4D0WA

Pyrrole-3-carboxamides as potent and selective jak2 inhibitors
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
292
structure length
289
Chain Sequence
RDPTQFEERHLKFLQQLGKGFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Pyrrole-3-Carboxamides as Potent and Selective Jak2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 103
structure length 289
sequence length 292
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d0wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d0wA01
1YDTE 2YIXA 3DLSA 5CWZA 3SD0A 5CNNA 5M51A 1PMNA 2HXLA 5TKDA 5DT3A 3WZEA 1FPUA 1YOLA 1SNXA 3R1NA 4TYHA 2PVMA 4YLJA 4CYIA 4BZNA 3LJ2A 3SXSA 2XJ0A 4EQUA 2C69A 2X4FA 5F94A 3PG1A 2B54A 3QTWA 4MK0A 4XG6A 1SM2A 3KXXA 4WHZA 5G1XA 3R8LA 2WNTA 2H96A 4U81A 3ZYAA 3VBQA 4AGWA 3QCQA 4FSWA 3H9OA 5K0XA 4AW0A 4GYGA 5KCVA 2YABA 4WG3A 1K2PA 2IN6A 3U6JA 1KE9A 3H4JA 3ZLSA 4WRSA 5EI8A 3RAIA 4Z7HA 1GIHA 2VRXA 5CEIA 2Y8OA 2UVYA 2V0DA 3QXOA 3OUNB 5I5ZA 1PKDA 3GOKA 3KN5A 4LL5A 4C62A 3ID6C 5E90A 3SQQA 2XK7A 4RZVA 4YZMA 4E5BA 4MXOA 3U6HA 1ZZLA 2W5BA 3POOA 2WQOA 4FKIA 3QTQA 3R9OA 4V05A 3TG1A 4GYIA 4DT9A 5GZ8A 4EOIA 2HY0A 5IDNA 3SG9A 3R71A 4LGHA 1OL1A 5HO7A 3WZKA 1PMVA 5AUWA 4YMJA 5EK7A 2ITTA 3OG7A 1VYZA 1DI9A 3Q60A 2QQ7A 3EQRA 3FZOA 3OWPA 4ZIMA 2P0CA 2XH5A 5L6OA 4OTFA 3KEXA 4R5YA 4F08A 3UG2A 1OPJA 1XO2B 4BTKA 3CEKA 4OUCA 1REKA 4YJVA 4WNMA 3NW6A 4NU1A 3OCSA 3V51A 4EKKA 2VX1A 5I4NA 2EB2A 4C59A 2FYSA 1PXPA 5LMBA 2Z7SA 5FDPA 3AD5A 1J3HA 3PA5A 2YN8A 3MA6A 4GH2A 3UIXA 1H1PA 5JK3A 4P7EA 5CF5A 1H0WA 3LXPA 3PIZA 3ET7A 1YDRE 2J50A 1XWSA 4IE9A 1BLXA 3ZUTA 5E8SA 3ZLWA 5FXRA 2PHKA 5AR4A 2YWVA 3IK3A 4D4SA 4FV6A 5IA5A 3D5UA 3F82A 5J9ZA 5AFVA 3E8NA 2VTAA 5E8VA 1P4FA 4FT7A 3DB8A 4HYHA 3R9NA 3SOCA 3LFFA 2OLCA 4FTTA 4E93A 2XS0A 4Y85A 4DH1A 4RGJA 4R8QA 3TZ7A 1IEPA 3R9RA 