3VHKA

Crystal structure of the vegfr2 kinase domain in complex with a back pocket binder
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
355
structure length
297
Chain Sequence
DEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title A Back-to-Front Fragment-Based Drug Design Search Strategy Targeting the DFG-Out Pocket of Protein Tyrosine Kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 297
sequence length 355
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vhkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vhkA01
4BGQA 4PTGA 4ZSJA 4EYMA 5DMZA 2XYNA 3R71A 4XS2A 3G51A 3SV0A 4J96A 2HYYA 2R64A 4FTCA 4F7JA 4R6VA 5CU6A 3QC9A 2C30A 3R7EA 4C59A 3VUDA 3EL7A 3NS9A 3HL7A 4I5MA 2X7OA 2VU3A 4H1MA 3BHTA 3SXRA 5KMJA 3FLWA 2JBOA 4JS8A 3WZDA 4O7SA 5EM6A 4BI2A 4EOSA 3FMKA 1SNXA 4Y5HA 3PXZA 5H8EA 3LE6A 5AP2A 5A4CA 2G9XA 1CDKA 2UW4A 5IF1A 2O63A 4R7HA 2R0IA 2XKCA 5I9YA 1L3RE 2A2AA 5DA3A 3G0EA 4I6FA 1H4LA 3ROCA 3PXQA 2O8YA 4BDGA 4LGHA 5IQBA 1TKIA 1W0XC 2VWWA 4EBVA 1H01A 3TV7A 2JFLA 3IQ7A 3UJGA 2VTLA 5AV0A 2RFSA 2OFUA 2OJGA 5EW3A 5LWNA 4C4GA 4HVHA 4W9XA 3PJ8A 4F7SA 1OZ1A 3LHJA 4ZIMA 4EOPA 3W8QA 3G33A 1XH9A 2WELA 3R7YA 5ANIA 1URWA 2JD5A 4YZCA 4N70A 3NWWA 2YWVA 3EQHA 1H24A 1ZAOA 2W0JA 1SMHA 3HMMA 2Y7JA 4JG7A 3T9IA 3ZFYA 3U4UA 4K6ZA 5B7VA 2QVSE 2J0LA 1OECA 2VWUA 3R00A 4KBCA 3E3BX 4LOOA 3LIJA 2JIUA 1PXMA 3E62A 1PJKA 2FYSA 1Q99A 4UV0A 4J8MA 5M4FA 2OO8X 3H9RA 3CP9A 1GJOA 3ZLXA 3ORTA 4AZSA 5J5SA 3UE4A 2P0CA 3I1AA 4OTPA 4I4EA 3PPKA 2I0YA 4U7ZA 3RZBA 4TZRA 3C5IA 1JKLA 5J1VA 3PXYA 4GUEA 4TWCA 3CKWA 3UOLA 2CN8A 4E20A 2CHLA 1KE8A 4G6OA 4YJVA 3R22A 3MH2A 3HV6A 4IMYA 4JG6A 1GY3A 4XG6A 3F5UA 3R7IA 1ZOGA 3BQCA 2UVZA 3LMGA 1O6LA 1PKGA 2ZDUA 3AC8A 2FUMA 3SD0A 2FSOX 2V55A 2F4JA 4FI1A 1CSNA 4XUFA 4IAAA 3KXXA 3RHXA 4KS7A 2W4JA 3KK9A 3FDNA 4QNYA 4FK3A 5J1WA 3PG3A 3R1QA 4I94A 1V1KA 4L44A 3FE3A 4RX7A 4ANBA 4Z7HA 1FBNA 4QOXA 2OXXA 5L6OA 4TYHA 5IH5A 2VN9A 1GZNA 4DH3A 4JT3A 1W82A 2OU7A 4USDA 4X21A 1P4FA 5I9XA 2PWLA 5E7RA 3AGLA 2C3KA 2PVJA 3MTLA 2VTMA 4JG8A 3GGFA 1YVJA 4HYSA 1J1CA 2OZAA 2BIKB 3MGYA 4E5AX 4CKRA 2Z8CA 4FE2A 2HWOA 3C13A 1FVRA 1NW1A 4XBUA 4IAYA 4C36A 4BYIA 2VTSA 3DB8A 3E8DA 4H3QA 3VAPA 3VS6A 5E8YA 3F3WA 4D4RA 4XLIA 4KIPA 4RIWA 4EOLA 3E7OA 5AP3A 2PU8A 1WBPA 2YCSA 5H9BA 3I7CA 3F61A 3RK7A 4NW6A 4GVAA 4EOKA 4GRBA 5K5XA 4FF8A 4FV7A 5I4NA 2UZOA 3LFBA 2YDKA 3E87A 1MQ4A 5GIOE 4TN6A 3MW1A 2H8HA 2W06A 3AC4A 3I0QA 4LGDA 3FY0A 1B39A 4PMTA 5CSWA 3COIA 2PL0A 4CZTA 3N4TA 1Q24A 1JSVA 3QFVA 4O38A 2BAKA 4J52A 3W16A 3OWJA 2AYPA 4ZMEA 4TL0A 1TQMA 4FSMA 1Z57A 3JVSA 4RVTA 2GS6A 4I92A 2H96A 4ALUA 3SXSA 2Z60A 4GG5A 3U9NA 3EQDA 2PYWA 2BRHA 3Q9YA 1PMUA 2GNJA 4R3CA 5HZNA 5AUZA 4MNEA 4FVRA 3LXLA 3MFSA 3V8TA 2VTJA 5BX0A 4BHZA 1SZMA 3QAME 4BDAA 3G6HA 3OXIA 4EH7A 3BGZA 4M69A 5IDNA 3UO5A 2WO6A 4TRLA 4UZHA 5CZHA 4MD8E 3ZTXA 4KRCA 4X2JA 4DH1A 5EH0A 1YDTE 2B0QA 1OL6A 3F5PA 1KE7A 3CJGA 4XRJA 3JPVA 3QLGA 1Q4LA 2WQOA 1VJYA 3Q3BA 5AJQA 3QC4A 3BHHA 4R5YA 3OHTA 5GHVA 2IVVA 3KB7A 3VUMA 1OIQA 4IXPA 3RPSA 4U9AA 1IRKA 3RNIA 3UZPA 5J79A 5CF6A 1UWHA 4PV0A 4PMSA 4DEBA 4NT4A 3Q5ZA 2B9FA 1L8TA 1Q8TA 5BVOA 3DV3A 3AGMA 3D7ZA 3NUSA 5FLFA 5L8LA 4EQUA 1SM2A 3UYTA 1YXXA 2A1AB 3I79A 2ONLA 2QG5A 2WU7A 3K5UA 4GIIA 2XCHA 1CMKE 3RVGA 2OK1A 3ORZA 3EN7A 3MFRA 2IW6A 3KXZA 2G1TA 4W4XA 3DZQA 2UZBA 2XEYA 1LEWA 3D2IA 3GC0A 2WMSA 1QPJA 2BDFA 5L6WL 4CFMA 5M51A 2P33A 2HZ0A 1ZZLA 2R7IA 4RIXB 4AOTA 4PUZA 4B4LA 4FV4A 3HNGA 3PA5A 4CSVA 3FXWA 2GQGA 4D0XA 5M4CA 3DDQA 4KBAA 5HE2A 5CF4A 3CLYA 4WUNA 2O2UA 3SLSA 3T3VA 3V5TA 4CQEA 3LLAA 4ZTNA 5EK7A 3DT1A 2CJMA 4FTOA 4JNWA 1H1RA 4QTDA 1OI9A 3ORKA 5ITAA 4EC9A 4RLKA 3RHKA 4ANQA 5CVFA 3G2FA 4FT0A 4YHJA 5HTBA 4PTEA 4NH1A 5HBJA 4NWMA 2WFYA 2V5QA 2XNEA 4RSSA 3GT8A 5DT3A 3ZCLA 4BCNA 4HZRA 3DBFA 5EKNA 1DAWA 3AD6A 4G9RA 2C6IA 2XB7A 4PY1A 3U87A 3SG9A 2NRUA 3O0GA 4FT9A 5LMKC 2H9VA 2AUHA 3OUNB 5HCXA 2VTOA 3JS2A 4C8BA 2FGIA 2I0HA 2XEZA 3IOKA 1AGWA 2CSNA 5E90A 3K54A 3LPBA 4IM0A 2J7TA 3UO6A 2HOGA 4IDTA 1GAGA 4P5ZA 5LCKA 4FNXA 4OT6A 3I6UA 2JKKA 2X39A 4H39A 4USEA 3RMFA 3FSKA 3ATSA 2JAMA 3TUBA 2X1NA 2WMAA 3D15A 4PP7A 2FSLX 2DYLA 3GUBA 4WSYA 5DOSA 4HYIA 4Q9SA 4QD6A 4QMUA 1NA7A 5HEZA 3HP5A 2O65A 1IA9A 2XNBA 4G6LA 3TJCA 5ETCA 5HNIX 1WFCA 5JKGA 4AP7A 2JDTA 3GU7A 4FOBA 3DJ6A 3EKKA 2RL5A 4GJ2A 3CPCA 4EZ5A 4ZJIA 4NFMA 3QUEA 3SQQA 2VTHA 3GU8A 2PVFA 3RPOA 2HW6A 5FEEA 2R3IA 3SX9A 3F3ZA 3EQIA 3FI4A 4J7BA 4RJ4A 5AX9A 4BDHA 3BYMA 4WIHA 5I5ZA 5HLPA 5TO8A 2XIYA 4C02A 2UZLA 1ND4A 3UZRA 4FG8A 3KEXA 2X8DA 1J1BA 2VAGA 4BC6A 2JKOA 1JOWB 1H28A 2ZVAA 5LOHA 4DEAA 1G3NA 3E8CA 3OCSA 4RC4A 5GZ9A 4EK3A 4UMQA 5BPYA 3D94A 5HX8A 4C2WA 3RGFA 2HWPA 4KWPA 3SW4A 5B2KA 3NMUF 2WMRA 4YHTA 4ID7A 3EQPA 3COKA 2QONA 2PVRA 4FKTA 2C0IA 1BUHA 5CEKA 1WBVA 1CKPA 4AGWA 4IB0A 4FV1A 1M2PA 5D7VA 4X0MA 3I0OA 3Q60A 3VW6A 4C58A 2DQ7X 4PRJA 4G9CA 3ZZEA 2F57A 2C4GA 3U6HA 4AZVA 4O82A 2VTIA 4I1ZA 2VTTA 2Y4IC 2VUWA 3ZU7A 4PDYA 4CFFA 4FG9A 2AC3A 2XH5A 5E8TA 3AOXA 3ORMA 2ITNA 5CEQA 4DFYA 4HVDA 5BYLA 4YURA 2J5FA 4O2PA 3GC7A 3C4EA 3FYKX 3MN3A 4O96A 3OT8A 