3VHKA

Crystal structure of the vegfr2 kinase domain in complex with a back pocket binder
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
355
structure length
297
Chain Sequence
DEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title A Back-to-Front Fragment-Based Drug Design Search Strategy Targeting the DFG-Out Pocket of Protein Tyrosine Kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 297
sequence length 355
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vhkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vhkA01
4OTWA 3KRJA 4I92A 2X7FA 4FR4A 4EQMA 4IAAA 2NNWB 4CTBA 4BI0A 2XYNA 4D2RA 2BZKB 1WVWA 3EB0A 5AA9A 3Q04A 4FVQA 5IA5A 1Y6AA 5CAOA 5I5ZA 3NUAA 3CQUA 3OOMA 4N0SA 5K3YA 4CQGA 3V04A 4BDDA 2VTHA 5DR9A 5J9ZA 4FF8A 2X7GA 4ALWA 5A6NA 4ZY5A 4DCAA 2YEXA 5ANEA 1WBWA 1VR2A 1QPJA 1OIQA 2A2AA 2IO6A 2VWWA 4CZTA 1P4FA 4TTHB 2J0LA 3DNEA 2FGIA 4AN3A 5EHYA 3TCPA 4QYYA 2UVZA 2XA4A 5EI8A 3FXZA 4ARKA 1P5EA 3JXWA 2PK9A 4MXCA 4CYIA 3QCXA 3I81A 4DFYA 2AC5A 3WYYA 2XVDA 5I3RA 4V0GA 2UZLA 4FTUA 4EZ5A 5AFVA 4DTBA 3PVUA 4YLJA 3R00A 1M2RA 4L44A 3HVCA 2YIYA 3DLZA 4AZFA 1Q99A 5FQDC 3U9CA 3T8OA 2WIHA 3D2IA 3QD2B 3DU8A 2IN6A 4J53A 4ZTQA 3PJCA 4CZYB 4WG5A 2XP2A 1YVJA 2VO0A 2VTMA 3UE4A 4GG7A 3HYHA 5JK3A 3GC8A 1OIRA 4M69A 4K2RA 4RJ3A 4QMQA 3QGYA 2B1PA 4U80A 2JEDA 3P79A 3V5JA 4A4OA 2QHNA 3OHTA 2BTSA 4QPMA 1HCKA 3HL7A 5IA3A 2R3MA 4EZ3A 4KAOA 3UVQA 3OC1A 3WF5A 2XZSA 3F3ZA 3R9RA 2V22A 3SXSA 3HAMA 2RG5A 3D0EA 2DQ7X 3DS6A 3M11A 4H3BA 4QTDA 5F95A 4BR3A 4XJ0A 5C01A 4ASEA 1K3AA 2QU6A 4CLIA 2H34A 3UOHA 3UTOA 4ZSGA 1BL7A 1Q62A 4O22A 4XHKB 5CU3A 2YISA 3RBWA 3V3VA 4ACCA 3F2NA 3ZXZA 2J0JA 3FLQA 4O7ZA 4QP3A 4E5BA 3ZONA 3LQ8A 4AGUA 3OXIA 2OW3A 5HQ0A 4DFZE 2A19B 3RK7A 2R5TA 3IK3A 4IE9A 3N4VA 3A7FA 2WU6A 2X4FA 4FZDB 4IC7A 4ANQA 3F66A 2O64A 4LMNA 4UWCA 5CAPA 3BIZA 1XKKA 3WZJA 3HUCA 5FEQA 3OCTA 1MRUA 4L3PA 4RLLA 4KA3A 3HUBA 3E7OA 5FTGA 3FMLA 4C57A 5DG5A 2Y4IB 3TNWA 4DITA 5FDPA 4F99A 3SG8A 3NX8A 4O38A 5DYJA 2GNJA 2F7XE 5L2TA 2EVAA 2W5BA 3KRRA 4O7VA 5EHLA 2PVMA 3BYOA 1U5QA 2QLUA 5IMXA 3QKKA 5EOBA 4XNEA 4GKIA 2UZDA 2KTYA 4IZYA 2YA9A 3OROA 3GQLA 1XH4A 4BBMA 3ENHA 5F1ZA 5AAEA 2Y7JA 4JT3A 2QOBA 3QC4A 3EQPA 3QA8A 1WBPA 4FKTA 3CTQA 5FBNC 5HGIA 4PX6A 2EUFB 4M68A 1WVYA 4TYHB 1ND4A 3NAXA 3NYOA 1YXTA 5ETFA 3ZUVA 4QRCA 2J5FA 4YTIA 3SVVA 1YI4A 4J95A 5LVPA 4YLLA 2AUHA 2VO7A 4IB5A 2X1NA 3DB6A 4CD0A 1YOJA 4ZAUA 2YLEA 3ZFXA 1GIHA 1JSTA 4D4RA 1Q41A 4K1BA 5CYIA 4HZRA 3O50A 3UNJA 2YIQA 4BY9E 4QPAA 4LYNA 4TT7A 3DFAA 4CSVA 4A4LA 4EYMA 3A61A 4DH8A 4FEXA 3DT1A 3E8DA 4X3FB 3SW4A 1U54B 3FKLA 4JBPA 4NIFB 4L53A 3OBGA 2ZDUA 3MY5A 3GU8A 3ZZEA 1CSNA 3RMFA 5IEVA 3LMGA 1SM2A 5M09A 3D2KA 3L8XA 4FC0A 2WMRA 4QP4A 4IW0A 3E88A 4JR7A 2H8HA 4FKLA 4OTIA 4C4HA 1J7UA 5IQDA 4MF1A 3COHA 3QTZA 4CT1A 5H8EA 3FY2A 3R83A 4DH1A 5HCZA 4FT5A 5JMSA 1HOWA 4DLIA 5FDXA 3ATTA 3GU6A 4NWMA 1FVTA 3DK7A 4LL0A 3F3TA 2CKOA 3AC2A 4BKZA 4RX8A 3FXWA 4XG9A 3R8UA 4QT1A 2VD5A 3GT8A 2XK7A 2A0CX 3EHAA 3PJ8A 3UIBA 5IF1A 3UPZA 3KCKA 2SRCA 3B8RA 3EIDA 3CKXA 2HZNA 4PPAA 3HMMA 5D11A 2PZ5A 5M44A 4IVAA 2XKFA 4LOOA 5HORA 2C4GA 2BKZA 4I0TA 3P0MA 4EWQA 2R3IA 4M7IA 5KHWA 4IFCA 3UIMA 1IA9A 3OD6X 1XBAA 1QL6A 2X2LA 3LJ2A 3NSZA 4YMJA 1RW8A 4XG4A 5L6WL 4QP8A 5LARA 3F5UA 3IG7A 4I6FA 5E1EA 1H8FA 4RZWA 4V01A 3GNIB 4PDPA 4C3FA 4ZLYA 4UMPA 1Q4LA 1R0EA 3WARA 4HVSA 4PL5A 3LHJA 2WTDA 1J3HA 1FOTA 4J71A 2YDJA 4L7SA 3ZC5A 5CAQA 2PHKA 4DE4A 4AP7A 4N6ZA 3BYVA 3NYVA 5CZHA 3PE1A 3LM0A 5F4NA 4AF3A 3PPZA 3ODZX 3D7ZA 3SA0A 1Q8WA 1F0QA 4QMVA 4C34A 3NRMA 3KL8A 5EI2A 2VO6A 5AAGA 1H0WA 3IQ7A 4FTRA 5ACBC 1H0VA 3QTUA 2VWBA 4LGGA 3TJCA 4C4EA 5KMLA 3VUIA 2LAVA 2OIBA 1KE7A 4FKGA 3T9IA 4H36A 4C58A 3WYXA 1EH4A 4YC8A 3U87A 4GRBA 3TZMA 4DEHA 4B6LA 3QQGA 3QZGA 3DZOA 4DGNA 2B4SB 4IAZA 5HIBA 4BDFA 2V5QA 3QUDA 5EYCA 4FSYA 4EKLA 4DEGA 4UXLA 1YQJA 1YWRA 2E9UA 2RFSA 4QP7A 5L8LA 4Z55A 3CKWA 2ETRA 3VS1A 4HCTA 4QTAA 4CMTA 3FPMA 3KK9A 3EQCA 3FHIA 2OH0E 4P4CA 2W1IA 2VTSA 4RIWB 4O6EA 4ANLA 3U9NA 2PVLA 4FA2A 4TYJA 3L9MA 2CMWA 4GKHA 1CMKE 1MRVA 4KSQA 4O0RA 1ZMWA 4HPTE 5AADA 1KV1A 1M7QA 4ZSLA 3V5TA 3TDVA 4D2VA 5A46A 1VYZA 4EORA 5BX0A 3BKBA 3TNHA 4WSQA 4JXFA 5IMEA 2OXDA 2W1DA 1LEZA 4FTJA 4HPUE 4BN1A 1ZYJA 5A4TA 5AUVA 2UZTA 2JFLA 2ZM4A 4R1VA 4EONA 3OT8A 2C5XA 3UP7A 4GK4A 3D4QA 3Q4TA 4L6QA 2UW9A 1ZARA 2DS1A 2IVSA 3N51A 1U59A 4YZCA 4YSMA 5JQ5A 3DBEA 3WI6A 4GK2A 3FMNA 3D9VA 4IXPA 2W1ZA 1PMEA 3BYUA 3T3VA 3WE8A 1G8SA 4B8LA 4I4EA 1YXXA 4OBPA 4U6RA 3TEIA 5BVOA 4YZBA 2ZV2A 3NUPA 4GH2A 3ZFYA 4DINA 2JD5A 2FO0A 1H26A 4RLKA 4HVIA 3MVJA 5BUIA 4USEA 2FYSA 5DA3A 4WG3A 3VS5A 4KIOA 2XMYA 3D94A 3VUDA 3B8QA 4BCJA 5KKRB 4EBVA 4FZFB 5HTBA 4KNBA 2C6LA 2HK5A 2J9MA 3RZFA 4TYHA 2BRMA 4IVCA 1QCFA 2P0CA 3IOPA 3O2MA 3V5PA 2DUVA 4YJVA 3F5PA 1H1RA 1OIYA 3BHUA 4FV3A 2ZM1A 5DT4A 4AOTA 4FTNA 5EM5A 2WO6A 2OBJA 3OWLA 1RJBA 2WMBA 5CNOA 4RX5A 4TYGA 1LP4A 2EXMA 4HNFA 3WZDA 4FEVA 3D14A 4F65A 3BYMA 2VTJA 2UW5A 2O0UA 2PMNX 4JQ8A 1ZWSA 4RBLA 3RPRA 2UW4A 4P5QA 5AR2A 1ZYCA 4RIXB 3BRBA 3V8TA 5IU2A 4ZJIA 4IMYA 2X9EA 2XNBA 3QD0A 4NIFA 4QP6A 