3VHKA

Crystal structure of the vegfr2 kinase domain in complex with a back pocket binder
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
355
structure length
297
Chain Sequence
DEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Back-to-Front Fragment-Based Drug Design Search Strategy Targeting the DFG-Out Pocket of Protein Tyrosine Kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
total genus 93
structure length 297
sequence length 355
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vhkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vhkA01
3QXOA 4LRMA 4DYMA 2B52A 2IZUA 3QWKA 3NGAA 3WZJA 5LCKA 4EHVA 4AZSA 5KKRB 5KNJA 3TJDA 1S9JA 2LAVA 3LLAA 4D28A 3ZM9A 4YBKA 3I6WA 3TIZA 3I5ZA 1SZMA 2UZEA 3FL5A 1O6LA 4O1PA 3IS5A 5CTPA 3TKUA 5IKWA 2O0UA 3K5UA 4BC6A 1WVWA 1OKZA 1DM2A 2H34A 4U8ZA 1YWVA 5HG8A 4DC2A 3PXFA 2VTLA 3DK6A 5IEYA 4EJ7A 2H96A 3PY1A 2C3LA 3N4VA 3HRBA 4RJ5A 3PVGA 3TUCA 2VTMA 5H8GA 2QO9A 3R8LA 3TZMA 2XCHA 5HIBA 2BPMA 3K5VA 2CKPA 3GU4A 1IA8A 2A1AB 4L45A 4LRJA 3QD4A 2BAJA 4FSRA 4E7WA 3GC7A 4IMYA 2X39A 2Y9QA 2OKRA 2V62A 3RGFA 2ZM1A 4F1TA 5BVFA 5JZJA 5ETAA 4FI1A 2Y4IC 3SC1A 1KSWA 2RF9A 3ELJA 1PMUA 3LJ2A 4O0RA 1LEWA 3BCEA 2DYLA 4BKYA 3KREA 5JK3A 3KVXA 2H9VA 3LJ1A 4PPCA 1H00A 4D9TA 1PXPA 2QOOA 3OOMA 3FQEA 2XCKA 5CS6A 3ZC5A 4EK3A 2UW5A 1PF8A 5C8MA 1WBSA 2W1CA 3HNGA 4BCJA 4DFYA 2WXVA 4IZ5A 4BCPA 4TYHB 2GSFA 4K77A 5HE1A 4JQEA 3D4QA 3Q60A 3Q9XA 2ITNA 3PJ8A 3R21A 4FICA 5FP6A 3VIDA 4DH3A 4QT1A 4BY9E 5AM6A 3M11A 4TT7A 2PHKA 3LCTA 3VS3A 4V01A 3Q2JA 2XK3A 4EC9A 1P5EA 2XK6A 3TIYA 3FJQE 4C58A 4YNOA 2XNOA 4R3RA 1A06A 4UV0A 3LMIA 2YM5A 4M14A 3QQGA 2XKDA 3EN9A 1OPLA 3ZYAA 2O64A 5IUGA 5HCXA 3QRTA 1J7IA 5FWKK 1NY3A 2PZRA 4D2PA 2IVSA 3GCQA 3H0ZA 3OMVA 4YC3A 3ZLYA 2YWPA 4O7YA 4ZJVA 3OWPA 5KBRA 4R7IA 4QNYA 2IWIA 2VWWA 4R1YA 1FVRA 4YTHA 5E1EA 3R7EA 3R9NA 4IE9A 4NJ3A 5CQWA 4RIYB 3I4BA 2W06A 3QGYA 3WF5A 4K9YA 4N70A 4X2KA 3ZZEA 4G16A 5ANDA 3HMMA 5EI6A 2ZB0A 4D2TA 4JIAA 4Y83A 3OEFX 3T3UA 4IANA 3KULB 4GIHA 4YSJA 5IA0A 3FKNA 5J7BA 1ZOEA 1APME 4MXYA 4F9AA 2VN9A 3A62A 5H3QA 3EWHA 1ZZ2A 1ZYJA 3BQCA 3H4JA 5D7AA 5ANIA 3WZDA 2P2HA 2W0JA 5AR5A 4A07A 4PTGA 5EHYA 3VS2A 4U40A 4LM5A 2WNTA 2JBOA 3C5IA 4X3JA 1PXMA 2JDOA 3JXWA 5JFWA 1U54B 4KNBA 3ZO4A 3RAHA 1OL5A 4QMMA 3HAMA 2R3LA 3DOGA 3C13A 3CD3A 4YO4A 5DH3A 5AX9A 4UZDA 4TW9A 2X7FA 2DWBA 4I22A 4IAKA 2R0UA 2IW6A 3UOKA 4JQ8A 3NIEA 4YJRA 4FC0A 4NTSA 1Y91A 5CEKA 4CG8A 4XLIA 4D58A 1QCFA 2J0IA 4RC4A 1GIHA 5HD4A 3MV5A 2OIBA 3DJ5A 5IQCA 2WMWA 3OWLA 5LMKA 1WFCA 1K3AA 5E8TA 4UXLA 2OIQA 1OGUA 4BZNA 3NUXA 4K11A 2VTHA 5HZNA 4O7WA 4NW5A 3A61A 3DQXA 4C59A 4PMPA 4OBOA 3W8QA 3QX4A 3RPRA 5C8NA 5M4IA 2JC6A 3Q6UA 3RI1A 3FEGA 5JZNA 4DT9A 2IVVA 3GT8A 3C51A 4QP6A 1ZOHA 1JKTA 5IZFA 3FLYA 4FTCA 4L3JA 4QQCA 2AC5A 2A2AA 4PF4A 4OW8A 5L2WA 2HIWA 1Y6AA 3MBLA 4FSZA 2UZOA 4MEDA 3H9FA 4UXQA 4NYEA 2J5EA 4FV8A 2FSTX 3B2TA 3NS9A 4ID7A 4GMYA 3RP9A 3EYHA 1ZYLA 4F9YA 2Z7LA 4IW0A 3EQIA 1YHWA 1JVPP 2X81A 2R7IA 2FVDA 3LPBA 3FZTA 4ACDA 2XH5A 4AF3A 4BZDA 3MFRA 3Q53A 4QQJA 4AN3A 4HCVA 3TNWA 2JAMA 4C2VA 4CCUA 4UYAA 4NJDA 2FSOX 3WZEA 3KU2A 2ITVA 1CKJA 3DFCB 3QUEA 5F94A 4C02A 4FV4A 2I7QA 4RVKA 5HNGA 4O83A 2VWYA 4YO6A 3PE1A 3Q04A 4FTLA 3QRKA 4MBIA 3PG1A 2V7AA 2CKOA 1ZYDA 5IH5A 2F7EE 4G5PA 4IVCA 3ZHPC 2PUNA 4FYNA 1W84A 2PUUA 4CG9A 1QMZA 2WGJA 4A9SA 4KIOA 3TNPC 4NM0A 3PWYA 4DG3E 4IVAA 2QU5A 1JAMA 2O65A 4QMQA 3GUBA 2C6OA 2PPQA 4EJNA 4ZEGA 4AG8A 4GFMA 4WIHA 4LGDA 4YPDA 4IACA 1XH4A 5CANA 5CF8A 3Q4ZA 3BYUA 5GZ9A 1VJYA 4QYEA 1TQIA 5CZIA 3VQHA 3HLLA 3OG7A 2YIXA 5D11A 3N4TA 4B8MA 5IUHA 3CBLA 3NNUA 2C30A 3OVVA 3PUPA 3MB7A 4U81A 2WKMA 4XP2A 4AZFA 3P4KA 1CDKA 2BALA 4EOKA 3F3TA 4XLVA 4BBFA 5L3AA 4ZTHA 4DLJA 4OTQA 4RIOA 3ALNA 3ETAA 3QTIA 3PXRA 4O0SA 4O38A 5DA3A 3OUKA 3PPJA 2ZB1A 2HXLA 2YLFA 3AG9A 3CQEA 5HNBA 4PNIA 4KABA 3E7OA 4M7IA 3R6XA 3OF0A 5D7VA 2HOGA 2B54A 4MK0A 4XV3A 2C6LA 2UVZA 2C1AA 5JFSA 4RIYA 2CNQA 1I09A 2IJMA 3JPVA 1JKKA 4GU6A 4QMVA 4CFFA 3PSCA 3JVSA 2F49A 2B9HA 4OTWA 2YZLA 4CFNA 4MNEB 5IU2A 4YC6A 3KMUA 4G3DA 5HOAA 3F9NA 3ORNA 3ERKA 2QHMA 3HV4A 4LGGA 3LXKA 4RJ4A 3VW8A 4C4JA 2PVYA 3PA4A 4MBLA 3HGKA 4QMUA 2WQMA 3GGFA 3MJ1A 4XG7A 3NX8A 4BCOA 4DEDA 1NA7A 5A6OA 3KXMA 4UB7A 3PSBA 4AZTA 3EQRA 4A4XA 4CMTA 5B2LA 4AP7A 2WOTA 3EHAA 3A7IA 1UKHA 2OJJA 5IA1A 4FIGA 5IMEA 2F9GA 3W2PA 2RSVA 5KMKA 5IH6A 2ZDUA 3E3BX 2WMUA 5CYIA 3BELA 2JITA 3W18A 4PNKA 3EQPA 3LFFA 3DXPA 2YIYA 3G6HA 5J5TA 3P0MA 4C33A 4DEEA 3DJ6A 4KB8A 4ZJIA 1Y8GA 2GQSA 4L44A 2W1GA 4FNWA 3QQFA 4BGHA 5TOZA 2LGCA 3RAKA 2OXXA 2HZ0A 2IZTA 3CY2A 3VVHA 3P79A 3G9LX 1M2PA 1JQHA 2W1FA 3A4PA 1OL6A 2RIOA 3PY0A 4F0FA 3OXZA 4ZAUA 3CY3A 3OCTA 4X3FA 4S33A 4A4LA 1XH8A 2PUIA 1G3NA 1Q5KA 5EK7A 4BCGA 1H1PA 3IW7A 2DUVA 3QA8A 3VS0A 3GBZA 4B0GA 2PZIA 4ACHA 4BBMA 5AUTA 3FZSA 3ZO2A 4ASZA 4O7VA 3EMGA 2BRBA 3OEZA 4L42A 1WBNA 2VO3A 2RFDA 3SOAA 1KE7A 4L00A 2EVAA 4WO5A 5EH0A 5HG9A 3ORMA 3OWKA 4EYJA 4FSUA 5M06A 2CHLA 3I0OA 2VGPA 3WBLA 3ZTXA 5CNNA 4DFLA 4ACMA 2VTOA 5CXZA 4G9CA 4ANSA 2GQGA 4WNKA 2YABA 2OZAA 2PU8A 4YGAA 2UZLA 4HNFA 2BDJA 5CQUA 