA 2UZDA 5BMSA 1GZ8A 4OAUC 3NNWA 3OWKA 5CEOA 4I6HA 1Q3WA 3EYGA 1MUOA 3HMOA 4LMNA 3OUKA 4XV3A 3BHYA 4AW2A 4DFLA 3ORIA 5GZ8A 5IU2A 3SGCA 3U54A 3TV6A 1OL1A 3EQFA 5F1ZA 1I44A 3NYNA 2B9IA 4HZRA 4ERWA 1UU8A 4ZSJA 1O6LA 2BCJA 4YLLA 3UQCA 4N57A 1WBNA 3ORLA 3DJ5A 3Q6WA 4XRLA 4K2RA 3OCGA 3O96A 3QGYA 3D7TB 2ZV9A 3QTSA 4XOZA 2QG5A 2EUFB 3GU7A 4AZSA 1MRVA 1XBAA 4BZOA 1Y8YA 3LJ2A 5ANIA 4ZTNA 2DQ7X 2OXDA 3FXZA 3LAUA 1AD5A 3R7GA 5AAEA 3QD0A 2FSMX 5CAUA 3PA5A 4BWKA 2XYUA 4CCBA 2QU6A 5KNJA 2XIZA 4IB0A 2A4LA 3GI3A 4NM0A 4WG5A 5IQFA 4ACHA 4QMWA 3RKBA 1JKSA 3R7IA 2YIQA 3T8OA 3ZC5A 1PYEA 4O0RA 5T6KA 3FI3A 3HEGA 4DTAA 4FNWA 4R5SA 3JVRA 4XG3A 3BYUA 2X6DA 3GC8A 1PHKA 3A4OX 3QUDA 2F7EE 5E8WA 2QD9A 2UVYA 4I23A 4HOKA 4AU8A 5EG3A 4RFMA 4O21A 2ZAZA 3G51A 3PXYA 3F5UA 2X1NA 2OBJA 3ET7A 4F63A 4YPSA 5FDPA 2ZM4A 4YJTA 4NWMA 2RFNA 4C2VA 2KULA 3ITZA 3TXOA 3ZLSA 5JZJA 4PNIA 5JMSA 3E8CA 3DXQA 2YCRA 1YXUA 3BV3A 5CENA 2HW7A 3GCPA 3JS2A 2WOUA 4I5PA 4MWHA 1FQ1B 4XV1A 4JQEA 5DRBA 3DDQA 5J1VA 4I0TA 3HV4A 5DYJA 5EQYA 2JAMA 2JC6A 5CSVA 4C3FA 2WTKC 3A61A 1AQ1A 4PRJA 2P0CA 4C62A 4F7NA 1Y91A 4IBMA 4GG5A 3FQEA 2VTTA 3ZONA 3ACKA 4FEQA 4IW0A 3TZ8A 4RX9A 3VS5A 4Z9LA 4BTFA 4MNEA 4JNWA 3OCTA 2BRMA 1YHWA 4IAZA 4DG0E 4LRMA 4IZAA 4YJPA 3EOCA 5EOBA 4FF8A 4YZDA 3LXLA 3POOA 4GMYA 4KIQA 1ATPE 2JDTA 3CKXA 4JDIA 4C4JA 3FXWA 3ODZX 4ENYA 2W1EA 4EONA 4FTKA 3RZBA 4FTRA 3ZRKA 3DAJA 3OWJA 3AD6A 2O63A 4CKIA 2G2HA 3UO4A 1KE8A 2R3GA 5DI1A 3SG9A 1WVXA 2F2CB 4GVJA 2G15A 5KMIA 5I9UA 2GCDA 4ANOA 4DFBA 3EHAA 5AX3A 3VS7A 5J5SA 1GOLA 5CEPA 5CVHA 4D28A 2W05A 2BAKA 1OIYA 4WG4A 4I94A 4MEDA 2GS7A 3UDBA 2IW8A 5KKRC 4TYIA 5L2SA 4L7SA 1Y8GA 3WZDA 3UIXA 3NCGA 3F69A 3OOGA 3QWJA 4B4LA 2PMLX 2VTAA 4MXZA 1I09A 3SQQA 4MF0A 4G31A 4XBRA 1OPJA 1PXKA 1T45A 1U54A 2WMXA 3I0QA 3MN3A 3TWJA 2ITUA 3COMA 4CQGA 2VX1A 3DGKA 1G3NA 1JSUA 2ITQA 4TNBA 2BKZA 5F9EA 3UZPA 2OO8X 4E7WA 4FODA 4BB4A 5KMNA 2EXEA 4EH2A 3AC5A 1VEBA 2P2IA 3LFCA 4TW9A 4J95A 3DKFA 4FZFB 1A9UA 3BPRA 3KXGA 4RWKA 4CSVA 4FV0A 2R4BA 3VF8A 3BI6A 2RG5A 1XWSA 3IW8A 5FBOA 3HMPA 1Q8ZA 2QQ7A 5EKNA 3AC3A 4GJ3A 3QKLA 3C4EA 3QD4A 4IM0A 3NGAA 4EH3A 2VGOA 2GHGA 3GU8A 1W83A 2R3JA 4JT3A 4EWHA 3R9RA 2BKKA 3MA6A 5IF1A 3U6HA 4NM7A 2QO7A 1H0WA 4JIKA 3BYOA 3GT8A 3N4UA 4JS8A 5HG9A 4E26A 2WIHA 3QFVA 3LOKA 3KMWA 2AC3A 3EZVA 2Y9QA 4BDEA 2A0CX 4QOXA 1J91A 1V1KA 3HAMA 4WBOA 4DGGA 2BDJA 1FVRA 2BPMA 2B53A 2ZV8A 3AG9A 5I9XA 4D55A 5D11A 4RQVA 3UG2A 3H0ZA 4QMUA 3CLYA 4BI0A 3TZ9A 3E93A 2ERKA 4JBQA 5CEIA 3V5LA 2XF0A 4BBMA 4UN0C 2X2MA 5HCZA 3ANRA 4WRSA 4UWBA 1H4LA 1UNLA 3JVSA 4LRJA 3Q60A 4HYSA 2YHVA 4S33A 4EHEA 1PF8A 5AR4A 5FTGA 5A54A 1H26A 3FKLA 3E8DA 3TNIA 3KEXA 1YXVA 3OUNB 3L9PA 5E7RA 2YDJA 4FSYA 3BGPA 3LFQA 3P23A 3NS9A 2Y6OA 2PMIA 4YUQA 4EL9A 1HCKA 1XH6A 2RIOA 2HELA 3QCXA 3U4WA 3SRVB 5CAVA 4EOIA 1AGWA 4G1WA 4RWIA 3BWFA 3ZTXA 3PIYA 4JAIA 4OTWA 4RA5A 5FRIA 5HD7A 4I5HA 4ZTHA 3MFTA 5K0KA 3QL8A 2BRHA 3MVHA 3CXWA 5I9YA 5K5NA 5DH3A 1UVRA 3O71A 3Q9ZA 3GQLA 3A8XA 4CMTA 5M51A 4LI5A 2XBJA 3BGQA 4FV6A 3UOHA 3VUGA 4XNEA 4DBNA 4F64A 3KRLA 3H9FA 4I1ZA 1SVHA 4EEVA 5LCJA 4M84A 4EH8A 3F66A 3ZLWA 3HDNA 1GIHA 3EN6A 3UVRA 4TYHA 3IK3A 4JX7A 1WVWA 4Y8DA 3E8NA 2YEXA 4Z16A 2X81A 3OEZA 1H00A 4I6BA 3WOWA 3PRIA 4Q5EA 2VX0A 1DAYA 1W8CA 3I79A 4KINA 2GNJA 4X3FA 3DA6A 4FG8A 4IIRA 1VR2A 2ZDTA 4KKGA 4C61A 3Q3BA 4P90A 4V0GA 1GY3A 4CFUA 5AADA 4EOOA 2XH5A 2BALA 3Q9YA 4QMQA 4LL5A 3ATSA 4IX3A 2YM3A 4Q5HA 2C5NA 1CMKE 2FSTX 3PJCA 3W1FA 4MVFA 3QD3A 4CLJA 3C1XA 5AP1A 4XS2A 4QYGA 1KUTA 3HGKA 1FPUA 3U9NA 3I6UA 3NNVA 2VTRA 5FM2A 5TKDA 3W2QA 4CG8A 2X6EA 4DH7A 4FKOA 2J0LA 2QOKA 2HXQA 2VZ6A 3E92A 3RALA 4EOPA 4U97A 5M57A 4X3FC 3FMKA 1MP8A 2W4OA 3VHEA 1YDTE 2WMWA 2ZJWA 5TOZA 2YWPA 3UYTA 5FUTA 2WMQA 4ANMA 2QONA 4WKQA 1UWHA 4WRGA 2ITWA 2PE0A 1R3CA 4EQMA 3ZDIA 5I9ZA 3HMMA 1YI3A 4AN9A 4QTAA 4YC3A 4YLJA 4F70A 4F09A 1YXXA 4DT9A 3KFAA 3P08A 3A7JA 1Z9XA 3TI1A 1U4DA 4ZZOA 4AACA 5AV2A 4BKYA 5FTQA 3EFLA 5BNJA 4NK9A 4FA2A 1ZY4A 3ZRMA 4F1TA 2FUMA 5IH5A 3VS0A 4A9RA 4LGDA 1Q24A 5LVLA 4EOJA 3GENA 5M4CA 2ZMCA 4MNEB 3VULA 2ITXA 4WSQA 2B4SB 2XKFA 4XH6A 4BCMA 5KMMA 1E9HA 4AQCA 3NYVA 5H8EA 5HE3A 5BUEA 4GCJA 3IPHA 4FVQA 2OXXA 2X7FA 5IA0A 3FLNC 3AGMA 4FEVA 3GCQA 4DLIA 2YCQA 5KKRB 4O2PA 4D4YA 3W2CA 3W10A 2QOCA 3LE6A 3LQ8A 4LL0A 1KE7A 5AV3A 3NZ0A 2UZUE 4L3JA 3HECA 3P9JA 4DFXE 4DCEA 1XHAA 3EZRA 2VTPA 1OVEA 4IC8A 4FTLA 4C35A 4BDIA 3PVUA 3JR1A 4ANLA 3E62A 4BBFA 5BYLA 4JG7A 5M06A 3PZHA 1IASA 2XJ1A 2UW6A 4L46A 3O51A 1R78A 2CCHA 3WF6A 4UXLA 3RP9A 4CTCA 3BLHA 4ORKA 2IW9A 3L8SA 3OCBA 4G6OA 3TZ7A 4E93A 4ZIMA 2I6LA 2HENA 3DFCB 4O7YA 4EBWA 4U40A 5IA1A 3O7LD 2UW3A 4L01A 2E9PA 4QTBA 4HZSA 2PVLA 3PWYA 4S2ZA 4TT7A 1CKJA 4W4VA 5DWRA 5AWMA 3BU3A 1H1RA 3S3IA 4L3LA 4CTBA 2YERA 5CNNA 5CX9A 4QNYA 1YOJA 3PXFA 3ZXTA 2OFUA 5LVPA 3ENMA 4TKSA 1KE6A 4H3QA 1U54B 4II5A 4ONAA 3WF7A 1BMKA 2UZEA 4HGTA 4YC6A 3W16A 4YHFA 2YZLA 2R3LA 4HJOA 4F1OA 5A6NA 5DG5A 3KB7A 3POZA 4LGGA 1XR1A 4FKVA 3BCEA 4OTIA 5IPJA 4RLLA 5CQWA 3HRCA 4QP2A 3WF9A 1QPJA 