4UMRA 4YP8A 3W33A 3TJDA 3OT3A 4NM5A 4FKSA 4FL3A 5AP6A 5TE0A 2PUNA 2C68A 2VX0A 4QP1A 2YCFA 3AG9A 2YN8A 4KIKA 4A9TA 5KBRA 3GC9A 4D2SA 4U0IA 4AZVA 2O63A 4AZTA 3EQHA 3UOJA 3LCKA 1ZYLA 3GCPA 5EYKA 5CU0A 2QO9A 4JNWA 4AW1A 4A06A 4L3JA 4LMUA 2CNVA 3I4BA 2PPQA 4CKJA 1PXMA 3W16A 1BX6A 5DH3A 4PP7A 4UXQA 4J98A 4FG7A 4NEUA 3Q5IA 1FBNA 1BI7A 1CDKA 4GEOA 5LJJA 2R3RA 3HA6A 2QLQA 3PE2A 5E8SA 1JLUE 3AGMA 2Y0AA 3MIAA 2ITWA 3HV5A 3UPXA 3PXQA 1ZMUA 3EQIA 4YHFA 5KMIA 5KX8A 5EK7A 3DJ6A 2RFNA 3SV0A 4JAIA 3MJ1A 3PY0A 4PY1A 3NEWA 2PUIA 3II5A 2UW3A 3R63A 2JIUA 4JJRA 4TWOA 2QD9A 3R28A 2EB2A 5AR3A 1U46A 3RK9A 3EL8A 4TRLA 3EJ1A 3D7TA 3BI6A 3WIKA 2Y4PA 2I0VA 3DK6A 3EN5A 4GT4A 3O17A 4KIPA 4NH1A 3VUMA 4WBBB 4NFNA 1Q5KA 2GMXA 3HA8A 4AW0A 3G2FA 2P55A 1FGIA 2XK3A 4GVJA 4IB3A 4ZIMA 4BICA 4O0XA 3CD8A 2YM4A 1PXLA 3OXZA 4I21A 4IBMA 4ANMA 4HYHA 3MI9A 1M2QA 2PE0A 4FTQA 1XBBA 2VGOA 5AV2A 4K9YA 4BCKA 4RZVA 4ZOGA 4BCGA 2YIRA 4XYFA 4U40A 3WF8A 1REJA 5CZIA 4BTJA 4NM0A 1CTPE 4UMUA 5FXSA 3UVPA 3KRWA 4L42A 2XNGA 3U6HA 2C6KA 3HLLA 1SVHA 2XM8A 1R0PA 3QX2A 1YHSA 2JAMA 4I4FA 3PA4A 3MFRA 4NKAA 5DI1A 3UIXA 1PHKA 4PNIA 4RIWA 2XUUA 3HMNA 4EC8A 2FA2A 4Z7HA 5E92A 4DTAA 4RVLA 3Q2MA 1B38A 4EH9A 1OL2A 1WBTA 3MVHA 4DC2A 1SVGA 2UV2A 3PZHA 4R3PA 4BTKA 4OTGA 2I0EA 2EWAA 2W4KA 2ZJWA 4FG9A 4YNOA 5HESA 3EN9A 3UODA 4E4MA 3DDPA 3OG7A 4FKVA 1VJYA 5IDNA 3FE3A 3UO4A 1JQHA 3L8SA 4RIYB 5J5SA 4QD6A 5A54A 3ZYAA 1H28A 3W32A 4AZEA 4IVBA 4WBOA 3QX4A 4TKSA 3AXWA 3MFSA 2BPMA 2GQSA 5HICA 1PW2A 3Q53A 5CS6A 2XF0A 4AW5A 3C7QA 2Z7LA 3VAPA 5AWMA 2O65A 3ZRMA 3BLQA 4IACA 2XIZA 3NVKI 3ORIA 3NNWA 3RPSA 2R3LA 4GFGA 4XUFA 1WMKA 3GENA 3QTSA 4YHJA 3P9JA 3DDQA 2XIRA 2WMUA 5CSPA 4DEBA 2GSFA 3GUBA 3MWUA 4ACGA 1H01A 2W1EA 3IW7A 3L9NA 2J4ZA 3R7IA 4CLJA 4C3PA 4FSMA 2QKWB 4FSTA 5T68A 3P1AA 2UW8A 2WQBA 3AD6A 4I3ZA 4MD8E 4TWPA 3SX9A 4YR8A 1FPUA 1TVOA 2BROA 5DEYA 1VZOA 1H24A 3IONA 3NUNA 5HKMA 4GW8A 3QHWA 3IKAA 4EOKA 4RQVA 3R2YA 5CQWA 3EQBA 1YI6A 5D1JA 4O86A 2W99B 3FLNC 3I7BA 2BFXA 3A99A 3FL4A 2QVSE 4QP9A 4XBUA 5DGZA 4IJPA 3S4QA 4GYGA 3CQEA 4FL1A 4JX7A 4TW9A 5I3OA 4BGGA 4IWDA 4AFEA 1X8BA 5M06A 3ZEWA 1IRKA 3O8TA 4FTIA 4B9DA 5CANA 5KMNA 3C4ZA 4QMTA 4W4YA 2ESMA 2I1MA 4MF0A 3VO3A 1HCLA 2HELA 5FP6A 1W82A 3VUTA 5CXZA 2X9FA 4X6RA 4FSZA 2BMCA 3I79A 2Y9QA 2QURA 4CRLA 2G9XA 1M17A 4FIJA 3VS6A 4USDA 4EJNA 4F0FA 4TNDA 4FG8A 3M2WA 1KV2A 4I6QA 4TL0A 3ULIA 1Q24A 4ZJVA 4W9XA 2ETKA 4GS6A 3JR1A 1F5QA 3C0HA 4NCTA 4EZ7A 3I0OA 4B4LA 4NCTC 3LM5A 1GNGA 2J50A 4LV5A 2REIA 2ITXA 2VTOA 1GAGA 2QHMA 3P4KA 5HG9A 3DOGA 4CMOA 3IPHA 4N70A 3R73A 4Z9LA 2XCHA 3FMHA 4QMOA 4MCVA 4XRLA 3SXFA 4X2JA 1IASA 5HU9A 3Q96A 4OTHA 5L2SA 4PV0A 4X21A 2OXXA 3OWPA 4PDYA 2VAGA 2WTKB 4GCJA 2HXLA 3ZOSA 3QKLA 3RAHA 3SD0A 3KVWA 5HHWA 4M66A 3C4XA 3LFCA 2RL5A 2HIWA 3COMA 2XIYA 5EKNA 2EXEA 5M08A 2OJIA 2XJ1A 2C3KA 4BDKA 4QMXA 4AS0A 3LOKA 5GZ9A 4B0GA 4ACHA 4K6ZA 5CASA 3H4JA 2PY3A 4QNYA 3NS9A 4H05A 1Y57A 4KSPA 5FEDA 4O0YA 5FP5A 4E20A 4YBJA 4EK8A 3KEXA 4EL9A 1YI3A 2W05A 4JIKA 3IW4A 2J7TA 4DH7A 3NYNA 3KXMA 3ZDUA 2VO3A 2WTJA 4S2ZA 2PVRA 2C5OA 2ZV7A 3DCVA 4C3RA 5TT7A 4EH8A 5JRQA 3UNZA 5BVNA 3VS7A 4K33A 4UALA 2BDFA 3LJ0A 2GNFA 2X2MA 4FSNA 2VNYA 4LM5A 3WF6A 5IQAA 3AT3A 3KXGA 1E1XA 2YJRA 1Q61A 3FHRA 3PJ1A 3P08A 3MESA 4BDJA 4X7QA 3BEGA 1SMHA 3HV6A 3OOGA 3G15A 3B2WA 4K77A 4CYJA 4ZY4A 4FV5A 4HZSA 4FIFA 4BDIA 3PJ2A 4BYJA 5EQPA 5J9LA 1H1SA 4J8NA 3C0GA 5EG3A 4XG7A 5TKDA 2CKQA 4L00A 4EQCA 5CAUA 2ZB1A 4FGRA 4JG6A 3HECA 3F3VA 3Q32A 3HX4A 3U8WA 4RFZA 3AMAA 3G0FA 4KRCA 3V5QA 3DAKA 4H3QA 5JEBA 5CI7A 5L6PA 5I9UA 3IGOA 2YWVA 2F2UA 3EQGA 3VNTA 5HZNA 5M4CA 5IH5A 5IQBA 3VHEA 3HP5A 3NNVA 2JC6A 2PYWA 1P2AA 3PPJA 4HGLA 3GP0A 4BWPA 3AT4A 2IVVA 4O6LA 3N4UA 5HTCA 5C26A 3VUGA 2CGVA 4BCOA 3KB7A 4E73A 4KB8A 4RJ5A 3R21A 2BAJA 4JG8A 5ANGA 4X2FA 5HO6A 3R8ZA 4DT9A 2HZ4A 5CF4A 4U81A 3P5KA 2WZJA 4YJQA 4OAVB 3CBLA 3HMPA 3DXQA 3U6JA 1I44A 4NKSA 4WRGA 4EOPA 4MXYA 1BLXA 1ZZLA 4NW6A 2WMTA 3R1QA 2R0UA 3CY3A 3EKNA 4EOJA 4F1MA 5AMNA 4MWHA 4CZUA 5AV1A 4QYEA 3SXRA 2PVFA 3MH1A 3VS4A 4I5MA 3VW8A 3NPCA 4EH2A 3EFKA 2Y8OA 3NIEA 2VX1A 3BELA 4QMUA 2OJGA 4YHTA 3JVSA 4FEQA 4IHPA 5FLFA 3RI1A 4HYSA 5L6OA 5LCJA 2WTVA 4FOCA 5AV4A 4C4IA 4O0VA 2C6IA 4JIAA 3Q5ZA 4DCEA 3R1SA 4FKJA 4MBLA 3RP9A 5A4EA 3A7GA 4YJNA 3DFCB 5IQEA 3WIGA 3FWQA 3VWAA 3GOKA 1LUFA 3E8CA 5G6VA 4C37A 4L43A 3FMMA 3MVLA 4ITHA 2Q0NA 3EH9A 3QYZA 1KWPA 3KC3A 4M3QA 4E6AA 3C51A 5AP2A 4BFMA 1UU3A 4O7SA 3DQXA 3TN8A 1OUYA 5GJGA 3QD3A 4CV9A 4E3CA 5JGAA 4C62A 5HO8A 3QWJA 3PUPA 3EQDA 3CJGA 2F7EE 5DT3A 4OT5A 5E7RA 2ITOA 1CKIA 3WE4A 4XV2A 3LCDA 4HCUA 4R3CA 3QFVA 5M07A 3UG2A 3QXOA 3KN5A 4BF2A 3ORXA 3Q9WA 2B55A 3PLSA 5HG7A 4AA4A 4F63A 2ZMCA 4Y72A 5C27A 3UYSA 3BV3A 3W8LA 3P86A 2OFVA 4AAAA 1M14A 1UKHA 3AC4A 5HNIX 3PY1A 2CCHA 4M8TA 4XV9A 4ASZA 5LOHA 3ID6C 3JPVA 5E8UA 2R3QA 4G34A 5D10A 5BUEA 1M7NA 4C35A 4F64A 4NZWB 3C13A 4EOOA 3FSFA 5BYYA 3DAEA 2BRNA 2GCDA 2H9VA 3BBTB 3D5WA 3N9XA 3UQCA 3HMIA 2IJMA 5HE1A 2XK8A 2E9PA 3NW5A 4RPVA 2IG7A 3SLSA 5DFPA 2QR8A 5IISA 5AP1A 3RM6A 4X2NA 2QQ7A 5AUXA 5KCVA 1O6YA 5DWRA 3KXNA 4AT3A 3KU2A 