4AW1A 3TV4A 4CT2A 5FEDA 5BVKA 4BKJA 4KSPA 3WE8A 2UW9A 4RWIA 2W4OA 3D5VA 2CLXA 2VV9A 4FVQA 4PF4A 3FKOA 4ZLYA 2F2CB 2RFNA 3NCGA 3VQUA 2XRWA 3KGAA 4CYJA 4E4MA 5IEYA 2OJFE 4E7WA 3A7HA 3DQWA 3EN5A 4HGEA 3QQKA 5KKRC 3HMPA 3VIDA 4S34A 3I5ZA 4BVUA 3ZSIA 3BU6A 4MXXA 3FQSA 3NDMA 1OITA 4AGCA 2UW5A 2WNTA 4MF1A 4WD5A 4LV5A 3ZEWA 4DYMA 4UYAA 4YZNA 4BKYA 3F88A 4IE9A 3TDVA 3PFQA 4BHNA 5CU2A 5I9UA 4CFNA 3A8WA 3PPJA 2B54A 3L1SA 3UZTA 4F1MA 3EYHA 2PY3A 4XCUA 4W9WA 3QQUA 2J50A 3LJ2A 4EH2A 1OPKA 3IONA 4AOJA 5AUYA 5TKDA 3G9LX 5DLSA 3C7QA 5CY3A 1FGKA 4JVGA 5IQEA 3Q4CA 2JAVA 5AAEA 3A7JA 1WBSA 2REIA 3FL5A 1WBWA 2Q0BA 5DT4A 1YXTA 4LQMA 1REJA 4YJRA 5CEMA 1H0VA 2R3QA 4EOJA 4D4YA 3P1AA 5HTIA 3KC3A 4G3EA 4AWIA 4ZZMA 5KMKA 2UZTA 3KKVA 3P7BA 4O81A 2IJMA 2OZOA 3IW8A 1U5QA 4FL3A 3KK8A 2XIZA 5B2LA 3OC1A 1RE8A 1B6CB 5JEBA 4U43A 5FDPA 3CIKA 4FKGA 3V3VA 3DAJA 3CPBA 2DWBA 4BWPA 2XK7A 4PQNA 3NUPA 3ODZX 2Z7LA 3DLSA 2PMLX 4PDSA 4CNHA 4BTMA 1E1XA 1GZ8A 4NM7A 5JQ5A 2PZPA 3WZJA 5FTGA 3IDBA 2C6TA 2JITA 2VO6A 3ROYA 5HO7A 4L43A 4WNPA 5FP5A 3ZC6A 3D0EA 4RZVA 2OFVA 3NYXA 2WEVA 4ENYA 4D55A 4F08A 2JDRA 4MVFA 2FVDA 1P14A 4W8EA 2OICA 2VO0A 2GPHA 2C5OA 3PJ1A 3SRVB 2E9VA 2YDIA 3L8PA 4FIGA 3ZHPC 3QQFA 4BDDA 3V6RA 4WRSA 1YWNA 4TWOA 5KZ0A 4HNIA 4EH4A 3NUYA 2XIKA 4JIAA 1K9AA 1DAYA 4D0WA 4ZJJA 3QTIA 1FQ1B 5DT0A 4D2RA 1ZLTA 3EQCA 4V05A 4Y8DA 5ETAA 4D2VA 4GFMA 1FINA 1XH7A 3PP1A 2XKDA 4K33A 4YJUA 5AP6A 5JGBA 2QOQA 2CKEA 2J0JA 4BCKA 2X4FA 1NVQA 3QUDA 5CXHA 4HYUA 4NIFB 5HNBA 3OT3A 3RPYA 1U54B 3RKBA 4YSJA 4FSRA 5ICPA 2RGPA 4XV9A 1FMOE 4UWYA 2UZNA 1U59A 1BL7A 4G3CA 3HVCA 2J51A 5CVHA 5AR2A 2WTKC 1OM1A 3LCDA 5AM6A 5D9HA 3VHEA 2YN8A 3SHEA 3ZRLA 3NUAA 5BNJA 3BYUA 3EQBA 2FSMX 2E9PA 2VTPA 2ZB1A 3VS3A 4G31A 3ELJA 1R0EA 5TR6A 1JAMA 4ASXA 4U0IA 4WKQA 3QRTA 5IA4A 3JYAA 4ZTQA 4XP3A 4EK5A 3BYVA 3IG7A 4QMWA 3IGGA 2Q0NA 2UVXA 3OW3A 5DIAA 4EUUA 4F63A 4CYIA 3PA3A 1QPCA 3PDTA 5HO6A 2B9JA 4QQCA 1KE6A 3LQ5A 5TT7A 3VF9A 2C6DA 3O7LD 3ULIA 3A61A 4X3JA 3WIGA 5KMIA 1BX6A 2GTNA 5M06A 2VWZA 3FZSA 1XH5A 3R9NA 3F6XA 4BDEA 4FZ6A 5B2MA 3IDPA 5DRDA 2X7GA 5E1SA 4QT1A 4B6LA 4DEGA 4NK9A 4M84A 5HVKA 1BYGA 2PMOX 4FYOA 4Y83A 4BDJA 3PE1A 3N4VA 3UPXA 3TV6A 4YPDA 4L7FA 5D11A 4Z16A 2YITA 5K5NA 4CZUA 4AW0A 1IAHA 4OTWA 3Q2MA 3KN6A 3LM5A 5TE0A 5F4NA 4DEDA 1PRYA 3MH0A 3UO4A 4GUBA 1WBNA 4ACGA 3GXLA 5FP6A 4BN1A 3WARA 4KKHA 2YCRA 4WNKA 4C35A 4BCQA 2GNLA 3U9CA 3W2SA 3MBLA 4FZFB 2PVYA 1M7NA 3LOKA 3TXOA 4PMPA 2O64A 1JKTA 1KSWA 2R4BA 2BHEA 3LXPA 4DFUA 5TF9A 5D7AA 4LMUA 4BICA 4EC8A 4QMNA 4R78A 4QP6A 3UC3A 4F7LA 4IHPA 3VVHA 2XZSA 3KMWA 4IAIA 3UQCA 4MBJA 4QP8A 2ACXA 4JBOA 4U41A 4Y5QA 4CTCA 2W9FB 4RIYA 3ENHA 3QU0A 4UBAA 2PHKA 3VUHA 3C4WA 4K77A 1KOBA 5M4UA 3V5QA 5C9CA 4LMNA 5AUUA 3HA6A 3P79A 2EWAA 4KIKA 3SDJA 5IQFA 5CAOA 4CRLA 2VWBA 2JEDA 4IAFA 4K0YA 5EM7A 3DKOA 3UTOA 3LJ0A 4BDFA 4OGRA 5EHYA 3IGOA 4C3PA 4LGGA 5IA5A 2BDWA 2NO3A 3OTUA 5T3QA 4KD1A 5GZAA 5LWMA 4GFOA 4FTMA 4JAJA 1HOWA 1I09A 4AN3A 2V0DA 3KU2A 4KNBA 4RZWA 4BY9E 2BAJA 4FKLA 2NP8A 4QYEA 1UNGA 4O21A 5A4TA 4C0TA 3DAEA 1OUKA 5D1JA 4AZWA 4C33A 4Z3VA 4DBNA 3CTQA 4FUYA 2IVSA 3KRLA 4FIJA 4FTUA 4RJ6A 5D12A 3ZXZA 2JKMA 4RFZA 5M09A 1OB3A 1LP4A 1JLUE 4ZTHA 1PXIA 2ZDTA 3PUPA 4MXCA 3TNIA 5AR3A 2BKZA 4XHKB 5E8UA 1UU7A 1J3HA 5EHOA 4YBKA 3MFTA 1XO2B 5M55A 3WYXA 4DCAA 4E3CA 2EU9A 3NAXA 4HVIA 4HVGA 4WSQA 3FC1X 3IDCA 4FODA 4P7EA 4ZY4A 1OUYA 4F0IA 1RDQE 4WOVA 4G5JA 3I81A 4FEQA 4PDPA 4CQGA 4ARKA 5CX9A 2IVUA 2WTWA 4D5HA 3CBLA 3DB6A 3R21A 4K2RA 1F0QA 4L00A 3D4QA 4ALVA 5IH6A 4FV9A 4X3FA 2YDJA 4CMUA 3VNTA 1WMKA 2Z02A 2W1HA 3FMMA 3FLNC 2WMTA 3ALOA 4IADA 4PMMA 1DI8A 1HCKA 2PPQA 4Z55A 3U6JA 4GH2A 3BI6A 4FV8A 3EQRA 3TNHA 3C4CA 4FA2A 4ZXTA 1B38A 2YA9A 1CKIA 5H2UA 5CALA 3Q04A 4DGMA 3IW4A 4FV0A 4GCJA 3GVUA 2Y4IB 3GP0A 4QQ5A 4G34A 4IQ6A 3HRFA 4QTCA 3MB6A 4YBJA 4EJ7A 4AFJA 4H58A 5HU3A 1YOJA 5KHXA 1PMVA 3R02A 4EK6A 2YM8A 4DT8A 3GC8A 3MVHA 4LM5A 4TYJA 2E9OA 2YLEA 4YLKA 4FTTA 5ANKA 4JBQA 3OEZA 5CU0A 4DCEA 2FSTX 4QP9A 2I0EA 2QD9A 5JQ8A 5IEVA 2BFXA 3ACJA 4NZWB 2JDVA 2O3PA 2XK6A 3VBYA 1YI4A 5IUGA 2BZHB 4QP3A 4BWXA 4DLIA 2YCFA 5M53A 1X8BA 2BILB 3TKIA 4TT7A 2G01A 3EHAA 4GIHA 5KKRB 5L2IA 1Y6BA 5AUVA 2J2IB 3UMXA 3DAKA 3ULZA 4IWDA 4XG2A 2G2HA 1YXUA 4RVMA 4XRLA 3WZEA 4QP2A 5FXRA 5L2WA 5A4LA 3M11A 3OVVA 1FMKA 5H8GA 3RINA 3QKLA 3HGKA 4HGLA 3ID6C 3HRBA 3R0TA 3WF6A 4X2FA 4CFVA 4EHZA 4BTKA 3LQ3A 4O7TA 2HY81 4MK0A 4P90A 3FYJX 4QP1A 5JGAA 4RC2A 1R3CA 4FKQA 3QXPA 2F7XE 4F1OA 2UZUE 4J71A 3UYSA 3O17A 3SC1A 3ZZWA 3S00A 2J9MA 3NLBA 3C51A 4M15A 2UVYA 3QCQA 2WOUA 1YWVA 4ZSLA 2PTKA 3R30A 4EHGA 2W1CA 3WE4A 4ASZA 1Y57A 2YAAA 3D7TA 3ORIA 3W2PA 2IW9A 3LFNA 1UA2A 2IZSA 3UOJA 5C1QB 2WMBA 2X81A 2QR8A 3DFAA 2QOFA 3EN4A 5F1ZA 4O7LA 4E6DA 2GNIA 3KREA 3PIYA 5FUTA 4ZAUA 1QPDA 1PMNA 4O7VA 4E73A 3BV2A 1OIYA 3QBNA 3TI1A 5ETIA 2B53A 4RPVA 3W2RA 2C5XA 4FT5A 5T6KA 4YUQA 2C3JA 2ITVA 4UMTA 3DA6A 4EH5A 4CG9A 4FV3A 3MJ2A 2XNOA 1PXLA 2XYUA 3D5UA 3NIZA 4CKJA 3M42A 3MY5A 4OTFA 4QNAA 3K2LA 3UIMA 1IAJA 3ORLA 1A06A 4H1JA 2BAQA 2VNWA 4FSTA 4MHAA 4MWHA 4NCTA 4U42A 4JRNA 4RVKA 5A9UA 5HD7A 