2X2LA 1M2QA 4MWIA 3VVHA 3DKOA 3I60A 4HYIA 3CQEA 4HPTE 1ZYDA 4E4LA 2JKQA 4IM3A 3SX9A 5IQAA 3R22A 2ZM1A 4G6NA 3QZHA 4GH2A 4DFYA 3W33A 4LRKA 5CAQA 3N4VA 3DB6A 5CASA 2VV9A 4YJRA 2O64A 1R39A 4GUBA 3IDPA 2OIQA 4ZTMA 2EWAA 4G3GA 4AFEA 4JG6A 5M56A 4U43A 5EH0A 2WQOA 3JYAA 2JIUA 2X8DA 4C3PA 2R7IA 3G9NA 3IOPA 4IZ5A 4UBAA 4CVAA 3FLWA 3BYVA 3QA0A 4FV3A 3VUIA 3PVBA 3PXZA 4DGOA 1YWVA 5AM7A 1IA9A 3SHEA 3LLAA 4F9AA 1WFCA 4IZ7A 4GK2A 4MKCA 4QMMA 5AMNA 3LCKA 3VS4A 2W5BA 5C4LA 5EM7A 4BCQA 4HGSA 3ZBFA 3WARA 4AT5A 2PVRA 3ZOSA 4K11A 1YKRA 3DAKA 5DMZA 3QU0A 4FTTA 3UOKA 3NYXA 1XH9A 2VO0A 3LVPA 1W0XC 4QP7A 4YZBA 4CRLA 2IZSA 4NKSA 4FKJA 2ZYBA 5HIEA 3BEGA 2QKRA 3P7BA 4AG8A 5B7VA 4Y85A 4CYIA 5BVOA 5EDPA 3PJ1A 2I0HA 4RSSA 4BIDA 1ZY5A 2ZM3A 3OCSA 1LPUA 5F94A 4ANNA 4QMOA 5JQ8A 1Y6BA 2PTKA 3V8TA 4CFVA 2X8IA 1MQ4A 2VO6A 3R00A 3ULIA 4ASEA 2V7OA 4PMPA 5CU3A 2WQNA 3NW6A 3BWJA 4TYGA 2C6EA 4QP8A 4U3ZA 4DGNA 1M7NA 2VUWA 4FSMA 1YI4A 4Z7GA 3B8QA 4OTRA 5BMMA 5DRDA 3JUHA 3UC4A 1YXSA 3OWPA 3AC2A 4KUJA 3OC1A 2C1BA 4DEEA 4C4FA 4JDJA 5JRSA 3V5JA 4R5YA 5A46A 2WOTA 2PSQA 3E7VA 3OXTA 4JQ7A 4QYEA 3ROYA 3FKOA 5CT7A 4G5PA 2YM6A 4IX5A 4CFWA 4CV9A 4BGHA 2QODA 1O6YA 3PE1A 3W2PA 5E9EA 3MIYA 4X3FB 3FY0A 4RGJA 3IW6A 2W1IA 3I6WA 3QQHA 4V0GB 4X0MA 2W0JA 3TTIA 1YWRA 2YZAA 3Q6UA 4KS8A 4CQEA 1UNGA 4AGCA 3OFMA 5CAOA 2QG7A 3RMFA 1KV2A 3ZZEA 4LV8A 2IZTA 4H05A 5AUYA 4G2FA 5GIOE 5HIBA 2GFCA 3FUPA 1KV1A 1IG1A 4O0TA 3QQUA 2HZ4A 3C51A 3MPAA 3QHWA 4WUNA 4ZJJA 4H58A 3WE8A 3PPZA 3PSDA 4PWNA 3ZC6A 3CSVA 3D7ZA 3BIZA 2F49A 2O2UA 4OGRA 5EI8A 5E8TA 2PVMA 4OBQA 3T9TA 3FMDA 2WTCA 2XVDA 2W96B 4BWXA 4PUZA 2OG8A 3RZFA 3PPKA 4FNZA 4I20A 1OUYA 2OU7A 3IW5A 2PL0A 5FM3A 3HUBA 4DINA 5AR8A 3RPOA 2GMXA 3MVMA 4FIHA 3RBWA 2B54A 2WEIA 4F6SA 3IDCA 3UZTA 4PPBA 1UV5A 3DY7A 1ZOEA 2BZHB 5HU3A 4U5JA 1ZMWA 1PY5A 4IJ9A 1Q99A 2UW0A 3JY0A 5J9LA 3HRFA 3QUEA 2VTIA 3EQIA 3U8WA 4JXFA 4E4XA 2YJRA 2VO3A 3VUKA 4XG6A 5JEBA 2C6TA 4X3JA 3G9LX 4FTNA 3D94A 3QTWA 4FTIA 2G01A 4NH1A 4RVMA 1YDSE 4B9DA 5IDPA 3DOGA 1BI8A 3RAKA 3HDMA 3TN8A 1NVQA 2WELA 4CKJA 1SNXA 2Z7RA 5JZNA 3OY3A 4I0SA 4D4RA 4R6VA 4YSMA 2Y6MA 4AGWA 3D83A 3EKNA 3SW7A 1QMZA 4JLCA 4AW0A 4R1VA 2WTWA 3SG8A 5D10A 2PVKA 2CMWA 5HX6A 4BICA 4E3CA 1F3MC 3MS9A 3DT1A 2H34A 4G3DA 5FP6A 1GJOA 5KHXA 4GVAA 1A06A 1H1QA 2BR1A 5DVRA 4O1OA 3OTUA 5DN3A 1OIQA 4KA3A 4XX9A 4E4MA 2J0IA 4DG2E 3PY3A 3UVQA 3BHTA 4GK4A 4WD5A 5AV4A 2JGZA 4YC8A 4RMZA 3HA8A 5CTPA 4AZWA 4FEXA 2VTLA 5HHWA 4QYHA 2BFYA 2A1AB 4IVBA 3FQSA 4BYIA 3LFSA 4NKAA 3ZFXA 5E90A 3F82A 3QA8A 4FV7A 4QP9A 4RZWA 2J9MA 5C01A 2GHLA 3I7BA 2YIXA 1K2PA 3F9NA 4FTQA 2LGCA 4BDBA 3MTFA 1WBWA 2R3NA 4FTAA 4J8MA 2BZKB 5ETIA 2XM8A 3GUBA 3VS3A 3QXPA 4R78A 3R30A 4A9UA 3AXWA 3BZ3A 5KUPA 3QBNA 3QZFA 4I93A 5F95A 3ZLYA 4JOAA 3TUDA 4Q2AA 4TNDA 5AUXA 4NW5A 2YDIA 4B8MA 4CV8A 4RVTA 3MH2A 3CQWA 4ACDA 4NTTA 4O0WA 1URWA 4JL9A 2O5KA 2EXMA 1LEWA 4Y95A 4OR5A 4CFMA 3GC9A 5BVKA 5HE0A 4BKJA 1YXTA 4J96A 5CZHA 3R21A 3V8WA 4ACGA 1FVTA 3FAAA 4O38A 4I6QA 4QYFA 2R0IA 4X21A 3ZSIA 2J5EA 2IG7A 4D1SA 5ETAA 4D2PA 2PVJA 3CY3A 1YHSA 1GZNA 4XP2A 4QQTA 4KAOA 3BRBA 3BX5A 1GNGA 3R8ZA 3RK5A 4MTAA 1J1BA 4NFMA 5ETFA 3EQPA 5HVYA 3R8PA 3NYOA 4GV1A 3M42A 4MQ2A 4O0SA 3BGZA 1ZYLA 2H8HA 2VTNA 3LFFA 3TZMA 4YTFA 4AT4A 4BCKA 4BCIA 1OBGA 5AAGA 4BCJA 3MSSA 3MH1A 3FDNA 2RFDA 4DH8A 3QYWA 4F99A 3KRXA 2BUJA 4FIFA 3BYSA 1YDRE 2UV2A 3KMMA 5TT7A 3THBA 3DLZA 3GOKA 4AN2A 5HZNA 3SRVA 3ZM9A 4QRCA 2CDZA 5AUZA 2IWIA 5IEXA 2ERZE 4FE2A 5HCYA 2VTQA 3UNJA 3FMJA 3T3UA 3ACJA 3HX4A 4AGDA 2HZ0A 4FG7A 3OXZA 4O7SA 2C3KA 3O7LB 3FZRA 1JSVA 1XJDA 4A06A 2DYLA 2PVFA 3ZO3A 5E8XA 5JFXA 2YLFA 1KSWA 2GHMA 4O7NA 4AWIA 1TKIA 2XYNA 2X39A 4XYFA 5DOSA 1DI8A 2O3PA 1FMKA 3HV3A 1UKHA 2Z7SA 3QTIA 5HNGA 4EKLA 5LMBA 3IGOA 3NMUF 4O1PA 3ID6C 4X2FA 3DXNA 3MGYA 3R8LA 2ITOA 2JBPA 3K3JA 1GAGA 1WMKA 3FC2A 5EKOA 4J97A 4CYJA 1SVEA 1GZKA 3ZUTA 4FTMA 4EHGA 4F7LA 3FZ1A 4NCTA 2DS1A 3R6XA 3DNEA 5LXMA 3RAHA 3FBVA 3ZCLA 4FV2A 2ITPA 5B2LA 2J51A 4BKZA 2CN8A 4WIHA 3PE2A 5IQDA 3NUSA 1XH8A 3R63A 2PVYA 2J0KA 2Z2WA 3DBFA 5E8SA 2HZNA 3QC9A 1PRYA 3CE3A 3NUUA 5TO8A 2W1ZA 5HG5A 2OKRA 4IVCA 3UP7A 2C5XA 2OJFE 3PXKA 2YIWA 2E9NA 4D1ZA 4YJVA 3Q53A 2JIVA 4CG9A 3C7QA 3FYKX 3GCVA 5C8NA 4PPAA 3KKVA 1XBCA 4XHKB 1CM8A 1ZZ2A 2C0IA 2CGVA 1H08A 3F5PA 3NUYA 5E1EA 3SV0A 3NCZA 2BDFA 3NLBA 1VZOA 3D2IA 3MJ1A 3LKMA 3K5VA 4E6AA 2PZPA 3FJQE 5L8LA 3A62A 4EK6A 4TTHB 4FUXA 2X4ZA 4F0IA 5HBJA 5FXRA 3QTUA 4IZYA 3C0GA 4MXXA 4YSJA 1DAWA 2G2IA 4EC8A 3IOKA 3JY9A 3S4QA 3R9HA 1W82A 3KL8A 4FG9A 1OL7A 4X2NA 3HUCA 2WHBA 4FT3A 3LFDA 5J9YA 2UZOA 4S30A 4GFMA 4GL9A 4IACA 5IH4A 3SA0A 3RNIA 3FYJX 4PTGA 3QZGA 2E2BA 4FSUA 4O22A 4YJNA 4FT5A 1OL2A 5DR2A 5AP3A 5L2QA 5I9WA 5A6OA 5J5TA 4O7LA 2GS2A 1Q8WA 4RRVA 1FBNA 3CGFA 1JAMA 4DEDA 3S2PA 2WXVA 4E1ZA 3GFWA 4LQMA 4ZXTA 2VTSA 5CSXA 4EQUA 3VUDA 2VNWA 3ZZWA 4PMSA 4U79A 1URCA 2CPKE 1UU7A 3DBEA 4IDVA 2PPQA 3OOMA 3GQIA 1KOBA 2BVAA 3DKGA 4FYNA 4QMVA 4UZDA 3UOJA 2GU8A 3OY1A 1B6CB 3GVUA 3Q96A 4FNXA 2HY81 4O27B 4U6RA 2WQEA 3WZJA 