3HRFA 2XM8A 1XH7A 1GZOA 3BHVA 3FSKA 4BDKA 2VAGA 3BLQA 2A4LA 2UVXA 2PMOX 3CKXA 5L2SA 2QNJA 3FBVA 4JAIA 4F64A 2VU3A 3MVLA 1OKYA 2W7XA 3CXWA 3R1QA 5ICPA 3D14A 4E6QA 4AW2A 3FZOA 3VF8A 4D5KA 1YXUA 2ERKA 4IX5A 1XBAA 2CKEA 2C69A 5HU9A 4MF1A 4UBAA 5BVWA 5L6WL 4MBJA 4NW6A 4GFOA 4UZHA 4B4LA 1GZ8A 3R7GA 3R9DA 4X2NA 4C4FA 4IWDA 5ETCA 2I0YA 4FTQA 5HIDA 3GFEA 2BZIB 3B2WA 3MVJA 4RFZA 5A4LA 1XQZA 3KN5A 1H28A 2GS6A 4EC8A 3G33A 3QZHA 3PXYA 2J2IB 5DIAA 5CEIA 3FUPA 3ZXTA 2CLQA 4IIRA 4RG0A 4EUUA 5K4JA 4GKIA 2VO7A 5FM3A 2R0IA 4I94A 5BUIA 2CKQA 4XNEA 2YISA 4I5CA 2X8EA 4FEVA 3EFLA 5JFXA 2QVSE 3UP2A 2EXEA 3V5LA 2HELA 4S32A 3S95A 2BZKB 3PRFA 4UWCA 3KMWA 1AQ1A 4DH7A 3PJ3A 4JBQA 3RK7A 5M53A 3UQCA 1YWRA 1PKGA 3MY5A 4XCUA 3RVGA 3R8ZA 4NFMA 4WRSA 3TN8A 5J5SA 2BAQA 3FSFA 3BHHA 1G8AA 4QP3A 3UE4A 3VBYA 5FXRA 4PMMA 4XV2A 3BQRA 5B2MA 2VTRA 1URCA 2UW9A 3QYZA 4O2ZA 2JBPA 4EBWA 3HDNA 3HYHA 1REJA 5CF4A 3QX2A 2ZV2A 3LCOA 2F7XE 4FTMA 4FT3A 2YCRA 4GT3A 5AP4A 4V0GA 3SW7A 4TWNA 2EXCX 3LCKA 4GG7A 4HGLA 4KD1A 1QPEA 2QLQA 1HCKA 4Y5QA 3V5QA 4B7TA 3FYKX 4JG7A 4IC8A 3ID6C 3Q3BA 3TEIA 3ZZWA 3KN6A 3HVCA 2GTMA 3KY2A 4C38A 3SVVA 4D4SA 3A7GA 4CV8A 4QTBA 1ZMVA 4NKSA 3UODA 4J53A 1YKRA 3OY1A 3RPOA 4IJ9A 2CGUA 4C2WA 5ACBC 4CV9A 5AUZA 4QQ5A 4DGNA 4UY9A 2WD1A 4K2RA 4C3RA 2ZV8A 1LUFA 5DT4A 4EH5A 3R63A 5DFPA 5E4HA 1Q4LA 5KMNA 4LQMA 1IEPA 4PMSA 4RGJA 3R9OA 2JAVA 3ZM4A 4RRVA 1VYZA 2PSQA 5F9EA 3DJ7A 2BRMA 3PLSA 4G9RA 4C61A 3DK3A 4BB4A 3MDYA 4F7JA 5L2TA 4H05A 4XG9A 5HE3A 3BYVA 3BRBA 3R73A 4G3GA 3DKFA 5HBHA 4EH7A 4XV1A 1GZKA 2ITQA 5I9ZA 5ANGA 4J97A 2XK9A 3FC2A 3FMMA 3IPHA 5BVEA 3ZUUA 5J1WA 5E8WA 3VBQA 2P55A 4LOPA 3LQ3A 2WZJA 4CD0A 5FBOA 2WMXA 3MFTA 2R3JA 2RFEA 1Q8WA 5CENA 3TUDA 3MVHA 2QOIA 4U0IA 5IEXA 5AV2A 4BTMA 4IH8A 3KL8A 3M2WA 1PHKA 3DB8A 3ANQA 4EI4A 3E8EA 3ODZX 4P2KA 3KXZA 4CFUA 4PL3A 5BNJA 3VRYA 4XG3A 3HRCA 1YOMA 1FMKA 4YHJA 1RE8A 3QTQA 4EYMA 3F88A 3Q96A 3FMLA 4A4OA 4EBVA 3NYVA 3Q9ZA 3TNQB 4FTKA 3U55A 3QLFA 3ZEPA 3P78A 3SD0A 3D83A 3RNYA 4HZRA 5CAVA 4G17A 3SRVB 1H26A 2UZNA 2PZPA 4F9CA 3MPMA 4QRCA 2H6DA 3C4XA 4C3FA 1M52A 5D12A 3NUAA 5CI6A 3I5NA 2Y6OA 3KXNA 3E93A 4IB1A 5DT0A 4F0IA 3PXQA 4YUQA 4CGAA 2CN5A 4BI2A 5DWRA 3Q2MA 2UZWE 5LVOA 5I5ZA 3E63A 4YU2A 3QTZA 2DQ7X 3FI2A 2ETRA 5ETFA 5IQDA 4YLLA 4JBOA 1O6YA 5EW9A 2PK9A 2WTJA 3GU7A 3NYOA 2BIYA 3PA3A 4O82A 4W4XA 4W8DA 3DQWA 4FK3A 5AMNA 4Q9ZA 4BCQA 3L9NA 4KBKA 4XG6A 5LCJA 3FKOA 1VYWA 4YMJA 3HMIA 4UWBA 3ZSGA 3LCSA 5M55A 2HZIA 4BWKA 4F6UA 3QQHA 1H07A 3KRJA 3EQCA 3POZA 4FG9A 4KS8A 4ONAA 4U9AA 3RINA 3A8XA 1XH9A 2YIWA 3DU8A 3VS4A 3ZONA 4R6VA 4DG0E 3P9JA 3VS5A 3OBGA 4NM5A 4NL0A 2QODA 1FGIA 4TWCA 3VWAA 4FV6A 4MXCA 3F3VA 4WUNA 1EH4A 1VZOA 4R77A 4DHFA 5BUEA 4GEOA 5HQ0A 3HV6A 4GT4A 3QQKA 4DBNA 3DAJA 2JEDA 4WG5A 4K33A 3R7VA 1I44A 3NUNA 2NRYA 4LV8A 1H1SA 5A14A 3QU0A 4LUEA 2XIYA 3FV8A 3LM0A 3HV3A 2YM7A 4O7ZA 3TZ7A 3EL8A 5E1SA 5HG5A 4RIWA 4EH9A 2W17A 4BCMA 4FEUA 2Z2WA 3VW6A 4CZYB 5CSWA 2WMSA 3OCSA 2VTTA 2Z7SA 3ORZA 4C35A 5CF6A 4YZBA 1OIQA 1W0XC 3LXLA 4QP2A 5CU6A 3UZTA 3HV5A 3G51A 4TYEA 1ZZLA 4YJVA 2CNVA 3A60A 4AW0A 4X0MA 5DYJA 3TV4A 4DE4A 2OWBA 2RG5A 2XJ2A 2BDWA 3KMMA 5FTQA 3BZ3A 3CTHA 3KRWA 3SHEA 3U6IA 1TVOA 4J52A 4L7FA 4GJ3A 4KKHA 1ZYCA 5KO1A 3C0IA 2QOBA 3EFKA 3EQDA 5EYKA 2Y7JA 4AUAA 4E73A 2X9FA 2ITTA 3UNZA 4DCAA 4IZAA 4MKCA 2IN6A 5KMMA 3KFAA 4RWKA 3R1NA 3TNHA 3VS7A 4G6LA 4FSYA 4R5YA 4TYGA 4ZJJA 3WOWA 1IR3A 3E8NA 4QMWA 5IQBA 5JFVA 5DBXA 4GYIA 4G3EA 3AC5A 2PMNX 3R7YA 2O8YA 2PE2A 4GH2A 5FTOA 4ZTLA 3UQFA 4H1MA 4CCBA 2BHEA 1QPDA 2GNLA 5EDPA 5HHWA 3WILA 4BIBA 3AMAA 3OXIA 1M2RA 4E20A 2QOQA 4FEWA 1KE8A 2X1NA 2PYWA 4IB0A 1MQ4A 3WF9A 5C03A 3GB2A 5FGKA 5B2KA 2R2PA 2HCKA 2RG6A 3F3ZA 4XEYA 4AT3A 4DLIA 2ONLA 2YCSA 5L4QA 3R04A 2XB7A 2W96B 2YHVA 1BKXA 3DXNA 4DTKA 5KHWA 1WVYA 4GIIA 3CGOA 1ERKA 4G6OA 4M68A 3ORTA 1YDSE 5JGDA 4IEBA 2W9FB 5EM5A 3Q6WA 4NFNA 3L1SA 3SXFA 1HCLA 4F1MA 5CU4A 2R3GA 4O1OA 2Z8CA 4JBPA 2KULA 4OBQA 3KK8A 4USDA 5AX3A 3WF8A 5CX9A 3S1HA 4N6YA 4RT7A 4BWPA 3LVPA 5EKOA 3LFAA 5AR4A 3A8WA 4U6RA 4NIFB 1V0OA 4ERKA 3BEGA 3IDPA 4KKEA 5HEZA 2C3IB 5TT7A 4GRBA 4EOLA 2WTIA 3QCYA 4LL5A 4M15A 5J9LA 1XHAA 2PZYA 3LFBA 4M69B 3QFVA 4I24A 4J1RA 3BE2A 4M69A 4ALUA 4FL1A 3OXTA 4HYUA 5EM6A 3T9IA 1ZXEA 4BDFA 1WBOA 5HX6A 1E1XA 5HCYA 4R7HA 4YBJA 4BDJA 4TRLA 4QMNA 3IDCA 4BCHA 3I0QA 5LMBA 4A9RA 3HZTA 5DEYA 1U59A 2QONA 4XYFA 5F4NA 2JFMA 4P7EA 5ETIA 5HO6A 1SYKA 4D1SA 4XOZA 4KSQA 4AOJA 2QG7A 5CT0A 3MH1A 2ACXA 2EWAA 3FI3A 3QCXA 3EOCA 1U46A 4I3ZA 5HBJA 4O6LA 3G2FA 3QYWA 2PY3A 5EYCA 4I1ZA 2WU7A 4E5BA 4RSSA 5EHOA 4GU9A 4FZ6A 4HPUE 3CJFA 3UIUA 3HL7A 4ZP5A 4OT6A 3PVBA 1IRKA 3KXGA 3OT3A 5HICA 3V51A 2X4ZA 4E6DA 4ZTMA 5E8XA 3EIDA 4G2FA 3UNJA 4L3PA 3S3IA 4GUBA 4ZSEA 1XKKA 2I0EA 3LFNA 3Q4TA 4JR3A 4L6QA 4RX8A 4RFYA 5D10A 4G1WA 3L8XA 4MD7E 5DT3A 4ERWA 3OWJA 4FKGA 3EYGA 5M4FA 4FTAA 1OM1A 1JSTA 2ZVAA 3ZOSA 4AOIA 4Z7GA 2W1DA 5AA9A 2WMQA 3H10A 1H08A 3CPCA 3P7CA 1H1RA 4BIEA 3FMEA 4WG4A 5AP2A 1OMWA 3P7BA 1GAGA 1OL7A 2BZHB 2B7AA 3OD6X 4G31A 5E8YA 4EZ5A 4OTIA 4XHKB 4GK4A 4FG7A 4GCJA 4IWQA 4XJ0A 4QMXA 4RIXB 4F1OA 2V5QA 2XIKA 