4G3DA 4DGGA 2QODA 4YGAA 5EH0A 2QO2A 4O7RA 1H08A 4PTEA 2B9JA 2Y6OA 4F0IA 3EZRA 2FVDA 4EC9A 4AFJA 3KFAA 1URWA 4ITIA 4KBKA 3HAVA 2WTKC 2R3GA 4ZZMA 2HW6A 2HXQA 3S3IA 3N4TA 2GPHA 2W5HA 3FLSA 1NVQA 5JKGA 4UV0A 4XLIA 4FKRA 4QTBA 2XJ0A 3S1HA 2UUEA 3ZS5A 5GZ8A 4EHGA 4F09A 4ALUA 2ITVA 3UC3A 2VV9A 3TNQB 3RGFA 4D2WA 5AAFA 3QRIA 2XK9A 1UNHA 3CP9A 3OTUA 3ZRLA 2BVAA 1V0BA 3ZC6A 4AT4A 3CTJA 4IFGA 3ZLXA 2OLCA 2X8DA 3BQRA 4RWKA 5HCXA 3EQRA 4L68A 4E26A 1BL6A 2OG8A 3B2TA 4D9UA 4ZP5A 2FSTX 2XKCA 4Q2AA 2EU9A 4KS7A 3W2SA 1NXKA 5CI6A 4D0XA 3NLBA 4PTGA 4NK9A 3OMVA 5LMAA 5KMMA 4I0RA 1BYGA 4DBNA 3COKA 3SOCA 4FV2A 3NCZA 4MYGA 4EOLA 1W84A 4ZZOA 1NVRA 3WZEA 3W2QA 3KMWA 3SW7A 2PSQA 1XHAA 3QTWA 4W8DA 5FBOA 4MNEB 3DBCA 4I5HA 2DYLA 3RAIA 3VJOA 4M0YA 4TNBA 3FZPA 4YJTA 3E92A 5CEPA 4U44A 4RGJA 3KULA 2X81A 3FC2A 4AX8A 4WOVA 4Y8DA 5FD2A 5JFXA 3FV8A 2QOLA 5DN3A 4JL9A 4UBAA 2WFYA 2W4JA 3R7YA 4C59A 4DAWA 4I23A 4CT2A 3VVHA 3R7OA 2JKQA 4HW7A 3BLHA 4CKIA 2B0QA 4FNWA 1XH5A 1W98A 4JBOA 3G33A 1PY5A 4HVHA 5GJDA 3BGQA 2HYYA 2ZAZA 4G3FA 4TYIA 5TF9A 3IOKA 5EM6A 5IUHA 1FMKA 2WGJA 3FMKA 5CU2A 2OFUA 2R3JA 3IW6A 5HE2A 3L8VA 3SKCA 4X3JA 3PSBA 4TZRA 5H9BA 5BNJA 2ITYA 2VWUA 3R71A 3DBDA 3R7GA 3EQFA 4I22A 4E6QA 2XM9A 3PVWA 2UZNA 3R9DA 5HTIA 4RVTA 1GIIA 1PKDA 1OM1A 4A07A 2O8YA 1PXKA 5FEEA 4M15A 3PJ3A 5H8BA 4QO9A 4XRJA 3F2AA 1KE9A 3E64A 4GIIA 4N6YA 2PVNA 4Y85A 2CNUA 4BDHA 5AR7A 2PMLX 4YSJA 1QPDA 5BVWA 3IS5A 4ZY6A 2LGCA 5EFQA 2ACXA 2B9HA 3HV4A 4IZAA 3TV6A 3F6XA 2WD1A 2B9IA 4RC3A 4ENYA 2WEVA 4A7CA 5H2UA 5C8NA 2WMAA 4WIHA 5T3QA 3TV4A 4AA5A 5HX6A 3A4OX 3EZVA 5GNKA 1PMUA 2UZBA 4YZNA 1NT2A 4FT9A 5HE0A 1MQ4A 2A1AB 4MHAA 5DIAA 1MQBA 2JBOA 3I60A 4GT3A 4IWQA 3UDBA 5CEOA 5FWKK 2BZHB 3GC0A 4BDGA 1G3NA 1KE8A 1RQQA 3E8NA 4O91A 3QTIA 4G5JA 1JKKA 2BDJA 2XK6A 5DLSA 5HVJA 4P5ZA 5L2IA 3MFUA 1XO2B 3QRJA 2P4IA 4FVRA 3AD4A 4QMWA 4BTMA 4EK4A 4MXZA 5J7BA 4RC4A 2VUWA 5BVFA 3VQHA 2QKRA 3GGFA 2WTIA 4JR3A 5AR8A 5HBHA 3U4WA 1NY3A 2G2HA 4QNAA 3PVBA 4MVFA 4EH4A 5JZJA 3DJ7A 5IA2A 2C6DA 2BZJA 4OW8A 3PXYA 4IB1A 4BDBA 2YDKA 2YM3A 5M53A 3NCGA 4IWOA 3MTLA 4ACMA 3LE6A 5IQFA 3QTQA 3ZBXA 2VTAA 4OLIA 2I6LA 2JDSA 2YHVA 5EW3A 3R8VA 2XEZA 4G9CA 3I6WA 4FTOA 5BQ0A 1IG1A 1BI8A 3A7JA 5AP5A 4GJ2A 4MXAA 3OTVA 4IM3A 4F7SA 4BKYA 3ZMMA 4D0WA 3SDJA 3KVXA 3H9RA 1AD5A 5M56A 3EMGA 2OKRA 5IQIA 4LUEA 5AUZA 5HVKA 3E93A 2OZAB 4RWJA 2NPQA 1JKSA 5CTPA 3HRBA 5M4IA 4RQKA 5HI2A 2G1TA 5AP7A 3WZUA 3NZ0A 3WF7A 3C5IA 3QTRA 4KRDA 5E8ZA 5BYZA 4RC2A 5J87A 2CDZA 4CFXA 5HBJA 3ALNA 5ETCA 4Y95A 4BWKA 3DKCA 2PUUA 3A62A 3G9NA 4U3ZA 4HVDA 3ZXTA 2XK4A 2VWVA 3DA6A 4IAIA 4X6QC 4F6UA 1O9UA 3TKIA 4IDTA 4JQ7A 3EWHA 4OGRA 4GK3A 2ITNA 3QWKA 3NGAA 5DHJA 5J79A 4O1PA 3PIXA 3VRZA 2PVHA 3OP5A 3TACA 4E6DA 5IA4A 3CXWA 3BWJA 4CFFA 1UU9A 3C50A 1MUOA 3ZH8A 1OECA 2JIIA 4O0UA 4BHZA 3GQIA 3G0EA 1YW2A 3GCVA 2GQGA 4RJ8A 5B2KA 2Y4IC 3C9WA 4U42A 3VBXA 4OTPA 5EM8A 4EHEA 2I7QA 2BRBA 2G01A 4EHVA 2PVJA 1KOAA 1YOMA 3OY3A 4L52A 4PMTA 3AMYA 4WO5A 3U55A 2BIKB 5KUPA 4H3PA 3KMMA 4WHZA 3TG1A 4IB0A 3QLFA 2HY0A 2ZOQA 2XNOA 3GU7A 5M51A 3PXKA 4KBAA 3HMOA 3CJFA 3UJGA 4J1RA 3G5DA 1GZKA 4AQCA 1JSVA 3DXPA 5K9IA 3E8EA 2VTRA 3IO7A 3JUHA 2W17A 4GG5A 4JVGA 2ITZA 5FM2A 1GZNA 5CX9A 3UGCA 1Q8ZA 2UVXA 4DEEA 5JFSA 2PVYA 2QNJA 4PP9A 3RJCA 1ZY5A 3O0GA 4HVGA 3G51A 1GZ8A 4S31A 4YZ9A 2BUJA 2YDIA 3QQJA 4C0TA 5A6OA 3HDNA 3ALOA 1R1WA 4HGSA 5A14A 4KKGA 5B2MA 4CVAA 5I0BA 5AUUA 5I4NA 5J7HA 1PXPA 2YM5A 4FV1A 2OJ9A 5JT2A 2VTNA 3ZU7A 2C5VA 4F08A 3FZOA 3RK5A 4KKHA 5DOSA 4EOMA 3KA0A 5FXQA 2NP8A 4IC8A 2W1HA 2GNIA 4HYUA 4UYAA 1YWVA 3BE2A 2VU3A 4WNMA 1Q3DA 4L7FA 4X3FA 1U54A 2X39A 3AMBA 3GI3A 4AW2A 4DFNA 2W9ZB 4X3FC 3CGFA 2GFCA 2VGPA 3ORKA 3ZRKA 3MIYA 5AR4A 3CEKA 2FB8A 2RSVA 5CLPA 4AOJA 2WXVA 3CE3A 4UMTA 2QOIA 4ERWA 2F7ZE 2OJJA 4XV3A 2C6EA 2VNWA 3A7HA 2BKKA 1UWHA 5ICPA 1T46A 3OCGA 3KGAA 1UV5A 4FODA 4IZ7A 4GL9A 4R5SA 3U4UA 3W2OA 5IH6A 2CLQA 4U9AA 4D4VA 3BHYA 2FSOX 4TY1A 4YNEA 5K5NA 3C4WA 4UWYA 2Y6MA 3V01A 4IJ9A 4MAOA 3R7VA 3Q6UA 3TIZA 5EQEA 4FUYA 4O84A 3PYYA 4F4PA 3FQSA 3OCBA 4XX9A 4BCHA 3AD5A 3CPBA 4RA4A 3DPKA 3EOCA 4W9WA 3QU0A 5C8MA 4M97A 5E8YA 4MXOA 2G15A 3I7CA 3GU5A 5ACKA 4EI4A 2EXCX 4DA5A 3MYGA 1DI9A 5EI6A 2OWBA 4BIEA 1H1QA 4FV0A 4LOQA 3Q3BA 5CENA 1H4LA 2QI8A 4A9YA 3CGOA 4YJPA 4R3RA 1XH9A 4C4JA 1H1PA 2C6OA 2ITQA 4R5YA 4CXAA 1CKPA 3KF4A 3GFEA 4XEYA 4AT5A 4I20A 4BIBA 3R1NA 2VTQA 5HVYA 3UOLA 3CCNA 4FUXA 4I6HA 3R6XA 4PF4A 2WTCA 4FTTA 4ZEGA 2FSLX 3MY1A 5DMZA 3FLZA 4R8QA 4UX9A 4O0SA 2HCKA 1OPKA 4LRMA 4C38A 3RPVA 3ORZA 5EKOA 3AC5A 2XNNA 5TOZA 3CC6A 5CALA 4O1OA 2XKDA 5KHXA 5GINE 3L9LA 1YWNA 2B7AA 3POOA 4FICA 3FKOA 4KINA 4MBJA 1UKIA 2XYUA 2ZMDA 3EN7A 4ZK5A 4RIOA 5FTQA 3EYHA 3GCUA 3OVVA 4C2VA 5HLWA 1IAJA 2UZEA 4Z7GA 3AC3A 3ZSIA 4AWIA 4B8MA 4W8EA 3SQQA 4CKRA 3OXTA 3DXNA 4C2WA 4G3GA 4NYEA 2E9OA 3FSKA 4K11A 4IX3A 4JI9A 2ITPA 2HZ0A 5IZFA 4RVKA 1O6KA 4EH3A 4PWNA 4C33A 4ZTHA 2YZLA 1M2PA 5AA8A 4IWPA 4W4WA 1Q97A 4IAFA 2ZM3A 3FMJA 3FZTA 2IZSA 4X2KA 2C5NA 4BGQA 1A48A 2Z2WA 3Q4UA 3FZRA 3NIZA 2VTTA 2W4OA 3QA0A 3FLWA 4XOZA 4K0YA 3RPOA 3KQ7A 5CEMA 2W1FA 2OZAA 4ZSJA 3FY0A 