2ITXA 3CGFA 4LQMA 4ENYA 4O0TA 3D5VA 4DFXE 4YTHA 2QI8A 5JT2A 3WILA 2ONLA 4A4XA 4BCPA 4R1VA 5EYDA 3LFNA 4PPAA 5LMAA 4D4RA 3PTGA 1X8BA 4YUQA 3ZFYA 4H1JA 3DKCA 4D1ZA 2C5VA 1CTPE 3NAYA 3QD2B 5L2QA 2OXXA 4U43A 4EL9A 2ZB1A 2GQGA 4I5HA 3KCFA 3EZRA 4UMQA 4NH1A 2VO7A 3R00A 1Q97A 4CZUA 2JEDA 1QCFA 2W4OA 3D5XA 5HGIA 3QC9A 4IJ9A 4XV1A 4ACMA 4U0IA 2IG7A 5J7HA 3ATSA 4QQ5A 3EN7A 4U5JA 5E7RA 4EH3A 4TY1A 3SLSA 5JSMA 5KZ0A 3ETAA 4NJDA 2Q83A 2GDOA 4FT5A 4XG2A 4AU8A 3UNZA 2PVRA 4X3JA 2GNGA 3H0ZA 4H58A 4ZOGA 3W55A 4U97A 3A4OX 4XRLA 3NNWA 3QD4A 4EHEA 3HECA 4HCVA 4YPSA 4BCGA 1OKWA 5EG3A 5AM7A 1GZ8A 1UNHA 5ETCA 5LXMA 5L3AA 4D5HA 4L9IA 5AV4A 3UYSA 2VTTA 2R3KA 1OPKA 4JBOA 4D2SA 3AOXA 4DINA 3PWYA 5D11A 3MH2A 3OY1A 2XNGA 2VX3A 4HYSA 4BCNA 1JLUE 1OBDA 4L3PA 4O0VA 4AQCA 4FV5A 4JT3A 2X7FA 5DT4A 4Q5HA 5FP5A 2QLQA 4U42A 2YM4A 3TL8A 3SDJA 3UG1A 2YCSA 4O84A 4FSUA 4EH6A 4YTCA 5LWMA 4FKUA 2GSFA 3BQRA 2I0EA 4EYJA 4JQEA 4FV7A 3BLQA 3G9NA 5EW8A 1M52A 1Y6BA 4EOJA 2PZIA 3D14A 5B2MA 4L44A 2ITWA 4ACCA 3Q32A 2C6DA 4AT3A 3P79A 4IM3A 1KUTA 3FMNA 3F5PA 3L9NA 3ZO2A 5LMKC 3Q9ZA 4MNFA 4FKOA 4JIAA 1QPJA 5CI7A 2PVLA 4ALUA 2CNQA 3QKLA 1M2PA 1YI6A 1ZYDA 2XM8A 2R3MA 4FTOA 4ZTSA 1R1WA 2BILB 3LLTA 2UW8A 3E93A 2BRBA 4E1ZA 4GCJA 4JAIA 2B9HA 3HA6A 5FXSA 5JZJA 1OZ1A 5F20A 2W1IA 1UU7A 2WIPA 4F9CA 3RPOA 2QOIA 5JRQA 2HW7A 3IO7A 4XRJA 2WFYA 3DTWA 3CD3A 1PXNA 2P33A 3TM0A 3RJCA 4K6ZA 4GL9A 4BZDA 3FY0A 3IG7A 2QHNA 2DQ7X 3IW8A 1BL6A 2IZTA 3FSKA 3H3CA 4H3PA 2DYLA 2X39A 4OW8A 4DF3A 2AC5A 4F9WA 3TZ9A 2WHBA 4CFUA 3AMAA 2HK5A 4M97A 3O8TA 2OIDA 3FZSA 4QQCA 2OH4A 3WF9A 2BAQA 4BIBA 4FTMA 2WTKB 1ZWSA 2O8YA 2YCQA 3P1AA 4BTJA 1KOBA 2C1BA 2EXMA 4NEUA 2XK8A 4IB0A 1GZNA 2HWOA 2HELA 4FEQA 3LZBA 3UMXA 4FC0A 5KKRC 3WARA 2PVFA 4RVTA 2QODA 4AFEA 3S0OA 2A2AA 5FEEA 3W8QA 1FBNA 2SRCA 3P7CA 5AR3A 2OZAB 