4LFIA 1NVSA 3ZDIA 3F7ZA 4HPTE 4DTBA 5GNKA 4FTUA 4FKPA 4D1XA 2ZV9A 5FQDC 4IWOA 3AT3A 4O84A 3DZOA 4NEUA 2P4IA 3EJ1A 3FMNA 3OT8A 3EQBA 1M14A 1YI4A 4FTIA 4Q5EA 3VUHA 3AGLA 5TR6A 5BYYA 2CGXA 3MH2A 4WNMA 4AE6A 5IA3A 3NVKI 3PLAE 4AT5A 4V05A 4IX3A 2PVNA 4F09A 5C01A 2PVMA 4IADA 4J98A 5K0XA 4ITHA 3HKOA 2C5NA 3F3WA 4WUAA 4YJTA 3U4UA 3MFUA 1OI9A 5FXQA 4FYOA 4GV1A 3MPAA 3OBJA 4R1VA 3QTUA 4OTDA 3PXZA 1QPCA 1U5QA 1XWSA 4J99A 3PSDA 3BX5A 5GZAA 2X0GA 2R4BA 1PXLA 5EW8A 1O6KA 2X6DA 3O7LB 4FGRA 5E92A 1U5RA 2XK7A 4BDHA 3TWJA 1OUYA 3DS6A 5BX0A 2BRNA 5LOHA 1IAHA 3UG1A 4JDKA 5FM2A 4QTDA 3G5DA 4L46A 3RAWA 3AMBA 3WARA 4EOQA 4ZIMA 5BVNA 3MB6A 3F5XA 5AM7A 2C6EA 4RMZA 3RNIA 3QF9A 1ATPE 4IHPA 4QMZA 4L01A 3QGWA 3ROCA 4G34A 4RVTA 3LMGA 3RJCA 2ZMDA 4E5AX 2CGVA 5IUIA 4ZTNA 4RBLA 3QC9A 3WE8A 3QRJA 4X2FA 3BGZA 3U54A 2EB2A 4H3PA 5L8LA 4W8EA 1SVHA 4F7SA 5JQ5A 3GU6A 1H25A 5FBNC 2P0CA 4EWQA 4MXZA 4BCIA 2J50A 1NT2A 3GENA 3DBFA 2BHHA 1UWJA 5HLWA 3WIKA 3DXQA 4YZDA 2OSCA 1MP8A 5AR2A 5K9IA 1OIYA 4XG8A 2QQ7A 3ATSA 4DH1A 1IAJA 3ZRLA 4M0ZA 4C4EA 4R78A 3B8RA 4QP7A 2QOHA 1UWHA 2FUMA 2OICA 4XMOA 1GZNA 3DB6A 3PP1A 3W2CA 2QOKA 1GNGA 3BLHA 2VWIA 3P86A 3R2YA 3R8UA 2GDOA 2QCSA 3V5PA 3SA0A 5AAFA 3MI9A 3AQVA 3DKGA 3BYMA 5BMMA 4S31A 3W16A 4C34A 3UTOA 5C4KA 3BYOA 3NR9A 5F20A 1FGKA 2UV2A 1RDQE 3FWQA 4FNYA 1IA9A 1DS5A 3D94A 1M7QA 2QG5A 2ZM3A 4S30A 3CLYA 1JSVA 4Y72A 3V5WA 2UZTA 5IH4A 3JUHA 3LM5A 1Q3DA 2OG8A 2Q83A 1Q61A 4P4CA 5DR9A 3R83A 3GU8A 3ZEWA 1G5SA 4FZAB 1PXJA 2CCHA 1PMNA 2QR8A 3OW3A 3KKVA 2XNBA 3QHWA 3VUKA 4DBXA 3UMXA 4IX6A 5M4CA 4ITIA 3GOKA 4TXCA 4GVAA 4NSTA 4I5PA 2GQRA 3W2RA 4ZMEA 2ETKA 3E64A 4EUTA 4MWIA 5ACKA 5IQHA 4DINA 3CTJA 4EOMA 5D41A 2PULA 2WTKC 3E62A 4ACGA 3QWJA 4FTRA 5CAOA 2OW3A 3NNWA 4L52A 4N57A 4ZTRA 1FMOE 2IO6A 5LJJA 2XIZA 2PE0A 1BI8A 2J0MB 2C3JA 4CKRA 3RALA 4FV5A 4TZRA 5HORA 4AFJA 2G9XA 4HYIA 5CU3A 2WB8A 3MY0A 4WHZA 2QURA 3QC4A 2RFSA 4FVRA 4KIKB 3NDMA 1FVTA 3AC2A 4DN5A 2NRUA 2JD5A 2WEIA 3SXSA 2ITZA 4AW1A 3TZ9A 3PE2A 2WTWA 2R3RA 3CC6A 4BCFA 2RL5A 4HVHA 3PYYA 3E88A 2Y4PA 4XUFA 1B38A 5KZIA 4CYJA 1Q41A 4Y85A 3IW6A 5L8JA 1Y6BA 2R5TA 2XYUA 3DV3A 3VUGA 4E4LA 1WAKA 3KXXA 4E1ZA 4KUJA 4X21A 5AWMA 1DI8A 3NNXA 4QMPA 5DGZA 4ZLYA 3TM0A 4JS8A 4MD9E 1JSUA 4KS7A 4USFA 5AUVA 4IVDA 5M44A 2HWPA 3QTSA 3FI8A 3R22A 4I92A 4BTJA 3LQ8A 4B99A 4AGUA 4QOXA 2O2UA 2B55A 4APCA 4JJRA 5CI7A 3PPKA 3H0YA 2J9MA 2JKQA 1WBVA 4U3ZA 5K4IA 4MQ2A 3CIKA 3RPYA 5DRDA 5AV4A 2BTSA 1YW2A 1KWPA 3CR0A 5AUXA 4RZVA 2V0DA 4YR8A 3BYSA 2W4KA 2GMXA 2R3OA 2X4FA 3MIAA 4FF8A 1ZAOA 4G3FA 4XV9A 5AIRA 4AZWA 2ITPA 3C4CA 3BI6A 3C5UA 4YNEA 5E8SA 4D0XA 3II5A 4TNDA 4EH6A 4BFMA 4ZTSA 3E87A 4F99A 2WQEA 4AAAA 3OS3A 3FMJA 3C0HA 1YI3A 2JIIA 4QYGA 3K3IA 2BROA 4JOAA 3U51A 2P33A 4FV9A 4OTPA 4RC2A 3IW8A 5DMZA 3N9XA 2VD5A 5CVGA 3RWPA 4CLJA 3SXRA 2XRUA 2NPQA 3W32A 4B6LA 1OPKA 2FGIA 5CAQA 4PTEA 3VN9A 2R64A 2YWVA 3SGCA 4FKWA 5CSVA 2G2FA 2C6IA 2XVDA 5K5NA 2OLCA 3TKHA 4RC3A 3H3CA 3EQGA 3OROA 5AP6A 3ZLXA 3C4EA 3UG2A 4PRJA 4FL2A 4I23A 4OT5A 5M4UA 4TNBA 1MRYA 2EUFB 2YDKA 2BFXA 3EN7A 2B1PA 3DBEA 1A9UA 3H9OA 5DEWA 4R8QA 2V7OA 4ZLZA 5EHLA 2AUHA 2OGVA 3I81A 3BE9A 3UYSA 5BYLA 3R0TA 3NW7A 3LQ5A 3F69A 3GEQA 2OXYA 2IZSA 2VRXA 2XMYA 3I79A 4AGDA 5M09A 1B6CB 5DLSA 3FLZA 3OUNB 1WBTA 4TYHA 3RKBA 4JG8A 4ANLA 4PX6A 1PXIA 4EK6A 3MH3A 4J7BA 3OOGA 5A4CA 4JDHA 5EYDA 4CKJA 2XEZA 4D0WA 2QD9A 3ZFYA 2GFCA 2QHNA 1UKIA 3ZFXA 3WYYA 1P4FA 3U8WA 1GIJA 2ZAZA 4MHAA 1J1BA 4QP9A 3NEWA 3UOHA 4X2JA 4DH8A 2E9UA 5H8EA 3CS9A 4Z55A 3KRRA 3HMNA 3TUBA 4GVJA 4QP1A 4A9TA 5CU2A 5FEDA 3F5PA 2UW8A 2YACA 3BHTA 3RCDA 5CWZA 3TKIA 4YP8A 4C8BA 2PMIA 3FLNC 1UNLA 3PJCA 5T6KA 2JKKA 2C0OA 4FIIA 4P5ZA 3UDBA 5EI2A 1UVRA 4O7SA 4A06A 4J71A 2WQNA 4DT8A 4DFBA 2AC3A 2H8HA 2W1EA 4RIXA 3AC8A 1P2AA 4KIQA 4RZWA 3UVPA 2BMCA 2FO0A 4ZY5A 5J87A 4I4EA 4ENYA 4M12A 3R1SA 4ASDA 3QQLA 2CNUA 5E91A 3UO5A 2VWVA 4PWNA 4Z7HA 2X8DA 1Z9XA 2JLDA 5GZ8A 4CT2A 2VV9A 3DPKA 4NWMA 4PDOA 1Q8UA 4O0UA 4ZS0A 3RHXA 3SG9A 2J7TA 3VBVA 3RHKA 3QCSA 3QLGA 3GCSA 2R3NA 4ENXA 1NVQA 2QI8A 1HOWA 2OBJA 1OIUA 4WNPA 4ZY4A 3ZXZA 4QMYA 5AP0A 1XBBA 2A27A 2VTNA 4JG6A 3UIBA 4BKZA 3SW4A 3AC3A 2GCDA 4PPAA 4BN1A 1UU8A 2EB3A 2YM8A 3LOKA 5AP1A 5BYZA 1H8FA 3LAUA 1OUKA 3JVRA 3N51A 4GK2A 4E3CA 4F6WA 4WRGA 1H0WA 3MWUA 1MRUA 3TXOA 4BVUA 4HYSA 3BGQA 2I1MA 3RM7A 2R3FA 3NW6A 4JIKA 4PUZA 3IGOA 1PYEA 4IAYA 3CEKA 3NUSA 1KE6A 4FSQA 4EZ3A 5H8BA 3G15A 3EN5A 1YOJA 4FUXA 5DR2A 2J90A 4TPTA 4V04A 4D4RA 5JQ8A 4D1ZA 4M13A 2ZM4A 3IOKA 3UQGA 2CDZA 4TWPA 5HX8A 1NXKA 5AV0A 5L2IA 2IVUA 1G8SA 2PVFA 4FTJA 4I6QA 4LGHA 4WG3A 2WTDA 3B8QA 2YITA 3R2BA 2BRHA 2GNFA 2C5VA 4RVLA 3ITZA 3AD4A 3C1XA 4NT4A 4S34A 5CXHA 2BUJA 3V04A 3TDWA 2X8IA 1TKIA 3PTGA 3ZBXA 5KBQA 2Z7QA 4I6HA 4E26A 2VUWA 4WA9A 4QPSA 4LL0A 3QZGA 3S0OA 4U97A 3NCGA 4IAAA 2JGZA 3I7BA 2OH0E 1H4LA 5HCZA 1OITA 4I4FA 3WE4A 4JX7A 3ENHA 4RJ7A 1ZY5A 4JDJA 5CSPA 1BL7A 4ZK5A 3UPXA 5IA5A 2ZOQA 3C4FA 3QXPA 4RWIA 4IXPA 4U41A 5EOLA 5LVPA 4F65A 4FOBA 3BU6A 4UMQA 5GHVA 5I9UA 1H1WA 4CFVA 1ZYSA 4UALA 5KUPA 3V8TA 2BKZA 2OFUA 3GC0A 2R3MA 4FBXA 4JT3A 4L67A 4MQ1A 3VRZA 4ANNA 