2YERA 3GOPA 4DYMA 3LXKA 3DTWA 4JDIA 4YJRA 2JITA 3PP0A 4O82A 2X4ZA 2HW7A 3OEFX 2OZOA 4KBCA 4ZTMA 1XJDA 4XV1A 5EOLA 3U51A 2P2IA 2QOCA 3FJQE 3MA6A 4JX3A 1WCCA 3DV3A 4QQTA 1OKZA 3BCEA 4FBXA 2CGUA 3DBFA 4IQ6A 4F9AA 3GVUA 2OGVA 2FUMA 3GCSA 2QOQA 4PL4A 2XEYA 5J5TA 2C6TA 2WOTA 4RG0A 4UN0C 1A9UA 1PYEA 4CEGA 4GV1A 4FL2A 5D12A 3QQUA 1S9IA 4JDJA 2Z02A 4I6BA 4U43A 1W83A 2NO3A 1DM2A 3MS9A 4YLKA 4BDEA 4E5AX 5BPYA 3PSCA 5D9HA 2XRUA 4PNKA 1W0XC 3FAAA 4JG7A 4FZ7A 4FTLA 3DTCA 5IA1A 3LXNA 2VX3A 4A4XA 3ZO2A 3PDTA 2CCIA 2H6DA 4E7WA 4FIHA 4P2KA 3TKHA 4FK3A 2VTPA 5ANJA 3UG1A 4QMNA 3LKMA 2B9FA 3EFJA 3UMXA 2GTNA 2WQMA 3MPMA 3E62A 3ZTXA 3PA5A 4YJUA 3A2CA 5J95A 5HBEA 2YAAA 5IQHA 5FM3A 3PTGA 5DVRA 1L3RE 3VIDA 5KKRC 3QUPA 5C4LA 2PZPA 5E8WA 4O7LA 1ZXEA 4XLVA 5CF8A 1TQIA 1PKGA 2WMVA 4XG3A 3MTFA 5DBXA 3MBLA 3ITZA 4C36A 5KMJA 1Z5MA 2XS0A 2WKMA 4FZ6A 3M42A 3FMDA 5EDPA 4UZDA 5JRSA 3RALA 4S33A 3TL8A 4LI5A 1ATPE 1AQ1A 2OXYA 3QTXA 3CPCA 5IEYA 2Z7SA 3TXOA 4GU6A 3Q4ZA 3QRTA 5CF6A 4ONAA 5KMKA 2QG5A 5B2LA 4RIXA 2JDOA 2QC6A 2WPAA 4BDCA 3BYSA 4V05A 2QOOA 4A9RA 3JY0A 2GNLA 1XH6A 3D83A 3THBA 2PZRA 1JSUA 3NUXA 2X6EA 5LWNA 2IWIA 3V6SA 1ZLTA 2C30A 1AGWA 4NM3A 2XKEA 4CCUA 2BHHA 2V0DA 3R7EA 3RAKA 2PUPA 4G1WA 5K4IA 3F3WA 2QO7A 4ANOA 2HENA 3PXZA 2OO8X 5AIRA 3BX5A 2KULA 3O7LD 4H39A 5LMBA 4K8AA 4FV6A 5EYDA 3G9LX 5I9VA 4AGWA 2BIYA 4KIQA 2PWLA 2CPKE 5AUWA 4FZAB 2JBPA 1KE5A 3IW8A 3KXXA 3CS9A 3RAWA 4O7NA 1VEBA 1Q8YA 3FKNA 3ANRA 1ERKA 4DFLA 3FEGA 1O6LA 5BMMA 3PG1A 1H1WA 3QHRA 3LAUA 1FINA 4CMUA 5CAVA 4XP0A 4YZMA 4RFYA 4YU2A 4DG2E 3ET7A 4FV8A 5JN2A 3R9NA 3P7CA 4F1OA 4EEVA 3QC9A 4I93A 3DB8A 3LFBA 3LXPA 4BZNA 3MH3A 3VRYA 3BPRA 4PMMA 3RNYA 3RKBA 5CWZA 2WU7A 1XQZA 2X8IA 1IR3A 3QF9A 4C4FA 4PUZA 1H25A 3MGYA 4XG2A 4YC6A 3BHVA 3P23A 2V7OA 4JBQA 3RCJA 1LEWA 4AGCA 1GZOA 1DAYA 5L4QA 3LFAA 4LOPA 5C9CA 2YFXA 4GUEA 4G17A 3LQ5A 3RNIA 3ZO1A 3H9OA 3LPBA 5DRDA 3QZFA 4BDAA 4M67A 2GDOA 3NW6A 4AOIA 3EFWA 2JDRA 4GU9A 4XBRA 3RWQA 2CN5A 2JKMA 5AR5A 5F20A 3PP1A 4CG9A 3LVPA 2R64A 3DKFA 4TWNA 5E8TA 5CSHA 2WQEA 4F7JA 3CSVA 4FIIA 4IEBA 4XCUA 1JWHA 3H0YA 3DLSA 4HOKA 4ASXA 1Q8UA 5B7VA 3R8PA 4LUDA 1JAMA 3QZHA 3LFEA 2NRUA 2W06A 3RHXA 1FMOE 3HZTA 4O21A 5DRBA 3ENMA 4J8MA 3RINA 3DGKA 2C1AA 3UOKA 1PF8A 1UNGA 2C69A 3NUSA 5AP3A 1GY3A 4MQ2A 4YPDA 4RT7A 3VBQA 3QCQA 3TT0A 2PE1A 4QOXA 2YM6A 1R39A 2R3PA 4D2PA 1KOBA 2GU8A 2RFDA 4AG8A 3D5UA 3QQLA 3UZTA 3T9TA 4BCQA 1DAWA 4NUSA 2XIXA 2ZVAA 3L8PA 3U6IA 3BU5A 4FKOA 4ANNA 3Q4CA 1XH7A 2W96B 1PMNA 4S30A 1QPEA 2QOKA 3LMIA 5HNGA 4D5KA 4EK3A 1H07A 4L46A 3PZEA 2Z60A 4LGDA 3F82A 4WNPA 3H3CA 2OU7A 4RIYA 5KZIA 5HO7A 1GIJA 3QCSA 4DT8A 5E91A 3BV2A 5L8JA 4FI1A 4ERKA 3R9OA 4OBOA 4YURA 4CFNA 4O2ZA 3FZSA 4MH7A 5J9YA 3HEGA 4O7TA 3AC1A 5M4UA 4F70A 1UA2A 4QQ5A 4J96A 4Y83A 2PVKA 4UWBA 2UZWE 3GEQA 3F5XA 2GHMA 4TYEA 1PXIA 2OIQA 4YUQA 4IX6A 3ZEPA 1OB3A 2AYPA 3LFQA 4WKQA 1Z57A 2O2UA 3W55A 4HYIA 1W8CA 2IZTA 5JQ8A 4J97A 1TQMA 5FG8A 5EW9A 2CNQA 4LG4A 4RSSA 3I1AA 3BLRA 3FZ1A 2X0GA 1PRYA 3P7AA 3SC1A 4F6WA 5DT0A 2ZB0A 3DZQA 4EWHA 2JIVA 3ANQA 3EN6A 3R8MA 4DGMA 4DFBA 5HE3A 4QYGA 2I0HA 5J1WA 3OCSA 3E7VA 2I0YA 4TXCA 3PXRA 3BZ3A 1B6CB 3KY2A 4QMPA 4RFMA 3UZPA 1SNXA 1OUKA 4NU1A 5CT7A 3ZM4A 4BCPA 5M55A 1IEPA 3ACKA 3HP2A 1IAHA 3UP2A 2W5AA 2ERKA 3NMUF 1CKJA 2XIKA 3C5UA 2JGZA 4I0SA 5I9XA 4FTMA 3BGPA 3S00A 2BALA 4F9CA 3UO5A 4IAYA 4X2GA 5EHOA 3UO6A 2UZOA 4ZTNA 5IPJA 4OAUC 2WEIA 1FQ1B 2F2CB 3V8SA 3E5AA 3TNPC 3Q52A 3BHHA 3H30A 4DH5A 4DLJA 3WOWA 4KUJA 4RJ7A 4RX7A 3VS3A 1ZOGA 1XBCA 4J99A 3OEZA 3W2PA 4ZS4A 4GMYA 4GUBA 4FSQA 2Q0BA 3LCTA 4BL1A 5LVLA 4DGLC 1WBSA 2BAKA 2PE2A 4PRJA 3HKOA 4JDHA 2OH4A 3GXLA 3E3BX 4DFUA 3IDCA 3MH0A 4YBKA 2XBJA 2CGWA 4RX9A 4R6VA 1Z9XA 2HOGA 3UMWA 2WHBA 3WZKA 4TN6A 5BVEA 4AXAA 4ZLZA 3O8PA 3QQKA 2UW7A 3CIKA 3NNUA 3SRVB 3OWKA 3VULA 4D1SA 4MBIA 2R7BA 5LVMA 3OWJA 3ZSGA 2GTMA 5IUGA 2VWYA 4WA9A 4ZS0A 1OPJA 2UVYA 2R3NA 4HGTA 1JPAA 3ORPA 3KMUA 3R7UA 3I0QA 4ZMFA 1GOLA 1JBPE 2XB7A 3C4FA 3NW7A 4WUNA 3F69A 5E4HA 4M12A 5HIDA 3GC7A 3MPTA 2BTRA 1XR1A 2RF9A 4ANBA 3BHTA 1DS5A 4ZMEA 2WIPA 4OT6A 1FGKA 3NUYA 4N4SA 4CFVA 4ZXTA 3F88A 3PFQA 4ACDA 4IM2A 3W8QA 4BIDA 4CFMA 4AN9A 3ETAA 5IEXA 1OGUA 3ERKA 3A8XA 2PMOX 5LCKA 3K54A 5CEQA 3BU3A 3I5NA 4FSRA 4G9RA 4E5WA 5JH6A 1GJOA 3PIYA 1OZ1A 2GNGA 5CNNA 4IANA 2HZIA 2YCQA 3C1XA 2YIWA 4FKPA 2BR1A 4FV9A 4IVDA 4YJOA 3TKUA 3LXLA 2VRXA 4RJ6A 3TV7A 4UY9A 3Q9YA 5J8IA 2GHLA 4IX4A 1DI8A 4YPSA 3F2RA 4BI2A 2F49A 4MXXA 4IM0A 3AQVA 3RCDA 4B7TA 1OI9A 2ITTA 3OW4A 4FT0A 5DR6A 4C61A 4FVPA 4BYIA 4O83A 3O23A 3EFLA 1K2PA 1SVEA 1ZRZA 5IQCA 3TI1A 4EOQA 5GIPE 2BAQA 4WNOA 3UYTA 3H0ZA 4NJDA 1J7LA 4AA0A 1OBGA 3VBWA 4E1ZA 2IVTA 4ZZNA 3FQHA 1OMWA 4FV7A 4FKWA 2C3IB 4WUAA 5LWMA 2E2BA 3VF8A 5AV0A 4GIHA 4FIGA 3L1SA 4RRVA 3TTIA 5C03A 2Z7QA 2VWIA 3HNGA 4MD9E 4UZHA 4BCFA 3G90X 2CN8A 1G8AA 3UNKA 3FI8A 4M84A 4FKUA 1YHVA 1Y6BA 3FUPA 4FGBA 3ZLYA 3NR9A 1S9JA 1RDQE 5DR2A 3OUKA 3LFDA 3TUBA 4G5PA 2JFMA 2OJFE 4II5A 1J1BA 2F57A 4P90A 4APCA 5CVHA 1ZYDA 1KE6A 3FYKX 2JDTA 4O81A 4TWCA 4A9UA 4KWPA 4ZJJA 2QU5A 4ZTRA 4EK6A 4MX9A 2EB3A 3E3PA 3S2PA 2C3JA 