5AP6A 5AA8A 2JD5A 2CPKE 2EVAA 3NDMA 5JH6A 3EIDA 3SAYA 4C3PA 2E9UA 3QQGA 1U5RA 5CXHA 3TEIA 3U4WA 3D0EA 5TF9A 4IWOA 3FKOA 3NIZA 4I4FA 4QMTA 3DZOA 4ITIA 4Y83A 2C3LA 5A9UA 3QHRA 4QMYA 4FA2A 5IH6A 2P2HA 4RJ4A 5KKRB 3TXOA 2J51A 3LFCA 4J7BA 4U3YA 4DCEA 2G2IA 4IB1A 5AJQA 4FEXA 5KMJA 2Z7LA 5L2SA 4L7FA 2VN9A 2W1FA 1GZOA 3DK3A 4F1OA 2QKRA 4CKIA 2C6MA 3EKNA 2QR8A 3HLLA 5LCKA 3RALA 4AZEA 4CTBA 2UUEA 3A8WA 3BRBA 2UW3A 4F9BA 4MXAA 4PRJA 1IA8A 4IAFA 3OXTA 1JAMA 2H8HA 2EXEA 3O7LB 5C8KA 2C3JA 4QYGA 2XEZA 4ZSLA 4C33A 4I3ZA 4GFGA 2VD5A 2W1ZA 3KRJA 3QQHA 1FINA 4XV3A 5M57A 3N4UA 1RE8A 1DS5A 4BDHA 5HLNA 1YOJA 5ETFA 5F95A 2YDJA 4AN9A 4C4GA 3RK5A 1URWA 5CS6A 4JLCA 3FXXA 3NEWA 4V04A 5DHJA 2Y9QA 3TN8A 3COMA 4NYEA 2VTNA 1M2RA 5JFXA 1FVRA 1GJOA 2WELA 3H10A 3MS9A 3PWDA 4NFMA 3O0GA 2V22A 3BV2A 4Y8DA 3V5QA 1J7LA 2DWBA 3JR1A 1PY5A 3A7IA 3SC1A 5AUUA 2UV2A 3HV4A 3QKKA 5HHWA 2HY81 4AT4A 2R3HA 4YJUA 4DH7A 2VNWA 4IWPA 3SX9A 2CN5A 3W33A 2VUWA 5DPVA 5DWRA 1QPCA 3CTHA 4MBIA 4BWKA 3FYJX 2OW3A 1OL2A 3PRIA 2W1GA 4ZZMA 3QF9A 4NM7A 3R1YA 5HIBA 4NCTA 1OL5A 5M4CA 1AD5A 4JNWA 1M2QA 2YDIA 3BYOA 3OFMA 3FQEA 4GUEA 1OBGA 3CLYA 4OGRA 1L3RE 1QMZA 2C1AA 3OBJA 4C57A 4KBCA 3PSDA 3ZSHA 1SVEA 4L43A 1JVPP 4O22A 4ZTLA 2VGOA 2QURA 4YC6A 1URCA 2ZV2A 3NUPA 5IUGA 2O63A 3EL8A 3TTIA 1Q99A 5E8TA 4X2FA 4E4NA 4FTLA 3BQCA 3MW1A 3HRBA 4LMUA 5HX8A 2OO8X 2F7ZE 4PNKA 2YZAA 5EDPA 1H25A 3F5XA 3HYHA 4KKGA 1J1CA 5HU3A 3UMWA 5J1VA 5FTGA 3IECA 4K2RA 5E8ZA 3NUAA 3QAME 2Z7RA 1ATPE 3CPBA 4J52A 5HESA 5CEQA 5A4QA 4I6FA 3H30A 3LFQA 4FT9A 4KIOA 3H9RA 5HZNA 4RJ8A 5CAOA 4M0ZA 3D94A 4PX6A 4PMPA 2HENA 3HAVA 1PJKA 5H3QA 2GU8A 2G9XA 4FL1A 4FKSA 4A4LA 1XKKA 3PP1A 2YITA 2BTSA 4G1WA 5D10A 4QMPA 4C3RA 3RHKA 1YKRA 4FNZA 5CENA 3KY2A 4YTFA 3MPAA 4AGCA 1MRYA 2WAJA 4EOPA 4WNPA 2WOTA 2OU7A 4RA5A 3NNVA 3A4PA 3QCSA 4BBEA 