5JKGA 3VJNA 5J7HA 1KOBA 3NRMA 4FV0A 2Y0AA 1ZY4A 4I0TA 5B0XA 2Y8OA 4IAFA 5L2QA 1ND4A 2VNWA 4C4HA 5E7RA 2C4GA 4ZSJA 4O0YA 4DGOA 1V1KA 4X7QA 4BDEA 3FQHA 1R3CA 3KCKA 3VHEA 5HD7A 3BWFA 3ULIA 4CMOA 3CQUA 3LHJA 2FB8A 1WVXA 4R3PA 4ARKA 4DFZE 5AADA 3ENMA 2RKUA 4LOOA 4LV5A 3DLSA 4D2VA 3KF4A 3OCGA 4MTAA 4WKQA 3BKBA 3SLSA 3UC4A 2W4JA 3K2LA 4D9UA 2B4SB 2OXDA 5L8KA 5LXMA 3GU5A 3VO3A 3BEAA 3CGFA 4IWPA 4LG4A 2W5HA 3GNIB 3VBXA 3ZLWA 4AE9A 1BUHA 5HBEA 5J95A 3DNDA 3S4QA 3W2OA 4DEIA 1JKLA 1SVEA 4AQCA 4DFXE 5CF5A 4AT4A 2PL0A 2WTKB 4FKRA 3V5JA 4UYNA 4FMQA 2C5OA 4FSWA 2WU6A 2XIRA 5I9YA 2XK8A 3JYAA 3IKAA 4QO9A 3A7HA 2QR7A 3A2CA 3QQJA 4MD8E 3D5VA 4MX9A 3QCQA 2GNIA 4PQNA 4B8LA 4NIFA 4BGQA 3QTWA 4MNEA 3D5XA 4D2WA 5AUYA 1F0QA 4QTCA 4EOJA 3BV2A 4C0TA 5A54A 1T45A 3QD3A 4WD5A 1M7NA 4M97A 1SMHA 3KXHA 4M84A 5LWMA 2WMAA 5I9WA 4CYIA 3V8WA 3BIZA 4FKUA 4MXAA 2IZRA 3LZBA 3ORKA 3FHRA 4CFXA 4DGMA 3KEXA 3KULA 2HK5A 3IG7A 1J91A 2C3KA 4R3CA 1DAYA 3KRLA 3COMA 4X6RA 4BI0A 3F2AA 4DITA 4EQCA 3FMHA 4MWHA 4W4WA 3TDVA 3CQWA 3F5GA 4I41A 4OTGA 3R28A 4PMTA 5C9CA 1PMVA 2OK1A 3SV0A 4AXAA 3LCDA 3BHYA 4FX3A 3UC3A 3RK5A 4DA5A 1CMKE 5IDNA 4YC8A 1OZ1A 3OFMA 4AW5A 4K18A 5CT7A 3FC1X 3FZPA 2PUPA 4PP9A 1RQQA 3MSSA 5FEEA 3BU3A 3MPTA 3TACA 4NH1A 3WI6A 4FKJA 4HVGA 2FSLX 5BVDA 4RJ3A 3TI1A 1J1CA 3TTIA 3LFCA 4AZEA 3O8TA 3V8SA 1MUOA 4Q5HA 1BMKA 1F5QA 3GFWA 2Q0BA 2XBAA 1DAWA 4WSQA 4AN9A 1Y57A 2J4ZA 3AD5A 3ZSIA 1YI6A 1ZMUA 3FLSA 1FINA 2BCJA 3QRIA 4LOQA 1LP4A 2BDFA 3IECA 3FYJX 4R5SA 4RWJA 4ZSGA 3UVQA 5JGBA 3PG3A 5CU0A 5IA2A 2C68A 1YHSA 5AAEA 4HGEA 2I40A 2W1IA 3HP5A 2WIHA 2JDRA 4BKJA 1UA2A 2GS7A 4JNWA 2ITYA 4E4NA 1W83A 3UOLA 4QPAA 5KHXA 3IQ7A 4PL5A 2I0HA 4FTNA 4FTTA 2YAKA 5FDXA 2BILB 1PXNA 4Z16A 5EKNA 2W05A 3UZRA 3UO6A 3SX9A 3VS6A 4DCEA 1UU9A 2J0LA 2JIVA 2W5BA 3ZO3A 3FPQA 4CFMA 2VX0A 3DK7A 3VC4A 5HO7A 3BWJA 4CRSA 4KRCA 2XKCA 2J51A 5FD2A 4C7TA 2YIRA 4U42A 4IB3A 4IBMA 4BF2A 5A4QA 3F82A 3ZO1A 1YXSA 4EH2A 1GJOA 5CVFA 4IVBA 3PVWA 1XBCA 4KIKA 4N6ZA 5CEOA 5DOSA 1W8CA 4DF3A 3FMDA 4K8AA 1ZWSA 4DEHA 5HGIA 1E1VA 2GTNA 2XNPA 2DS1A 3MY1A 1JKSA 4CTBA 3HV7A 4RX5A 4CQEA 5BMSA 5JGAA 3LKMA 2BRGA 5EI8A 1YDRE 3MESA 5FP5A 2JDTA 3E92A 2NNWB 3R01A 3HEGA 3KF7A 3TTJA 2XIXA 3GOPA 5C26A 4NUSA 1Q3WA 1GIIA 4IB5A 4TYIA 5DRBA 4IM0A 2XNNA 2X2LA 3GI3A 4GT5A 4HVIA 4FSMA 2OJ9A 5DI1A 4R7BA 5GJGA 3O71A 4HYHA 3UO4A 2PTKA 2ZDTA 4TYJA 3IDBA 2O5KA 4PDPA 3QHRA 1YDTE 2XJ1A 5HG7A 5K3YA 5LMAA 5CEQA 3TJCA 4TN6A 5HE2A 3RWQA 5BPYA 2BIKB 3HA8A 3GC8A 4QNAA 4W9WA 4NZWB 3E3PA 4AA5A 1H27A 3D5UA 4BGGA 4QP4A 3EH9A 4PDSA 1DI9A 2IG7A 3OY3A 3LFEA 4BDAA 5BVKA 2VWUA 2YN8A 5A6NA 2J5FA 2R3KA 3ORXA 4E4MA 1OL2A 4MAOA 4CT1A 3FZ1A 3OTVA 3LFDA 5C4LA 4BL1A 1XH6A 2QLUA 3DY7A 4UMTA 2OZAB 4WSYA 3W1FA 2E9VA 2YEXA 3Q9WA 4QYFA 3NYXA 2PVKA 4IZYA 4FSNA 4YJQA 4HVDA 3S00A 3VNTA 2OH4A 2WMTA 5CLPA 4O22A 4RX7A 5J8IA 5AIKA 3AXWA 3ANRA 5AR8A 5HE0A 5AR3A 3RCJA 4II5A 5AUUA 2XNEA 1OBDA 2OIDA 4JAJA 3GP0A 4PPBA 3GC9A 3S2PA 3C9WA 2BTRA 4EL9A 3VUMA 3ODYX 2JKMA 3F2NA 4EQUA 4FKIA 3UVRA 4RJ6A 1OIRA 2P3GX 1XR1A 3COIA 3JY0A 4IJPA 5HVYA 3R7OA 4BI1A 1YVJA 4F6SA 4ZLOA 3RMFA 2HXQA 3G6GA 4K1BA 2C6MA 2YCQA 3DGKA 4BYJA 4TKSA 2JDSA 5CSXA 1ZMWA 3PXKA 3U6HA 3ZH8A 5AEPA 2WMVA 3ORPA 5KX8A 2ZJWA 3UZPA 3IO7A 1Q8TA 4WBOA 4XRJA 1JLUE 2WHBA 1M17A 2FA2A 5LARA 2ZYBA 4Y95A 3FXZA 4W4YA 5HTBA 1CTPE 2BFYA 4IM3A 4FIHA 3G9NA 2QKWB 2WPAA 4GYGA 4H1JA 4USEA 5KMIA 3FLWA 3PZHA 2W1HA 5I3OA 2UW3A 2RGPA 4YTCA 3HECA 4JXFA 4AWIA 2CLXA 5HO8A 2NP8A 3VF9A 3ZU7A 2FH9A 3DTCA 3QTXA 4BDCA 3EN6A 3ULZA 2YJSA 3MVMA 4JVGA 3MH0A 5E8VA 1R78A 3EB0A 5M07A 5T3QA 4KINA 4OLIA 4GFGA 4ZMFA 3MJ2A 4GG5A 4JR7A 4AACA 2GNHA 3KQ7A 4KBAA 4I5HA 3WIGA 3NZ0A 4OTRA 5H2UA 4OBPA 3KRXA 2WOUA 3E8DA 2F2UA 2XS0A 3VUDA 1P14A 1QL6A 1PW2A 3AOXA 4YJUA 3NIZA 5JT2A 3E5AA 4DEBA 5J9ZA 5CZHA 4M8TA 2WELA 4MXOA 3PJ2A 4RLLA 3NMUF 5CEPA 2UVYA 1FVVA 4QMLA 4YZ9A 4BICA 3QKKA 4FG8A 3NUUA 5ANOA 3PIZA 4PTCA 4NKAA 4FR4A 3DFAA 3M1SA 1OPJA 3D9VA 4U44A 5FEQA 4F63A 2ZMCA 3IW5A 2VWXA 1JPAA 4O7NA 5ANKA 5AUWA 1Z57A 4Q9SA 5HU3A 3P5KA 3R30A 2PMLX 4ZS4A 3COHA 3COKA 2WAJA 4DG2E 1PXKA 3POOA 4I5MA 1W7HA 4XX9A 5TE0A 4F7NA 3AT2A 2XRWA 3O2MA 5K0KA 4C4IA 4YJNA 2UZBA 3BV3A 4O0VA 3UIMA 4EONA 5C1QB 1ZOGA 2VX1A 4FKTA 5LMKC 4I21A 2X9EA 3R71A 4X6QC 5T68A 5CSHA 3P23A 4L3LA 2YLEA 4DEAA 5FRIA 4X2GA 1YOLA 2BVAA 4M0YA 2XEYA 3TV7A 5IDPA 3F66A 1Q99A 2E9OA 4AA0A 3AC1A 1O9UA 5IA4A 2ETMA 4ZTQA 4QD6A 1H24A 4X3FC 4EKLA 1Q24A 2G2IA 3HP2A 4QMSA 4O0XA 3VJOA 5M56A 4BTFA 2FSMX 4QMTA 5HLPA 4CMUA 3PDTA 3W2SA 4TY1A 2WTVA 5FTGA 4FK6A 5G1XA 1LEZA 2GHLA 4KWPA 1OECA 2BAKA 3LXNA 4YPSA 4AFEA 1CSNA 1OL1A 4O7TA 3KGAA 3W8LA 3HUBA 2X7OA 3EKNA 4NU1A 5AP7A 3OZ6A 2XBJA 5I0BA 3W10A 5EQPA 3L9PA 1UU3A 1W98A 5DVRA 3IGGA 2UZDA 3OP5A 4IQ6A 4M66A 3JR1A 3LFSA 2VTJA 3VULA 5IMXA 5C8KA 3R8VA 2HZ4A 2J6MA 2PVJA 3KK9A 3KVWA 3F7WA 4Y46A 4DEGA 4BDIA 2R9SA 1ZLTA 2E9PA 3D15A 3D7TB 3FY0A 4BDDA 3WZUA 4C62A 4TWOA 2C1BA 5J79A 4L53A 4XP3A 4U43A 4UX9A 3MA6A 5M57A 3TG1A 1WCCA 3PFQA 4MF0A 2CMWA 2YDJA 2HENA 2QOFA 5ANJA 3OCBA 3HA6A 3DLZA 5JRSA 3H30A 2CJMA 3ORIA 4U45A 4XP0A 4FIFA 