2JBPA 4FKIA 3P5KA 5F94A 5E91A 3N4UA 2VNYA 4AT4A 4KRDA 3I6WA 3LQ8A 2AC5A 3PP0A 4G17A 2YJSA 3H0YA 4FZAB 3KVXA 2VGPA 4YHFA 1NY3A 2GU8A 3KCFA 5A3XA 5JGDA 2X2MA 3RCJA 4KAOA 1OKZA 4XMOA 1PXNA 4IACA 3RJCA 4EH6A 3E8EA 4LI5A 5DR6A 5HLWA 3G15A 4BDIA 3E93A 3WIKA 4FSNA 5CT7A 3KRRA 2IVTA 4CD0A 4DFNA 2PULA 3OUKA 3DXPA 2WMUA 2Y9QA 2VD5A 2YIXA 2C1BA 2ITPA 3BX5A 3FLQA 3M2WA 2JC6A 1REKA 4IANA 4Y95A 3AMAA 3ZBFA 4AA5A 4C4HA 5JT2A 3DLZA 4S2ZA 4L53A 2QHMA 4YNOA 2RG6A 4M12A 5DWRA 4FG7A 1Q8UA 3QRJA 4MTAA 1PYXA 2X9FA 1Y8GA 4O22A 4NM0A 4TW9A 4V0GB 5IMXA 3ENMA 5IDPA 4MX9A 2JKQA 4ZJVA 1ZYLA 3V8WA 3ZH8A 1V0PA 4E5BA 3TCPA 3FQHA 3LCTA 5ANJA 2WTKB 4NM5A 3H30A 3UVRA 3E7VA 4IC8A 1ZYJA 4G1WA 3EWHA 4O91A 4B99A 2BMCA 2X7FA 5H8BA 3FMHA 2FA2A 4RX8A 3EH9A 4YZBA 2BRBA 4BBEA 4IVCA 4DTKA 3UNZA 4LUDA 4J97A 3CCNA 3ZSGA 5JFWA 3KRXA 4F6WA 4PL3A 1MP8A 4QYGA 4JXFA 2BALA 4R5SA 2C3LA 5IUHA 4RJ5A 3SOAA 2JDOA 2V62A 5BQ0A 2XUUA 3AT3A 4K8AA 2WTJA 2YHVA 3PVBA 2PVMA 3AG9A 2KTYA 5A46A 2ITQA 4CV8A 2XNNA 1WBTA 5HU9A 4PNKA 1ZMVA 3G90X 4CMTA 4GFGA 5KHWA 2XK8A 5DE2A 4EHEA 2RFEA 3RPRA 3JY0A 2ZMDA 2CNUA 4YTIA 2QKRA 3MTFA 5JZJA 5CU4A 1Q3DA 2UV2A 3CQWA 3ITZA 3FUPA 2R3KA 3QL8A 4ZOGA 2GFCA 3RZFA 4E6AA 4OLIA 5C26A 2C6KA 2QU6A 5HE0A 1E1VA 4KKEA 3D9VA 1ZXEA 2BZKB 3BRBA 2CMWA 1T45A 2CNVA 1VEBA 3PVWA 3MPTA 1ZOHA 2P55A 3WZKA 3QTWA 4J1RA 1SVEA 3MH3A 4R8QA 5CAVA 3WF7A 2B7AA 4G3DA 5E8SA 3MPMA 3NX8A 4LOQA 3ZUUA 4BI0A 4NFNA 2G2IA 3MVLA 3ACKA 4I4FA 2BHHA 1KE5A 2PVNA 4K1BA 5ANEA 5BYZA 3VQHA 4DFZE 5L6PA 2R3HA 4LG4A 1QCFA 3CR0A 3A7IA 4QP7A 4BL1A 3RWQA 4WHZA 3TIZA 3QQHA 2QQ7A 4RRVA 4U8ZA 3MDYA 5A6NA 3BLRA 5ETFA 3ZM4A 2WHBA 1U46A 3DBEA 3UOHA 3ZRKA 4LRMA 3CTHA 1XJDA 4U6RA 5IQCA 2W96B 4EK4A 3FI8A 1F3MC 4C4FA 3E63A 1UU3A 3O23A 4G5PA 3ZO4A 2GMXA 3Q9ZA 4JOAA 3OCGA 3R8VA 5L8KA 4C34A 2OIDA 2YCQA 3HUBA 2XKEA 4WNOA 5IG1A 4DC2A 2HENA 5FGKA 3MA6A 3Q5IA 3KVWA 3ZFMA 3MVJA 5CSXA 4E26A 2Z7RA 4O1PA 3RPVA 4XLVA 1UWJA 2HELA 3O2MA 3O50A 3C1XA 4BGHA 5EQEA 4II5A 5E8VA 2GHLA 2V22A 4FV2A 3CD3A 4QMVA 3FPQA 4FKVA 4ZSGA 3W10A 5EW9A 3ZSHA 4AX8A 4CXAA 2WU6A 3NYOA 1KE9A 2WAJA 1CM8A 2XMYA 4UMRA 1IA8A 4WBOA 2IG7A 5C4KA 4DG2E 2UW7A 1OL7A 3NRMA 5C03A 3PY3A 3RK9A 4MAOA 3VWAA 4CEGA 3FLSA 3NUNA 5DGZA 4QMSA 5IA1A 2QOLA 4CLJA 2HZ4A 4L42A 1ZMWA 5HG5A 1G8SA 3E92A 2XM9A 4LRJA 5JRQA 3U54A 4D1ZA 1J7LA 4DF3A 5KBRA 2E2BA 3K5VA 4FTAA 4TYGA 3C4XA 4HPTE 4F70A 3IECA 5CS6A 5HIBA 1SVHA 3EMGA 4XV2A 5C01A 4OBOA 4N57A 4CZYB 3KFAA 3EOCA 5FQDC 3QZHA 3WF5A 3LFCA 3HLLA 2IW8A 4Y73A 5BVWA 4GK3A 2QR7A 4GYIA 1NVRA 3BE2A 5D41A 4BCGA 4HVSA 1OMWA 2H34A 4TYHB 5IZFA 5LVPA 4LOPA 4JLCA 4RGJA 4U44A 1AQ1A 4DFLA 4DGNA 5EDPA 4F1TA 4BCPA 4LL5A 4E6QA 1XQZA 3QD0A 5CI7A 2HXQA 4M97A 2X6EA 5KUPA 1JWHA 2OZAB 3PPZA 5CQUA 4OAUC 5I9VA 1UVRA 5AP0A 4KBKA 1LEZA 4FKOA 2WIHA 3MH1A 2ETKA 4ZTRA 4E4LA 2YIYA 1H1SA 3VBTA 5HNGA 4O7RA 3QKMA 4RIWB 1SYKA 4D2SA 5JK3A 3DBQA 4G2FA 4QYFA 1Q41A 5IA2A 1OL2A 5LMAA 3FBVA 5CAQA 3OF0A 3MV5A 2JIVA 1FGIA 2OH0E 3GU4A 4XP0A 3GI3A 5HICA 1XBCA 1Q3WA 3S3IA 2ZV8A 4AE6A 1Y8YA 2EB2A 5AV3A 4ZY6A 4TWNA 1GZKA 3ZYAA 2X4ZA 2VWXA 2XJ1A 1DI9A 2ITOA 4ZS0A 5I9ZA 4C3FA 2XVDA 4EQCA 5HGIA 2YEXA 4F6SA 2HY0A 1OPJA 2WTDA 4DH7A 2ZV2A 5EI2A 5AV1A 2XF0A 1H1PA 3QQJA 4FMQA 4ITHA 4OTQA 5L2QA 2OJIA 1XWSA 5AR8A 1ZYCA 4ALWA 5M56A 5EYCA 5L8JA 3M1SA 4JQ8A 5IQHA 4MNEB 4QMTA 5GZ8A 2C5NA 2WZJA 1F5QA 5EG3A 5HVYA 3QTSA 1YDRE 3R6XA 4IDVA 4UB7A 4Q5EA 5JSMA 3AT2A 3LFSA 4M69B 5FBOA 3R9DA 4OTGA 3PTGA 5IKWA 1Q8WA 1URCA 3PXRA 5CSHA 3ZC5A 3I5NA 1WBOA 3R2YA 1YXSA 2EB3A 4XH6A 1IR3A 1G8AA 5KZIA 4BKZA 4NSTA 3A7GA 4Z9LA 1XH4A 3OXZA 3A60A 3FZ1A 4FV5A 5CXZA 5E9EA 1W98A 1TQIA 3IO7A 3BLHA 3HEGA 2PZIA 3PSBA 4IZ5A 4ZLOA 5JMSA 4O7ZA 2YISA 5GINE 2R3MA 4B8MA 3BHVA 4FSQA 3QALE 4IB1A 4AF3A 4CCUA 3KXHA 3PY1A 3TJDA 4RJ3A 2J0MB 1PXOA 4XBRA 4GU9A 4GU6A 2R0UA 3COMA 3QYZA 4JBPA 3TUCA 2VO3A 3VS2A 3VJOA 2RSVA 3RAHA 4BBMA 3DDPA 5E92A 3R7OA 3ZDIA 3PG1A 4BIBA 2XJ0A 2KULA 3UQGA 1GIJA 5AP7A 3VBXA 4YZ9A 2R3OA 4R7BA 4MXAA 2PE1A 1W84A 4AAAA 3R28A 2F7ZE 1A48A 1YW2A 3JUHA 4D9TA 2UZWE 4G16A 4JRVA 5LXMA 3EYGA 3OS3A 4MQ1A 4OTRA 5A14A 3BWJA 3OWKA 3AC2A 3P7AA 4IVDA 4UXQA 4R7IA 4MNFA 3RP9A 4ZZNA 4DTAA 4P2KA 2GNGA 3O8UA 2R3PA 5EFQA 4FSUA 1PXJA 3OROA 2DUVA 3JY9A 3PZEA 5LCJA 3DNEA 3Q9XA 4YLLA 3KN5A 4JQ7A 3NYVA 5GJDA 2VTQA 2OJ9A 5CEOA 5AFVA 4GG7A 4MBLA 4WBBB 4JDJA 4I23A 5IA0A 4PNIA 5DR9A 4YR8A 3DTWA 4DHFA 4HJOA 3TDWA 3CXWA 3Q53A 3DBCA 3RBWA 3PXFA 3LXKA 1XR1A 4U3ZA 3P4KA 1I44A 3F69A 1GZOA 3F2AA 5LJJA 4GW8A 4FBXA 5F9EA 3OW4A 4DGLC 4DFBA 4RA4A 3MPAA 4IJPA 5FTOA 4WUAA 5EOBA 4A06A 4R1YA 3R9OA 3RTPA 4D4VA 4O84A 3L9LA 4FIFA 3H10A 4U97A 5ACBC 5AA9A 1KUTA 4O0WA 4FKUA 4ANSA 4F65A 3C0GA 4AA4A 2R3GA 4RX5A 3QYWA 2OXDA 4E6CA 3VHKA 2QKWB 3L8SA 4QYHA 2XRUA 3NW7A 5IMEA 3FI3A 4BTJA 3QHWA 1J91A 3HMIA 1YWRA 4FSYA 3PRIA 3LM0A 3CTJA 1R0PA 3PSDA 5JFSA 5IU2A 1U5RA 3BEGA 5TOZA 3ZO1A 3CY3A 3UG1A 3EZRA 3OY3A 3FHRA 4FGBA 1H26A 3BHUA 1P5EA 4FIHA 4QYYA 5C27A 4ZTLA 4WA9A 3VRZA 5IQAA 4ITIA 4AA0A 4FNYA 3GU6A 1Q61A 3NYNA 1GNGA 3AMYA 4KS8A 4RWJA 3B2WA 3F7ZA 4PPBA 1T46A 1ZZ2A 3GU5A 5JH6A 2CN5A 5KO1A 4KKGA 