5JRQA 4ZTSA 2VRXA 3G0FA 5FXSA 4YURA 1XKKA 2C6DA 3NAYA 4FIIA 4IB3A 4O7VA 3HNGA 3VW6A 4RFZA 3FWQA 3UTOA 3EQRA 3FMEA 2UW4A 3PA4A 4MQ1A 4WNMA 5FEDA 3V51A 1ND4A 4G5JA 5IQGA 5E8ZA 4WA9A 2GQRA 2Q0BA 3UNKA 4IFCA 4BCOA 3FI2A 4YLKA 5AUUA 4FSRA 2UW9A 3TEIA 3LFNA 3A2CA 1PXIA 2XIXA 3R1QA 2YCSA 3KRRA 1F5QA 3D5WA 5G6VA 3U6JA 4MD7E 2Z60A 3W55A 4TPTA 5AAFA 4GJ2A 4Y72A 5EYDA 4TL0A 2UW8A 5IEYA 5J7BA 3D5XA 4UMQA 1X8BA 5CXZA 5HX8A 2P4IA 1DM2A 2W5HA 3I4BA 5E91A 3VBYA 2CNQA 2F2UA 2XK4A 4YJOA 3NAXA 4IX4A 3QX4A 5CALA 3SW4A 5E92A 4FBXA 3BEAA 4ACMA 3I1AA 1GIIA 3LCOA 5HE2A 2QCSA 4DITA 3MY0A 1OKWA 3LQ5A 1CKIA 3CS9A 4TY1A 1UKIA 3ZUUA 3MVJA 3CR0A 4FKUA 2J5FA 2DUVA 3FMMA 1ZMUA 4RVLA 3QC4A 4O86A 1Q3DA 4QYYA 3L1SA 2XB7A 3E64A 3R7UA 5HU9A 2WMUA 5J9ZA 3WI6A 3F5XA 4BTKA 3S0OA 1SNUA 4CRSA 1V0BA 2BMCA 4L42A 4QMLA 4U3YA 3UG1A 1M17A 2YLEA 3FL5A 4TYEA 3BHUA 3PTGA 4QNAA 3LMIA 5EYMA 3V5QA 1CSNA 4JBVA 2IZRA 4I41A 4RG0A 4AXAA 3QRKA 4C38A 5M4UA 4KIPA 2PUIA 3V01A 4KBCA 1IAHA 3U51A 5J1WA 5AP2A 3R1YA 3R73A 4YPDA 4GT4A 4YMJA 2GS6A 1JKKA 2O0UA 2UZWE 3QGWA 2HCKA 3ZO2A 2X2KA 3I5ZA 4M3QA 2LAVA 3D0EA 2A2AA 4QPSA 5F20A 1M14A 3G2FA 2R3OA 4IAFA 1OPKA 4P7EA 5CLPA 3TJCA 3OVVA 4UALA 3ZO1A 4AA0A 2RKUA 4D2TA 3G5DA 1V0OA 3VW8A 4O2ZA 3QALE 4IXPA 5IQIA 3MA3A 3DU8A 3IQ7A 5CXHA 3KA0A 5LARA 4RIYB 4KS7A 3Q9WA 4O0UA 2E9OA 5K0XA 4LGHA 3A99A 4R7HA 3P5KA 2I40A 2XNBA 3AC1A 3TACA 3G33A 3E88A 4GEOA 4C4HA 4D5KA 3LQ3A 4R8QA 2AUHA 5IG1A 5TR6A 1O9UA 2X4FA 5K4IA 3NUAA 1REJA 3F3TA 3TM0A 1OL5A 2VWBA 2OI4X 1XH7A 4LOPA 3L8VA 1FGKA 2HIWA 5JN2A 4JBOA 3NR9A 4NSTA 4ARKA 1NT2A 4R1YA 3DFAA 3ENHA 3LFAA 5HKMA 1WAKA 4D1XA 1KE9A 5L6PA 1OMWA 3GCSA 3F7ZA 3A7FA 3FL4A 1LEZA 4QMTA 3DZQA 4FTOA 3DK6A 4MX9A 4G9RA 3QD2B 3BQRA 1XQZA 4FMQA 4C02A 5GINE 3LMGA 4K33A 4OAVB 2HWOA 3AT3A 4QP6A 3VRZA 4Z7HA 4BBEA 2W9FB 5FEQA 3PP1A 4LOQA 3UMXA 4ALWA 4X7QA 2C5OA 4WSYA 3ERKA 3VUTA 2NRYA 2ITNA 4EZ5A 4GS6A 2OJ9A 4DFUA 3D2KA 4EJ7A 3OEFX 3H9RA 4DTBA 2BAQA 4NL0A 1PKDA 2XA4A 4NM3A 3WZEA 3CC6A 3R83A 4BCFA 2QOOA 4D4SA 5L2TA 4XV2A 2CKOA 4PDYA 2VWZA 2XK7A 4D5HA 2JAVA 4YJQA 4HNIA 3EYHA 3PZEA 2WAJA 4JDKA 4C57A 1DI9A 1PJKA 3KF7A 4DFZE 4FV4A 4F08A 5LQFA 5K9IA 5E4HA 1JPAA 3QRTA 4IB1A 4IQ6A 4IVAA 5HQ0A 2IVVA 4ANSA 4XMOA 2CLXA 5HTCA 3ORXA 2O65A 3QLFA 3B2TA 4XLIA 5HGIA 4F0FA 2OSCA 2PY3A 1V0PA 4F9CA 4PTEA 5L4QA 1YOMA 3PIXA 4NJ3A 3CD3A 3O23A 5EW9A 2ONLA 2YM4A 3TTJA 4Q9ZA 3FQHA 4BVUA 3MH3A 5HCXA 3MFRA 5M09A 2XJ2A 4BRXA 1JBPE 3NIEA 3CEKA 3P7AA 4H3PA 3O17A 2IO6A 2VWUA 5FTOA 5CEQA 3QUPA 3TIZA 3HVCA 3PRFA 3FPMA 5JGAA 3V8SA 4OTPA 3MIAA 1VJYA 3UYSA 3RM6A 3UNZA 4BDHA 3RK9A 5EFQA 3PSCA 3PIZA 3NNXA 3BE2A 3NRMA 2UZVA 2RFSA 3MYGA 2W99B 5L8KA 3MESA 3SOCA 4ZJIA 4EOMA 5L2WA 2QI8A 3TUCA 2WNTA 1NA7A 1XO2B 4QP4A 3KCKA 2OIDA 2QNJA 5DFPA 3EN9A 5HIDA 3Q4CA 4ASZA 4AE9A 3BLQA 3OZ6A 3DNDA 2OW3A 2XK8A 4IH8A 3CTJA 4Z3VA 4HVDA 2P33A 2I0EA 4JX3A 4WO5A 4XOYA 1WVYA 4C4IA 1K9AA 2CN5A 3P0MA 3CJGA 2XIKA 5HO6A 2QOIA 3KULA 3NNUA 4WHZA 3GU4A 5E8YA 4NYEA 4U0IA 4HNFA 5D9HA 4F1MA 4J99A 2CGUA 5FD2A 4QQJA 4OBOA 5FLFA 4CGAA 1OZ1A 4BGGA 4L8MA 3ZH8A 4ZJVA 5HLNA 2R2PA 5CEMA 2RSVA 2WB8A 4UXQA 4FTCA 4FT0A 4HGEA 5DHJA 4C34A 5IDNA 1P4OA 3W32A 1ZYSA 3VC4A 5K3YA 3C4ZA 3F3UA 3NW7A 1BKXA 5EM6A 4N6ZA 3Q5ZA 4WT6A 5GHVA 2QLQA 2XM9A 4P5QA 5BVDA 5JQ5A 4N6YA 1S9JA 4BWPA 4IWQA 2OH4A 2JD5A 4X2GA 4ID7A 5CI6A 4JVGA 4KKHA 5AR3A 4EYJA 1NXKA 2CKPA 3BHVA 3VJNA 3OT3A 1FOTA 1STCE 4IAKA 5EHYA 1U5RA 3IG7A 2OXYA 4KKEA 3H30A 5EI2A 1BI7A 1HCLA 4TWOA 4FSNA 4X2KA 5CZIA 4B6LA 1R1WA 3O2MA 3RK7A 2B1PA 4EBVA 5L8JA 4GFOA 5FDXA 3BHHA 3R7EA 3SXRA 1G8AA 1SVGA 3LJ1A 4QMSA 1OBDA 3RPSA 2VO7A 4ACCA 4FSWA 4R77A 4W8EA 3DLSA 4BCGA 2R3PA 5CF8A 4DF3A 2VTJA 2YAAA 3QZIA 3C4CA 1OB3A 4GIIA 4JRVA 4AZVA 4DT8A 3FMLA 2IN6A 3FKNA 2RG6A 4EOKA 4JQ8A 3O0GA 4RLKA 4KBKA 1H1SA 1Q62A 1YWNA 3QF9A 4USFA 2C3JA 2QOBA 3I0OA 5B0XA 3AT4A 4CMOA 4O0XA 2J2IB 3IKAA 3VF9A 2F9GA 4OTGA 4DC2A 2WTDA 3CIKA 2YWVA 3EQBA 2W06A 4ZY6A 5CVFA 1PXJA 4FZ7A 4HVGA 1WBPA 3A60A 3QQGA 2ZOQA 4BZDA 2Q0NA 4RJ5A 5IQHA 4IWOA 4ZTQA 1OITA 4MF1A 4RX8A 5LCKA 1UWJA 4CCUA 3VAPA 3TDWA 3UBDA 2HXLA 4NU1A 4MNFA 2QHMA 2CSNA 3NUNA 5DA3A 3U87A 4RIWB 4BDAA 2WMBA 4GU9A 4CXAA 5KZ0A 4ZAUA 4QTEA 3E63A 4FIEA 4JAJA 4V01A 4RFYA 3TNHA 5IQEA 4PX6A 4G17A 2BFXA 5ANEA 4NFNA 3OP5A 3VBQA 3RVGA 1CKPA 2ETRA 1PYXA 3OBGA 2PMOX 3PWDA 3EH9A 4AOTA 2V22A 2ZV2A 5ANGA 3UC3A 4H1JA 4MXOA 4EKKA 5AA8A 2J50A 3K5UA 4PF4A 3W2RA 3O8UA 2YN8A 3CP9A 2WQBA 3Q4ZA 4DEAA 3WZUA 2B9FA 2ETMA 3UPXA 2X8EA 3PG1A 4RC3A 3NUPA 5CS6A 3VIDA 2RF9A 4ZTRA 3VWAA 4ZLZA 2YDKA 4PPCA 4MAOA 2QKWB 3MBLA 4YNOA 3RPRA 2UZLA 2PZIA 4EJNA 4YTHA 4FV1A 2C6LA 4RC2A 3DS6A 4XRJA 5FP5A 3GU5A 3GB2A 4GKHA 3FI4A 5CVGA 2AC5A 4JBPA 4M97A 3EQCA 5EDQA 4ZS0A 4O0VA 4F9BA 5C4KA 4J98A 3C4FA 2OJJA 1NY3A 5EHOA 4C7TA 3CTHA 4GYGA 4I92A 5EM8A 4W8DA 4A9SA 4YU2A 4QD6A 1IAJA 4O7TA 3R28A 4MXAA 1OKVA 1XH4A 3CGOA 5AR7A 4BDKA 4NW6A 5EW8A 3UO5A 5HNIX 2XKCA 3KVWA 4K0YA 1P2AA 4ZTLA 3F61A 3W8QA 4HW7A 3OBJA 3FLSA 3FI8A 1J7LA 2FGIA 2QU5A 4U41A 5I3RA 