3R9RA 4D2SA 3SAYA 3CCNA 4GK3A 4IFCA 4YJOA 3UGCA 4CSVA 2V55A 3VQUA 4EK4A 4CQGA 3OC1A 5GIPE 4IFGA 3V5TA 3BHUA 3THBA 5F95A 4ZZNA 3TV6A 2J0JA 2WO6A 4I0SA 4O21A 4EOSA 1P4OA 3HMPA 5C27A 4ANMA 4FEQA 4O27B 4YLKA 3ZRKA 2XYNA 4KA3A 1SM2A 2VTIA 4H58A 3MGYA 3ALOA 2JIUA 1U54A 4FZFB 5AV3A 3RAIA 3DNEA 3F2RA 2OFVA 2X6EA 5IQAA 2C5XA 3QALE 2R3HA 5E8UA 4OAVB 3AGMA 2VTPA 4U79A 4H36A 4EH3A 5J1VA 2VO6A 2X7GA 4KSPA 5TF9A 2HY81 4YTFA 5AAGA 4IDVA 1FQ1B 2XKEA 3TNIA 2NO3A 2OO8X 3DBQA 5EDRA 1OVEA 5KCVA 2XK4A 2FYSA 4O7RA 4H3BA 2YM3A 5A4EA 4FNZA 5CAUA 3MTFA 1QPJA 4RA4A 3UJGA 4ANBA 1XJDA 4E93A 4FIJA 4XBRA 4FV2A 4K0YA 3ZFMA 4GS6A 3QTRA 4FKVA 1B39A 1CKIA 3F5UA 3U9CA 4C37A 2YERA 3SDJA 3MFSA 3ATTA 5E8ZA 5G6VA 3VUTA 4QP8A 2XA4A 2UZVA 4DH5A 2Z7RA 2RFNA 3DDQA 3RK9A 2ITOA 4E6CA 2P2IA 3EQHA 3VHKA 4OTHA 3PRIA 3VUIA 4QPMA 4G6NA 3ET7A 2PVLA 4ALVA 4BDBA 4O86A 4FKLA 4PY1A 2CN8A 2W4OA 3RBWA 2QO2A 4O0WA 4F9WA 4GL9A 2VWZA 3FI4A 2CGWA 4J96A 2C6DA 4EOPA 4EORA 4HGTA 5DNRA 1WMKA 2VTQA 5EYMA 4EOOA 4D5HA 4F0GA 3UNKA 4I0RA 3GXLA 3WZKA 1RW8A 3NLBA 2VO0A 4WBBB 1YXTA 1RJBA 3R9HA 4BCKA 5FXSA 5FUTA 1SNUA 2BR1A 2OJFE 4FZDB 3VAPA 4TL0A 4FKOA 3NPCA 4NCTA 4FV7A 1KOAA 2GHMA 1WBWA 3CJGA 5DPVA 4Z9LA 5E90A 1V0BA 5JSMA 1U4DA 5LVLA 5AR7A 1R39A 3U9NA 3D7ZA 4IAIA 1JNKA 3L8VA 2R3QA 5IQFA 3EL7A 5I9XA 3P7AA 3PJ1A 4K6ZA 4KAOA 2SRCA 3UIXA 5FLFA 4PV0A 4JLCA 4AA4A 1KE9A 1T46A 2Y4IB 5AA8A 5DR6A 2VWBA 3PY3A 4UMUA 3QAME 4CFWA 5AV1A 4QYYA 5FDPA 2VNYA 4RJ8A 3JY9A 5K5XA 2G1TA 3P1AA 2HYYA 3L8SA 3DBDA 5JEBA 2HW6A 4MNFA 1UNHA 2JDVA 3LW0A 4MYGA 4U3YA 3V3VA 3D0EA 5LWNA 3DBCA 5ITAA 2OF2A 3FY2A 2W5AA 3AC4A 3NYNA 4YZNA 1Q62A 3GQLA 4I20A 4H3QA 1WBPA 2WQOA 3G0EA 3FAAA 3D5WA 3FL4A 2A0CX 3NUYA 3GVUA 3FLQA 4HZSA 4JQ7A 4MVFA 4APPA 5IQIA 2GNGA 4V0GB 3C7QA 4LMNA 1H1QA 3R02A 4L43A 4P5QA 4F4PA 4UN0C 1PJKA 4JX3A 4UEUA 5I3RA 4FODA 4H39A 3ZCLA 5GJDA 2W1ZA 3PZEA 4YSMA 4ANQA 3KCFA 5EW3A 4FV1A 5JN2A 4DGGA 4EH8A 1Q8YA 4L68A 2GU8A 4B9DA 2UW0A 3L9LA 4ZSLA 2XM9A 2QOCA 2B9IA 4EWHA 3MA3A 4CZTA 4YZCA 1ZRZA 2OU7A 3BBWA 3HDMA 1REKA 2OJGA 3U4WA 5DE2A 5HIEA 4OTFA 2WEVA 2VGOA 4FUYA 2C6TA 4O0TA 3R7IA 4FT5A 3ZMMA 4FE2A 2B9JA 4FOCA 4RWLA 4X3FB 4Z3VA 1MRVA 2R3PA 4EZ7A 4HJOA 4XH6A 4I93A 2ITUA 3K3JA 4KIPA 1LR4A 1URWA 2JFLA 3V6SA 3RTPA 3T3VA 3ZBFA 3C4WA 5M51A 2IW8A 3HMOA 4MH7A 4BRXA 2GPHA 2UUEA 1Y8YA 2JKOA 4Y73A 4CVAA 3ZLSA 1SVGA 3NW5A 3UOJA 3QUPA 2I6LA 4LMUA 5CASA 4O7LA 3Q5IA 3V01A 4ZZOA 3PPZA 4YHTA 3G0FA 4BHZA 1WZYA 1E9HA 2PE1A 4OUCA 2XJ0A 3LJ0A 4ZY6A 1F3MC 3I6UA 1UV5A 2YM4A 3PA5A 5IQEA 1J7UA 4F7LA 3OTUA 4FKSA 3WF7A 5CNOA 3O8UA 3QD0A 3SG8A 2G2HA 3WYXA 2XNMA 4GJ2A 1UNGA 3DKCA 2HW7A 3Q5ZA 3FXXA 4KRDA 4CTCA 2J0KA 2QOLA 3DZQA 4C4GA 2O63A 3IOPA 4W9XA 1VR2A 2A19B 4FA2A 4AZVA 4L9IA 4DAWA 3UPZA 4E8AA 2ONLC 3ZSHA 3F3UA 2IPXA 4IZ7A 3DKOA 4HNIA 4J8MA 4NTTA 3BU5A 3A4OX 4GUEA 4U5JA 4O6EA 4BTKA 4BDGA 4A7CA 4ACCA 4AX8A 5EQYA 5HNIX 1YQJA 2C0IA 2YA9A 4KKGA 4BHNA 1AD5A 3R1YA 5A4TA 2ESMA 2ERZE 3F61A 3HAVA 3DAEA 1H01A 3MN3A 3CTQA 3UYTA 3I60A 5I9VA 1GY3A 2B53A 3KB7A 3E8CA 1NVRA 4FL3A 3HX4A 3O51A 4HCTA 2X2MA 5HESA 3KA0A 3ORLA 4FV3A 5F1ZA 2VZ6A 3GQIA 4DGLC 2HAKA 4EOIA 2PWLA 2I0VA 2YZAA 4CZUA 3Q4UA 4O81A 2XKFA 3FKLA 3LLTA 1S9IA 1BYGA 2C47A 1J3HA 3LIJA 3V6RA 2YDIA 5LQFA 3W55A 2OI4X 1BLXA 4OAUC 2VTAA 3C50A 4WNOA 3AD6A 2YFXA 4AGWA 4BWXA 2CCIA 4D2RA 5CY3A 3M42A 3T8OA 2R7BA 3NAYA 4A9YA 4HCUA 5HTIA 3NVMB 5EFQA 4CKIA 3O7LD 4D55A 4YHFA 3DTWA 4OR5A 2B0QA 2BZJA 3BGPA 4FEXA 5IISA 4D4YA 3MYGA 4LYNA 4FSTA 3CP9A 3FZRA 5CEMA 3PP0A 1PYXA 5KZ0A 3DAKA 2UW6A 5LVNA 4CEGA 1H0VA 2C6KA 2UW7A 2WMBA 4UWYA 5AP5A 3TZ8A 4F08A 3A99A 3MS9A 1AGWA 4DFNA 3O23A 4L7SA 1FBNA 3QUDA 5JMSA 3QD2B 3DDPA 4O91A 4I6FA 4HGSA 4YLJA 4YZMA 2EXMA 1MQBA 2GS2A 4RIWB 2WTCA 3ROYA 1JWHA 2VTSA 3D7TA 1UU7A 2WMRA 2EU9A 4NM3A 4RLKA 2O3PA 3WF6A 4M3QA 4IC7A 3Q9YA 5JH6A 2C5YA 3R8MA 3ZUVA 4CNHA 4F9BA 4U80A 5A9UA 4DTAA 3CSVA 2F7ZE 3DCVA 4LI5A 4JRVA 4W4VA 2E9NA 5H9BA 4ANOA 1KV1A 3UP7A 4HVSA 4PP7A 3QKMA 2XNGA 4NK9A 2YJRA 4M67A 4BBEA 4EQMA 5EM8A 5KMLA 4MXXA 4Y5HA 4FNXA 4EHGA 3SOCA 3PIXA 4WT6A 1R0PA 4EKKA 3NUPA 4CXAA 3DT1A 3O17A 2CPKE 2GHGA 2OJIA 1ZARA 4Q2AA 1TQMA 3Q4CA 2YAAA 4ORKA 3QA0A 3QQUA 2PZ5A 4N0SA 2WQBA 3TCPA 5HVJA 2ZV7A 3RM6A 3A7FA 1Q8ZA 5IG1A 3EZRA 5GJFA 3ZS5A 2UW4A 3KC3A 3IW4A 1NW1A 5EDQA 3VBTA 5IF1A 1J7LA 1CKPA 4XOYA 4CRLA 5DN3A 5DHJA 5EOBA 2C0TA 4BYIA 3D2KA 5CVHA 3UBDA 4EK5A 2QO7A 4BR3A 3O8PA 3UMWA 4DFUA 4MCVA 2HZNA 4FVPA 4IAZA 1R0EA 4UMPA 3BLRA 4IDTA 3G90X 1BX6A 4XRLA 3TT0A 3FHIA 3GCUA 3QZIA 2VX3A 3EKKA 4GKHA 1A48A 5GINE 3Q32A 3PWDA 4AS0A 3U6JA 3ACKA 1SNXA 4HOKA 3SKCA 4FVQA 3CE3A 4N4SA 3MTLA 3NCZA 1PY5A 4LUDA 3IK3A 4FT0A 5HKMA 1YWNA 4IX4A 5HI2A 1XH5A 4O96A 3QRUA 2XZSA 5B7VA 3O0GA 5BVOA 1JOWB 2XUUA 4LRKA 3W2QA 5KMOA 5JRQA 2IVTA 4JI9A 5EQEA 1YRPA 2V22A 4FT9A 1PXOA 4QQTA 5AFVA 1Z5MA 4HW7A 3VS1A 4P90A 4C57A 4RX9A 3SRVA 3N4UA 3NAXA 3PVUA 5HLNA 3P08A 4E5WA 3C0GA 3MW1A 5D9HA 5LVMA 1L8TA 2XF0A 3IONA 4PDYA 5DG5A 3LXPA 3LE6A 1IASA 1R1WA 2W9ZB 4BIDA 1CM8A 1KV2A 4AU8A 2Y6MA 1M2QA 3FE3A 5TKDA 4BZOA 4AN2A 1PRYA 2HY0A 1W82A 3NWWA 4EHZA 2IW9A 4EH4A 1Q97A 