1BMKA 2C6LA 4UWCA 3TN8A 1OGUA 2QOCA 3FWQA 1J7IA 3QCXA 2YM6A 3HX4A 4ASEA 4CLIA 3NNVA 4X3FC 4F9CA 3E3PA 3HV7A 3HECA 3AC1A 4EBWA 3MFUA 4RVLA 3MA3A 2IZRA 3BU3A 2WMXA 2XJ2A 2VZ6A 4H36A 2CKOA 4FIIA 1UKIA 4S33A 4IVAA 1ZMUA 4BBFA 5EM8A 5KMOA 5LMKA 4OW8A 5CU3A 4D2TA 4EZ7A 2PSQA 2A19B 1MQBA 4L3LA 3PYYA 4YP8A 1XHAA 3QQGA 4UMPA 4LRKA 4LYNA 4NKAA 2VTAA 4MH7A 3TEIA 4QMQA 4PWNA 4KIQA 3R73A 4F7NA 2ETRA 5EYDA 2QODA 1PY5A 2XNMA 4M7IA 4C4IA 3Q6UA 3DS6A 3DXNA 5IEXA 3QTRA 1YQJA 1Y6AA 4CRSA 5HBEA 1WCCA 2PVHA 3GENA 3KULA 4NUSA 3DU8A 3PWYA 3A4OX 2W5BA 3HKOA 4FSWA 3RAIA 2RKUA 3ZS5A 2IN6A 4J99A 4R1VA 4BDBA 4YTCA 4EH8A 4CFWA 3R7UA 5EOLA 2H6DA 4C62A 3A62A 4RC3A 3P9JA 1GIHA 3BBTB 4QPSA 4A07A 4AZTA 3ZM9A 3NR9A 3RALA 3WZUA 2ZYBA 5HKMA 2JLDA 3PSCA 4AXAA 1WAKA 4EKLA 1ZYDA 2Q83A 3H4JA 2W9ZB 4RJ7A 3LFEA 2CCIA 1V0OA 1YI3A 5LMBA 5LVOA 4OAVB 1OPLA 4D9UA 4N4SA 5HCYA 4Q2AA 2WOTA 3DOGA 4YC6A 3IKAA 5HCZA 1SNUA 3DJ7A 3GC9A 4FC0A 4IAZA 4AZEA 2ITYA 3FMLA 5CVGA 3KXNA 1O6YA 4HW7A 4EKKA 4XG7A 1JNKA 2RFDA 3QUPA 4MWIA 4YPSA 3SKCA 3WOWA 4BFMA 4GT5A 2XK3A 2W05A 3AC5A 4V04A 4ERWA 3NGAA 3ZUTA 4KIOA 5E8WA 4FEWA 3O51A 2PVKA 4ACDA 4A9UA 4LUEA 3PJ3A 1R39A 5AUXA 4F4PA 2C0OA 2A0CX 3A8XA 4FVPA 3QZFA 2E9NA 3VS5A 4WG4A 4CGAA 5E8XA 3QD4A 3BGPA 5DI1A 3ZO3A 4NTSA 4RWKA 4DLJA 3JXWA 2C1AA 1YOLA 4APPA 4U40A 5FXSA 3BYOA 4AS0A 3F3TA 3NUUA 2BTSA 4NCTC 2GFSA 4FKJA 2QLUA 4X2KA 2CKPA 3UMWA 5K0KA 4RQKA 4ACHA 4C4EA 4G3GA 4MQ2A 4EYJA 3MY0A 2PVLA 4XYFA 3TT0A 5IUIA 1BI8A 2PE0A 4D1XA 4W4WA 2BIYA 3DCVA 3EN6A 5B0XA 4N0SA 3ZONA 2HAKA 2XK4A 3I4BA 4I20A 2ZAZA 3DGKA 4YTHA 5J9YA 5CENA 3C4ZA 4XOYA 3W2QA 5CT0A 4QMPA 3OBJA 2X9EA 4AZFA 4BZNA 5JFXA 5L3AA 4QTEA 2GQSA 4FYNA 3BWFA 3EJ1A 4DTBA 4YLJA 1W8CA 3R7VA 3KQ7A 4L45A 2RG5A 2B55A 4FX3A 3POZA 4KSQA 3NIEA 3UOKA 3GFWA 1PXPA 4XJ0A 2JDSA 2VX1A 4ANMA 4YJNA 3F82A 1H1QA 3K3JA 4O0UA 4F09A 3F3VA 4QMOA 4UEUA 5DHJA 3TNWA 4EONA 4H05A 3HMOA 2ZOQA 4RWLA 4PL5A 4DN5A 3CQUA 2B9IA 3R8PA 4A9SA 1YKRA 5IA3A 5J9ZA 4C7TA 3QWJA 2IZTA 1RQQA 3C4FA 1A9UA 3SVVA 1ZARA 3HAMA 4YZMA 1YRPA 1UU8A 3LFAA 2Z7QA 3EN9A 3FPMA 2C3IB 1W7HA 2VO7A 3UNKA 4BTFA 2XKFA 4NTTA 3KA0A 1CKJA 3LJ1A 4DGOA 4D5KA 2R5TA 4H3BA 5M07A 2VTNA 1XH8A 4MD9E 2B4SB 3OZ6A 3RAKA 3TWJA 4EH3A 2UW0A 1JSUA 1MRYA 5G6VA 4XV3A 4I0TA 3GBZA 4YGAA 1MRVA 4I5PA 2YZLA 4EZ3A 3QRIA 4Q9ZA 3VS4A 4ZEGA 5CF8A 2NPQA 2QURA 5BVNA 4GL9A 4KABA 2XIRA 2W1FA 4XNEA 5HE3A 5CEIA 1XKKA 2LAVA 2NNWB 3L9PA 1CTPE 3D5XA 3ORNA 3T9TA 2QLQA 3UPZA 1U4DA 2UW3A 3OFMA 4M0ZA 5BUEA 3LMHA 1NT2A 5EQPA 4J8NA 2PMNX 5J7HA 3OG7A 3LFFA 4FKPA 3MESA 4FTRA 4M0YA 3OBGA 3JVRA 3Q2JA 5ANOA 4F0GA 4IAKA 2WTIA 4MBIA 2WB8A 4V0GA 4CV9A 4XOZA 1ZY5A 3P0MA 2BRMA 5C8KA 4M66A 3H0ZA 4Z7GA 5DFPA 1Y91A 3QKKA 3R9RA 1OL1A 2FB8A 1K3AA 5BMSA 2X2KA 3VS1A 5EM5A 2OI4X 4FL2A 5DEYA 5M4IA 3N51A 5EDQA 3OCTA 5D10A 2XCKA 2EXCX 4ZSAA 3VF8A 4O7WA 4G3FA 4EORA 3ZRMA 2BCJA 2VWVA 5A4QA 3TIYA 4LV8A 5FXQA 3OY1A 5DVRA 1TQPA 1P4OA 4A4XA 4TNDA 3D83A 4ZTMA 3PY0A 5JFVA 5K4IA 3GOKA 3JR1A 5KCVA 3HRCA 3BIZA 4KIKB 2Y0AA 3PJ2A 1OKVA 3O7LB 5HE1A 4F0FA 2UW6A 3A4PA 4PX6A 1GIIA 2W1ZA 3R8UA 3MWUA 3P23A 4GVJA 4MXYA 2OSCA 1V0BA 2OXYA 4APCA 4EWHA 3IW7A 1ATPE 4EOMA 3C50A 4IIRA 5CSPA 3PWDA 1AD5A 3DK6A 3PXKA 4EQMA 2C6OA 3EZVA 4I6HA 2F7EE 4PPCA 3D5WA 3QQLA 4AUAA 4JX7A 3R8LA 4QO9A 5J87A 3VC4A 2ONLC 2UW8A 4I22A 3E8NA 2PZ5A 3FXXA 2IPXA 4FEUA 2OWBA 3EKNA 1VR2A 5K9IA 3EB0A 3V01A 5HI2A 3IS5A 4ZS4A 2QG7A 1M7QA 2R9SA 2X8IA 4M14A 3W32A 4OUCA 3V5PA 4CVAA 3OP5A 2XK9A 3DZOA 3OEFX 4GKIA 3ET7A 4FTQA 4A4LA 4EI4A 4LFIA 4DITA 2G2FA 2WEIA 4AN2A 2UZVA 4NM3A 4YC3A 5G1XA 2R3LA 3OWPA 4F9BA 4IZ7A 2Y6OA 3THBA 3BHYA 3IW6A 5CEPA 3COHA 4IX5A 1YOMA 4N6YA 3QLFA 4L8MA 2R2PA 3NNWA 3NVKI 3R2BA 2WMWA 4L68A 5FDXA 3QRKA 3TNPC 4ANLA 2CKQA 2OG8A 4PTCA 3O8PA 2GS7A 1K2PA 2WQNA 3IPHA 5CYIA 3A2CA 2OKRA 4X2GA 4X3FB 1H0WA 1UKHA 5KMLA 4A7CA 3AMBA 3R1SA 2QOKA 4X7QA 2YAKA 2ZM3A 2OW3A 5ACKA 5CAUA 3F9NA 3FKNA 2VX0A 3DTCA 4UWBA 5HD4A 4BWKA 3CY2A 2QOBA 3K3IA 4O0SA 4QTAA 3QD2B 3E64A 3ZMMA 1H25A 3ZFXA 4USFA 5HX6A 4OT5A 3EIDA 4IC7A 4ZTSA 4JI9A 5HG8A 1Q8ZA 1H00A 5BMMA 2XS0A 3QCSA 4QMMA 5LVLA 5T68A 2UUEA 2YM4A 3KXGA 5H3QA 1VYWA 2C5YA 4YJPA 4BI1A 1KWPA 5A54A 4UX9A 4KB8A 5CLPA 4QMZA 3CKXA 3UBDA 2HW7A 3C9WA 4U45A 2B52A 4NEUA 3KXMA 3BZ3A 5CNOA 2W17A 3KMUA 2GSFA 3ALNA 5DEWA 1BKXA 5FBNC 2BDJA 3U4WA 2VWIA 3R8MA 1QPEA 3QWKA 3VS7A 4E4NA 2CGXA 2F2UA 4I21A 4K18A 3KRJA 3WI6A 1YHVA 2W99B 5EW8A 5GJGA 5L2TA 4ORKA 4OTIA 2PUUA 4EK8A 5BYYA 5GNKA 4TWPA 2BUJA 1JQHA 4YJSA 4Y46A 4JQEA 4XG8A 4RIXA 2O5KA 4O0RA 5C8NA 2X0GA 1PF8A 3NW6A 4I3ZA 4S30A 3W1FA 3WYYA 4F6UA 3DK3A 4R3PA 3BLQA 1WVWA 3PE2A 1UV5A 5KBQA 5AV2A 4CCBA 2J90A 3C0HA 1G5SA 4HGTA 3BGQA 5LARA 4DEEA 4DH5A 4RFMA 1KV2A 3BKBA 1Q8YA 2V7AA 4A4OA 2CNQA 4L46A 2NRYA 3FXZA 3SGCA 1ZY4A 3P7CA 3V5LA 3OOGA 5C8MA 1JKKA 5BVFA 4OTDA 3CC6A 4WNMA 3ZLWA 3AXWA 5DR2A 2VGOA 2CCHA 1OVEA 2WGJA 3LCSA 4IEBA 5K3YA 4L9IA 3D7TB 3TKHA 4IB3A 2HK5A 4JDHA 3IOPA 4BIDA 1JKSA 3VUIA 2DS1A 2WD1A 3MYGA 3D2KA 3FZPA 4I0RA 4I6BA 4TYEA 3W2CA 4C3RA 3TL8A 1YI6A 4B8LA 3NZ0A 3EFWA 4EOOA 3DK7A 4BRXA 3Q6WA 4CKIA 5HORA 3NEWA 