2UZUE 2VTLA 4AZSA 5ANKA 4NTTA 4QMLA 2VTIA 2E9VA 1YXSA 2CSNA 4U8ZA 3KXHA 4KIKB 3IGGA 2RIOA 1PMVA 4D2TA 5E8XA 5F94A 4Y5HA 3LFFA 3HV7A 3LZBA 2QCSA 4FNXA 4RVMA 5E1SA 5EM7A 2OK1A 4CNHA 5BMSA 1L8TA 5JFWA 4B99A 3R22A 4H1JA 3CQWA 4L01A 4E4XA 2G2IA 4L45A 1BUHA 1R78A 2ERZE 2YIXA 5CVGA 3BE9A 4AE9A 4KD1A 3EYGA 4Q9ZA 5KMOA 5CEKA 1YKRA 2CKEA 4U5JA 3OBJA 2RFEA 4WT6A 4TPTA 3W2RA 3MB6A 3BWFA 4CG8A 4CGAA 3OZ6A 2A27A 1OL1A 1OVEA 3F7WA 4OTFA 5HG8A 2XNMA 4BKJA 5FUTA 2F9GA 4JOAA 5LQFA 5CQUA 4KKEA 4CFUA 4LFIA 1PXOA 2OIDA 4XH6A 4GSBA 2FSMX 3KRXA 4OUCA 2WQNA 3MV5A 4GFOA 4BZOA 5L8KA 3UZRA 5F9EA 2P3GX 5KBQA 2IW9A 5HX8A 1UU8A 2XNEA 3O51A 5GJFA 4DTKA 4D58A 3DK3A 3D7TB 2WNTA 3HDMA 4NM7A 1J1CA 4K18A 1KUTA 3R0TA 4BBFA 3QZIA 3POZA 4FNZA 4YTFA 5HG5A 3P7BA 4G6LA 4LV8A 4LL5A 5M57A 4W4XA 1OL6A 2QR7A 5CXHA 3KXZA 3W10A 3CLYA 5GZAA 4HCVA 4PDSA 4W4VA 2C0TA 2OF4A 4FEUA 2HWOA 5J1VA 2XJ2A 3PG3A 3QQFA 5E9EA 5HNBA 3DKGA 1PYXA 2BDWA 2BRGA 3JS2A 3PVGA 1V0OA 1YDTE 3QLGA 3ZBFA 3AOXA 4DG0E 1E9HA 3EN4A 4EK5A 3S95A 4CFWA 1ZY4A 4R7HA 4M13A 5C4KA 3VBVA 1WVXA 3A4PA 4I5CA 3QAME 2RG6A 3MDYA 3QQHA 4I5PA 3W18A 4XG8A 3SRVA 5TO8A 2W7XA 1R3CA 1Q3WA 2WMWA 3PWDA 2O5KA 3COIA 4MKCA 3RHKA 3ZDIA 2VN9A 3OF0A 5AEPA 3ORMA 2IPXA 4FNYA 5A4QA 3TIYA 3LIJA 1M52A 4DFXE 4D55A 4GYIA 3IECA 4YC3A 4ASDA 4YO6A 4S34A 1JVPP 5EYMA 4Y73A 4MD7E 4DH3A 4O2PA 3KRLA 5BVDA 4O0WA 4V04A 4D1XA 2WELA 2IW8A 1B39A 3VW6A 4EUTA 3MSSA 5C8KA 4F9YA 3NDMA 4BGHA 3VUHA 2P33A 3NAYA 4Q9SA 1PJKA 3GBZA 2BRHA 5JGDA 2J51A 3A60A 4ZSEA 3KCFA 4RMZA 2W1GA 4RWLA 3KF7A 3PRIA 4WRSA 3MB7A 3ZCLA 3LLAA 1UU7A 2OSCA 4MEDA 4NW5A 1YDRE 4OTDA 5I9WA 4KS8A 4C8BA 2ZDTA 5IKWA 4FK6A 1XH8A 4MNEA 1JOWB 5I9YA 1YHWA 4FT3A 4M0ZA 2BHEA 3IDPA 5KZ0A 3EKKA 2YLFA 1MP8A 4IZ5A 3TZ8A 2C6MA 5E90A 5HD4A 1K9AA 5AX9A 5GIOE 5A9UA 4BTFA 4MK0A 4O7YA 3K2LA 3NUUA 4DBXA 2GFSA 4EH5A 4IX5A 4IAKA 3TNIA 1OKVA 2YCRA 2C0OA 2I40A 3Q60A 3PXFA 3VS2A 5CSXA 1OITA 3O7LB 1U4DA 3ZO3A 5CU6A 1LR4A 3JYAA 5D7VA 5HLPA 4PL3A 2YITA 3FBVA 5AM7A 4G16A 1UWJA 3SHEA 2JDVA 2J2IB 5IA0A 2B52A 4O0TA 5IG1A 3FYJX 5B0XA 5CU4A 4BRXA 3PLAE 4IH8A 1FVVA 4PDOA 4CTCA 3OFMA 4ENXA 4YO4A 1XWSA 4EQUA 2CGXA 2R2PA 4L3LA 3D15A 1WZYA 1WBNA 1UVRA 3LMHA 3QCYA 4QMMA 2HWPA 3CY2A 5BYLA 4DG3E 5CVFA 2QOFA 1JNKA 5HU3A 3O96A 3ZM9A 2BCJA 1ZMVA 4UYNA 3ZO4A 3UQFA 3EL7A 3OS3A 2PZYA 4FYNA 4GVAA 3DBQA 5ITAA 2ZV9A 1UNLA 4LGHA 4FEWA 3MH2A 1ZOEA 4RA5A 4YJSA 4O27B 2GQRA 1JKTA 1STCE 3GB2A 1QPCA 4NFMA 4IDVA 4WD5A 3MPAA 4JBVA 4BHNA 4FIEA 3PIZA 4R7IA 4P7EA 2WB8A 3RZBA 5KNJA 3LW0A 4N57A 4FSWA 5ETAA 1OL7A 4G6NA 4C7TA 3VJNA 4PPCA 1F3MC 2O3PA 3V51A 3GU4A 2Q83A 2BILB 4XP3A 4H1MA 5KE0A 5ETIA 3NNXA 4EHZA 5EDRA 3FLYA 4QTEA 4ITJA 4WSYA 3G6HA 4JDKA 3A7IA 4BI1A 2B53A 3K3JA 2GS2A 3HRCA 3Q9ZA 4FMQA 3ZLSA 4O7WA 3VQUA 3QL8A 2WAJA 3Q6WA 2UW6A 5H3QA 1ZAOA 2OF2A 3ZUUA 2WMQA 3FDNA 4F6SA 3I5ZA 4JQEA 3G6GA 1T45A 4AUAA 3FXXA 3DAJA 2X8EA 3FQEA 4BC6A 5EW8A 3DY7A 5ANIA 2C5YA 4GJ3A 4LRKA 5AIKA 5LXMA 5C1QB 2V62A 3FI2A 3OW3A 3ZLWA 4BWXA 1PXNA 4Q5EA 2X2KA 4S32A 4R77A 4D28A 1OKYA 4FX3A 1QMZA 3BQCA 4LRJA 5I9ZA 5LMKA 4AN2A 4G3CA 5HIEA 5LMKC 4AE6A 3ROCA 5DNRA 4IIRA 1REKA 4OBQA 4BBEA 3K5UA 4D4SA 4RWIA 2CLXA 2C47A 2R9SA 3H9FA 3QD4A 1CM8A 5T6KA 1P14A 4U7ZA 3V5LA 4D1ZA 2CHLA 3CTHA 2YAKA 4F0GA 1LPUA 2R0IA 1H00A 2VWZA 3A8WA 2R3HA 4I41A 3MA3A 4L67A 5AJQA 2C1BA 2YWPA 5ANOA 5IDPA 2YCSA 3BU6A 1Y8YA 4C02A 4PMSA 4NT4A 4APPA 5K4JA 3HV3A 4R7BA 4MQ1A 2OI4X 4FT7A 3KKVA 4UEUA 3MFTA 3FMEA 3WF9A 2RKUA 4J52A 3LQ3A 3Q2JA 4R1YA 3ULZA 3TUDA 2XH5A 2ZYBA 4O96A 4L9IA 2J6MA 3ZFMA 2V55A 4XG6A 3VF9A 3CD3A 1OL5A 1YOLA 2Z8CA 2PTKA 4U79A 3HRFA 4U97A 4BZDA 3VHKA 4CRSA 4D4YA 3VS0A 3BEAA 3NYXA 4U41A 1KSWA 2V7AA 5FRIA 3JVRA 3S0OA 4QMZA 1SYKA 2R7IA 2YJSA 5DE2A 3VN9A 1OPLA 4G6OA 3GFWA 3ODYX 3D5VA 3ACJA 2UZVA 3SAYA 5LVNA 3IW5A 5E8VA 2ZV8A 3TZ7A 3AT2A 3PY3A 4FYOA 3QYWA 3C4EA 3R2BA 4MNFA 4DN5A 3LCOA 4CCBA 4USFA 5L2QA 5L3AA 2VZ6A 3PPKA 4EYJA 1IA8A 2HAKA 4DGOA 2QG7A 3V8WA 1URCA 3SOAA 3RM7A 1I09A 3FI3A 5AV3A 2JLDA 4Z3VA 2ITUA 2GS6A 4EJ7A 4DHFA 4ZTLA 4EOIA 3UQGA 3QBNA 3LLTA 4J7BA 4ALVA 5HCYA 1YXVA 4EUUA 2NRYA 3QKMA 1NW1A 5AM6A 3TZ9A 3D5XA 4BB4A 1W7HA 5JFVA 2X7OA 2W1CA 2WTWA 5IUIA 1Y91A 3LJ1A 3BBWA 4QYFA 3UC4A 4FKQA 3MN3A 2GHGA 4MTAA 5CY3A 1BMKA 4QYHA 3NWWA 4A9SA 1NVSA 5JSMA 2J0KA 1ZOHA 4HJOA 4E8AA 1Y8GA 2YM8A 1J7IA 3UVRA 4D5HA 1OBDA 4QPSA 3K3IA 4DEAA 2UW0A 4BCIA 4X0MA 2P2HA 2XRWA 4DEDA 4F9WA 5L2WA 2ETMA 2VWXA 3RWPA 4WNKA 4G3EA 3R01A 5TR6A 4AU8A 4F7NA 3MVMA 2WMSA 4V0GB 1FVRA 3I6UA 4FSUA 4NL0A 2QOHA 3C4CA 3LFSA 4H58A 3TWJA 3VBTA 3W2CA 4Y5QA 3JY9A 2FH9A 3LFNA 5EDQA 4CQEA 4ZLOA 4FTAA 5H8GA 3R04A 2XNPA 2CJMA 1V1KA 2WOUA 4JAJA 5ANDA 5FGKA 3ORNA 4YTCA 3MJ2A 4MWIA 4I1ZA 4M69B 3ATSA 3TTJA 2R3OA 3VBYA 2CKPA 4HNIA 3C0IA 1BKXA 1WAKA 3PWYA 3FI4A 3R30A 2GS7A 3MW1A 4FTCA 4I94A 4JS8A 4QQCA 4UMQA 5D7AA 3Q9XA 5K0XA 4E93A 2W9FB 3PA3A 4JRVA 3ZZWA 2YZAA 3CR0A 3K5VA 3KREA 4DEIA 4XMOA 4PMPA 3GCQA 3ROYA 4JLCA 4L8MA 1WBOA 5AP0A 3RVGA 3ORTA 5HD7A 1SZMA 3U54A 3SG9A 4GFMA 1U5RA 3KN6A 4OTRA 4ZTSA 3PRFA 1WBVA 1E1VA 2PL0A 4OTQA 5G1XA 2RGPA 3W1FA 4C4GA 1YXUA 4QP2A 