5D1JA 4QTEA 3FPMA 3LMHA 4JBVA 2G01A 3HUCA 4RQVA 4BCNA 4ZOGA 1X8BA 4D4VA 1KUTA 2OZOA 3NNVA 3D2IA 2QU6A 3EFJA 3QBNA 4FIEA 2GNJA 3FDNA 3EZVA 5CAPA 2PVRA 1V0PA 4TTHB 3RPVA 1GOLA 4FKQA 4S2ZA 5KE0A 3SQQA 1XO2B 5L6OA 5TO8A 3JS2A 5E9EA 5ANEA 3O50A 3F6XA 5A3XA 2YCFA 3MIYA 4GSBA 2ITXA 4EHEA 4FGBA 2CSNA 4RVMA 4U7ZA 2GFSA 4C36A 4JRNA 3C4ZA 3U87A 1KE5A 3AMYA 2QC6A 2YIQA 4I6BA 2WFYA 4OGRA 4YJPA 3E7VA 3ACJA 3CPBA 2YM6A 2F2CB 3I7CA 3GCVA 3Q52A 4ZSAA 3VBWA 3H9RA 2F57A 3L9MA 2WIPA 3GCPA 1JBPE 5FG8A 2F4JA 2UZUE 1LPUA 2PVHA 2W99B 3QKLA 2OF4A 1PMEA 5IPJA 2E2BA 3OHTA 5M08A 3RZFA 2BKKA 4ASXA 5BUJA 5I4NA 3ZC6A 4Y8DA 4EK8A 3QL8A 2ITWA 1FOTA 4FTOA 1K9AA 4JL9A 4J8NA 5HVKA 3K54A 3ZRMA 5KMJA 3EFWA 1VEBA 4ZZMA 3FQSA 3LFQA 1IG1A 2QKRA 5CALA 5KKRC 4RFMA 1K2PA 3O96A 4NM7A 3R8PA 5BQ0A 4C3PA 3FMKA 1BL6A 3CD8A 3QZFA 4WOVA 4AGCA 4XS2A 2REIA 1YXXA 4ALWA 2Z02A 4PL4A 1FPUA 4QMOA 4XBUA 4CLIA 3RZBA 5A46A 4O2PA 2R3IA 4RQKA 4YTIA 2AYPA 2G15A 1OBGA 3L8PA 4FT7A 1L3RE 2KTYA 5IEVA 5GIOE 3DA6A 3TL8A 5AJQA 3EN4A 4G5JA 3EQFA 4J95A 5EG3A 3OW4A 4GW8A 5AP3A 4E6AA 4YURA 1OKWA 3PIYA 3AT4A 3BBTB 5IQGA 4AOTA 4JDIA 1BI7A 4XG4A 3A7JA 1YHVA 3REPA 2B9FA 3NSZA 4RA5A 3ZUTA 3BPRA 4ZXTA 4IM2A 3R00A 4F70A 2XP2A 1OKVA 5L6PA 3R7UA 4A9UA 3CKWA 5HTCA 4EEVA 3RPSA 3ZDUA 2Z60A 2X2KA 4NCTC 3T9TA 4UMRA 1STCE 4QYHA 4G3CA 2HWOA 1PKDA 5EM7A 1YXVA 4RPVA 4ITJA 3W33A 1OB3A 4YJSA 5J9YA 4XG2A 4QTAA 4E4XA 4ASEA 1TQPA 2Q0NA 4FZ7A 3FXWA 4L8MA 4KBCA 3I1AA
chains in the Genus database with same CATH superfamily
3QXOA 4LRMA 4DYMA 2B52A 2IZUA 3QWKA 3NGAA 3WZJA 5LCKA 4EHVA 4AZSA 5KKRB 5KNJA 3TJDA 1S9JA 2LAVA 3LLAA 4D28A 1XMLA 3ZM9A 4YBKA 3I6WA 3TIZA 3I5ZA 1SZMA 2UZEA 3FL5A 1O6LA 4O1PA 2XAMA 3IS5A 5CTPA 3TKUA 5IKWA 2O0UA 3K5UA 4BC6A 1WVWA 1OKZA 1DM2A 2H34A 4U8ZA 1YWVA 5HG8A 4DC2A 3PXFA 2VTLA 3DK6A 5IEYA 4EJ7A 2H96A 3PY1A 2C3LA 3N4VA 3HRBA 4RJ5A 3PVGA 3TUCA 2VTMA 5H8GA 2QO9A 3R8LA 3TZMA 2XCHA 5HIBA 2BPMA 3K5VA 2CKPA 3GU4A 1IA8A 2A1AB 4L45A 4LRJA 3QD4A 2BAJA 4FSRA 4E7WA 3GC7A 4IMYA 2X39A 2Y9QA 2OKRA 2V62A 3RGFA 2ZM1A 4F1TA 5BVFA 5JZJA 5ETAA 4FI1A 2Y4IC 3SC1A 1KSWA 2RF9A 3ELJA 1PMUA 3LJ2A 4O0RA 1LEWA 3BCEA 2DYLA 4BKYA 3KREA 5JK3A 3KVXA 2H9VA 3LJ1A 4PPCA 1H00A 4D9TA 1PXPA 2QOOA 3OOMA 3FQEA 4AXEA 2XCKA 5CS6A 3ZC5A 4EK3A 2UW5A 1PF8A 5C8MA 1WBSA 2W1CA 3HNGA 4BCJA 4DFYA 2WXVA 4IZ5A 4BCPA 4TYHB 2GSFA 4K77A 5HE1A 4JQEA 3D4QA 3Q60A 3Q9XA 2ITNA 3PJ8A 3R21A 4FICA 5FP6A 3VIDA 4DH3A 4QT1A 4BY9E 5AM6A 3M11A 4TT7A 2PHKA 3LCTA 3VS3A 4V01A 3Q2JA 2XK3A 4EC9A 1P5EA 2XK6A 3TIYA 3FJQE 4C58A 4YNOA 2XNOA 4R3RA 1A06A 4UV0A 3LMIA 2YM5A 4M14A 3QQGA 2XKDA 3EN9A 1OPLA 3ZYAA 2A98A 2O64A 5IUGA 5HCXA 3QRTA 1J7IA 5FWKK 1NY3A 2PZRA 4D2PA 2IVSA 3GCQA 3H0ZA 3OMVA 4YC3A 3ZLYA 2YWPA 4O7YA 4ZJVA 3OWPA 5KBRA 4R7IA 4QNYA 2IWIA 2VWWA 4R1YA 1FVRA 4YTHA 5E1EA 3R7EA 3R9NA 4IE9A 4NJ3A 5CQWA 4RIYB 3I4BA 2W06A 3QGYA 3WF5A 4K9YA 4N70A 4X2KA 3ZZEA 4G16A 5ANDA 3HMMA 5EI6A 2ZB0A 4D2TA 4JIAA 4Y83A 3OEFX 3T3UA 4IANA 3KULB 4GIHA 4YSJA 5IA0A 3FKNA 5J7BA 1ZOEA 1APME 4MXYA 4F9AA 2VN9A 3A62A 5H3QA 3EWHA 1ZZ2A 1ZYJA 3BQCA 3H4JA 5D7AA 5ANIA 3WZDA 2P2HA 2W0JA 5AR5A 4A07A 4PTGA 5EHYA 3VS2A 4U40A 4LM5A 2WNTA 2JBOA 3C5IA 4X3JA 1PXMA 2JDOA 3JXWA 5JFWA 1U54B 4KNBA 3ZO4A 3RAHA 1OL5A 4QMMA 3HAMA 2R3LA 3DOGA 3C13A 3CD3A 4YO4A 5DH3A 5AX9A 4UZDA 4TW9A 2X7FA 2DWBA 4I22A 4IAKA 2R0UA 2IW6A 3UOKA 4JQ8A 3NIEA 4YJRA 4FC0A 4NTSA 1Y91A 5CEKA 4CG8A 4XLIA 4D58A 1QCFA 2J0IA 4RC4A 1GIHA 5HD4A 3MV5A 2OIBA 3DJ5A 5IQCA 2WMWA 3OWLA 5LMKA 1WFCA 1K3AA 5E8TA 4UXLA 2OIQA 1OGUA 4BZNA 3NUXA 4K11A 2VTHA 5HZNA 4O7WA 4NW5A 3A61A 3DQXA 4C59A 4PMPA 4OBOA 3W8QA 3QX4A 3RPRA 5C8NA 5M4IA 2JC6A 3Q6UA 3RI1A 3FEGA 5JZNA 4DT9A 2IVVA 3GT8A 3C51A 4QP6A 1ZOHA 1JKTA 5IZFA 3FLYA 4FTCA 4L3JA 4QQCA 2AC5A 2A2AA 4PF4A 4OW8A 5L2WA 2HIWA 1Y6AA 3MBLA 4FSZA 2UZOA 4MEDA 3H9FA 4UXQA 4NYEA 2J5EA 4FV8A 2FSTX 3B2TA 3NS9A 4ID7A 4GMYA 3RP9A 3EYHA 1ZYLA 4F9YA 2Z7LA 4IW0A 3EQIA 1YHWA 1JVPP 2X81A 2R7IA 2FVDA 3LPBA 3FZTA 4ACDA 2XH5A 4AF3A 4BZDA 3MFRA 3Q53A 4QQJA 4AN3A 4HCVA 3TNWA 2JAMA 4C2VA 4CCUA 4UYAA 4NJDA 2FSOX 3WZEA 3KU2A 2ITVA 1CKJA 3DFCB 3QUEA 5F94A 4C02A 4FV4A 2I7QA 4RVKA 5HNGA 4O83A 2VWYA 4YO6A 3PE1A 3Q04A 4FTLA 3QRKA 4MBIA 3PG1A 2V7AA 2CKOA 1ZYDA 5IH5A 2F7EE 4G5PA 4IVCA 3ZHPC 2PUNA 4FYNA 1W84A 2PUUA 4CG9A 1QMZA 2WGJA 4A9SA 4KIOA 3TNPC 4NM0A 3PWYA 4DG3E 4IVAA 2QU5A 1JAMA 2O65A 4QMQA 3GUBA 2C6OA 2PPQA 4EJNA 4ZEGA 4AG8A 4GFMA 4WIHA 4LGDA 4YPDA 4IACA 1XH4A 5CANA 5CF8A 3Q4ZA 3BYUA 5GZ9A 1VJYA 4QYEA 1TQIA 5CZIA 3VQHA 3HLLA 3OG7A 2YIXA 5D11A 3N4TA 4B8MA 5IUHA 3CBLA 3NNUA 2C30A 3OVVA 3PUPA 3MB7A 4U81A 2WKMA 4XP2A 4AZFA 3P4KA 1CDKA 2BALA 4EOKA 3F3TA 4XLVA 4BBFA 5L3AA 4ZTHA 4DLJA 4OTQA 4RIOA 3ALNA 3ETAA 3QTIA 3PXRA 4O0SA 4O38A 5DA3A 3OUKA 3PPJA 2ZB1A 2HXLA 2YLFA 3AG9A 3CQEA 5HNBA 4PNIA 4KABA 3E7OA 4M7IA 3R6XA 3OF0A 5D7VA 2HOGA 2B54A 4MK0A 4XV3A 2C6LA 2UVZA 2C1AA 5JFSA 4RIYA 2CNQA 1I09A 2IJMA 3JPVA 1JKKA 4GU6A 4QMVA 4CFFA 3PSCA 3JVSA 2F49A 2B9HA 4OTWA 2YZLA 4CFNA 4MNEB 5IU2A 4YC6A 3KMUA 4G3DA 5HOAA 3F9NA 3ORNA 3ERKA 2QHMA 3HV4A 4LGGA 3LXKA 4RJ4A 3VW8A 4C4JA 