1XBAA 2WIPA 4FEXA 3LAUA 3ERKA 1Z9XA 3ETAA 4U80A 3VBWA 2BR1A 4BGGA 3Q96A 4AW5A 1OBDA 1DM2A 4EOIA 4L67A 1M52A 2ZJWA 3PLSA 3KMMA 3EFKA 3KCKA 1KV1A 4OR5A 2JIIA 2C5VA 2ESMA 4U81A 5CASA 4WT6A 4HCTA 5AP4A 2WTCA 3UIBA 5FM2A 3ZXTA 4FTKA 2PE2A 2WMVA 3P78A 3SAYA 5HQ0A 4QQJA 4TXCA 5EI6A 3TZ9A 4E4XA 4S32A 2YERA 3FMJA 1OL5A 4U5JA 4TPTA 4QMYA 4HZSA 3G6GA 2C6MA 2VTRA 3V8SA 5EHLA 2GNFA 2PZYA 3TUDA 1MUOA 4GV1A 1JSTA 1BI7A 4IZYA 4O6EA 2XIXA 1R78A 5KMNA 2OIQA 3QA8A 3QTUA 4W4VA 5DG5A 5AAGA 2GTMA 4UZDA 4JIKA 1UNLA 4GK4A 4PP9A 5L2SA 4TYIA 4ZK5A 3UNJA 4KINA 4QPAA 3R01A 4XG4A 2YACA 5DH3A 3RCDA 4D2WA 1UU9A 3H9OA 5AM7A 2C6EA 2Z2WA 4F9WA 4O0YA 4EHVA 1IASA 3MS9A 3KRWA 3HZTA 3NCZA 4HGSA 4HOKA 2QHNA 5I3OA 3V5JA 2P3GX 3VBVA 3LKMA 1ZOEA 2W5AA 5A4EA 5C4LA 5IQDA 3FSFA 4BCIA 1H27A 4QTBA 4FTNA 4ITJA 3ORPA 4EJNA 3ANRA 5F95A 3RWPA 2EUFB 2HIWA 3VRYA 2YIQA 2BVAA 3MVMA 1VZOA 3UC4A 4E5WA 3HDMA 4YO6A 3ZLSA 5FD2A 1Z5MA 2W1GA 2GS2A 3IK3A 2QO7A 5K4JA 5HO8A 4BZOA 3HAVA 1H08A 3TTIA 3I60A 3CGOA 3MIYA 3W55A 2HCKA 4YJOA 3W33A 3PVGA 2ITTA 4FNWA 4O0VA 3FZRA 4FT3A 3TM0A 3R1YA 3LFDA 3TKUA 3RM7A 2CGWA 5J8IA 3HA8A 3F3UA 3BCEA 1RJBA 2EVAA 5HG9A 3T3UA 5J5TA 2OF2A 2OH4A 2QO9A 4JX3A 5J95A 4UALA 3LFQA 4UN0C 4MD7E 4U3YA 2VRXA 3V6SA 5JRSA 4KUJA 1ZRZA 2W7XA 3RAWA 4DE4A 3DKGA 3V5WA 3BV3A 3PLAE 4GS6A 2ZM4A 5IPJA 1ZWSA 3QGWA 3FAAA 3PJCA 3LCOA 4C61A 4BR3A 3H3CA 3I7BA 2IZUA 2R3RA 3F5GA 5I9WA 2JGZA 3KY2A 3DY7A 2BRNA 3BELA 4JJRA 4UXLA 2A4LA 4DT9A 4IH8A 3FKLA 2I1MA 5JZNA 4A9YA 4FIEA 2CPKE 2R3JA 4D2PA 2BTRA 1DS5A 2YIRA 4O83A 4LL0A 1FVTA 3AD4A 4YU2A 4C38A 4MXZA 4I5CA 5CAPA 2Z7SA 1OKYA 2ITWA 2E9UA 4FL1A 4RQVA 5HIEA 3NPCA 4O86A 4GJ3A 4BDCA 4QPMA 2V7OA 4L01A 4RLLA 3VUKA 1IEPA 3S0OA 2ERZE 2X2LA 1H8FA 2BFYA 2GNHA 3FQEA 1YDSE 3R1NA 3OOMA 3ORXA 2EXMA 2ETMA 3FL4A 3FZOA 4IBMA 4RG0A 3TG1A 3VUTA 3W2OA 3TTJA 3UQFA 1M2QA 4CG8A 4FV6A 4M13A 3Q32A 4XP2A 2WXVA 4IWOA 4TKSA 4IM3A 3DNDA 4BYJA 3QXOA 4C4JA 3VS0A 4TY1A 5CQWA 3N9XA 3Q4TA 4ERKA 2XP2A 3ANQA 4GMYA 3E88A 3SRVA 3R8ZA 2HZIA 4WG5A 2R7BA 4RBLA 1OIUA 1NVSA 2XM8A 4O7NA 2XBJA 4OTHA 5BUIA 1PW2A 4FICA 5JN2A 3WF9A 3QGYA 4M3QA 5HBHA 5AMNA 3AQVA 5AX3A 4FTLA 4FEVA 1Q62A 3UIUA 2VX3A 2CGUA 3PVUA 5LVNA 4AQCA 1PMEA 1WVYA 3DQXA 4AT3A 4NIFA 1U54A 3SXFA 1GOLA 4XX9A 5EQYA 4FTIA 4BCHA 3QZGA 4IJ9A 4YMJA 5AIKA 4EOQA 5L4QA 4FKWA 5EDRA 4IX3A 2IWIA 3VN9A 4YO4A 2F9GA 4YJQA 4FOCA 2GQRA 3DJ5A 4AE9A 1LR4A 2XNGA 3QRUA 4F9AA 3QX2A 3S1HA 2IO6A 3O8TA 3R9HA 2EXEA 1PYEA 1APME 2ERKA 4FUXA 5AR5A 3F66A 2CGVA 4FTJA 4J53A 4DEHA 2OBJA 3OTVA 2WKMA 4J95A 3QTQA 5DNRA 5FEQA 3F7WA 3TZ7A 5HLNA 3POOA 1JPAA 1QL6A 4YZDA 2C47A 3BBWA 3MY1A 3PA4A 2YJRA 4NJDA 2QC6A 4GK2A 2YLFA 4ZLZA 4BCMA 4B9DA 5HTCA 2LGCA 1M17A 5BUJA 5AEPA 4HPUE 3UVQA 3R04A 2WQEA 1XH6A 2OGVA 2QOIA 3OMVA 3II5A 4I5HA 2UZDA 3NAYA 4NW5A 4P4CA 1S9IA 4OBQA 4MKCA 5DBXA 3LMIA 2P2IA 3LXNA 2WTVA 5FWKK 1P2AA 2WPAA 4L3JA 4ZP5A 1OKWA 5EYKA 2W5HA 4RIOA 4IVBA 3F2NA 2G15A 3LLTA 1Q5KA 4RJ8A 2PZRA 5KE0A 4E8AA 3GNIB 3S4QA 1XBBA 5EI8A 4K9YA 5I3RA 3DXQA 3G5DA 4I41A 3BYSA 4IM2A 2J6MA 4IZAA 4ASDA 2ITZA 4R3RA 1YXVA 4ACCA 5IH4A 3FJQE 4AG8A 4JR3A 3LW0A 4CFXA 5FM3A 3AT4A 4IFGA 4FGRA 4FZ7A 4FKSA 3P08A 3VW8A 3ZLYA 2A27A 4DINA 4N6ZA 4HYHA 4V01A 3CGFA 5AP1A 4GKHA 2GDOA 3CD8A 3FZTA 3CQEA 4M68A 4O0XA 2F49A 4UY9A 2YABA 5AADA 4H3PA 4JL9A 4Y72A 2YM3A 4YNEA 3WILA 3AD5A 4AACA 3D14A 2QI8A 2QCSA 2JFMA 2W1EA 2PK9A 3L9MA 1WVXA 4BDKA 5CANA 3NNUA 2BKKA 3LCKA 1M2RA 3OCBA 2BROA 2J4ZA 3GCVA 4FSZA 4NKSA 5HESA 3SA0A 3NUXA 3O96A 4AW2A 3RK5A 5IQGA 4X6RA 4HCVA 4JDIA 4Y85A 5CNNA 4JDKA 3VBQA 4FZDB 4DA5A 3Q4ZA 3OD6X 3H9FA 3L8VA 2R3FA 2XNPA 4XV1A 1M14A 2ZV9A 3QCYA 4JR7A 5J7BA 2ZMCA 1PXKA 5ANGA 4X6QC 2UZEA 3QX4A 4IX4A 1H07A 1PHKA 5ANDA 2ZM1A 3UP7A 4GT3A 4BZDA 1YHSA 3R83A 3SOCA 5AP5A 5BVDA 4F9YA 3OWLA 4FR4A 1H1WA 3FMDA 2HZNA 3E5AA 2CDZA 2ITUA 2QNJA 5AUWA 4RT7A 3U8WA 5DN3A 3Q9WA 5I0BA 3GEQA 4O2ZA 5FTQA 4I93A 4CTBA 2P4IA 5IISA 2YZAA 3ZOSA 2PMIA 4DBXA 2QOOA 4IB5A 3AC3A 1SVGA 5LVMA 3NNXA 4QP4A 2W4KA 4NL0A 5GIPE 5LQFA 4EH9A 5M57A 4B7TA 1MRUA 1ZYSA 2GHMA 3FY2A 3HV5A 2Y4PA 3DFCB 3U51A 3UG2A 3B8RA 4F99A 3FMNA 4WG3A 3UODA 2ZB0A 5HVJA 3VJNA 3VO3A 3DBDA 3B2TA 4RA5A 1NXKA 4IW0A 3ODYX 4DAWA 4XEYA 1STCE 4X2NA 4W4YA 4L3PA 4K11A 3A99A 5AIRA 2ZV7A 4PDOA 3CEKA 5M44A 4AOIA 3GCUA 4NYEA 4C37A 4EUTA 3QTXA 3DKCA 3LZBA 2YIWA 3R63A 2B9HA 1JVPP 3BQRA 2R3NA 2BZJA 3QHRA 1OIRA 3HP2A 5J9LA 2I40A 4ZSEA 4BCOA 2OJJA 3GQLA 4NU1A 5CF5A 2YFXA 5CWZA 3UDBA 2XBAA 3S2PA 2OIBA 3UGCA 1BL6A 2BRGA 2YWPA 2BZIB 1LUFA 4ANNA 4AT5A 4WO5A 4YTFA 3EL8A 5CTPA 2I7QA 3HYHA 3WBLA 1FPUA 5AWMA 5EKOA 2C69A 4ONAA 3UIXA 2GCDA 4QMXA 4DFXE 4A9RA 4JBVA 3C5UA 4CT1A 4ANOA 4TTHB 3GQIA 4M67A 4L7SA 4NJ3A 3SW7A 3W8LA 3BEAA 3HV4A 1Q97A 5HIDA 3V51A 3NVMB 4BIEA 3A7FA 2FH9A 1FVVA 2C0TA 3O71A 5FRIA 4AGDA 2WQMA 4D58A 2J5EA 3KL8A 4O1OA 1ERKA 4ZY5A 5E8ZA 1W83A 3FC2A 5A6OA 2SRCA 4MF0A 3DPKA 2VWYA 3CSVA 4CFUA 4FKRA 1EH4A 3C0IA 1TVOA 5AR4A 5CZIA 5AR7A 3UP2A 2O0UA 4RX9A 3ZUVA 2GHGA 3MJ1A 2YM7A 4AFEA 4DGGA 2B1PA 1PKDA 3S95A 3FLZA 3L9NA 1R1WA 3MB7A 5FG8A 2PUIA 3TACA 4OBPA 4W8DA 4C57A 3F2RA 2Y8OA 