2JDSA 4NTSA 1PXMA 3VS1A 5HLPA 3TIYA 1M7QA 2OF2A 3PJ8A 1LP4A 3OXIA 2QOHA 4GFGA 2WO6A 4Y46A 4RPVA 5I9VA 1ZRZA 2V62A 5AUWA 3R02A 4KNBA 2Z8CA 3GEQA 3SXFA 4DAWA 3EFKA 4RX7A 5A4CA 4GW8A 3KF4A 1OL6A 1Z57A 4IVDA 3MI9A 4EOLA 1H28A 3FMHA 3UGCA 5CU4A 4C58A 2JKMA 2XNGA 3VRYA 4TZRA 3FPQA 4L52A 2PZRA 3KRJA 3WIKA 5DNRA 4A07A 4I24A 5HTBA 3PDTA 5AFVA 4RIOA 3VN9A 4OUCA 5J87A 5HESA 3ZEWA 2WTVA 4IE9A 5HBHA 4FI1A 2P3GX 5IEVA 4ZLYA 2X9EA 5CSWA 2PYWA 5HI2A 3WIGA 3AMAA 2C30A 1YQJA 4XLVA 2Z7QA 4FV9A 4AA5A 2Y4IB 5JKGA 3E7OA 1H01A 2WMRA 4DEIA 5L6OA 4FVPA 3P86A 5EK7A 4O7WA 4XG9A 1BLXA 2FSOX 3KK9A 5HG7A 5GJGA 1WBVA 3ORPA 1NVSA 4ITJA 3NIZA 3H0YA 3OW3A 2WU7A 4RJ8A 1H8FA 5T68A 2F57A 3RCDA 4UV0A 4FZAB 4CNHA 4DH3A 3R2BA 3V5TA 4K77A 4FR4A 3D4QA 1Z5MA 3F2AA 2VWYA 1UA2A 4EK3A 2Q83A 2BTSA 2GTNA 4WBBB 4GG7A 4XBUA 5IUIA 2IVTA 3JPVA 4D9UA 4G3CA 4K9YA 1OM1A 4D0XA 3KULB 4QQ5A 4MK0A 3B8RA 3LIJA 2WEVA 4E6CA 2VNYA 5HO8A 3MB7A 3RWQA 1UU9A 2OZOA 3MWUA 4O82A 3E5AA 4MBJA 3ATTA 4FSZA 2IZUA 1IA8A 3MV5A 3R1SA 4UB7A 4BGQA 2FH9A 2UZTA 2VU3A 3CCNA 3FE3A 4FZDB 3VNTA 4E5AX 1RDQE 2WMTA 2PE2A 3WYYA 4E6QA 2FVDA 3LM5A 4X6QC 4C0TA 4FT9A 4GT3A 5HVKA 2V55A 5CI7A 5HVJA 2VWXA 2VWWA 4RBLA 3ELJA 3MY1A 4C2WA 3QKMA 4FT7A 4HVSA 3CY2A 3FZTA 3QKKA 3CPBA 4BCHA 5AA9A 4DEBA 4KABA 4M12A 3H10A 4YHJA 5E1SA 5BUJA 2C6KA 2E9VA 4FSQA 5C26A 3NW5A 4LUDA 3R8VA 4ANBA 2C69A 4GU6A 4I21A 3RNYA 1OI9A 4EYMA 4O0YA 3VHKA 4YZ9A 4AP7A 3P1AA 3R9OA 4BI2A 3WYXA 1Y6AA 5IZFA 1J1CA 3A4PA 2JKOA 3DQXA 4K6ZA 2EB3A 4RZVA 4F7JA 4RIXA 2ITZA 4AOJA 1PMEA 2IJMA 4OTDA 3KN6A 4C36A 3R8UA 4C37A 4QT1A 1H24A 2J90A 4R3RA 3R1NA 4CMUA 2J7TA 4EH7A 5JT2A 4P2KA 2FO0A 3ALNA 3EJ1A 5JGBA 4CT1A 2V7AA 2C68A 5LWNA 3RGFA 1H0VA 5AUVA 2HK5A 3AOXA 3W8LA 3SOAA 4UYNA 4FKRA 4BZNA 5BX0A 2XNPA 3W2OA 3KY2A 4FIJA 3ZEPA 2ESMA 2GPHA 4W9XA 4ZSEA 4J52A 3ZDUA 2W5AA 4KSQA 2BTRA 2R3QA 3LJ0A 3SXSA 4CZTA 3QCQA 3RAIA 4EC9A 4UEUA 1FMOE 3UODA 5DPVA 4BTMA 4EQCA 4RIYA 5LMAA 4FKLA 4XG8A 4AS0A 1JQHA 1OKYA 2C6IA 4MXCA 3S95A 3A8WA 4AW1A 4TN6A 4R7BA 5M07A 4JRNA 5ITAA 5KCVA 5HNBA 1S9IA 3O8PA 3ZSHA 3NX8A 3F7WA 5CF4A 4OTHA 3H9OA 4YP8A 2H9VA 4DFNA 3BYMA 3GCUA 3EL8A 4EZ7A 2AYPA 3ANQA 2BIKB 3HMNA 3OT8A 2R3HA 3R0TA 2YM8A 2PUUA 4JIAA 4AZFA 4D2VA 3NDMA 2JKKA 2QHNA 3NSZA 2OF4A 2BAJA 2R9SA 4N0SA 5DGZA 4AZEA 1UNHA 4BC6A 4RT7A 5A4EA 3PLSA 4ZK5A 1T46A 5LMKA 2YM7A 1H27A 3G90X 3TCPA 2V5QA 4DLJA 2BRBA 1JLUE 3GC7A 3Q9XA 3EMGA 2YABA 3ZRLA 4BDCA 4D2WA 4EH9A 4IWPA 5CU6A 1Q97A 1ERKA 3MPMA 4MBIA 4L7FA 3O50A 3TT0A 4IHPA 5IUHA 1BUHA 3IW4A 3KU2A 4O6EA 4YJSA 2XKDA 4CLIA 2YIYA 4K18A 5AIKA 2C0TA 3R7YA 3HL7A 3PSBA 3PXQA 5HG8A 2VWIA 5BPYA 5IQCA 4FSTA 1WBOA 4QPMA 4TXCA 2H6DA 4C4GA 4AE6A 4ERKA 3UJGA 2CNUA 5I0BA 2OK1A 4OT6A 3Q32A 5AR5A 3TKHA 4ZOGA 3S00A 2PULA 2X9FA 4DG3E 2NP8A 3TUBA 3SAYA 5LMKC 5IQBA 1EH4A 4IAYA 1OECA 3QQJA 1PMUA 4QMNA 1JWHA 3KXNA 4AA4A 1PMNA 1QPDA 4FX3A 4W4WA 1J7UA 3TDVA 4FVRA 3LFBA 5KE0A 4IX6A 5F4NA 3Q2MA 4OTQA 2VWVA 2R3FA 4NJDA 5HLWA 2X0GA 3MFSA 3LCDA 2QOFA 3FHRA 5D41A 4NCTC 3TV4A 2PUNA 3UQGA 3FZSA 3F3WA 3PLAE 2YM5A 2YACA 5DR6A 4NIFB 3TKIA 3AMYA 4OT5A 4FKIA 5KX8A 4U8ZA 4AT3A 5KMOA 5BVEA 3ORMA 4HCVA 4Y73A 4CZUA 3LHJA 2QOLA 5IA5A 1E1VA 4H3BA 4BDJA 4U80A 3R7VA 1JSTA 3KCFA 4RJ6A 5LOHA 3S1HA 2VTHA 1YW2A 3KXZA 3M11A 4M0YA 3EQGA 1ZWSA 4ZSLA 5M55A 2C6MA 4EK4A 2BILB 3EKKA 2QLUA 3UIBA 3DTWA 2QR8A 4LMUA 5M4IA 5M08A 3BELA 4BL1A 4F7SA 5TF9A 3DK3A 3QRJA 4A9YA 3R04A 4FGRA 2Y8OA 5AEPA 4LOOA 3OHTA 1RE8A 4ITIA 1W98A 1YVJA 4I5MA 2IVUA 4N70A 4PNKA 4YNEA 3HMIA 5DE2A 4FEUA 2JLDA 1RQQA 2REIA 4BHNA 4D58A 2WU6A 2WQMA 1BYGA 3QCSA 3UPZA 2A27A 4O7ZA 3R71A 4DE4A 1ZZLA 4BI1A 2R0UA 2CGWA 4JG8A 4FKTA 2ITVA 4PY1A 2UW7A 1G5SA 1GZOA 2EB2A 3UIUA 3ORKA 3HAVA 1PXLA 2PE1A 5D7AA 4YGAA 4QO9A 1ZLTA 3KVXA 3DPKA 3FXXA 4FL3A 2OIBA 3ZM4A 4E8AA 1MRUA 2IVSA 2F4JA 4BIEA 3KXHA 4M14A 4AZTA 3ORZA 3BBTB 1BX6A 4XG4A 5HOAA 4ZLOA 5IISA 2XMYA 1OUKA 3C5IA 2WKMA 1W84A 3QRIA 5CSPA 4G3FA 5JFSA 1QPCA 3QYZA 5DT4A 3M2WA 4APPA 4B99A 4BCNA 4F65A 5KMKA 1OPLA 1RJBA 3HV7A 4O91A 4JI9A 4B7TA 4PDOA 3H4JA 1XH5A 3DBQA 4HYHA 5K4JA 4RJ4A 2BIYA 3C5UA 1Q5KA 1VYWA 2B9HA 2CLQA 3LXNA 3PUPA 4WNKA 5ANDA 3VUHA 3GOPA 2XZSA 1P4FA 4G9CA 4OTFA 5BQ0A 5L2IA 4ZMFA 2G2FA 1U5QA 3HP5A 4XJ0A 5I4NA 4RJ3A 4ALUA 2B55A 4XCUA 3ZHPC 3ZMMA 3DAEA 3LXPA 3UZRA 2CHLA 4I4EA 2WMAA 5CWZA 2XNMA 4UZHA 2W1DA 1Q61A 2W1GA 4O84A 3ZBXA 3D15A 4DGLC 4J53A 4D9TA 4KIKA 5C8MA 3V6SA 5LVNA 5L3AA 2GTMA 4F4PA 4KB8A 2UZBA 4IFGA 4YJUA 4HVHA 1A48A 4LM5A 5C8KA 3F3VA 2CGXA 2GSFA 1M52A 1J7IA 3H3CA 3KN5A 3U4UA 3OF0A 3A7HA 3RINA 3F6XA 2PU8A 3FLQA 2WZJA 2XP2A 4FGBA 3BBWA 3AT2A 4OW8A 4EI4A 1ZAOA 2ZV7A 1PMVA 4TWCA 4QMXA 5D7VA 5AP5A 3ZLXA 4DCAA 4MD8E 2WMSA 4PP9A 2ITYA 2QR7A 4FL1A 5GZ9A 3PVWA 2BROA 1SZMA 4RIXB 5HICA 4A4XA 5GIPE 3AMBA 3Q04A 4CFFA 4RA4A 4KWPA 3E3BX 3V6RA 3C4XA 3KK8A 5E8VA 2VGPA 2ZMDA 1JKLA 1KOAA 3LZBA 4YR8A 4O7RA 3COIA 4U45A 5I5ZA 3PJ3A 4USDA 4I0RA 3A7GA 5CEKA 5CU2A 5IMXA 5DT0A 5AP4A 4FTUA 1H1PA 4BR3A 4PP7A 4RIWA 3DBDA 4AW5A 5JGDA 4D0WA 4UMPA 2YIRA 