5KE0A 4M69A 3MIAA 4GW8A 3GEQA 4IAKA 4FSZA 2OJ9A 2WO6A 4OT6A 5EI6A 5JGAA 1V0BA 4IM0A 2XKFA 4UN0C 5C27A 5M56A 5E8YA 1YWRA 4JBPA 2C6LA 3UOLA 1U4DA 4G6OA 1TQIA 3FLSA 2B4SB 3D9VA 3E92A 3GCVA 3I0OA 3A2CA 3OROA 4CD0A 2NP8A 3B2TA 5DR9A 5IZFA 5IQBA 4WKQA 5DI1A 2XIRA 3BEAA 4F7LA 1Q3WA 4BY9E 2I0HA 4K18A 2W96B 4TYIA 3ULIA 4OLIA 3ENMA 5A4EA 4IBMA 3JPVA 4A9YA 3RNYA 5KUPA 2I40A 4G9CA 4RWKA 3W32A 2VNYA 2IVSA 3OHTA 4UWCA 3DY7A 2GHMA 4IDVA 1F3MC 1JWHA 3QUPA 3NYVA 1Q8WA 3L8SA 5I9VA 4BDJA 3FC2A 3GU7A 3FAAA 4ID7A 4HGSA 4U7ZA 1FVVA 4GRBA 5C4LA 1W8CA 4BGGA 1Q62A 5LVPA 2F49A 3HP2A 4X2JA 3D7ZA 3BPRA 4M69B 3NW5A 4P5ZA 4BHZA 2RSVA 3MV5A 5EW9A 1AQ1A 1PRYA 3QX4A 2BDFA 3EFJA 4RLLA 4RRVA 2X4ZA 3OD6X 4FNYA 2HZ4A 3WF5A 3EQGA 4ZEGA 3ACKA 5LOHA 4DEDA 5TE0A 1NA7A 3TZ8A 1V0PA 2YWPA 2UW5A 3ENHA 3QYZA 4BDDA 5HG7A 4S31A 4AAAA 4BCHA 4E6QA 3R6XA 4XNEA 2PE1A 2JIIA 4ALVA 3PPZA 3Q6WA 1OMWA 2ZM3A 3JXWA 4E3CA 4H1MA 2XKDA 2VTRA 3DDPA 3ZCLA 2JBPA 4DH5A 4ZS4A 4CFVA 3OW3A 2CCHA 2BHEA 3V5PA 1MQ4A 4RIXB 3ZEWA 2YEXA 3BBWA 5BQ0A 4MBLA 3ZDIA 3FC1X 2OJIA 2QOOA 4JBQA 4DEBA 3W2QA 2XP2A 1FMOE 3OZ6A 3VUTA 3ZSIA 4F65A 4LL0A 3ZONA 2A19B 4FIHA 4RX9A 5FGKA 1G5SA 4RLKA 3GT8A 2F2CB 4IXPA 2RG5A 5EH0A 5IQGA 3ZEPA 2R4BA 2H6DA 4EHVA 4B7TA 3P7BA 4A7CA 4C7TA 5AR2A 3W2CA 2J2IB 2X2KA 4C61A 2WEVA 5LVOA 3OCTA 3NWWA 5BYLA 2WPAA 2BKKA 4CZYB 4I0TA 3MSSA 3THBA 4PNIA 2QOLA 4BKYA 3I60A 2CKQA 4RWLA 2X2LA 4RPVA 4O27B 5FG8A 4JG8A 2WOUA 2YFXA 3BLRA 4CFFA 4TWPA 4EC9A 3KQ7A 4X3FA 5HIDA 4AA4A 2GNLA 1ZLTA 4Z9LA 5CY3A 2XIZA 4BDBA 4L00A 5CQUA 3K3JA 3DOGA 4R77A 2Z60A 4XBRA 3QTUA 4MX9A 3UP2A 1PKGA 2WTDA 4DFZE 5ANDA 2FSMX 3UOKA 2Y4IB 3QTXA 4WNOA 2ITVA 3LM0A 4OR5A 3ZLYA 3KCKA 1CM8A 1ZXEA 3QL8A 4OTGA 3OTVA 5H8GA 4CMTA 4TZRA 4LRKA 3AQVA 3C7QA 3MYGA 2QG5A 1JKTA 3C4EA 3NIEA 5DRBA 2W1CA 1DM2A 3QQFA 3KMWA 4GG5A 4XYFA 