4BCMA 4G31A 2XBAA 1OIUA 3OUNB 4FE2A 4EKKA 1G5SA 1J91A 5IH4A 2OICA 5CEIA 1WFCA 2IZUA 1MRYA 2B54A 4FV4A 4D9TA 2IW6A 2JAVA 4ID7A 4AACA 5JGBA 3WILA 5FTOA 5CSVA 2R3KA 4BVUA 3F7ZA 5HLNA 4ORKA 3F5GA 4XP2A 3O8UA 3MY0A 4M14A 3QALE 2PZIA 4Z16A 2R3FA 3OY1A 4QQJA 3F61A 4NJ3A 4U45A 5CF5A 5A4CA 3FC1X 2AC3A 3V6RA 1NA7A 4BCNA 3TM0A 4RJ4A 4EH7A 3R02A 3H10A 5AUYA 3V5WA 3RPYA 4QTCA 4ANSA 2J0IA 4YTHA 2PMIA 5CSWA 3BGZA 4I24A 4Q5HA 3WBLA 5AP4A 2IZRA 4QMYA 1PXJA 5FXRA 2J5EA 4PQNA 1V0PA 4JRNA 5DEWA 3ZUTA 5AX3A 5IQGA 3T3UA 4NTSA 5CT0A 2WQOA 4F9BA 5LVOA 3QRKA 5D41A 3RTPA 2PULA 2F4JA 1YRPA 4GT5A 5KO1A 3VC4A 3UIUA 3ZSHA 3R1YA 5A4LA 3TDWA 3M1SA 4XS2A 3AGLA 3L9PA 1ZYSA 3ORLA 2BZIB 3IDBA 4EOSA 4CV8A 2X6DA 3QXPA 4UB7A 5DPVA 2DWBA 3UBDA 4E4LA 2J0MB 5BVKA 5EQYA 5HOAA 2E9NA 2WMXA 1APME 1P4OA 3LCSA 3QGWA 4ZSAA 5JZNA 4FOBA 3KULB 3ZHPC 1ZZ2A 5A3XA 2H96A 2YACA 3PSDA 4LQMA 3O71A 4IADA 1YDSE 5HEZA 3QRUA 1TQPA 2A4LA 2YM7A 4XOYA 4DF3A 3P78A 4YZDA 2ONLA 5M4FA 3F3UA 2ONLC 4PTCA 2W0JA 4F7LA 4FKIA 4HGEA 3HGKA 3DJ5A 3AC8A 2IVUA 3FL5A 4EBWA 3E63A 2G2FA 4E4NA 4F1TA 3NVMB 3TUCA 2R4BA 2YABA 3SGCA 2Z7RA 1Q8TA 4FTKA 4WG4A 4R78A 2BFYA 3DNDA 2HY81 5GHVA 5AUTA 2C3LA 4NSTA 3E87A 3F9NA 3VUKA 5K0KA 4U3YA 4EH6A 5K5XA 1OKWA 2C0IA 2J90A 4E6CA 2JKKA 3DQWA 3QUEA 4AZWA 1A06A 1SNUA 2QONA 1RE8A 2GNHA 1H27A 4KABA 4PPBA 4AGDA 3R8LA 2JKOA 4QMSA 3KK8A 3R9HA 1VYWA 4G2FA 3ELJA 5BUJA 2PU8A 4OR5A 1TKIA 3REPA 2XCKA 3DKOA 1JKLA 4Y46A 3FPQA
chains in the Genus database with same CATH superfamily
4OTWA 3KRJA 4I92A 2X7FA 4FR4A 4EQMA 4IAAA 2NNWB 4CTBA 4BI0A 2XYNA 4D2RA 2BZKB 1WVWA 3EB0A 5AA9A 3Q04A 4FVQA 5IA5A 1Y6AA 5CAOA 5I5ZA 3NUAA 3CQUA 3OOMA 4N0SA 5K3YA 4CQGA 3V04A 4BDDA 2VTHA 5DR9A 5J9ZA 4FF8A 2X7GA 4ALWA 5A6NA 4ZY5A 4DCAA 2YEXA 5ANEA 1WBWA 1VR2A 1QPJA 1OIQA 2A2AA 2IO6A 2VWWA 4CZTA 1P4FA 4TTHB 2J0LA 3DNEA 2FGIA 4AN3A 5EHYA 3TCPA 4QYYA 2UVZA 2XA4A 5EI8A 3FXZA 4ARKA 1P5EA 3JXWA 2PK9A 4MXCA 4CYIA 3QCXA 3I81A 4DFYA 2AC5A 3WYYA 2XVDA 5I3RA 4V0GA 2UZLA 4FTUA 4EZ5A 5AFVA 4DTBA 3PVUA 4YLJA 3R00A 1M2RA 4L44A 3HVCA 2YIYA 3DLZA 4AZFA 1Q99A 5FQDC 3U9CA 3T8OA 2WIHA 3D2IA 3QD2B 3DU8A 2IN6A 4J53A 4ZTQA 3PJCA 4CZYB 4WG5A 2XP2A 1YVJA 2VO0A 2VTMA 3UE4A 4GG7A 3HYHA 5JK3A 3GC8A 1OIRA 4M69A 4K2RA 4RJ3A 4QMQA 3QGYA 2B1PA 4U80A 2JEDA 3P79A 3V5JA 4A4OA 2QHNA 1ST0A 3OHTA 2BTSA 4QPMA 1HCKA 3HL7A 5IA3A 2R3MA 4EZ3A 4KAOA 3UVQA 3OC1A 3WF5A 2XZSA 3F3ZA 3R9RA 2V22A 3SXSA 3HAMA 2RG5A 3D0EA 2DQ7X 3DS6A 3M11A 4H3BA 4QTDA 5F95A 4BR3A 4XJ0A 5C01A 4ASEA 1K3AA 2QU6A 4CLIA 2H34A 3UOHA 3UTOA 4ZSGA 1BL7A 1Q62A 4O22A 4XHKB 5CU3A 2YISA 3RBWA 3V3VA 4ACCA 3F2NA 3ZXZA 2J0JA 3FLQA 4O7ZA 4QP3A 4E5BA 4AAYA 3ZONA 3LQ8A 4AGUA 3OXIA 2OW3A 5HQ0A 4DFZE 2A19B 3RK7A 2R5TA 3IK3A 4IE9A 3N4VA 3A7FA 2WU6A 2X4FA 4FZDB 4IC7A 4ANQA 3F66A 2X0OA 2O64A 4LMNA 4UWCA 5CAPA 3BIZA 1XKKA 3WZJA 3HUCA 5FEQA 3OCTA 1MRUA 4L3PA 4RLLA 4KA3A 3HUBA 3E7OA 5FTGA 3FMLA 4C57A 5DG5A 2Y4IB 3TNWA 4DITA 5FDPA 4F99A 3SG8A 3NX8A 4O38A 5DYJA 2GNJA 2F7XE 5L2TA 2EVAA 2W5BA 3KRRA 4O7VA 5EHLA 2PVMA 4DHZA 3BYOA 1U5QA 2QLUA 5IMXA 3QKKA 5EOBA 4XNEA 4GKIA 2UZDA 2KTYA 4IZYA 2YA9A 3OROA 3GQLA 1XH4A 4BBMA 3ENHA 5F1ZA 5AAEA 2Y7JA 4JT3A 2QOBA 3QC4A 3EQPA 3QA8A 1WBPA 4FKTA 3CTQA 5FBNC 5HGIA 4PX6A 2EUFB 4M68A 1WVYA 4TYHB 1ND4A 3NAXA 3NYOA 1YXTA 5ETFA 3ZUVA 4QRCA 2J5FA 4YTIA 3SVVA 1YI4A 4J95A 5LVPA 4YLLA 2AUHA 2VO7A 4IB5A 2X1NA 3DB6A 4CD0A 1YOJA 4ZAUA 2YLEA 3ZFXA 1GIHA 1JSTA 4D4RA 1Q41A 4K1BA 5CYIA 4HZRA 3O50A 3UNJA 2YIQA 4BY9E 4QPAA 4LYNA 4TT7A 3DFAA 4CSVA 4A4LA 4EYMA 3A61A 4DH8A 1W2CA 4FEXA 4BJJA 3DT1A 3E8DA 4X3FB 3SW4A 1U54B 3FKLA 4JBPA 4NIFB 4L53A 3OBGA 2ZDUA 3MY5A 3GU8A 3ZZEA 1CSNA 3RMFA 5IEVA 3LMGA 1SM2A 5M09A 3D2KA 3L8XA 4FC0A 2WMRA 4QP4A 4IW0A 3E88A 4JR7A 2H8HA 4FKLA 4OTIA 4C4HA 1J7UA 5IQDA 4MF1A 3COHA 3QTZA 4CT1A 5H8EA 3FY2A 3R83A 4DH1A 5HCZA 4FT5A 5JMSA 1HOWA 4DLIA 5FDXA 3ATTA 3GU6A 4NWMA 1FVTA 3DK7A 4LL0A 3F3TA 2CKOA 3AC2A 4BKZA 4RX8A 3FXWA 4XG9A 3R8UA 4QT1A 2VD5A 3GT8A 2XK7A 2A0CX 3EHAA 3PJ8A 3UIBA 5IF1A 3UPZA 3KCKA 2SRCA 3B8RA 3EIDA 3CKXA 2HZNA 4PPAA 3W0NA 3HMMA 5D11A 2PZ5A 5M44A 4IVAA 2XKFA 4LOOA 5HORA 2C4GA 2BKZA 4I0TA 3P0MA 4EWQA 2R3IA 4M7IA 5KHWA 4IFCA 3UIMA 1IA9A 3OD6X 1XBAA 1QL6A 2X2LA 3LJ2A 3NSZA 4YMJA 1RW8A 4XG4A 5L6WL 4QP8A 5LARA 3F5UA 3IG7A 4I6FA 5E1EA 1H8FA 4RZWA 4V01A 3GNIB 4PDPA 4C3FA 4ZLYA 4UMPA 1Q4LA 1R0EA 3WARA 4HVSA 4PL5A 3LHJA 2WTDA 1J3HA 1FOTA 4J71A 2YDJA 4L7SA 3ZC5A 5CAQA 2PHKA 4DE4A 4AP7A 4N6ZA 3BYVA 3NYVA 5CZHA 3PE1A 3LM0A 4FRFA 5F4NA 4AF3A 3W0MA 3PPZA 3ODZX 3D7ZA 3SA0A 1Q8WA 1F0QA 4QMVA 4C34A 3NRMA 3KL8A 5EI2A 2VO6A 5AAGA 1H0WA 3IQ7A 4FTRA 5ACBC 1H0VA 3QTUA 2VWBA 4LGGA 3TJCA 4C4EA 5KMLA 3VUIA 2LAVA 2OIBA 1KE7A 4FKGA 3T9IA 4H36A 4C58A 3WYXA 1EH4A 4YC8A 3U87A 4GRBA 3TZMA 4DEHA 4B6LA 3QQGA 3QZGA 3DZOA 4DGNA 2B4SB 4IAZA 5HIBA 4BDFA 1VLRA 2V5QA 3QUDA 5EYCA 4FSYA 4EKLA 4DEGA 4UXLA 1YQJA 1YWRA 2E9UA 2RFSA 4QP7A 5L8LA 4Z55A 3CKWA 2ETRA 3VS1A 4HCTA 4QTAA 4CMTA 3FPMA 3KK9A 3EQCA 3FHIA 2OH0E 4P4CA 2W1IA 2VTSA 4RIWB 4O6EA 4ANLA 3U9NA 2PVLA 4FA2A 4TYJA 3L9MA 2CMWA 4GKHA 1CMKE 1MRVA 4KSQA 4O0RA 