2PVYA 3PA4A 4MBLA 3HGKA 4QMUA 2WQMA 3GGFA 3MJ1A 4XG7A 3NX8A 4BCOA 4DEDA 1NA7A 5A6OA 3KXMA 4UB7A 3PSBA 4AZTA 3EQRA 4A4XA 4CMTA 5B2LA 4AP7A 2WOTA 3EHAA 3A7IA 1UKHA 2OJJA 5IA1A 4FIGA 5IMEA 2F9GA 3W2PA 2RSVA 5KMKA 5IH6A 2ZDUA 3E3BX 2WMUA 5CYIA 3BELA 2JITA 3W18A 4PNKA 3EQPA 3LFFA 3DXPA 2YIYA 3G6HA 5J5TA 3P0MA 4C33A 4DEEA 3DJ6A 4KB8A 4ZJIA 1Y8GA 2GQSA 4L44A 2W1GA 4FNWA 4AQKA 3QQFA 4BGHA 5TOZA 2LGCA 3RAKA 2OXXA 2HZ0A 2IZTA 3CY2A 3VVHA 3P79A 3G9LX 1M2PA 1JQHA 2W1FA 3A4PA 1OL6A 2RIOA 3PY0A 4F0FA 3OXZA 4ZAUA 3CY3A 3OCTA 4O4EA 4S33A 4X3FA 1XH8A 4A4LA 2PUIA 1G3NA 1Q5KA 5EK7A 3W0OA 4BCGA 1H1PA 3IW7A 2DUVA 3QA8A 3VS0A 3GBZA 4B0GA 2PZIA 4ACHA 4BBMA 5AUTA 3FZSA 3ZO2A 4ASZA 4O7VA 3EMGA 2BRBA 3OEZA 4L42A 1WBNA 2VO3A 2RFDA 3SOAA 1KE7A 4L00A 2EVAA 4WO5A 5EH0A 5HG9A 3ORMA 2X0OA 3OWKA 4FSUA 4EYJA 5M06A 2CHLA 3I0OA 2VGPA 3WBLA 3ZTXA 5CNNA 4DFLA 4ACMA 2VTOA 5CXZA 4G9CA 4ANSA 2GQGA 4WNKA 2YABA 2OZAA 2PU8A 4YGAA 2UZLA 4HNFA 2BDJA 5CQUA 3HRFA 2XM8A 1XH7A 1GZOA 3BHVA 3FSKA 4BDKA 2VAGA 3BLQA 2A4LA 2UVXA 2PMOX 3CKXA 5L2SA 2QNJA 3FBVA 4JAIA 4F64A 2VU3A 3MVLA 1OKYA 2W7XA 3CXWA 3R1QA 5ICPA 3D14A 4E6QA 4AW2A 3FZOA 3VF8A 4D5KA 1YXUA 2ERKA 4IX5A 1XBAA 2CKEA 2C69A 5HU9A 4MF1A 4UBAA 5BVWA 5L6WL 4MBJA 4NW6A 4GFOA 4UZHA 4B4LA 1GZ8A 3R7GA 3R9DA 4X2NA 4C4FA 4IWDA 5ETCA 2I0YA 4FTQA 5HIDA 3GFEA 2BZIB 3B2WA 3MVJA 4RFZA 5A4LA 1XQZA 3KN5A 1H28A 2GS6A 4EC8A 3G33A 3QZHA 3PXYA 2J2IB 5DIAA 5CEIA 3FUPA 3ZXTA 2CLQA 4IIRA 4RG0A 4EUUA 5K4JA 4GKIA 2VO7A 5FM3A 2R0IA 4I94A 5BUIA 2CKQA 4XNEA 2YISA 4I5CA 2X8EA 4FEVA 3EFLA 5JFXA 2QVSE 3UP2A 2EXEA 3V5LA 2HELA 4S32A 3S95A 2BZKB 3PRFA 4UWCA 3KMWA 1AQ1A 4DH7A 3PJ3A 4JBQA 3RK7A 5M53A 3UQCA 1YWRA 1PKGA 3MY5A 4XCUA 3RVGA 3R8ZA 4NFMA 4WRSA 3TN8A 5J5SA 2BAQA 3FSFA 3BHHA 4O4DA 1G8AA 4QP3A 3UE4A 3VBYA 5FXRA 4PMMA 4XV2A 3BQRA 5B2MA 2VTRA 1URCA 2UW9A 1G8JA 3QYZA 4O2ZA 2JBPA 4LV7A 4EBWA 3HDNA 3HYHA 1REJA 4O4CA 5CF4A 3QX2A 2ZV2A 3LCOA 2F7XE 4FTMA 4FT3A 2YCRA 4GT3A 5AP4A 4V0GA 3SW7A 4TWNA 2NYAA 2EXCX 3LCKA 4GG7A 4HGLA 4KD1A 1QPEA 2QLQA 1HCKA 4Y5QA 3V5QA 4B7TA 3FYKX 4JG7A 4IC8A 3ID6C 3Q3BA 3TEIA 3ZZWA 3KN6A 3HVCA 2GTMA 3KY2A 4C38A 3SVVA 4D4SA 3A7GA 4CV8A 4QTBA 1ZMVA 4NKSA 3UODA 4J53A 1YKRA 3OY1A 3RPOA 4IJ9A 2CGUA 4C2WA 5ACBC 4CV9A 5AUZA 4QQ5A 4DGNA 4UY9A 2WD1A 4K2RA 4C3RA 2ZV8A 1LUFA 5DT4A 4EH5A 3PUFC 3R63A 5DFPA 5E4HA 1Q4LA 5KMNA 4LQMA 1IEPA 4PMSA 4RGJA 3R9OA 2JAVA 3ZM4A 4RRVA 1VYZA 2PSQA 5F9EA 3DJ7A 2BRMA 3PLSA 4G9RA 4C61A 3DK3A 4BB4A 3MDYA 4F7JA 5L2TA 4H05A 4XG9A 5HE3A 3BYVA 3BRBA 3R73A 4G3GA 3DKFA 5HBHA 4EH7A 4XV1A 1GZKA 2ITQA 5I9ZA 5ANGA 4J97A 2XK9A 3FC2A 3FMMA 1G8KA 3IPHA 5BVEA 3ZUUA 5J1WA 5E8WA 3VBQA 2P55A 4LOPA 3LQ3A 2WZJA 4CD0A 5FBOA 2WMXA 3MFTA 2R3JA 2RFEA 1Q8WA 5CENA 3TUDA 3MVHA 2QOIA 4U0IA 5IEXA 5AV2A 4BTMA 4IH8A 3KL8A 3M2WA 1PHKA 3DB8A 3ANQA 4EI4A 3E8EA 3ODZX 4P2KA 3KXZA 4CFUA 4PL3A 5BNJA 3VRYA 4XG3A 3HRCA 1YOMA 1FMKA 4YHJA 1RE8A 3QTQA 4EYMA 3F88A 3Q96A 3FMLA 4A4OA 4EBVA 3NYVA 3Q9ZA 3TNQB 4FTKA 3U55A 3QLFA 3ZEPA 3P78A 3SD0A 3D83A 3RNYA 4HZRA 5CAVA 4G17A 3SRVB 1H26A 2UZNA 2PZPA 4F9CA 3MPMA 4QRCA 2H6DA 3C4XA 4C3FA 1M52A 5D12A 3NUAA 5CI6A 3I5NA 2Y6OA 3KXNA 3E93A 4IB1A 5DT0A 4F0IA 3PXQA 4YUQA 4CGAA 2CN5A 4BI2A 5DWRA 3Q2MA 2UZWE 5LVOA 5I5ZA 3E63A 4YU2A 3QTZA 2DQ7X 3FI2A 2ETRA 5ETFA 5IQDA 4YLLA 4JBOA 1O6YA 5EW9A 2PK9A 2WTJA 3GU7A 3NYOA 2BIYA 3PA3A 4O82A 1ST0A 4W4XA 4W8DA 3DQWA 4FK3A 5AMNA 4Q9ZA 4BCQA 3L9NA 4KBKA 4XG6A 5LCJA 3FKOA 1VYWA 4YMJA 3HMIA 4UWBA 3ZSGA 3LCSA 5M55A 2HZIA 4BWKA 4F6UA 3QQHA 1H07A 3KRJA 3EQCA 3POZA 4FG9A 4KS8A 4ONAA 4U9AA 3RINA 3A8XA 1XH9A 2YIWA 3DU8A 3VS4A 2ZFYA 3ZONA 4R6VA 4DG0E 3P9JA 3VS5A 3OBGA 4NM5A 4NL0A 2QODA 1FGIA 4TWCA 3VWAA 1W2CA 4FV6A 4MXCA 3F3VA 4WUNA 1EH4A 1VZOA 4R77A 4DHFA 5BUEA 4GEOA 5HQ0A 3HV6A 4GT4A 3QQKA 4DBNA 3DAJA 2JEDA 4WG5A 4K33A 3R7VA 1I44A 3NUNA 2NRYA 4LV8A 1H1SA 5A14A 3QU0A 4LUEA 2XIYA 3FV8A 3LM0A 3HV3A 2YM7A 4O7ZA 3TZ7A 3EL8A 5E1SA 5HG5A 4RIWA 4EH9A 1ST4A 2W17A 4BCMA 4FEUA 2Z2WA 3VW6A 4CZYB 5CSWA 2WMSA 3OCSA 2VTTA 2Z7SA 3ORZA 4C35A 5CF6A 4YZBA 1OIQA 1W0XC 3LXLA 4QP2A 5CU6A 3UZTA 3HV5A 3G51A 4TYEA 1ZZLA 4YJVA 2CNVA 3A60A 4AW0A 4X0MA 5DYJA 3TV4A 3KIOC 4DE4A 2OWBA 2RG5A 2XJ2A 2BDWA 3KMMA 5FTQA 3BZ3A 3CTHA 3KRWA 3SHEA 3U6IA 1TVOA 4J52A 4L7FA 4GJ3A 4KKHA 1ZYCA 5KO1A 3C0IA 2QOBA 3EFKA 3EQDA 5EYKA 2Y7JA 4AUAA 4E73A 2X9FA 2ITTA 3UNZA 3UDZA 4IZAA 4MKCA 4DCAA 2IN6A 5KMMA 3KFAA 4RWKA 3R1NA 2X0QA 3TNHA 4G6LA 4FSYA 4R5YA 4TYGA 4ZJJA 3VS7A 1IR3A 3E8NA 4QMWA 3WOWA 5IQBA 5JFVA 5DBXA 4GYIA 4G3EA 3AC5A 2PMNX 3R7YA 3P5JC 2O8YA 2PE2A 4GH2A 5FTOA 4ZTLA 3UQFA 4H1MA 4CCBA 4DDGA 2BHEA 1QPDA 2GNLA 5EDPA 5HHWA 3WILA 4BIBA 3AMAA 3OXIA 1M2RA 4E20A 2QOQA 4FEWA 1KE8A 4F78A 2X1NA 2PYWA 4IB0A 1MQ4A 3WF9A 5C03A 3GB2A 5FGKA 5B2KA 2R2PA 2HCKA 2RG6A 3F3ZA 4XEYA 4AT3A 4DLIA 2ONLA 2YCSA 5L4QA 3R04A 2XB7A 2W96B 2YHVA 1BKXA 3DXNA 4DTKA 5KHWA 1WVYA 4GIIA 3CGOA 1ERKA 4G6OA 4M68A 3ORTA 1YDSE 5JGDA 4IEBA 2W9FB 5EM5A 3Q6WA 4NFNA 3L1SA 3SXFA 1HCLA 4F1MA 5CU4A 2R3GA 4O1OA 2Z8CA 4JBPA 2KULA 4OBQA 3KK8A 4USDA 5AX3A 3WF8A 5CX9A 3S1HA 4N6YA 4QEBA 4RT7A 4BWPA 3LVPA 