2F7XE 1FINA 5AJQA 4EH6A 2PK9A 4JR3A 1W7HA 4HVIA 2GDOA 5CNOA 2OFVA 3U9CA 3WF5A 4BCPA 3KXMA 2PHKA 5DIAA 3VBXA 1JKTA 3FY2A 3U55A 4UX9A 2HWPA 4IADA 4WNOA 2JIIA 4JJRA 4M0ZA 1WBSA 3EN7A 4KRDA 4E5BA 3L9NA 3FV8A 3COKA 3QAME 4RWLA 4O96A 4FZ6A 2XCKA 4P5ZA 3RI1A 4BN1A 2ETKA 4PL5A 2O8YA 5H8GA 4N4SA 1WCCA 4EWQA 3CQUA 3R8MA 3QTZA 4JDHA 5CU0A 4X2JA 1ZYCA 3C50A 4PMMA 5FGKA 3FC1X 5EM5A 3MB6A 4L53A 3VBWA 4DN5A 2V0DA 2G1TA 3PJ2A 5C03A 4QMZA 5BYYA 4C33A 3HV5A 3VO3A 4BHZA 5TE0A 3TNPC 3GC0A 2H96A 2HZIA 3P4KA 5J8IA 4M8TA 1SM2A 2J0MB 2Y7JA 2YFXA 2YJSA 4ITHA 5G1XA 4C59A 4EHZA 4LUEA 2GNGA 3AD4A 3TNQB 4O83A 2C3LA 2WMVA 2RFEA 4S32A 3L9LA 3QCYA 4YZMA 2WD1A 3QHRA 4H39A 4IJPA 3QTQA 2B9JA 4LFIA 5CT0A 4H1MA 3RPVA 4MCVA 4U44A 4XV9A 1Q4LA 5L6WL 1APME 4GYIA 4S34A 4AN3A 5AP7A 5J95A 1ZOHA 5A9UA 2Z02A 5A14A 4R3PA 3OW4A 4LG4A 4PL4A 4PDSA 4TYJA 4TWPA 3DK7A 2Z7LA 3VUMA 3EB0A 4GSBA 4FKSA 4EUUA 3ZS5A 4EOQA 3EIDA 2G9XA 5FWKK 5CF5A 4C8BA 1J3HA 3UQFA 3CPCA 2BHHA 4FOCA 4YBJA 2XNEA 4HCTA 3UP2A 3AQVA 4DGMA 3BLRA 1E1XA 2ITTA 5C1QB 5HO7A 4ANQA 4FL2A 4PMTA 3UMWA 3NUXA 3ODYX 5D12A 3C4WA 2ZVAA 2ZDUA 3BQCA 3D5UA 3OWLA 3R2YA 3FLZA 4B8LA 5ANOA 3QTRA 4UWYA 5CANA 5HD4A 4GIHA 3KQ7A 4V05A 1IR3A 5EI6A 4PTCA 4YO4A 1M2RA 4QMYA 5AM6A 5CQUA 4BY9E 1JOWB 2QOQA 5GJFA 3VS6A 4ZSAA 3L8PA 2UUEA 2WTKB 2RGPA 5C9CA 4DTKA 1M2PA 1ZMVA 4UWCA 4PDPA 1LR4A 4E73A 5BUIA 2YA9A 4UY9A 2C6OA 4QP3A 5HTIA 3G15A 4O6LA 2Y0AA 3IDBA 2ONLC 4KRCA 3G6GA 2OJIA 5EYCA 3WZKA 4D4VA 2CKEA 5DT3A 3WE4A 4W4XA 3N4TA 4M15A 3E87A 4U42A 1PXNA 3M1SA 3HP2A 3PY1A 2WTIA 4BDDA 2W1HA 2J6MA 3EFWA 5J7HA 4KD1A 1YOLA 1FGIA 2XRWA 2NPQA 2C3IB 4ZZNA 2JDVA 3HYHA 3NVKI 4A9TA 4AFJA 3E8EA 3KMUA 1IEPA 4EUTA 4RVKA 5DBXA 4TRLA 4EZ3A 5CYIA 5LJJA 3CBLA 4XP3A 2Y4IC 1SMHA 1R0EA 5ANJA 3MPTA 4OBPA 2PMNX 3D5VA 2OZAA 4KSPA 3UOLA 3U6IA 3ROCA 2OGVA 3IO7A 3BV2A 3DXPA 4HPUE 1PKGA 1BL6A 2C5VA 3K2LA 2C0OA 3F5GA 2QO2A 1ZOGA 3IGGA 5IA4A 5FBNC 2W1CA 4UMUA 3TV7A 5K5XA 3R9DA 5ETCA 5ANKA 5H8BA 1UU3A 4MHAA 3B2WA 3OROA 3ZXZA 2GQGA 3V5PA 3TNWA 2XCHA 4FV5A 4M67A 3PG3A 1CTPE 2GNIA 4A4OA 5JFWA 2BHEA 5FEEA 1H25A 3QQKA 3TL8A 4DHFA 5EQPA 2WGJA 4M68A 4M69A 5DEWA 5A4TA 3MW1A 2EVAA 4BTJA 2B7AA 2WIPA 3PP0A 3QQFA 5T3QA 2R5TA 4L9IA 3ZFYA 2W17A 5AP0A 2B52A 3R7OA 3COHA 3RHKA 2XEZA 3BE9A 3PY0A 4G3EA 4ZMEA 3EN5A 3DCVA 3CJFA 4ZP5A 2R3MA 2VTMA 4I4FA 4ZSGA 4G6LA 2FA2A 4NM5A 3ALOA 2JITA 4FYOA 1O6KA 3WILA 4DEHA 5LWMA 2QVSE 4KIKB 1K3AA 4S31A 2HW6A 1MQBA 4GT5A 5EW3A 4YO6A 2R3RA 2R3IA 3TKUA 3UVPA 3T3VA 4WG3A 4YTCA 5A4LA 4CEGA 4EK8A 2WTJA 3UE4A 3E3PA 4CT2A 4FKGA 2GNHA 4G34A 3SLSA 2CCIA 2IPXA 3SVVA 3AGLA 3EQHA 3G0EA 3MJ2A 4FC0A 3WF8A 4YZCA 4ZY4A 5HORA 3TJDA 2PVHA 4EH5A 2XKEA 1Y57A 3C0IA 4CKRA 5JFVA 3CKWA 2YAKA 4IAIA 1OKZA 3ULZA 5GNKA 2B0QA 2GNFA 3D14A 5D1JA 2R64A 2BRNA 2C1AA 5BVWA 3VS2A 4APCA 3I5NA 3DDPA 3Q4UA 2PZ5A 4HYUA 3ZYAA 3NPCA 1OIRA 4D2RA 4K1BA 5EYKA 1L3RE 4QMPA 4IC7A 1KWPA 3LW0A 3IECA 5HBEA 1YI6A 3KC3A 5CSHA 3HRBA 5H2UA 2HY0A 4I22A 5JH6A 4J8NA 2EU9A 1TQPA 3MH0A 5AV1A 2VAGA 4MD9E 4L43A 3V5WA 3SC1A 2BZJA 4V04A 4L6QA 4A4LA 3DB8A 3C13A 1P5EA 4L3PA 3LM0A 3DJ6A 3C0HA 3HZTA 2I0YA 3AC4A 4EK5A 1IRKA 4MBLA 1JVPP 4C3RA 2NNWB 5I3OA 4G16A 5J79A 2YITA 3FLYA 2PWLA 5DR9A 4BDFA 4CD0A 4ENXA 3A7IA 2PZYA 2XS0A 4WUAA 4K8AA 4CZYB 2A19B 1MRYA 4QPAA 3ZU7A 2UVXA 5FQDC 5KBRA 3BU6A 5H3QA 4IANA 4RQKA 5AV0A 2I0VA 4RC4A 2R7BA 5BYZA 3VQHA 4BFMA 4DYMA 3KREA 5EOLA 5KZIA 3RPYA 4AGUA 2JFLA 4O81A 3MFUA 5CF6A 5A3XA 4E20A 3IW7A 5AR2A 2OICA 3C9WA 3LMHA 4QQCA 3HKOA 3OD6X 3GXLA 2XK3A 3D7TA 5IA3A 3NWWA 4PL3A 2ZB0A 4XG7A 1Q8YA 2HYYA 2OWBA 3LLTA 4AF3A 3MDYA 4J7BA 1H1WA 4L67A 2E9UA 4X6RA 4ALVA 5IH6A 5LVMA 5LVOA 1PXOA 4F6UA 4DH5A 3RWPA 4BF2A 3DKCA 2C4GA 4ASDA 2C5YA 2XK9A 2C47A 2BZIB 3ORNA 3DV3A 3L9MA 2PVNA 3DZOA 2IW6A 3IS5A 4NIFA 3TG1A 4D2SA 1NVRA 2XNNA 3SDJA 1OGUA 1WZYA 1L8TA 1R0PA 1B39A 2OJGA 4GUEA 4EH4A 2NO3A 1ZYJA 4TWNA 4Y5QA 4ZEGA 2I1MA 4XUFA 3T9IA 5M4FA 2UZNA 5DEYA 4USEA 3OS3A 3BU5A 1U59A 2XNOA 4TYHB 4ZY5A 4XEYA 2R3KA 3EFJA 4FIGA 2XIYA 2GQSA 4AX8A 2X7GA 3JXWA 4U7ZA 3L8XA 3RAWA 4B0GA 3PA3A 3QQLA 2XRUA 1P14A 4IWDA 3QWKA 4A7CA 4IAAA 3LPBA 5EQEA 4FICA 4HCUA 3RJCA 4E6DA 4AOIA 4L68A 3Q5IA 4Q9SA 3QXOA 2OLCA 4WNPA 5E8UA 4BYJA 4MH7A 5M53A 4RJ7A 4W4YA 3QRUA 1DS5A 3FZOA 2ACXA 4F6WA 5IKWA 2JBOA 3LXKA 1XBBA 5AIRA 4L00A 5H9BA 1Q8UA 3AC8A 1H07A 1QL6A 3HA6A 5EHLA 2W1FA 3AD5A 4XP0A 4NUSA 4KBAA 4NEUA 4PQNA 4R3CA 4XG2A 5JSMA 2ZB1A 5HE1A 1Q8TA 4E5WA 3UO6A 3KGAA 2YCFA 2VD5A 3PFQA 3GP0A 1TQIA 5GJDA 3ZFMA 2JFMA 4LV5A 4QTDA 3HV6A 3LFEA 3Q52A 3OTVA 4FTJA 3VBVA 2GFSA 5ICPA 5IA2A 4F0GA 4GRBA 4F9YA 3QLGA 5A4QA 3VJOA 3FHIA 1OIUA 4DBXA 3F3ZA 2P2HA 5CY3A 5AP6A 3G6HA 3P78A 3RCJA 3ZO4A 4YBKA 3R01A 3K3IA 4UMTA 1WBTA 3CD8A 2JEDA 4FOBA 1QPEA 2EXCX 2UW5A 3KXXA 4YHTA 3F88A 3SD0A 4M13A 4F9WA 5FG8A 4DH1A 4EHVA 2OZAB 4FK3A 1NW1A 2RL5A 4I5CA 3WBLA 3N51A 2UVZA 3IONA 3ZSGA 4FV8A 4W9WA 2OH0E 4I6FA 4AUAA 3BKBA 3CTQA 1ZXEA 4R7IA 4FKQA 3LCSA 2J0JA 4P4CA 5IMEA 4MYGA 4MXYA 4BIBA 1CDKA 4GK3A 4CFXA 4BDGA 3F2RA 1VYZA 3GU6A 