1ZMWA 4HPTE 5AADA 1KV1A 1M7QA 4ZSLA 2XAOA 3V5TA 3TDVA 4D2VA 5A46A 1VYZA 4EORA 5BX0A 3BKBA 3TNHA 4WSQA 4JXFA 5IMEA 2OXDA 2W1DA 1LEZA 4FTJA 4HPUE 4BN1A 1ZYJA 5A4TA 5AUVA 2UZTA 2JFLA 2ZM4A 4R1VA 4EONA 3OT8A 2C5XA 3UP7A 4GK4A 3D4QA 3Q4TA 4L6QA 2UW9A 1ZARA 2DS1A 2IVSA 3N51A 1U59A 4YZCA 4YSMA 5JQ5A 3DBEA 3WI6A 4GK2A 3FMNA 3D9VA 4IXPA 2W1ZA 1PMEA 3BYUA 3T3VA 3WE8A 1G8SA 4B8LA 4I4EA 1YXXA 4OBPA 4U6RA 3TEIA 5BVOA 4YZBA 2ZV2A 3NUPA 4GH2A 3ZFYA 4DINA 2JD5A 2FO0A 1H26A 4RLKA 4HVIA 3MVJA 5BUIA 4USEA 2FYSA 5DA3A 4WG3A 4O4EA 3VS5A 4KIOA 2XMYA 3D94A 3VUDA 3B8QA 4BCJA 5KKRB 4EBVA 4FZFB 5HTBA 4KNBA 2C6LA 2HK5A 2J9MA 3RZFA 4TYHA 2BRMA 4IVCA 1QCFA 2P0CA 3IOPA 3O2MA 3V5PA 2DUVA 4YJVA 3F5PA 1H1RA 1OIYA 3BHUA 4FV3A 2ZM1A 5DT4A 4AOTA 4FTNA 5EM5A 2WO6A 2OBJA 3OWLA 1RJBA 2WMBA 5CNOA 4RX5A 4TYGA 1LP4A 2EXMA 4HNFA 3WZDA 4FEVA 3D14A 2NYAA 4F65A 3BYMA 2VTJA 2UW5A 2O0UA 2PMNX 4JQ8A 1ZWSA 4RBLA 3RPRA 2UW4A 4P5QA 5AR2A 1ZYCA 4RIXB 3BRBA 3V8TA 5IU2A 4ZJIA 4IMYA 2XANA 2X9EA 2XNBA 3QD0A 4NIFA 4QP6A 4UMRA 4YP8A 3W33A 3TJDA 4I6LA 3OT3A 4NM5A 4FKSA 4FL3A 5AP6A 5TE0A 2PUNA 2C68A 2VX0A 4QP1A 2YCFA 3AG9A 2YN8A 4KIKA 4A9TA 5KBRA 3UDTA 3GC9A 4D2SA 4U0IA 4AZVA 2O63A 4AZTA 3EQHA 2IEWA 3LCKA 1ZYLA 3GCPA 5EYKA 5CU0A 3UOJA 2QO9A 4JNWA 4AW1A 4A06A 4L3JA 4LMUA 2CNVA 3I4BA 2PPQA 4CKJA 1PXMA 3W16A 1BX6A 5DH3A 4PP7A 4UXQA 4J98A 4FG7A 4NEUA 3Q5IA 1FBNA 1BI7A 1CDKA 4GEOA 5LJJA 2R3RA 3HA6A 2QLQA 3PE2A 5E8SA 1JLUE 3AGMA 2Y0AA 3MIAA 2ITWA 3HV5A 3UPXA 3PXQA 1ZMUA 3EQIA 4YHFA 5KMIA 5KX8A 5EK7A 3DJ6A 2RFNA 3SV0A 4JAIA 3MJ1A 3PY0A 4PY1A 3NEWA 2PUIA 3II5A 2UW3A 3R63A 2JIUA 4JJRA 4TWOA 2QD9A 3R28A 3W0RA 2EB2A 5AR3A 1U46A 3RK9A 3EL8A 4TRLA 3EJ1A 3D7TA 3BI6A 3WIKA 2Y4PA 2I0VA 3DK6A 3EN5A 4GT4A 3O17A 4KIPA 4NH1A 3VUMA 4WBBB 4NFNA 1Q5KA 2GMXA 3HA8A 4AW0A 3G2FA 2P55A 1FGIA 2XK3A 4GVJA 4IB3A 4ZIMA 4BICA 4O0XA 3CD8A 2YM4A 1PXLA 3OXZA 4I21A 4IBMA 4ANMA 4HYHA 3MI9A 1M2QA 2PE0A 4FTQA 1XBBA 2VGOA 5AV2A 4K9YA 4BCKA 4RZVA 4ZOGA 4BCGA 2YIRA 4XYFA 4U40A 3WF8A 1REJA 5CZIA 4BTJA 4NM0A 1CTPE 4UMUA 5FXSA 3UVPA 3KRWA 4L42A 2XNGA 3U6HA 2C6KA 3HLLA 1SVHA 2XM8A 1R0PA 3QX2A 1YHSA 2JAMA 4I4FA 3PA4A 3MFRA 4NKAA 5DI1A 3UIXA 1PHKA 4PNIA 4RIWA 2XUUA 3HMNA 4EC8A 2FA2A 4Z7HA 5E92A 4DTAA 4RVLA 3Q2MA 1B38A 4EH9A 1OL2A 1WBTA 3MVHA 4DC2A 1SVGA 2UV2A 3PZHA 4R3PA 4BTKA 4OTGA 2I0EA 2EWAA 2W4KA 2ZJWA 4FG9A 4YNOA 5HESA 3EN9A 3UODA 4E4MA 3DDPA 3OG7A 4FKVA 1VJYA 5IDNA 3FE3A 3UO4A 1JQHA 3L8SA 4RIYB 5J5SA 4QD6A 5A54A 3ZYAA 1H28A 3W32A 4AZEA 4IVBA 4WBOA 3QX4A 4TKSA 3AXWA 3MFSA 2BPMA 2GQSA 5HICA 1PW2A 3Q53A 5CS6A 2XF0A 4AW5A 3C7QA 2Z7LA 3VAPA 5AWMA 2O65A 3ZRMA 3BLQA 4IACA 2XIZA 3NVKI 3ORIA 3NNWA 3RPSA 2R3LA 4GFGA 4XUFA 1WMKA 3GENA 3QTSA 4YHJA 3P9JA 3DDQA 2XIRA 2WMUA 5CSPA 4DEBA 2GSFA 3GUBA 3MWUA 4ACGA 1H01A 2W1EA 3IW7A 3L9NA 2J4ZA 3R7IA 4CLJA 4C3PA 1OGYA 4FSMA 2QKWB 4FSTA 5T68A 3P1AA 2UW8A 2WQBA 3AD6A 4I3ZA 4MD8E 4TWPA 3SX9A 4YR8A 1FPUA 1TVOA 2BROA 5DEYA 1VZOA 1H24A 3IONA 3NUNA 5HKMA 4GW8A 3QHWA 3IKAA 4EOKA 4RQVA 3R2YA 5CQWA 3EQBA 1YI6A 5D1JA 4O86A 2W99B 3FLNC 3I7BA 2BFXA 3A99A 3FL4A 2QVSE 4QP9A 4XBUA 5DGZA 4IJPA 3S4QA 4GYGA 3CQEA 4FL1A 4JX7A 4TW9A 5I3OA 4BGGA 4IWDA 4AFEA 1X8BA 5M06A 3ZEWA 1IRKA 3O8TA 4FTIA 4B9DA 5CANA 5KMNA 3C4ZA 4QMTA 4W4YA 2ESMA 2I1MA 4MF0A 3VO3A 4DDGA 1HCLA 2HELA 5FP6A 1W82A 3VUTA 5CXZA 2X9FA 4X6RA 4FSZA 2BMCA 3I79A 2Y9QA 2QURA 4CRLA 2G9XA 1G8JA 1M17A 4FIJA 3VS6A 4USDA 4EJNA 4F0FA 4TNDA 4FG8A 3M2WA 1KV2A 4I6QA 4TL0A 3ULIA 1Q24A 4ZJVA 4W9XA 3UDZA 2ETKA 4GS6A 3JR1A 1F5QA 3C0HA 4NCTA 4EZ7A 3I0OA 4B4LA 4NCTC 3LM5A 1GNGA 2J50A 4LV5A 2REIA 2ITXA 2VTOA 1GAGA 2QHMA 3P4KA 5HG9A 3DOGA 4CMOA 3IPHA 4N70A 3R73A 4Z9LA 2XCHA 3FMHA 4QMOA 4MCVA 4XRLA 3SXFA 4X2JA 1IASA 5HU9A 3Q96A 4OTHA 5L2SA 4PV0A 4X21A 2OXXA 3OWPA 4PDYA 2VAGA 2WTKB 4GCJA 2HXLA 3ZOSA 3QKLA 3RAHA 3SD0A 3KVWA 5HHWA 4M66A 3C4XA 3LFCA 2RL5A 2HIWA 3COMA 2XIYA 5EKNA 2EXEA 5M08A 2OJIA 2XJ1A 2C3KA 3W0PA 4BDKA 4QMXA 4AS0A 3LOKA 5GZ9A 4B0GA 4ACHA 4K6ZA 5CASA 3H4JA 2PY3A 4QNYA 3NS9A 4H05A 1Y57A 4KSPA 5FEDA 4O0YA 5FP5A 4E20A 4YBJA 4EK8A 3KEXA 4EL9A 1YI3A 2W05A 4JIKA 3IW4A 2J7TA 4DH7A 3NYNA 3KXMA 3ZDUA 2VO3A 2WTJA 4S2ZA 2PVRA 2C5OA 2ZV7A 3DCVA 4C3RA 5TT7A 4EH8A 5JRQA 3UNZA 5BVNA 3VS7A 4K33A 4UALA 2BDFA 3LJ0A 2GNFA 2X2MA 4FSNA 2VNYA 4LM5A 3WF6A 5IQAA 3AT3A 3KXGA 1E1XA 2YJRA 1Q61A 3FHRA 3PJ1A 3P08A 3MESA 4BDJA 4X7QA 3BEGA 1SMHA 3HV6A 3OOGA 3G15A 3B2WA 4K77A 4CYJA 4ZY4A 4FV5A 4HZSA 4FIFA 4BDIA 3PJ2A 4BYJA 5EQPA 5J9LA 1H1SA 4J8NA 3C0GA 5EG3A 4XG7A 5TKDA 2CKQA 4L00A 4AQKA 4EQCA 5CAUA 2ZB1A 4FGRA 4JG6A 3HECA 3F3VA 3Q32A 3HX4A 3U8WA 4RFZA 3AMAA 3G0FA 4KRCA 3V5QA 3DAKA 4H3QA 5JEBA 5CI7A 5L6PA 5I9UA 3IGOA 2YWVA 2F2UA 3EQGA 3VNTA 5HZNA 5M4CA 5IH5A 5IQBA 3VHEA 3HP5A 3NNVA 2JC6A 2PYWA 1P2AA 3PPJA 4HGLA 3GP0A 4BWPA 3AT4A 2IVVA 4O6LA 3N4UA 5HTCA 5C26A 3VUGA 3UDSA 2CGVA 4BCOA 3KB7A 4E73A 4KB8A 4RJ5A 3R21A 2BAJA 4JG8A 5ANGA 4X2FA 5HO6A 3R8ZA 4DT9A 2HZ4A 5CF4A 4U81A 3P5KA 2WZJA 4YJQA 4OAVB 3CBLA 3HMPA 3DXQA 3U6JA 1I44A 4NKSA 4WRGA 4EOPA 4MXYA 1BLXA 1ZZLA 4NW6A 2WMTA 3R1QA 2R0UA 3CY3A 3EKNA 4EOJA 4F1MA 5AMNA 