3Q52A 4GT4A 2PUPA 1QMZA 4HNFA 4IX6A 3FHIA 1BLXA 2C68A 3G9NA 4UYNA 3FEGA 1FOTA 4RMZA 4DEIA 3Q4UA 3FI2A 1YHWA 4EL9A 5AV4A 4UMUA 3NW5A 2RF9A 2CLQA 1E9HA 3EFLA 2W1IA 3PIZA 4DG3E 4D28A 3GCQA 3PIXA 3MI9A 2I6LA 2J0IA 4J98A 3RM6A 3VULA 4E1ZA 4ENXA 5E4HA 4FNZA 4O27B 4TNBA 4L52A 2QO2A 4U79A 3ATTA 2XA4A 3EFJA 4BCJA 4D4SA 5KX8A 3W18A 4A9TA 1S9JA 4FT7A 4D1SA 2QOHA 1JBPE 2OLCA 3KF7A 5KNJA 3MSSA 4WRGA 5IQIA 5HOAA 3HMNA 3REPA 2Y6MA 3GOPA 3L8XA 4JAIA 5HG7A 2I0VA 3DKFA 1WZYA 3FLYA 3KF4A 2W1DA 3BE9A 3KULB 4QQTA 4AN9A 1RW8A 4S31A 5AUTA 5E1EA 4GSBA 3TZ8A 1J7UA 1KOAA 3SG8A 5K0XA 3WF8A 3FMEA 4QRCA 3ZO2A 3TNQB 2WMQA 5DYJA 3QTZA 1IG1A 2OF4A 2WQBA 3GCPA 5M08A 3CE3A 4MEDA 4B0GA 3NSZA 3IW5A 3ZDUA 1HCLA 3GCSA 2FO0A 4O7YA 1VYZA 2J0KA 3P86A 3RI1A 3PZHA 4IFCA 2YM5A 4DG0E 4BCFA 3TZMA 4M8TA 4XG3A 3RNYA 4F64A 2BPMA 4O6LA 3U6IA 4ZZOA 3EQFA 4YC8A 3U55A 1UNHA 2HXLA 4XG9A 4C2VA 4YJTA 2RIOA 3B8QA 3BU5A 3PRFA 4E93A 4GYGA 5EYMA 4MXOA 5KMMA 4I0SA 4R77A 5HHWA 3VUGA 3T8OA 5CSVA 3UVPA 4AGUA 4O0TA 2ITXA 3BPRA 4BF2A 4DH8A 3R7GA 4EWQA 2X6DA 3OXTA 2P2HA 3QZIA 3V04A 3HDNA 4KA3A 4G6NA 3EQGA 3GB2A 4HCUA 4PPAA 5GJFA 5AAFA 3LVPA 4IWQA 4ACMA 4ZMFA 4EEVA 3CS9A 3MIAA 3QA0A 2X8EA 3QD3A 4PL4A 5F20A 3ZEPA 5AA8A 4Q5HA 4CMOA 4MYGA 5BVEA 4FK6A 3GFEA 4QMLA 3CJFA 1LPUA 4I6QA 4RFYA 4P5QA 4RIYB 1OBGA 4IWPA 3G0FA 3FV8A 2QU5A 4GEOA 3QF9A 5DRBA 4AU8A 3F5XA 4MCVA 5DPVA 3ZBXA 3HUCA 1O6KA 5CI6A 4YSMA 3HV3A 1O9UA 4BB4A 4L6QA 4I24A 2PUNA
chains in the Genus database with same CATH superfamily
4BGQA 4PTGA 4ZSJA 4EYMA 5DMZA 2XYNA 3R71A 4XS2A 3G51A 3SV0A 4J96A 3AKJA 2HYYA 2R64A 4FTCA 4F7JA 4R6VA 5CU6A 3QC9A 2C30A 3R7EA 4C59A 3VUDA 3EL7A 3NS9A 3HL7A 4I5MA 2X7OA 2VU3A 4H1MA 3BHTA 3SXRA 5KMJA 3FLWA 2JBOA 4JS8A 3WZDA 4O7SA 5EM6A 4BI2A 4EOSA 3FMKA 1SNXA 4Y5HA 3PXZA 5H8EA 3LE6A 5AP2A 5A4CA 2G9XA 1CDKA 2UW4A 5IF1A 2O63A 4R7HA 2R0IA 2XKCA 5I9YA 1L3RE 2A2AA 5DA3A 3G0EA 4I6FA 1H4LA 3ROCA 3PXQA 2O8YA 4BDGA 4LGHA 5IQBA 1TKIA 1W0XC 2VWWA 4EBVA 1H01A 3TV7A 2JFLA 3IQ7A 3UJGA 2VTLA 5AV0A 2RFSA 2OFUA 2OJGA 5EW3A 5LWNA 4C4GA 4HVHA 4W9XA 3PJ8A 4F7SA 1OZ1A 3LHJA 4ZIMA 4EOPA 3W8QA 3G33A 1XH9A 2WELA 3R7YA 5ANIA 1URWA 2JD5A 4YZCA 4N70A 3NWWA 2YWVA 3EQHA 1H24A 1ZAOA 2W0JA 1SMHA 3HMMA 2Y7JA 4JG7A 3T9IA 3ZFYA 3U4UA 4K6ZA 5B7VA 2QVSE 2J0LA 1OECA 2VWUA 3R00A 4KBCA 3E3BX 4LOOA 3LIJA 2JIUA 1PXMA 3E62A 1PJKA 2FYSA 1Q99A 4UV0A 4J8MA 5M4FA 2OO8X 3H9RA 3CP9A 1GJOA 3ZLXA 3ORTA 4AZSA 5J5SA 3UE4A 2P0CA 3I1AA 4OTPA 4I4EA 3PPKA 2I0YA 4U7ZA 3RZBA 4TZRA 3C5IA 1JKLA 5J1VA 3PXYA 4GUEA 4TWCA 3CKWA 3UOLA 2CN8A 4E20A 2CHLA 1KE8A 4G6OA 4YJVA 3R22A 3MH2A 3HV6A 4IMYA 4JG6A 1GY3A 4XG6A 3F5UA 3R7IA 1ZOGA 3BQCA 2UVZA 3LMGA 1O6LA 1PKGA 2ZDUA 3AC8A 2FUMA 3SD0A 2FSOX 2V55A 2F4JA 4FI1A 1CSNA 4XUFA 4IAAA 3KXXA 3RHXA 4KS7A 2W4JA 3KK9A 3FDNA 4QNYA 4FK3A 5J1WA 3PG3A 3R1QA 4I94A 1V1KA 4L44A 3FE3A 4RX7A 4ANBA 4Z7HA 1FBNA 4QOXA 2OXXA 5L6OA 4TYHA 5IH5A 2VN9A 1GZNA 4DH3A 4JT3A 1W82A 2OU7A 4USDA 4X21A 1P4FA 5I9XA 2PWLA 5E7RA 3AGLA 2C3KA 2PVJA 3MTLA 2VTMA 4JG8A 3GGFA 1YVJA 4HYSA 1J1CA 2OZAA 2BIKB 3MGYA 4E5AX 4CKRA 2Z8CA 4FE2A 2HWOA 3C13A 1FVRA 1NW1A 4XBUA 4IAYA 4C36A 4BYIA 2VTSA 3DB8A 3E8DA 4H3QA 3VAPA 3VS6A 5E8YA 3F3WA 4D4RA 4XLIA 4KIPA 4RIWA 4EOLA 3E7OA 5AP3A 2PU8A 1WBPA 2YCSA 5H9BA 3I7CA 3F61A 3RK7A 4NW6A 4GVAA 4EOKA 4GRBA 5K5XA 4FF8A 4FV7A 5I4NA 2UZOA 3LFBA 2YDKA 3E87A 1MQ4A 5GIOE 4TN6A 3MW1A 2H8HA 2W06A 3AC4A 3I0QA 4LGDA 3FY0A 1B39A 4PMTA 5CSWA 3COIA 2PL0A 4CZTA 3N4TA 1Q24A 1JSVA 3QFVA 4O38A 2BAKA 4J52A 3W16A 3OWJA 2AYPA 4ZMEA 4TL0A 1TQMA 4FSMA 1Z57A 3JVSA 4RVTA 2GS6A 4I92A 2H96A 4ALUA 3SXSA 2Z60A 4GG5A 3U9NA 3EQDA 2PYWA 2BRHA 3Q9YA 1PMUA 2GNJA 4R3CA 5HZNA 5AUZA 4MNEA 4FVRA 3LXLA 3MFSA 3V8TA 2VTJA 5BX0A 4BHZA 1SZMA 3QAME 4BDAA 3G6HA 3OXIA 4EH7A 3BGZA 4M69A 5IDNA 3UO5A 2WO6A 4TRLA 4UZHA 5CZHA 4MD8E 3ZTXA 4KRCA 4X2JA 4DH1A 5EH0A 1YDTE 2B0QA 1OL6A 3F5PA 1KE7A 3CJGA 4XRJA 3JPVA 3QLGA 1Q4LA 2WQOA 1VJYA 3Q3BA 5AJQA 3QC4A 3BHHA 4R5YA 3OHTA 5GHVA 2IVVA 3KB7A 3VUMA 1OIQA 4IXPA 3RPSA 4U9AA 1IRKA 3RNIA 3UZPA 5J79A 5CF6A 1UWHA 4PV0A 4PMSA 4DEBA 4NT4A 3Q5ZA 2B9FA 1L8TA 1Q8TA 5BVOA 3DV3A 3AGMA 3D7ZA 3NUSA 5FLFA 5L8LA 4EQUA 1SM2A 3UYTA 1YXXA 2A1AB 3I79A 2ONLA 2QG5A 2WU7A 3K5UA 4GIIA 2XCHA 1CMKE 3RVGA 2OK1A 3ORZA 3EN7A 3MFRA 2IW6A 3KXZA 2G1TA 4W4XA 3W0RA 3DZQA 2UZBA 4AAYA 2XEYA 1LEWA 3D2IA 3GC0A 2WMSA 1QPJA 2BDFA 5L6WL 4CFMA 5M51A 1OGYA 2P33A 2HZ0A 1ZZLA 2R7IA 4RIXB 4AOTA 4PUZA 4B4LA 4FV4A 3HNGA 3PA5A 4CSVA 3FXWA 2GQGA 4D0XA 5M4CA 3DDQA 4KBAA 5HE2A 5CF4A 3CLYA 4WUNA 2O2UA 3SLSA 3T3VA 3V5TA 4CQEA 3LLAA 4ZTNA 5EK7A 3DT1A 2CJMA 4FTOA 4JNWA 1H1RA 4QTDA 1OI9A 3ORKA 5ITAA 4EC9A 4RLKA 3RHKA 4ANQA 5CVFA 3G2FA 4FT0A 4YHJA 5HTBA 4PTEA 4NH1A 5HBJA 4NWMA 2WFYA 2V5QA 2XNEA 4RSSA 3GT8A 5DT3A 3ZCLA 4BCNA 4HZRA 3DBFA 5EKNA 1DAWA 3AD6A 4G9RA 2C6IA 2XB7A 4PY1A 3U87A 3SG9A 2NRUA 3O0GA 4FT9A 5LMKC 2H9VA 2AUHA 3OUNB 5HCXA 2VTOA 3JS2A 4C8BA 2FGIA 2I0HA 2XEZA 3IOKA 1AGWA 2CSNA 5E90A 3K54A 3LPBA 4IM0A 2J7TA 3UO6A 2HOGA 4IDTA 1GAGA 4P5ZA 5LCKA 4FNXA 4OT6A 3I6UA 4DHZA 2JKKA 2X39A 4H39A 4USEA 3RMFA 3FSKA 3ATSA 2JAMA 