5EKOA 3LFAA 5AR4A 3A8WA 4U6RA 4NIFB 1V0OA 4ERKA 3BEGA 3IDPA 4KKEA 5HEZA 2C3IB 5TT7A 4GRBA 4EOLA 2WTIA 3QCYA 4LL5A 4M15A 5J9LA 1XHAA 2PZYA 3LFBA 4M69B 3QFVA 4I24A 4J1RA 3BE2A 4M69A 4ALUA 4FL1A 3OXTA 4HYUA 5EM6A 3T9IA 1ZXEA 4BDFA 1WBOA 5HX6A 1E1XA 5HCYA 4R7HA 4YBJA 4BDJA 4TRLA 4QMNA 3IDCA 4BCHA 3I0QA 5LMBA 4A9RA 3HZTA 5DEYA 1U59A 2QONA 4XYFA 5F4NA 2JFMA 4P7EA 5ETIA 5HO6A 1SYKA 4D1SA 4XOZA 4KSQA 4AOJA 2QG7A 5CT0A 3MH1A 2ACXA 2EWAA 3FI3A 3QCXA 5BV3A 3EOCA 1U46A 4I3ZA 5HBJA 4O6LA 3G2FA 3QYWA 2PY3A 5EYCA 4I1ZA 2WU7A 4E5BA 4RSSA 5EHOA 4GU9A 4FZ6A 4HPUE 3CJFA 3UIUA 3HL7A 4ZP5A 4OT6A 3PVBA 1IRKA 2XALA 3KXGA 3OT3A 5HICA 3V51A 2X4ZA 4E6DA 4ZTMA 5E8XA 3EIDA 4G2FA 3UNJA 4L3PA 3S3IA 4GUBA 4ZSEA 1XKKA 2I0EA 3LFNA 3Q4TA 4JR3A 4L6QA 4RX8A 4RFYA 5D10A 4G1WA 3L8XA 4MD7E 5DT3A 4ERWA 3OWJA 4FKGA 3EYGA 5M4FA 4FTAA 1OM1A 1JSTA 2ZVAA 3ZOSA 4AOIA 4Z7GA 2W1DA 5AA9A 2WMQA 3H10A 1H08A 3CPCA 3P7CA 1H1RA 4BIEA 3FMEA 4WG4A 5AP2A 1OMWA 3P7BA 1GAGA 1OL7A 2BZHB 2B7AA 3OD6X 4G31A 5E8YA 4EZ5A 4OTIA 4XHKB 4GK4A 4FG7A 4GCJA 4IWQA 4XJ0A 4QMXA 4RIXB 4F1OA 2V5QA 2XIKA 4LFIA 1NVSA 3ZDIA 3F7ZA 4HPTE 4DTBA 5GNKA 4FTUA 4FKPA 4D1XA 2ZV9A 5FQDC 4IWOA 3AT3A 4O84A 3DZOA 4NEUA 2P4IA 3EJ1A 3FMNA 3OT8A 3EQBA 1M14A 1YI4A 4FTIA 4Q5EA 3VUHA 3AGLA 5TR6A 5BYYA 2CGXA 3MH2A 4WNMA 4AE6A 5IA3A 3NVKI 3PLAE 4AT5A 3TYKA 4V05A 4IX3A 2PVNA 4F09A 5C01A 2PVMA 4IADA 4J98A 3NFFB 5K0XA 4ITHA 3HKOA 2C5NA 3F3WA 4WUAA 4YJTA 3U4UA 3MFUA 1OI9A 5FXQA 4FYOA 4GV1A 3MPAA 3OBJA 4R1VA 3QTUA 4OTDA 3PXZA 1QPCA 1U5QA 1XWSA 4J99A 3PSDA 3BX5A 5GZAA 2X0GA 1OGYA 2R4BA 3W0NA 1PXLA 5EW8A 1O6KA 2X6DA 3O7LB 4FGRA 5E92A 1U5RA 2XK7A 4BDHA 3TWJA 1OUYA 3DS6A 5BX0A 2BRNA 5LOHA 1IAHA 3UG1A 4JDKA 5FM2A 4QTDA 3G5DA 4L46A 3RAWA 3AMBA 3WARA 4EOQA 4ZIMA 5BVNA 3MB6A 3F5XA 5AM7A 2C6EA 4RMZA 3RNIA 3QF9A 1ATPE 4IHPA 4QMZA 4L01A 3QGWA 3ROCA 4G34A 4RVTA 3LMGA 3RJCA 2ZMDA 4E5AX 2CGVA 5IUIA 4ZTNA 4RBLA 3QC9A 3WE8A 3QRJA 4X2FA 3BGZA 4JMQA 3U54A 2EB2A 4H3PA 5L8LA 4W8EA 1SVHA 4F7SA 5JQ5A 3GU6A 1H25A 5FBNC 2P0CA 2IEWA 4EWQA 4MXZA 4BCIA 2J50A 1NT2A 3GENA 3DBFA 2BHHA 1UWJA 5HLWA 3WIKA 3DXQA 4YZDA 2OSCA 1MP8A 5AR2A 5K9IA 1OIYA 4XG8A 2QQ7A 3ATSA 4DH1A 1IAJA 3ZRLA 4M0ZA 4C4EA 4R78A 3B8RA 4QP7A 2QOHA 1UWHA 2FUMA 2OICA 4XMOA 1GZNA 3DB6A 3PP1A 3W2CA 2QOKA 1GNGA 3BLHA 4QDVA 2VWIA 3P86A 3R2YA 3R8UA 2GDOA 2QCSA 3V5PA 3SA0A 5AAFA 3MI9A 3AQVA 3DKGA 3BYMA 5BMMA 4S31A 3W16A 4C34A 3UTOA 5C4KA 2AQXA 3BYOA 3NR9A 5F20A 1FGKA 2UV2A 1RDQE 3FWQA 4FNYA 1IA9A 1DS5A 3D94A 1M7QA 2QG5A 2ZM3A 4S30A 3CLYA 1JSVA 4Y72A 3V5WA 2UZTA 5IH4A 3JUHA 3LM5A 1Q3DA 2OG8A 2Q83A 1Q61A 4P4CA 5DR9A 3R83A 3GU8A 3ZEWA 1G5SA 4FZAB 1PXJA 2CCHA 1PMNA 2QR8A 3OW3A 3KKVA 2XNBA 3QHWA 3VUKA 3NFGB 1XMMA 3UMXA 4IX6A 5M4CA 4DBXA 4ITIA 3GOKA 4TXCA 4GVAA 4NSTA 4I5PA 2GQRA 3W2RA 4ZMEA 2ETKA 3E64A 4EUTA 4MWIA 5ACKA 5IQHA 4DINA 3CTJA 4EOMA 5D41A 2PULA 2WTKC 3E62A 4ACGA 3QWJA 4FTRA 5CAOA 2OW3A 3NNWA 1VLRA 4L52A 4N57A 4ZTRA 1FMOE 2IO6A 5LJJA 2XIZA 2PE0A 1BI8A 2J0MB 2C3JA 4CKRA 3RALA 4FV5A 4TZRA 5HORA 4AFJA 2G9XA 4HYIA 5CU3A 2WB8A 3MY0A 4WHZA 2QURA 3QC4A 2RFSA 4FVRA 4KIKB 3NDMA 1FVTA 3AC2A 4DN5A 2NRUA 2JD5A 2WEIA 3SXSA 2ITZA 4AW1A 3TZ9A 3PE2A 2WTWA 2R3RA 3CC6A 4BCFA 2RL5A 4HVHA 3PYYA 3E88A 2Y4PA 4XUFA 1B38A 5KZIA 4CYJA 1Q41A 4Y85A 3IW6A 5L8JA 1Y6BA 2R5TA 2XYUA 3DV3A 3VUGA 4E4LA 1WAKA 3KXXA 4E1ZA 4KUJA 4X21A 5AWMA 1DI8A 3NNXA 4QMPA 5DGZA 4ZLYA 3TM0A 4JS8A 4MD9E 1JSUA 4KS7A 4USFA 5AUVA 4IVDA 5M44A 4AAYA 2HWPA 3QTSA 3FI8A 3R22A 4I92A 4BTJA 3LQ8A 4B99A 4AGUA 4QOXA 2O2UA 2B55A 4APCA 4JJRA 5CI7A 3PPKA 3H0YA 2J9MA 2JKQA 1WBVA 4U3ZA 5K4IA 4MQ2A 3CIKA 3RPYA 5DRDA 5AV4A 2BTSA 1YW2A 1KWPA 3CR0A 5AUXA 4RZVA 2V0DA 4YR8A 3BYSA 2W4KA 2GMXA 2R3OA 2X4FA 3MIAA 4FF8A 1ZAOA 4G3FA 4XV9A 5AIRA 4AZWA 2ITPA 3C4CA 3BI6A 3C5UA 4YNEA 5E8SA 4D0XA 3II5A 4TNDA 3UDSA 4EH6A 4BFMA 4ZTSA 3E87A 4F99A 2WQEA 4AAAA 3OS3A 3FMJA 3C0HA 1YI3A 2JIIA 4QYGA 3K3IA 2BROA 4JOAA 3U51A 2P33A 4FV9A 4OTPA 4RC2A 3IW8A 5DMZA 3N9XA 2VD5A 5CVGA 3RWPA 4CLJA 3SXRA 2XRUA 2NPQA 3W32A 4B6LA 1OPKA 2FGIA 5CAQA 4PTEA 3VN9A 2R64A 2YWVA 3SGCA 4FKWA 5CSVA 2G2FA 2C6IA 2XVDA 5K5NA 2OLCA 3TKHA 4RC3A 3H3CA 3EQGA 3OROA 5AP6A 3ZLXA 3C4EA 3UG2A 4PRJA 4FL2A 4I23A 4OT5A 5M4UA 4TNBA 1MRYA 2EUFB 2YDKA 2BFXA 3EN7A 2B1PA 3DBEA 1A9UA 3H9OA 5DEWA 4R8QA 2V7OA 4ZLZA 3ML1A 4FRFA 5EHLA 2AUHA 2OGVA 3I81A 3BE9A 3UYSA 5BYLA 3R0TA 3NW7A 3LQ5A 3F69A 3GEQA 2OXYA 2IZSA 2VRXA 2XMYA 3I79A 4AGDA 5M09A 1B6CB 5DLSA 3FLZA 3OUNB 1WBTA 4TYHA 3RKBA 4JG8A 4ANLA 4PX6A 1PXIA 4EK6A 3MH3A 4J7BA 3OOGA 5A4CA 4JDHA 5EYDA 4CKJA 2XEZA 4D0WA 2QD9A 4AXCA 3ZFYA 2GFCA 2QHNA 1UKIA 3ZFXA 3WYYA 1P4FA 3U8WA 1GIJA 2ZAZA 4MHAA 1J1BA 4QP9A 3NEWA 3UOHA 4X2JA 4DH8A 2E9UA 5H8EA 3CS9A 4Z55A 3KRRA 3HMNA 3TUBA 4GVJA 4QP1A 4A9TA 5CU2A 5FEDA 3F5PA 2UW8A 2YACA 3BHTA 3RCDA 5CWZA 3TKIA 4YP8A 4C8BA 2PMIA 3FLNC 1UNLA 3PJCA 5T6KA 2JKKA 2C0OA 4FIIA 4P5ZA 3UDBA 5EI2A 1UVRA 4O7SA 4A06A 4J71A 2WQNA 4DT8A 4DFBA 2AC3A 2H8HA 2W1EA 4RIXA 3AC8A 1P2AA 4KIQA 4RZWA 3UVPA 2BMCA 2FO0A 4ZY5A 5J87A 4I4EA 4ENYA 4M12A 3R1SA 4ASDA 3QQLA 2CNUA 5E91A 3UO5A 2VWVA 4PWNA 4Z7HA