5EDRA 5KO1A 3PYYA 4IB5A 4QP1A 4IMYA 5BVNA 4Y5HA 5HEZA 5KMJA 1PXPA 3Q2JA 3W2SA 2W7XA 3P79A 2XIRA 3K54A 1F0QA 2DWBA 3RHXA 1LUFA 3PVGA 4M69B 4RWJA 3LCTA 4UYAA 4H36A 1KE5A 4ZZMA 3RTPA 3UIMA 4DEGA 3NEWA 2QC6A 5B2MA 5AUTA 3OMVA 3FSFA 3I81A 4IEBA 4ZS4A 4GKIA 4FNYA 3QTXA 2YISA 3D9VA 3DBCA 1ZARA 4M66A 3VQUA 4NT4A 3OG7A 2W4JA 2FB8A 4M7IA 4KIOA 4YTIA 2PUPA 1Q41A 5M44A 2X7OA 3W18A 3FZPA 5IUGA 4ASXA 2XK6A 4LYNA 5BVFA 4I3ZA 3DQWA 5ACBC 2KTYA 2GNLA 3GGFA 3PXRA 2SRCA 3R9NA 5KMLA 2HAKA 2VX3A 2I7QA 4U81A 4YZNA 1YRPA 2HOGA 2VN9A 2WPAA 2XJ0A 4Y83A 4FUYA 3VBTA 3I7CA 3DJ7A 5CAPA 3RM7A 5B2KA 1PW2A 4FKPA 3PPJA 3ORTA 4FEWA 3EQDA 3NVMB 2XEYA 3HLLA 5FXQA 1BL7A 4UMRA 3II5A 2NRUA 4J1RA 4JR7A 2FSLX 1TVOA 1U46A 2P55A 2XUUA 4L44A 1GIJA 2CNVA 2J4ZA 2WFYA 4IM2A 3F2NA 3GNIB 1HOWA 4FK6A 4EOSA 3N9XA 4L45A 3MVLA 4WOVA 4Z55A 2BDWA 4NZWB 1FVVA 1RW8A 4IDTA 5JK3A 3FMNA 4DA5A 2VTOA 1REKA 2BRGA 5KBQA 5ACKA 3DTCA 3GFEA 2JDRA 3MTLA 5C27A 5GZAA 3MY5A 2W9ZB 2QURA 4J71A 4OLIA 4QTCA 4EORA 2CKQA 2F7ZE 1G8SA 2Y4PA 2QO9A 2W4KA 1QCFA 3ETAA 1YHVA 3EWHA 3GBZA 3QX2A 2FYSA 4C4EA 1B38A 3KRWA 3P7CA 4HGLA 3V04A 5KHWA 3EL7A 5DLSA 4E4NA 5AX9A 3O8TA 4RX5A 3ZUVA 4CFNA 3V3VA 1SYKA 2JDOA 1JNKA 4PV0A
chains in the Genus database with same CATH superfamily
3SKCA 2CJMA 4AAAA 3FEGA 3Q4TA 4FKWA 3EN4A 4U9AA 1TQMA 2XBAA 3REPA 3FSKA 2UZDA 5BMSA 1GZ8A 4OAUC 3NNWA 3OWKA 5CEOA 4I6HA 4FJVA 1Q3WA 3EYGA 1MUOA 3HMOA 4LMNA 3OUKA 4XV3A 3BHYA 4AW2A 4DFLA 3ORIA 5GZ8A 4AQKA 5IU2A 3SGCA 3U54A 3TV6A 1OL1A 3EQFA 5F1ZA 1I44A 3NYNA 2B9IA 4HZRA 4ERWA 1UU8A 4ZSJA 1O6LA 2BCJA 4YLLA 3UQCA 4N57A 1WBNA 3ORLA 3DJ5A 3Q6WA 4XRLA 4K2RA 3OCGA 3O96A 3QGYA 3D7TB 2ZV9A 3QTSA 4XOZA 2QG5A 2EUFB 3GU7A 4AZSA 1MRVA 1XBAA 4BZOA 1Y8YA 3LJ2A 5ANIA 4ZTNA 2DQ7X 2OXDA 3FXZA 3LAUA 1AD5A 3R7GA 5AAEA 3QD0A 2FSMX 5CAUA 3PA5A 4BWKA 2XYUA 4CCBA 2QU6A 5KNJA 2XIZA 4IB0A 2A4LA 3GI3A 4NM0A 4WG5A 5IQFA 4ACHA 4QMWA 3RKBA 1JKSA 3R7IA 2YIQA 3T8OA 3ZC5A 1PYEA 4O0RA 5T6KA 3FI3A 3HEGA 4DTAA 4FNWA 4R5SA 3JVRA 4XG3A 3BYUA 2X6DA 3GC8A 1PHKA 3A4OX 3QUDA 2F7EE 5E8WA 2QD9A 2UVYA 4I23A 1ST0A 4HOKA 4AU8A 5EG3A 4RFMA 4O21A 2ZAZA 3G51A 3PXYA 3F5UA 2X1NA 4AXDA 2OBJA 3ET7A 3UDZA 4F63A 4YPSA 5FDPA 2ZM4A 4YJTA 4NWMA 2RFNA 4C2VA 2KULA 3ITZA 3TXOA 3ZLSA 5JZJA 4PNIA 5JMSA 3E8CA 3DXQA 2YCRA 1YXUA 3BV3A 5CENA 2HW7A 3GCPA 3JS2A 2WOUA 4I5PA 4MWHA 1FQ1B 4XV1A 4JQEA 5DRBA 3DDQA 5J1VA 4I0TA 3HV4A 5DYJA 5EQYA 2JAMA 2JC6A 5CSVA 4C3FA 2WTKC 3A61A 1AQ1A 4PRJA 2P0CA 4C62A 4F7NA 1Y91A 4IBMA 4GG5A 3FQEA 2VTTA 3ZONA 3ACKA 4FEQA 4IW0A 3TZ8A 4RX9A 3VS5A 4Z9LA 4BTFA 4MNEA 4JNWA 3OCTA 2BRMA 1YHWA 4IAZA 4DG0E 4QDVA 4LRMA 4IZAA 4YJPA 3EOCA 5EOBA 4FF8A 4YZDA 3LXLA 3POOA 4GMYA 4KIQA 1ATPE 2JDTA 3CKXA 4JDIA 4C4JA 3FXWA 3ODZX 4ENYA 2W1EA 4EONA 4FTKA 3RZBA 4FTRA 3ZRKA 3DAJA 4AXFA 3OWJA 3AD6A 2O63A 4CKIA 2G2HA 3UO4A 1KE8A 2R3GA 5DI1A 3SG9A 1WVXA 2F2CB 4GVJA 2G15A 5KMIA 5I9UA 2GCDA 4ANOA 3UDTA 3EHAA 5AX3A 3VS7A 3BL7A 4DFBA 5J5SA 1GOLA 5CEPA 5CVHA 4D28A 2W05A 2BAKA 1OIYA 4WG4A 4I94A 4MEDA 2GS7A 3UDBA 2IW8A 5KKRC 4TYIA 5L2SA 4L7SA 1Y8GA 3WZDA 3W0RA 3UIXA 3NCGA 3F69A 3OOGA 3QWJA 4B4LA 2PMLX 2VTAA 4MXZA 1I09A 3SQQA 4MF0A 4G31A 4XBRA 1OPJA 1PXKA 1T45A 1U54A 2WMXA 3I0QA 3MN3A 3TWJA 2ITUA 3COMA 4CQGA 2VX1A 3DGKA 1G3NA 1JSUA 2ITQA 4TNBA 2BKZA 5F9EA 3UZPA 2OO8X 4E7WA 4FODA 4BB4A 5KMNA 2EXEA 4EH2A 3AC5A 1VEBA 2P2IA 3LFCA 4TW9A 4J95A 3DKFA 4FZFB 1A9UA 3BPRA 3KXGA 4RWKA 4CSVA 4FV0A 2R4BA 3VF8A 3BI6A 2RG5A 1XWSA 3IW8A 5FBOA 3HMPA 1Q8ZA 2QQ7A 5EKNA 3AC3A 4GJ3A 3QKLA 3C4EA 3QD4A 4IM0A 3NGAA 4EH3A 2VGOA 2GHGA 3GU8A 1W83A 2R3JA 4JT3A 4EWHA 3R9RA 2BKKA 3MA6A 5IF1A 3U6HA 4NM7A 2QO7A 1H0WA 4JIKA 3BYOA 3GT8A 3N4UA 4JS8A 5HG9A 4E26A 2WIHA 3QFVA 3LOKA 3KMWA 2AC3A 3EZVA 2Y9QA 4BDEA 2A0CX 4QOXA 1J91A 1V1KA 3HAMA 4WBOA 3AKKA 4DGGA 2BDJA 1FVRA 1W2FA 2BPMA 2B53A 2ZV8A 3AG9A 5I9XA 4D55A 5D11A 4RQVA 3UG2A 3H0ZA 4QMUA 3CLYA 4BI0A 3TZ9A 3E93A 2ERKA 4JBQA 5CEIA 3V5LA 2XF0A 4BBMA 4UN0C 2X2MA 5HCZA 3ANRA 4WRSA 4UWBA 1H4LA 1UNLA 3JVSA 4LRJA 3Q60A 4HYSA 2YHVA 4S33A 4EHEA 1PF8A 5AR4A 5FTGA 5A54A 1H26A 3FKLA 3E8DA 3TNIA 3KEXA 1YXVA 3OUNB 3L9PA 5E7RA 2YDJA 4FSYA 3BGPA 3LFQA 3P23A 3NS9A 2Y6OA 2PMIA 4YUQA 4EL9A 1HCKA 1XH6A 2RIOA 2HELA 3QCXA 3U4WA 3SRVB 5CAVA 4EOIA 1AGWA 4G1WA 4RWIA 3BWFA 3ZTXA 3PIYA 4JAIA 4OTWA 4RA5A 5FRIA 5HD7A 4I5HA 4ZTHA 3MFTA 5K0KA 3QL8A 2BRHA 3MVHA 3CXWA 5I9YA 5K5NA 5DH3A 1UVRA 3O71A 3Q9ZA 3GQLA 3A8XA 4CMTA 5M51A 4LI5A 2XBJA 3BGQA 4FV6A 3UOHA 3VUGA 4XNEA 4DBNA 4F64A 3KRLA 3H9FA 4I1ZA 1SVHA 4EEVA 5LCJA 4M84A 4EH8A 3F66A 3ZLWA 3HDNA 1GIHA 3EN6A 3UVRA 4TYHA 3IK3A 4JX7A 1WVWA 4Y8DA 3E8NA 2YEXA 4Z16A 2X81A 3OEZA 1H00A 4I6BA 3WOWA 3PRIA 4Q5EA 2VX0A 1DAYA 1W8CA 3I79A 4KINA 2GNJA 4X3FA 3DA6A 4FG8A 4IIRA 1VR2A 2ZDTA 4KKGA 4C61A 3Q3BA 4P90A 4V0GA 1GY3A 4CFUA 5AADA 4EOOA 2XH5A 2BALA 3Q9YA 4QMQA 4LL5A 3ATSA 4IX3A 2YM3A 4Q5HA 2C5NA 1CMKE 2FSTX 3PJCA 3W1FA 4MVFA 3QD3A 4CLJA 3C1XA 5AP1A 4XS2A 4QYGA 1KUTA 3HGKA 1FPUA 3U9NA 3I6UA 3NNVA 2VTRA 5FM2A 5TKDA 3W2QA 4CG8A 2X6EA 