4MWHA 4CZUA 5AV1A 4QYEA 3SXRA 2PVFA 3MH1A 3VS4A 4I5MA 3VW8A 3NPCA 4EH2A 3EFKA 2Y8OA 1W2DA 3NIEA 2VX1A 3BELA 4QMUA 2OJGA 4YHTA 3JVSA 4FEQA 4IHPA 5FLFA 3RI1A 4HYSA 5L6OA 5LCJA 2WTVA 4FOCA 5AV4A 4C4IA 4O0VA 2C6IA 4JIAA 3Q5ZA 4DCEA 3R1SA 4FKJA 4MBLA 3RP9A 5A4EA 3A7GA 4YJNA 3DFCB 5IQEA 3WIGA 5BV3A 3FWQA 3VWAA 3GOKA 1LUFA 3E8CA 5G6VA 4C37A 4L43A 3FMMA 3MVLA 4ITHA 2Q0NA 3EH9A 3QYZA 1KWPA 3KC3A 4M3QA 4E6AA 3C51A 5AP2A 4BFMA 1UU3A 4O7SA 3DQXA 3TN8A 1OUYA 5GJGA 3QD3A 4CV9A 4E3CA 5JGAA 4C62A 5HO8A 3QWJA 3PUPA 3EQDA 3CJGA 2F7EE 5DT3A 4OT5A 5E7RA 2ITOA 1CKIA 3WE4A 4XV2A 3LCDA 4HCUA 4R3CA 3QFVA 5M07A 3UG2A 3QXOA 3KN5A 4BF2A 3ORXA 3Q9WA 2B55A 3PLSA 5HG7A 4AA4A 4F63A 2ZMCA 4Y72A 5C27A 3UYSA 3BV3A 3W8LA 3P86A 2OFVA 4AAAA 1M14A 1UKHA 3AC4A 5HNIX 3PY1A 2CCHA 4M8TA 4XV9A 4ASZA 5LOHA 3ID6C 3JPVA 5E8UA 2R3QA 4G34A 5D10A 5BUEA 1M7NA 4C35A 4F64A 4NZWB 3C13A 4EOOA 3FSFA 5BYYA 3DAEA 2BRNA 2GCDA 2H9VA 3BBTB 3D5WA 3N9XA 3UQCA 3HMIA 2IJMA 5HE1A 2XK8A 2E9PA 3NW5A 4RPVA 2IG7A 3SLSA 5DFPA 2QR8A 5IISA 5AP1A 3RM6A 4X2NA 2QQ7A 5AUXA 5KCVA 1O6YA 5DWRA 3KXNA 4AT3A 3KU2A 4G3DA 4DGGA 2QODA 4YGAA 5EH0A 2QO2A 4O7RA 1H08A 4PTEA 2B9JA 2Y6OA 4F0IA 3EZRA 2FVDA 4EC9A 4AFJA 3KFAA 1URWA 4ITIA 4KBKA 2XARA 3HAVA 2WTKC 2R3GA 4ZZMA 2HW6A 2HXQA 3S3IA 3N4TA 2GPHA 2W5HA 3FLSA 1NVQA 5JKGA 4UV0A 4XLIA 4FKRA 4QTBA 2XJ0A 3S1HA 2UUEA 3ZS5A 5GZ8A 4EHGA 4F09A 4ALUA 2ITVA 3UC3A 2VV9A 3TNQB 3RGFA 4D2WA 5AAFA 3QRIA 2XK9A 1UNHA 3CP9A 3OTUA 3ZRLA 2BVAA 1V0BA 3ZC6A 4AT4A 3CTJA 4IFGA 3ZLXA 2OLCA 2X8DA 3BQRA 4RWKA 5HCXA 3EQRA 4L68A 4E26A 1BL6A 2OG8A 3B2TA 4D9UA 4ZP5A 2FSTX 2XKCA 4Q2AA 2EU9A 4KS7A 3W2SA 1NXKA 5CI6A 4D0XA 3NLBA 4PTGA 4NK9A 3OMVA 5LMAA 5KMMA 4I0RA 1BYGA 4DBNA 3COKA 3SOCA 4FV2A 3NCZA 4MYGA 4EOLA 1W84A 4ZZOA 1NVRA 3WZEA 3W2QA 3KMWA 3SW7A 2PSQA 1XHAA 3QTWA 4W8DA 5FBOA 4MNEB 3DBCA 4I5HA 2DYLA 3RAIA 3VJOA 2ZFYA 4M0YA 4TNBA 3FZPA 4YJTA 3E92A 5CEPA 4U44A 4RGJA 3KULA 2X81A 3FC2A 4AX8A 4WOVA 4Y8DA 5FD2A 5JFXA 3FV8A 2QOLA 5DN3A 4JL9A 4UBAA 2WFYA 2W4JA 3R7YA 4C59A 4DAWA 4I23A 4CT2A 3VVHA 3R7OA 2JKQA 4HW7A 3BLHA 4CKIA 2B0QA 4FNWA 1XH5A 1W98A 4JBOA 3G33A 1PY5A 4HVHA 5GJDA 3BGQA 2HYYA 2ZAZA 4G3FA 4TYIA 5TF9A 3IOKA 5EM6A 4QDEA 5IUHA 1FMKA 2WGJA 3FMKA 5CU2A 2OFUA 2R3JA 3IW6A 5HE2A 3L8VA 3SKCA 4X3JA 4FJVA 3PSBA 4TZRA 5H9BA 5BNJA 2ITYA 2VWUA 3R71A 3DBDA 3R7GA 3EQFA 4I22A 4E6QA 2XM9A 3PVWA 2UZNA 3R9DA 5HTIA 4RVTA 1GIIA 1PKDA 1OM1A 4A07A 2O8YA 1PXKA 5FEEA 4M15A 3PJ3A 5H8BA 4QO9A 4XRJA 3F2AA 1KE9A 3E64A 4GIIA 4N6YA 2PVNA 4Y85A 2CNUA 4BDHA 5AR7A 2PMLX 4YSJA 1QPDA 5BVWA 3IS5A 4ZY6A 2LGCA 5EFQA 2ACXA 2B9HA 3HV4A 4IZAA 3TV6A 3F6XA 2WD1A 2B9IA 4RC3A 4ENYA 2WEVA 4A7CA 5H2UA 5C8NA 2WMAA 4WIHA 5T3QA 3TV4A 4AA5A 5HX6A 3A4OX 3EZVA 5GNKA 1PMUA 2UZBA 4YZNA 1NT2A 4FT9A 5HE0A 1MQ4A 2A1AB 4MHAA 5DIAA 1MQBA 2JBOA 3I60A 4GT3A 4IWQA 3UDBA 5CEOA 5FWKK 2BZHB 3GC0A 4BDGA 1G3NA 1KE8A 1RQQA 3E8NA 4O91A 3QTIA 4G5JA 1JKKA 2BDJA 2XK6A 5DLSA 5HVJA 4P5ZA 5L2IA 3MFUA 4LV7A 1XO2B 3QRJA 2P4IA 4FVRA 3AD4A 4QMWA 4MUQA 4BTMA 4EK4A 4MXZA 5J7BA 4RC4A 2VUWA 5BVFA 3VQHA 2QKRA 3GGFA 2WTIA 4JR3A 5AR8A 5HBHA 3U4WA 1NY3A 2G2HA 4QNAA 3PVBA 4MVFA 4EH4A 5JZJA 3DJ7A 5IA2A 2C6DA 2BZJA 4OW8A 3PXYA 4IB1A 4BDBA 2YDKA 2YM3A 5M53A 3NCGA 4IWOA 3MTLA 4ACMA 3LE6A 5IQFA 3QTQA 3ZBXA 2VTAA 4OLIA 2I6LA 2JDSA 2YHVA 5EW3A 3R8VA 2XEZA 4G9CA 3I6WA 4FTOA 5BQ0A 1IG1A 1BI8A 3A7JA 5AP5A 4GJ2A 4MXAA 3OTVA 4IM3A 4F7SA 4BKYA 3ZMMA 4D0WA 3SDJA 3KVXA 3H9RA 1AD5A 5M56A 3EMGA 2OKRA 5IQIA 4LUEA 5AUZA 5HVKA 3E93A 2OZAB 4RWJA 2NPQA 1JKSA 5CTPA 3HRBA 5M4IA 4RQKA 5HI2A 2G1TA 5AP7A 3WZUA 3NZ0A 3WF7A 3C5IA 3QTRA 4KRDA 5E8ZA 5BYZA 4RC2A 5J87A 2CDZA 4CFXA 5HBJA 3ALNA 5ETCA 4Y95A 4BWKA 3DKCA 2PUUA 3A62A 3G9NA 4U3ZA 4HVDA 3ZXTA 2XK4A 2VWVA 3DA6A 4IAIA 4X6QC 4F6UA 1O9UA 3TKIA 4IDTA 4JQ7A 3EWHA 4OGRA 4GK3A 2ITNA 3QWKA 3NGAA 5DHJA 5J79A 4O1PA 3PIXA 3VRZA 2PVHA 3OP5A 3TACA 4E6DA 5IA4A 3BWJA 3CXWA 4CFFA 1UU9A 3C50A 1MUOA 3ZH8A 1OECA 2JIIA 4O0UA 4BHZA 3GQIA 3G0EA 1YW2A 3GCVA 2GQGA 4RJ8A 5B2KA 2Y4IC 3C9WA 4U42A 3VBXA 4OTPA 5EM8A 4EHEA 2I7QA 2BRBA 2G01A 4EHVA 2PVJA 1KOAA 1YOMA 3OY3A 4L52A 4PMTA 3AMYA 4WO5A 3U55A 2BIKB 5KUPA 4H3PA 3KMMA 4WHZA 3TG1A 4IB0A 3QLFA 2HY0A 2ZOQA 2XNOA 3GU7A 5M51A 3PXKA 4KBAA 3HMOA 3CJFA 3UJGA 4J1RA 3G5DA 1GZKA 4AQCA 1JSVA 3DXPA 5K9IA 3E8EA 2VTRA 3IO7A 3JUHA 2W17A 4GG5A 4JVGA 2ITZA 5FM2A 1GZNA 5CX9A 3UGCA 1Q8ZA 2UVXA 4DEEA 5JFSA 2PVYA 2QNJA 4PP9A 3RJCA 1ZY5A 3O0GA 4HVGA 1TZDA 3G51A 1GZ8A 4S31A 4YZ9A 2BUJA 2YDIA 3QQJA 4C0TA 5A6OA 3HDNA 3ALOA 1R1WA 4HGSA 5A14A 4KKGA 5B2MA 4CVAA 5I0BA 5AUUA 5I4NA 5J7HA 1PXPA 2YM5A 4FV1A 2OJ9A 5JT2A 2VTNA 3ZU7A 4DDIA 2C5VA 4F08A 3FZOA 3RK5A 4KKHA 5DOSA 4EOMA 3KA0A 5FXQA 2NP8A 4IC8A 2W1HA 2GNIA 4HYUA 4UYAA 1YWVA 3BE2A 2VU3A 4WNMA 1Q3DA 4L7FA 4X3FA 1U54A 2X39A 3AMBA 3GI3A 4AW2A 4DFNA 2W9ZB 4X3FC 3CGFA 2GFCA 2VGPA 3ORKA 3ZRKA 3MIYA 5AR4A 3CEKA 2FB8A 2RSVA 5CLPA 4AOJA 2WXVA 3CE3A 4UMTA 2QOIA 4ERWA 2F7ZE 2OJJA 4XV3A 2C6EA 2VNWA 3A7HA 2BKKA 1UWHA 5ICPA 1T46A 3OCGA 3KGAA 1UV5A 4FODA 4IZ7A 4GL9A 4R5SA 3U4UA 3W2OA 5IH6A 2CLQA 4U9AA 4D4VA 3BHYA 4AXCA 2FSOX