3TUBA 2X1NA 2WMAA 3D15A 4PP7A 2FSLX 2DYLA 3GUBA 4WSYA 5DOSA 4HYIA 4Q9SA 4QD6A 4QMUA 1NA7A 5HEZA 3HP5A 2O65A 1IA9A 2XNBA 4G6LA 3TJCA 1TFFA 5ETCA 5HNIX 1WFCA 5JKGA 4AP7A 2JDTA 3GU7A 4FOBA 3DJ6A 3EKKA 2RL5A 4GJ2A 3CPCA 4EZ5A 4ZJIA 4NFMA 3QUEA 3SQQA 2VTHA 3GU8A 2PVFA 3RPOA 2HW6A 5FEEA 2R3IA 2IEWA 3SX9A 3F3ZA 3EQIA 3FI4A 4J7BA 4RJ4A 5AX9A 4BDHA 3BYMA 4WIHA 5I5ZA 5HLPA 5TO8A 2XIYA 4C02A 2UZLA 1ND4A 3UZRA 4FG8A 3KEXA 2X8DA 1J1BA 2VAGA 4BC6A 2JKOA 1JOWB 1H28A 2ZVAA 5LOHA 4DEAA 1G3NA 3E8CA 3OCSA 4RC4A 5GZ9A 4EK3A 4UMQA 5BPYA 3D94A 5HX8A 4C2WA 3RGFA 2HWPA 4KWPA 3SW4A 5B2KA 3NMUF 2WMRA 4YHTA 4ID7A 3EQPA 3COKA 2QONA 2PVRA 4FKTA 2C0IA 1BUHA 5CEKA 1WBVA 1CKPA 4AGWA 4IB0A 4FV1A 1M2PA 5D7VA 4X0MA 3I0OA 3Q60A 3VW6A 4C58A 2DQ7X 4PRJA 4G9CA 3ZZEA 2F57A 2C4GA 3U6HA 4AZVA 4O82A 2VTIA 4I1ZA 2VTTA 2Y4IC 2VUWA 3ZU7A 4PDYA 4CFFA 4FG9A 2AC3A 4I6LA 2XH5A 5E8TA 3AOXA 3ORMA 2ITNA 5CEQA 4DFYA 4HVDA 5BYLA 4YURA 2J5FA 4O2PA 3GC7A 3C4EA 3FYKX 3MN3A 4O96A 3OT8A 4AW1A 3TV4A 4CT2A 5FEDA 5BVKA 4BKJA 4KSPA 3WE8A 2UW9A 4RWIA 2W4OA 3D5VA 2CLXA 2VV9A 4FVQA 4PF4A 3FKOA 4ZLYA 2F2CB 2RFNA 3NCGA 3VQUA 2XRWA 3KGAA 4CYJA 4E4MA 5IEYA 2OJFE 4E7WA 3A7HA 3DQWA 3EN5A 4HGEA 3QQKA 5KKRC 3HMPA 3VIDA 3UDTA 4S34A 3I5ZA 4BVUA 4DDGA 3ZSIA 3BU6A 4MXXA 3FQSA 3NDMA 1OITA 4AGCA 2UW5A 2WNTA 4MF1A 4WD5A 4LV5A 3ZEWA 4DYMA 4UYAA 4YZNA 4BKYA 3F88A 4IE9A 3TDVA 3PFQA 4BHNA 5CU2A 5I9UA 4CFNA 3A8WA 3PPJA 2B54A 3L1SA 3UZTA 4F1MA 3EYHA 2PY3A 4XCUA 4W9WA 3QQUA 2J50A 3LJ2A 4EH2A 1OPKA 3IONA 4AOJA 5AUYA 5TKDA 3G9LX 5DLSA 3C7QA 5CY3A 1FGKA 4JVGA 5IQEA 3Q4CA 2JAVA 5AAEA 4LDTA 3A7JA 1WBSA 2REIA 3FL5A 1WBWA 2Q0BA 5DT4A 1YXTA 4LQMA 1REJA 4YJRA 5CEMA 1H0VA 2R3QA 4EOJA 4D4YA 3P1AA 5HTIA 3KC3A 4G3EA 4AWIA 4ZZMA 5KMKA 2UZTA 3KKVA 3P7BA 4O81A 2IJMA 2OZOA 3IW8A 1U5QA 4FL3A 3KK8A 2XIZA 5B2LA 3KIOC 3OC1A 1RE8A 1B6CB 5JEBA 4U43A 5FDPA 3CIKA 4FKGA 4LV7A 3V3VA 3DAJA 3CPBA 2DWBA 4BWPA 2XK7A 4PQNA 3NUPA 3ODZX 2Z7LA 3DLSA 2PMLX 4PDSA 4CNHA 4BTMA 1E1XA 1GZ8A 4NM7A 5JQ5A 2PZPA 3WZJA 5FTGA 3IDBA 2C6TA 2JITA 2VO6A 3ROYA 5HO7A 4L43A 4WNPA 5FP5A 3ZC6A 3D0EA 4RZVA 2OFVA 3NYXA 2WEVA 4ENYA 4D55A 4F08A 2JDRA 4MVFA 2FVDA 1P14A 4W8EA 2OICA 2VO0A 2GPHA 2C5OA 3PJ1A 3SRVB 2E9VA 2YDIA 3L8PA 4FIGA 3ZHPC 3QQFA 4BDDA 3V6RA 4WRSA 1YWNA 4TWOA 5KZ0A 4HNIA 4EH4A 3NUYA 2XIKA 4JIAA 1K9AA 1DAYA 3AKKA 4D0WA 4ZJJA 3QTIA 1FQ1B 5DT0A 4D2RA 1ZLTA 3EQCA 4V05A 4Y8DA 5ETAA 4D2VA 4GFMA 1FINA 1XH7A 3PP1A 2XKDA 4K33A 4YJUA 5AP6A 5JGBA 2QOQA 2CKEA 2J0JA 4BCKA 2X4FA 1NVQA 3QUDA 5CXHA 4HYUA 4NIFB 5HNBA 3OT3A 3RPYA 1U54B 3RKBA 4YSJA 4FSRA 5ICPA 2RGPA 4XV9A 1FMOE 4UWYA 2UZNA 1U59A 1BL7A 4G3CA 3HVCA 2J51A 5CVHA 5AR2A 2WTKC 1OM1A 3LCDA 5AM6A 5D9HA 3VHEA 2YN8A 3SHEA 3ZRLA 3NUAA 5BNJA 3BYUA 3EQBA 2FSMX 2E9PA 2VTPA 2ZB1A 3VS3A 4G31A 3ELJA 1R0EA 5TR6A 1JAMA 4ASXA 4U0IA 4WKQA 3QRTA 5IA4A 3JYAA 4ZTQA 1VLRA 4XP3A 4EK5A 3BYVA 3IG7A 4QMWA 3IGGA 2Q0NA 2UVXA 3OW3A 5DIAA 4EUUA 4F63A 4CYIA 3PA3A 1QPCA 3PDTA 5HO6A 2B9JA 4QQCA 1KE6A 3LQ5A 5TT7A 3VF9A 2C6DA 3O7LD 3ULIA 3A61A 4X3JA 3WIGA 5KMIA 1BX6A 2GTNA 5M06A 2VWZA 3FZSA 1XH5A 3R9NA 3F6XA 4BDEA 4FZ6A 5B2MA 3IDPA 5DRDA 2X7GA 5E1SA 4QT1A 4B6LA 4DEGA 4NK9A 4M84A 5HVKA 1BYGA 2PMOX 4FYOA 4Y83A 4BDJA 3PE1A 3N4VA 3UPXA 3TV6A 4YPDA 4L7FA 5D11A 4Z16A 2YITA 5K5NA 4CZUA 4AW0A 1IAHA 4OTWA 3Q2MA 3KN6A 3LM5A 5TE0A 5F4NA 4DEDA 1PRYA 3MH0A 3UO4A 4GUBA 1WBNA 4ACGA 3GXLA 5FP6A 4BN1A 3WARA 4KKHA 2YCRA 4WNKA 4C35A 4BCQA 2GNLA 3U9CA 3W2SA 3MBLA 4FZFB 2PVYA 1M7NA 3LOKA 3TXOA 4PMPA 2O64A 1JKTA 1KSWA 2R4BA 2BHEA 3LXPA 4DFUA 5TF9A 5D7AA 4LMUA 4BICA 4EC8A 4QMNA 4R78A 4QP6A 3UC3A 4F7LA 4IHPA 3VVHA 2XZSA 3KMWA 4IAIA 3UQCA 4MBJA 4QP8A 2ACXA 4JBOA 4U41A 4Y5QA 4CTCA 2W9FB 4RIYA 3ENHA 3QU0A 4UBAA 2PHKA 3VUHA 3C4WA 4K77A 1KOBA 5M4UA 3V5QA 5C9CA 4LMNA 5AUUA 3HA6A 3P79A 2NYAA 2EWAA 4KIKA 3SDJA 5IQFA 5CAOA 4CRLA 2VWBA 2JEDA 4IAFA 4K0YA 5EM7A 3DKOA 3UTOA 3LJ0A 4BDFA 4OGRA 5EHYA 3IGOA 4C3PA 4LGGA 5IA5A 2BDWA 2NO3A 3OTUA 5T3QA 4KD1A 5GZAA 5LWMA 4GFOA 4FTMA 4JAJA 1HOWA 1I09A 4AN3A 2V0DA 3KU2A 4KNBA 4RZWA 4BY9E 2BAJA 4FKLA 2NP8A 4QYEA 1UNGA 4O21A 5A4TA 4C0TA 3DAEA 1OUKA 5D1JA 4AZWA 4C33A 4Z3VA 4DBNA 3CTQA 4FUYA 2IVSA 3KRLA 4FIJA 3W0QA 4FTUA 4RJ6A 5D12A 3ZXZA 2JKMA 4RFZA 5M09A 1OB3A 1LP4A 1JLUE 4ZTHA 1PXIA 2ZDTA 3PUPA 4MXCA 3TNIA 5AR3A 2BKZA 4XHKB 3TMOA 5E8UA 1UU7A 1J3HA 5EHOA 4YBKA 3MFTA 1XO2B 5M55A 3WYXA 4DCAA 4E3CA 2EU9A 3NAXA 4HVIA 4HVGA 4WSQA 3FC1X 3IDCA 4FODA 4P7EA 4ZY4A 1OUYA 4F0IA 1RDQE 4WOVA 4G5JA 3I81A 4FEQA 4PDPA 4CQGA 4ARKA 5CX9A 2IVUA 2WTWA 4D5HA 3CBLA 3DB6A 3R21A 4K2RA 1F0QA 4L00A 3D4QA 4ALVA 5IH6A 4DDIA 4FV9A 4X3FA 2YDJA 4CMUA 3VNTA 1WMKA 2Z02A 2W1HA 3FMMA 3FLNC 2WMTA 3ALOA 4IADA 4PMMA 1DI8A 1HCKA 2PPQA 4Z55A 3U6JA 4GH2A 3BI6A 4FV8A 3EQRA 3TNHA 3C4CA 4FA2A 3ML1A 4ZXTA 1B38A 2YA9A 1CKIA 5H2UA 5CALA 3Q04A 4DGMA 3IW4A 4FV0A 4GCJA 3GVUA 2Y4IB 3GP0A 4QQ5A 4G34A 4IQ6A 3HRFA 4QTCA 3MB6A 2X0PA 4YBJA 4EJ7A 4AFJA 4H58A 5HU3A 1YOJA 5KHXA 1PMVA 3R02A 4EK6A 2YM8A 4DT8A 4QDVA 3GC8A 2XAOA 3MVHA 4LM5A 4TYJA 2E9OA 2YLEA 4YLKA 4FTTA 5ANKA 4JBQA 3OEZA 5CU0A 4DCEA 2FSTX 4QP9A 2I0EA 2QD9A 