4DH7A 4FKOA 2J0LA 2QOKA 2HXQA 2VZ6A 3E92A 3RALA 4EOPA 4U97A 5M57A 4X3FC 3FMKA 1MP8A 2W4OA 3VHEA 1YDTE 2WMWA 2ZJWA 5TOZA 2YWPA 3UYTA 5FUTA 2WMQA 4ANMA 2QONA 4WKQA 1UWHA 4WRGA 2ITWA 2PE0A 1R3CA 4EQMA 3ZDIA 5I9ZA 4BJJA 3HMMA 1YI3A 4AN9A 4QTAA 4YC3A 4YLJA 4F70A 4F09A 1YXXA 4DT9A 3KFAA 3P08A 3A7JA 1Z9XA 3TI1A 1U4DA 4ZZOA 4AACA 5AV2A 4BKYA 5FTQA 3EFLA 5BNJA 4NK9A 4FA2A 1ZY4A 3ZRMA 4F1TA 2FUMA 5IH5A 3VS0A 4A9RA 4LGDA 1Q24A 5LVLA 4EOJA 3GENA 5M4CA 2ZMCA 4MNEB 3VULA 2ITXA 4WSQA 2B4SB 2XKFA 4XH6A 4BCMA 5KMMA 1E9HA 4AQCA 3NYVA 5H8EA 5HE3A 5BUEA 4GCJA 3IPHA 4FVQA 2OXXA 2X7FA 5IA0A 3FLNC 3AGMA 4FEVA 3GCQA 4DLIA 2YCQA 5KKRB 4O2PA 4D4YA 3W2CA 3W10A 2QOCA 3LE6A 3LQ8A 4LL0A 1KE7A 5AV3A 3NZ0A 2UZUE 4L3JA 3HECA 3P9JA 4DFXE 4DCEA 1XHAA 3EZRA 2VTPA 1OVEA 4IC8A 4FTLA 4C35A 4BDIA 3PVUA 3JR1A 4ANLA 3E62A 4BBFA 5BYLA 4JG7A 5M06A 3PZHA 1IASA 2XJ1A 2UW6A 4L46A 3O51A 1R78A 2CCHA 3WF6A 4UXLA 3RP9A 4CTCA 3BLHA 4ORKA 2IW9A 3L8SA 3OCBA 4G6OA 3TZ7A 4E93A 4ZIMA 2I6LA 2HENA 3DFCB 4O7YA 4EBWA 4U40A 5IA1A 3O7LD 2UW3A 4L01A 2E9PA 4QTBA 4HZSA 2PVLA 3PWYA 4S2ZA 4TT7A 1CKJA 4W4VA 5DWRA 5AWMA 3BU3A 1H1RA 3S3IA 4L3LA 4CTBA 2YERA 5CNNA 3W0OA 5CX9A 4QNYA 1YOJA 3PXFA 3ZXTA 2OFUA 5LVPA 3ENMA 4TKSA 1KE6A 4H3QA 1U54B 4II5A 4O4EA 4ONAA 3WF7A 1BMKA 2UZEA 4HGTA 4YC6A 3W16A 4YHFA 2YZLA 2R3LA 4HJOA 4F1OA 5A6NA 5DG5A 3KB7A 3POZA 4LGGA 1XR1A 4FKVA 3BCEA 4OTIA 5IPJA 4RLLA 5CQWA 3HRCA 4QP2A 3WF9A 1QPJA 2X2LA 1M2QA 4MWIA 3VVHA 3DKOA 3I60A 4HYIA 3CQEA 4HPTE 1ZYDA 4E4LA 2JKQA 4IM3A 3SX9A 5IQAA 3R22A 2ZM1A 4G6NA 3QZHA 4GH2A 4DFYA 3W33A 4LRKA 5CAQA 3N4VA 3DB6A 5CASA 2VV9A 4YJRA 2O64A 1R39A 4GUBA 3IDPA 2OIQA 4ZTMA 2EWAA 4G3GA 4AFEA 4JG6A 5M56A 4U43A 5EH0A 2WQOA 3JYAA 2JIUA 2X8DA 4FRFA 4C3PA 2R7IA 3G9NA 3IOPA 4IZ5A 4UBAA 4CVAA 3FLWA 3BYVA 3QA0A 4FV3A 3VUIA 3PVBA 3PXZA 4DGOA 1YWVA 5AM7A 1IA9A 3SHEA 3LLAA 4F9AA 1WFCA 4IZ7A 4GK2A 4MKCA 4QMMA 4O4FA 5AMNA 3LCKA 3VS4A 2W5BA 5C4LA 5EM7A 4BCQA 4HGSA 3ZBFA 3WARA 4AT5A 2PVRA 3ZOSA 4K11A 1YKRA 3DAKA 5DMZA 3QU0A 4FTTA 3UOKA 3NYXA 1XH9A 2VO0A 3LVPA 1W0XC 4QP7A 4YZBA 4CRLA 2IZSA 4NKSA 4FKJA 2ZYBA 5HIEA 3BEGA 2QKRA 3P7BA 4AG8A 5B7VA 4Y85A 4CYIA 5BVOA 5EDPA 3PJ1A 4QDEA 2I0HA 4RSSA 4BIDA 1ZY5A 2ZM3A 3OCSA 1LPUA 5F94A 4ANNA 4QMOA 5JQ8A 1Y6BA 2PTKA 3V8TA 4CFVA 2X8IA 1MQ4A 2VO6A 3R00A 3ULIA 4ASEA 2V7OA 4PMPA 5CU3A 2WQNA 3NW6A 3BWJA 4TYGA 2C6EA 4QP8A 4U3ZA 4DGNA 1M7NA 2VUWA 4FSMA 1YI4A 4Z7GA 3B8QA 4OTRA 5BMMA 5DRDA 3JUHA 3UC4A 1YXSA 3OWPA 3AC2A 4KUJA 3NFFB 3OC1A 2C1BA 4DEEA 4C4FA 4JDJA 5JRSA 3V5JA 4R5YA 5A46A 2WOTA 2PSQA 3E7VA 3OXTA 4JQ7A 4QYEA 3ROYA 3FKOA 5CT7A 4G5PA 2YM6A 4IX5A 4CFWA 4CV9A 4BGHA 2QODA 1O6YA 3PE1A 3W2PA 5E9EA 3MIYA 4X3FB 3FY0A 4RGJA 3IW6A 2W1IA 3I6WA 3QQHA 4V0GB 4X0MA 2W0JA 3TTIA 1YWRA 2YZAA 3Q6UA 4KS8A 4CQEA 1UNGA 4AGCA 3OFMA 5CAOA 2QG7A 3RMFA 1KV2A 3ZZEA 4LV8A 2IZTA 4H05A 5AUYA 4G2FA 5GIOE 5HIBA 2GFCA 3FUPA 1KV1A 1IG1A 4O0TA 3QQUA 2HZ4A 3C51A 3MPAA 3QHWA 4WUNA 4ZJJA 4H58A 3WE8A 3PPZA 3PSDA 4PWNA 3ZC6A 3CSVA 3D7ZA 3BIZA 2F49A 2O2UA 4OGRA 5EI8A 5E8TA 2PVMA 4OBQA 3T9TA 3FMDA 2WTCA 2XVDA 2W96B 4BWXA 4PUZA 2OG8A 3RZFA 3PPKA 4FNZA 4I20A 1OUYA 2OU7A 3IW5A 2PL0A 5FM3A 3HUBA 4DINA 5AR8A 3RPOA 2GMXA 3MVMA 4FIHA 3RBWA 2B54A 2WEIA 4F6SA 3IDCA 3UZTA 4PPBA 1UV5A 3DY7A 3PFYA 1ZOEA 2BZHB 5HU3A 4U5JA 1ZMWA 1PY5A 4BJJB 4IJ9A 1Q99A 2UW0A 3JY0A 5J9LA 3HRFA 4JMQA 3QUEA 2VTIA 3EQIA 3U8WA 4JXFA 4E4XA 2YJRA 2VO3A 3VUKA 4XG6A 5JEBA 2C6TA 4X3JA 3G9LX 4FTNA 3D94A 3QTWA 4FTIA 2G01A 4NH1A 4RVMA 1YDSE 4B9DA 5IDPA 3DOGA 1BI8A 3RAKA 3HDMA 3TN8A 1NVQA 2WELA 4CKJA 1SNXA 2Z7RA 5JZNA 3OY3A 4I0SA 4D4RA 4R6VA 4YSMA 2Y6MA 4AGWA 3D83A 3EKNA 3SW7A 1QMZA 3W0QA 4JLCA 4AW0A 4R1VA 2WTWA 3SG8A 5D10A 2PVKA 2CMWA 5HX6A 4BICA 4E3CA 1F3MC 3MS9A 3DT1A 2H34A 4G3DA 5FP6A 1GJOA 5KHXA 4GVAA 1A06A 1H1QA 2BR1A 5DVRA 4O1OA 3OTUA 5DN3A 1OIQA 4KA3A 4XX9A 4E4MA 2J0IA 4DG2E 3PY3A 3UVQA 3BHTA 4GK4A 4WD5A 5AV4A 2JGZA 4YC8A 4RMZA 3HA8A 5CTPA 4AZWA 4FEXA 2VTLA 5HHWA 4QYHA 2BFYA 2A1AB 4IVBA 3FQSA 4BYIA 3LFSA 4NKAA 3ZFXA 5E90A 3F82A 3QA8A 4FV7A 4QP9A 4RZWA 3BL9A 2J9MA 5C01A 2GHLA 3I7BA 2YIXA 1K2PA 3F9NA 4FTQA 2LGCA 4BDBA 3MTFA 1WBWA 2R3NA 4FTAA 4J8MA 2BZKB 5ETIA 2XM8A 3GUBA 3VS3A 3QXPA 4R78A 3R30A 4A9UA 3AXWA 3BZ3A 5KUPA 3QBNA 3QZFA 4I93A 5F95A 3ZLYA 4JOAA 3TUDA 4Q2AA 4TNDA 5AUXA 4NW5A 2YDIA 4B8MA 4CV8A 4RVTA 3MH2A 3CQWA 4ACDA 4NTTA 4O0WA 1URWA 4JL9A 2O5KA 2EXMA 1LEWA 4Y95A 4OR5A 4CFMA 3GC9A 5BVKA 5HE0A 4BKJA 1YXTA 4J96A 5CZHA 3R21A 3V8WA 4ACGA 1FVTA 3FAAA 4O38A 4I6LA 4I6QA 4QYFA 2R0IA 4X21A 3ZSIA 2J5EA 2IG7A 4D1SA 5ETAA 4D2PA 2PVJA 3CY3A 1YHSA 1GZNA 4XP2A 4QQTA 4KAOA 3BRBA 3BX5A 1GNGA 3R8ZA 3RK5A 4MTAA 1J1BA 4NFMA 5ETFA 3EQPA 5HVYA 3R8PA 3NYOA 4GV1A 3M42A 4MQ2A 4O0SA 3BGZA 1ZYLA 2H8HA 2VTNA 3LFFA 3TZMA 4YTFA 4AT4A 4BCKA 4BCIA 1OBGA 5AAGA 4BCJA 3MSSA 3MH1A 3FDNA 2RFDA 4DH8A 2XARA 3QYWA 4F99A 3KRXA 2BUJA 4FIFA 3BYSA 1YDRE 2UV2A 3KMMA 5TT7A 3THBA 3DLZA 3GOKA 4AN2A 5HZNA 3SRVA 3ZM9A 4QRCA 2CDZA 5AUZA 2IWIA 5IEXA 2ERZE 4FE2A 5HCYA 2VTQA 3UNJA 3FMJA 3T3UA 3ACJA 3HX4A 4AGDA 2HZ0A 4FG7A 3OXZA 4O7SA 2C3KA 3O7LB 3FZRA 1JSVA 1XJDA 4A06A 2DYLA 2PVFA 3ZO3A 5E8XA 5JFXA 2YLFA 1KSWA 2GHMA 4O7NA 4AWIA 1TKIA 2XYNA 2X39A 4XYFA 5DOSA 1DI8A 2O3PA 1FMKA 3HV3A 1UKHA 2Z7SA 3QTIA 5HNGA 4EKLA 5LMBA 3IGOA 3NMUF 4O1PA 3ID6C 4X2FA 3DXNA 3MGYA 3R8LA 2ITOA 2JBPA 3K3JA 1GAGA 1WMKA 3FC2A 5EKOA 4J97A 4CYJA 1SVEA 1GZKA 3ZUTA 4FTMA 4EHGA 4F7LA 3FZ1A 4NCTA 2DS1A 3R6XA 3DNEA 5LXMA 3RAHA 3FBVA 3ZCLA 4FV2A 2ITPA 5B2LA 2J51A 4BKZA 2CN8A 4WIHA 3PE2A 5IQDA 3NUSA 1XH8A 3R63A 2PVYA 2J0KA 2Z2WA 3DBFA 5E8SA 2HZNA 3QC9A 1PRYA 3CE3A 3NUUA 5TO8A 2W1ZA 5HG5A 2OKRA 4IVCA 3UP7A 2C5XA 2OJFE 3PXKA 2YIWA 2E9NA 2AQXA 4D1ZA 4YJVA 3Q53A 2JIVA 4CG9A 3C7QA 3FYKX 3GCVA 5C8NA 4PPAA 3KKVA 1XBCA 4XHKB 1CM8A 1ZZ2A 2C0IA 2CGVA 1H08A 3F5PA 3NUYA 5E1EA 3SV0A 3NCZA 2BDFA 3NLBA 1VZOA 3D2IA 3MJ1A 4LV7A 3LKMA 3K5VA 4E6AA 2PZPA 3FJQE 5L8LA 3A62A 4EK6A 4TTHB 4FUXA 2X4ZA 4F0IA 5HBJA 4DHIB 5FXRA 3QTUA 4IZYA 3C0GA 4MXXA 4YSJA 1DAWA 2G2IA 4EC8A 3IOKA 3JY9A 3S4QA 3R9HA 1W82A 3KL8A 4FG9A 1OL7A 4X2NA 3HUCA 2WHBA 4FT3A 3LFDA 5J9YA 4MUQA 2UZOA 4S30A 4GFMA 4GL9A 4IACA 5IH4A 3SA0A 3RNIA 3FYJX 4PTGA 3QZGA 2E2BA 4FSUA 4O22A 4YJNA 4FT5A 1OL2A 5DR2A 5AP3A 5L2QA 5I9WA 5A6OA 5J5TA 4O7LA 2GS2A 1Q8WA 4RRVA 1FBNA 3CGFA 1JAMA 1OGYA 4DEDA 3S2PA 2WXVA 4E1ZA 3GFWA 4LQMA 4ZXTA 2VTSA 5CSXA 4EQUA 3VUDA 2VNWA 3ZZWA 3AKJA 4PMSA 4U79A 1URCA 2CPKE 1UU7A 3DBEA 4IDVA 2PPQA 3OOMA 3GQIA 1KOBA 2BVAA 3DKGA 4FYNA 4QMVA 4UZDA 3UOJA 2GU8A 3OY1A 1B6CB 3GVUA 3Q96A 4FNXA 2HY81 4O27B 4U6RA 2WQEA 3WZJA 5JRQA 4ZTSA 2VRXA 3G0FA 5FXSA 4YURA 1XKKA 2C6DA 3NAYA 4FIIA 4IB3A 4O7VA 3HNGA 3VW6A 4RFZA 3FWQA 3UTOA 3EQRA 3FMEA 2UW4A 3NFGB 3PA4A 4MQ1A 4WNMA 5FEDA 3V51A 1ND4A 4G5JA 5IQGA 5E8ZA 4WA9A 2GQRA 2Q0BA 3UNKA 4IFCA 4BCOA 3FI2A 4YLKA 5AUUA 4FSRA 3VONA 2UW9A 3TEIA 3LFNA 3A2CA 1PXIA 2XIXA 3R1QA 2YCSA 3KRRA 1F5QA 3D5WA 5G6VA 3U6JA 4MD7E 2Z60A 3W55A 4TPTA 5AAFA 4GJ2A 4Y72A 5EYDA 4TL0A 2UW8A 5IEYA 5J7BA 3D5XA 4UMQA 1X8BA 5CXZA 5HX8A 2P4IA 1DM2A 2W5HA 3I4BA 5E91A 3VBYA 2CNQA 2F2UA 2XK4A 4YJOA 3NAXA 4IX4A 3QX4A 5CALA 3SW4A 5E92A 4FBXA 3BEAA 4ACMA 3I1AA 1GIIA 3LCOA 5HE2A 2QCSA 4DITA 3MY0A 1OKWA 3LQ5A 1CKIA 3CS9A 4TY1A 1UKIA 3ZUUA 3MVJA 3CR0A 4FKUA 2J5FA 2DUVA 3FMMA 1ZMUA 4RVLA 3QC4A 4O86A 1Q3DA 4QYYA 3L1SA 2XB7A 3E64A 3R7UA 5HU9A 2WMUA 5J9ZA 3WI6A 3F5XA 4BTKA 3S0OA 1SNUA 4CRSA 1V0BA 2BMCA 4L42A 4QMLA 4U3YA 3UG1A 1M17A 2YLEA 3FL5A 4TYEA 3BHUA 3PTGA 4QNAA 3LMIA 3PUFC 5EYMA 3V5QA 1CSNA 4JBVA 2IZRA 4I41A 4RG0A 4AXAA 3QRKA 4C38A 5M4UA 4AXCA 4KIPA 2PUIA 3V01A 4KBCA 1IAHA 3U51A 5J1WA 5AP2A 3R1YA 3R73A 4YPDA 4GT4A 4YMJA 2GS6A 1JKKA 2O0UA 2UZWE 3QGWA 2HCKA 3ZO2A 2X2KA 3I5ZA 4M3QA 2LAVA 3D0EA 2A2AA 4QPSA 5F20A 1M14A 3G2FA 2R3OA 4IAFA 1OPKA 4P7EA 5CLPA 3TJCA 3OVVA 4UALA 3ZO1A 4AA0A 2RKUA 4D2TA 3G5DA 1V0OA 3VW8A 4O2ZA 3QALE 4IXPA 5IQIA 3MA3A 3DU8A 3IQ7A 5CXHA 3KA0A 5LARA 4RIYB 4KS7A 3Q9WA 4O0UA 2E9OA 5K0XA 4LGHA 3A99A 4R7HA 3P5KA 2I40A 2XNBA 3AC1A 3TACA 3G33A 3E88A 4GEOA 4C4HA 4D5KA 3LQ3A 4R8QA 2AUHA 5IG1A 5TR6A 1O9UA 2X4FA 5K4IA 3NUAA 1REJA 3F3TA 3TM0A 1OL5A 2VWBA 2OI4X 1XH7A 4LOPA 3W0NA 3L8VA 1FGKA 2HIWA 1TZDA 5JN2A 4JBOA 3NR9A 4NSTA 4ARKA 1NT2A 4R1YA 3DFAA 3ENHA 3LFAA 5HKMA 1WAKA 4D1XA 1KE9A 5L6PA 1OMWA 3GCSA 3F7ZA 3A7FA 3FL4A 1LEZA 4QMTA 3DZQA 4FTOA 3DK6A 4MX9A 4G9RA 3QD2B 3BQRA 1XQZA 4FMQA 4C02A 5GINE 3LMGA 4K33A 4OAVB 2HWOA 3AT3A 4QP6A 3VRZA 4Z7HA 4BBEA 2W9FB 5FEQA 3PP1A 4LOQA 3UMXA 4ALWA 4X7QA 2C5OA 4WSYA 3ERKA 3VUTA 2NRYA 2ITNA 4EZ5A 4GS6A 2OJ9A 3TYKA 4DFUA 3D2KA 4EJ7A 3OEFX 3H9RA 4DTBA 2BAQA 4NL0A 1PKDA 2XA4A 4NM3A 3WZEA 3CC6A 3R83A 4BCFA 2QOOA 4D4SA 5L2TA 4XV2A 2CKOA 4PDYA 2VWZA 2XK7A 4D5HA 2JAVA 4YJQA 4HNIA 3EYHA 3PZEA 2WAJA 4JDKA 4C57A 1DI9A 1PJKA 2X0OA 3KF7A 4FV4A 4DFZE 4F08A 5K9IA 5LQFA 1JPAA 3QRTA 4IB1A 4IQ6A 4IVAA 5HQ0A 2IVVA 4ANSA 4XMOA 2CLXA 5HTCA 3ORXA 2O65A 3QLFA 3B2TA 4XLIA 5HGIA 4F0FA 2OSCA 2PY3A 1V0PA 4F9CA 4PTEA 5L4QA 1G8JA 1YOMA 3PIXA 4NJ3A 3CD3A 3O23A 5EW9A 2ONLA 2YM4A 3TTJA 4Q9ZA 3FQHA 4BVUA 3MH3A 5HCXA 3MFRA 5M09A 2XJ2A 4BRXA 1JBPE 3NIEA 3CEKA 3P7AA 4H3PA 3O17A 2IO6A 2VWUA 5FTOA 5CEQA 3QUPA 3TIZA 3HVCA 3PRFA 3FPMA 5JGAA 3V8SA 4OTPA 3MIAA 1VJYA 3UYSA 3RM6A 3UNZA 4BDHA 3RK9A 5EFQA 3PSCA 3PIZA 3NNXA 3BE2A 3NRMA 2UZVA 2RFSA 3MYGA 2W99B 5L8KA 3MESA 3SOCA 4ZJIA 4EOMA 5L2WA 2QI8A 3TUCA 2WNTA 1NA7A 1XO2B 4QP4A 3KCKA 2OIDA 2QNJA 2IF8A 5DFPA 3EN9A 5HIDA 3Q4CA 4ASZA 4AE9A 3BLQA 3OZ6A 3DNDA 2OW3A 2XK8A 4IH8A 3CTJA 4Z3VA 4HVDA 2P33A 2I0EA 4JX3A 4WO5A 4XOYA 1WVYA 4C4IA 1K9AA 2CN5A 3P0MA 3CJGA 2XIKA 5HO6A 2QOIA 3KULA 3NNUA 4WHZA 3GU4A 5E8YA 4NYEA 4U0IA 4HNFA 5D9HA 4F1MA 4J99A 2CGUA 5FD2A 4QQJA 4OBOA 5FLFA 4CGAA 1OZ1A 4BGGA 3KIOC 4L8MA 3ZH8A 4ZJVA 5HLNA 2R2PA 5CEMA 2RSVA 2WB8A 4UXQA 4FTCA 4FT0A 4HGEA 5DHJA 4C34A 5IDNA 1P4OA 3W32A 1ZYSA 3VC4A 5K3YA 3C4ZA 3F3UA 3NW7A 1BKXA 5EM6A 4N6ZA 3Q5ZA 4WT6A 5GHVA 2AEGA 2QLQA 2XM9A 4P5QA 5BVDA 5JQ5A 4N6YA 1S9JA 4BWPA 4IWQA 2OH4A 2JD5A 4X2GA 4ID7A 5CI6A 4JVGA 4KKHA 5AR3A 4EYJA 1NXKA 2CKPA 3BHVA