5JQ8A 5IEVA 2BFXA 3ACJA 4NZWB 2JDVA 2O3PA 2XK6A 3VBYA 1YI4A 5IUGA 2BZHB 4QP3A 4BWXA 4DLIA 2YCFA 5M53A 1X8BA 2BILB 3TKIA 4TT7A 2G01A 3EHAA 4GIHA 5KKRB 5L2IA 3PFYA 1Y6BA 5AUVA 2J2IB 3UMXA 3DAKA 3ULZA 4IWDA 4XG2A 2G2HA 1YXUA 4RVMA 4XRLA 3WZEA 4QP2A 5FXRA 5L2WA 3UDSA 5A4LA 3M11A 3OVVA 1FMKA 5H8GA 3RINA 3QKLA 3HGKA 4HGLA 3ID6C 3HRBA 3R0TA 3WF6A 4X2FA 4CFVA 4EHZA 4BTKA 3LQ3A 4O7TA 2HY81 4MK0A 4P90A 3FYJX 4QP1A 5JGAA 4RC2A 1R3CA 4FKQA 3QXPA 2F7XE 4F1OA 2UZUE 4J71A 3UYSA 3O17A 3SC1A 3ZZWA 3S00A 2J9MA 3NLBA 3C51A 4M15A 2UVYA 3QCQA 2WOUA 1YWVA 4ZSLA 2PTKA 3R30A 4EHGA 2W1CA 3WE4A 4ASZA 1Y57A 2YAAA 3UDZA 3D7TA 3ORIA 3W2PA 2IW9A 3LFNA 1UA2A 2IZSA 3UOJA 5C1QB 2WMBA 2X81A 2QR8A 3DFAA 2QOFA 3EN4A 5F1ZA 4O7LA 4E6DA 2GNIA 3KREA 3PIYA 5FUTA 4ZAUA 2ZFYA 1QPDA 1PMNA 4O7VA 4E73A 3BV2A 1OIYA 3QBNA 3TI1A 5ETIA 2B53A 4RPVA 3W2RA 2C5XA 4FT5A 5T6KA 4YUQA 2C3JA 2ITVA 4UMTA 3DA6A 4EH5A 4CG9A 4FV3A 3MJ2A 2XNOA 1PXLA 2XYUA 3D5UA 3NIZA 4CKJA 3M42A 3MY5A 4OTFA 4QNAA 3K2LA 3UIMA 1IAJA 3ORLA 1A06A 4H1JA 2BAQA 2VNWA 4FSTA 4MHAA 4MWHA 4NCTA 4U42A 4JRNA 4RVKA 5A9UA 5HD7A 2JBPA 4FKIA 3P5KA 5F94A 5E91A 3N4UA 2VNYA 4AT4A 4KRDA 3I6WA 3LQ8A 2AC5A 3PP0A 4G17A 2YJSA 3H0YA 4FZAB 3KVXA 2VGPA 4YHFA 1NY3A 2GU8A 3KCFA 5A3XA 5JGDA 2X2MA 3RCJA 4KAOA 1OKZA 4XMOA 1PXNA 4IACA 3RJCA 4EH6A 3E8EA 4LI5A 5DR6A 5HLWA 3G15A 4BDIA 3E93A 3WIKA 4FSNA 5CT7A 3KRRA 2IVTA 4CD0A 4DFNA 2PULA 3OUKA 3DXPA 2WMUA 2Y9QA 2VD5A 2YIXA 2C1BA 2ITPA 3BX5A 3FLQA 3M2WA 2JC6A 1REKA 4IANA 4Y95A 3AMAA 3ZBFA 4AA5A 4C4HA 5JT2A 3DLZA 4S2ZA 4L53A 2QHMA 4YNOA 2RG6A 4M12A 5DWRA 4FG7A 1Q8UA 3QRJA 4MTAA 1PYXA 2X9FA 1Y8GA 4O22A 4NM0A 4TW9A 4V0GB 5IMXA 3ENMA 5IDPA 4MX9A 2JKQA 4ZJVA 1ZYLA 3V8WA 3ZH8A 1V0PA 4E5BA 3TCPA 3FQHA 3LCTA 5ANJA 2WTKB 4NM5A 3H30A 3UVRA 3E7VA 4IC8A 1ZYJA 4G1WA 3EWHA 4O91A 4B99A 2BMCA 2X7FA 5H8BA 3FMHA 2FA2A 4RX8A 3EH9A 4YZBA 2BRBA 4BBEA 4IVCA 4DTKA 3UNZA 4LUDA 4J97A 3CCNA 3ZSGA 5JFWA 3KRXA 4F6WA 4PL3A 1MP8A 4QYGA 4JXFA 2BALA 4R5SA 2C3LA 5IUHA 4AXFA 4RJ5A 3SOAA 2JDOA 2V62A 5BQ0A 2XUUA 3AT3A 4K8AA 2WTJA 2YHVA 3PVBA 2PVMA 3AG9A 2KTYA 5A46A 2ITQA 4CV8A 2XNNA 1WBTA 5HU9A 4PNKA 1ZMVA 3G90X 4CMTA 4GFGA 5KHWA 2XK8A 5DE2A 4EHEA 2RFEA 3RPRA 3JY0A 2ZMDA 2CNUA 4YTIA 2QKRA 3MTFA 5JZJA 5CU4A 1Q3DA 2UV2A 3CQWA 3ITZA 3FUPA 2R3KA 3QL8A 4ZOGA 2GFCA 3RZFA 4E6AA 4OLIA 5C26A 2C6KA 2QU6A 5HE0A 1E1VA 4KKEA 3D9VA 1ZXEA 2BZKB 3BRBA 2CMWA 1T45A 2CNVA 1VEBA 3PVWA 3MPTA 1ZOHA 2P55A 3WZKA 3QTWA 4J1RA 1SVEA 3MH3A 4R8QA 5CAVA 3WF7A 2B7AA 4G3DA 5E8SA 3MPMA 3NX8A 4LOQA 3ZUUA 4BI0A 4NFNA 2G2IA 3MVLA 3ACKA 4I4FA 2BHHA 1KE5A 2PVNA 4K1BA 5ANEA 5BYZA 3VQHA 4DFZE 5L6PA 2R3HA 4LG4A 1QCFA 3CR0A 3A7IA 4QP7A 4BL1A 3RWQA 3NFGB 4WHZA 3TIZA 3QQHA 2QQ7A 4RRVA 4U8ZA 3MDYA 5BV3A 5A6NA 3BLRA 5ETFA 3ZM4A 2WHBA 1U46A 3DBEA 3UOHA 3ZRKA 4LRMA 3CTHA 1XJDA 4U6RA 5IQCA 2W96B 4EK4A 3FI8A 1F3MC 4C4FA 3E63A 1UU3A 3O23A 4G5PA 3ZO4A 2GMXA 3Q9ZA 4JOAA 3OCGA 3R8VA 5L8KA 4C34A 2OIDA 2YCQA 3HUBA 2XKEA 4WNOA 5IG1A 4DC2A 2HENA 5FGKA 3MA6A 3Q5IA 3KVWA 3ZFMA 3MVJA 5CSXA 4E26A 2Z7RA 4O1PA 3RPVA 4XLVA 1UWJA 2HELA 3O2MA 3O50A 3C1XA 4BGHA 5EQEA 4II5A 5E8VA 2GHLA 2V22A 4FV2A 3CD3A 4QMVA 3FPQA 4FKVA 4ZSGA 3W10A 5EW9A 3ZSHA 4AX8A 4CXAA 4MUQA 2WU6A 3NYOA 1ST4A 1KE9A 2WAJA 1CM8A 2XMYA 4UMRA 1IA8A 4WBOA 2IG7A 5C4KA 4DG2E 2UW7A 4AXEA 1OL7A 3NRMA 5C03A 3PY3A 3RK9A 4MAOA 3VWAA 4CEGA 3FLSA 3NUNA 5DGZA 4QMSA 5IA1A 2QOLA 4CLJA 2HZ4A 4L42A 1ZMWA 5HG5A 1G8SA 3E92A 2XM9A 4LRJA 5JRQA 3U54A 4D1ZA 1J7LA 4DF3A 5KBRA 2E2BA 3K5VA 4FTAA 4TYGA 3C4XA 4HPTE 4F70A 3IECA 5CS6A 5HIBA 1SVHA 3EMGA 4XV2A 5C01A 4OBOA 4N57A 4CZYB 3KFAA 3EOCA 5FQDC 3QZHA 3WF5A 3LFCA 3HLLA 2IW8A 4Y73A 5BVWA 4GK3A 2QR7A 4GYIA 1NVRA 3BE2A 5D41A 4BCGA 4HVSA 1OMWA 2H34A 4TYHB 5IZFA 5LVPA 4LOPA 4AQKA 1G8JA 4JLCA 4RGJA 4U44A 1AQ1A 4DFLA 4DGNA 5EDPA 4F1TA 4BCPA 4LL5A 4E6QA 1XQZA 3QD0A 5CI7A 2HXQA 4M97A 2X6EA 5KUPA 1JWHA 2OZAB 3PPZA 5CQUA 4OAUC 5I9VA 1UVRA 5AP0A 4KBKA 1LEZA 4FKOA 2WIHA 3MH1A 2ETKA 4ZTRA 4E4LA 2YIYA 1H1SA 2XARA 3VBTA 5HNGA 4O7RA 3QKMA 4RIWB 1SYKA 4D2SA 5JK3A 3DBQA 4G2FA 4QYFA 2X0QA 1Q41A 5IA2A 1OL2A 5LMAA 3FBVA 5CAQA 3OF0A 3MV5A 2JIVA 1FGIA 2OH0E 3GU4A 4XP0A 3GI3A 5HICA 1XBCA 1Q3WA 3S3IA 2ZV8A 4AE6A 1Y8YA 2EB2A 5AV3A 4ZY6A 4TWNA 1GZKA 3ZYAA 2X4ZA 2VWXA 2XJ1A 1DI9A 2ITOA 4ZS0A 5I9ZA 4C3FA 2XVDA 4EQCA 5HGIA 2YEXA 4F6SA 2HY0A 1OPJA 2WTDA 4DH7A 2ZV2A 5EI2A 5AV1A 2XF0A 1H1PA 3QQJA 4FMQA 4ITHA 4OTQA 5L2QA 2OJIA 4FJVA 1XWSA 5AR8A 1ZYCA 4ALWA 5M56A 5EYCA 4DHJA 5L8JA 3M1SA 4JQ8A 5IQHA 4MNEB 4QMTA 5GZ8A 2C5NA 2WZJA 1F5QA 5EG3A 5HVYA 3QTSA 1YDRE 3R6XA 4IDVA 4UB7A 4Q5EA 5JSMA 3AT2A 3LFSA 4M69B 5FBOA 3R9DA 4OTGA 3PTGA 5IKWA 1Q8WA 1URCA 3PXRA 5CSHA 3ZC5A 3I5NA 1WBOA 3R2YA 1YXSA 2EB3A 4XH6A 1IR3A 1G8AA 5KZIA 4BKZA 4NSTA 3A7GA 4Z9LA 1XH4A 3OXZA 3A60A 3FZ1A 4FV5A 5CXZA 5E9EA 1W98A 1TQIA 3IO7A 3BLHA 3HEGA 2PZIA 3PSBA 4IZ5A 4ZLOA 5JMSA 4O7ZA 2YISA 5GINE 2R3MA 4B8MA 3BHVA 4FSQA 3QALE 4IB1A 4AF3A 4CCUA 3KXHA 3PY1A 3TJDA 4RJ3A 2J0MB 1PXOA 4XBRA 4GU9A 4GU6A 2R0UA 3COMA 3QYZA 4JBPA 3TUCA 2VO3A 3VS2A 3VJOA 2RSVA 3RAHA 4BBMA 3DDPA 5E92A 3R7OA 3ZDIA