4E73A 2JDSA 4YR8A 4USDA 5CANA 3PJ2A 4O0RA 4EQMA 2BUJA 4KRCA 4PY1A 3FZ1A 5D12A 5J95A 5GZAA 5EQPA 4EH5A 4AACA 4W9XA 4WSQA 2XB7A 2YCFA 3DBQA 4XP0A 2NNWB 3K5UA 2WU6A 3BV3A 5L6WL 5HORA 5E1SA 4BCIA 4L67A 4IQ6A 4WG5A 3UGCA 3PXQA 5HE1A 3QTZA 4XG8A 4O0UA 3R0TA 2C0OA 2Y6OA 5ICPA 4W9WA 4JOAA 2GS2A 3AC4A 5L2WA 4AZVA 2HCKA 2UW4A 5CU4A 3F5UA 1YWNA 2I0VA 4I5PA 5E8UA 4XS2A 1SVHA 5AIRA 4FEUA 3OTUA 4O7VA 3F6XA 3GFWA 3F3VA 4BL1A 1LUFA 3F2RA 5FP6A 5LCJA 1ZMVA 3GC9A 4RJ7A 4UXLA 4X3FB 1SYKA 4MF0A 3MPTA 5I3RA 2WTJA 5A6OA 3VO3A 4IVCA 1VZOA 4MAOA 3QQJA 4TYGA 5HKMA 4O2ZA 3KB7A 3VBWA 4RG0A 4XG7A 1OB3A 3Q9WA 2JAMA 3P4KA 2WB8A 2W4KA 4OT5A 4YZNA 5DBXA 5HBEA 4RC3A 2J6MA 3D5WA 3R63A 4KIQA 1SZMA 2W7XA 5HCZA 3MY5A 4YO6A 1PF8A 4C38A 2CKEA 1YXSA 3IQ7A 2VWWA 3F88A 3LE6A 4J96A 5HG8A 5K3YA 4G16A 4F6WA 3IGOA 4FIEA 1OIYA 3A7JA 4FR4A 2F7XE 3HDMA 4L6QA 3E88A 5IUHA 5HE2A 3QUDA 5LJJA 5EI2A 4YURA 5M4UA 3DK7A 2B9JA 3GGFA 2UZUE 4B6LA 4ZJVA 1L8TA 4O7NA 5M09A 4IACA 5IA1A 3DAEA 4QP1A 4F7NA 5CYIA 3N4TA 3BE9A 3DAJA 3QTIA 4BYJA 2PVHA 4IWQA 1JSTA 2F7EE 3ZUVA 3KF7A 2V62A 2XNOA 3U55A 2WTVA 4FZFB 5DH3A 1W83A 4LUEA 5AAFA 5E9EA 2KTYA 4J8MA 2XIYA 3U9CA 2QVSE 3OVVA 3FMLA 3DXNA 4E7WA 3EQIA 4GT3A 2BAJA 3BELA 5I9WA 1OL6A 5BMMA 1MP8A 1F0QA 2WTIA 3CQEA 1HOWA 3IW6A 3ORKA 3EL7A 3GCPA 1WVWA 3P9JA 1UKHA 4OTRA 4QRCA 3LW0A 3R7UA 3BBTB 2G2HA 3CTJA 4UY9A 3VS7A 4BCFA 4X2GA 3ZBFA 4FV8A 1J7UA 2BMCA 3UBDA 5JKGA 4F63A 4OTDA 2X6EA 4LFIA 3BWJA 4IHPA 2VTLA 5BVNA 2IVVA 2OWBA 4NJ3A 4CTCA 4ERWA 1ND4A 4O0SA 3RBWA 3R28A 1OKYA 4CZTA 3SVVA 4MH7A 2YIRA 4ZP5A 4YHTA 1GY3A 1RW8A 3HDNA 3PPKA 3PJCA 4BC6A 4CV9A 3JUHA 4W4VA 2H9VA 4HNFA 3ELJA 4S34A 3PDTA 4QMLA 1UU3A 4XUFA 3AGLA 3MFSA 4U8ZA 1UWHA 1XH9A 3O23A 2ZVAA 4FZ7A 2B9FA 4C0TA 3ATTA 3W8LA 3ZC5A 4IM2A 4TWOA 3ZUUA 4ASXA 3P86A 2PWLA 3BGZA 1NVQA 3PRFA 3R21A 4IAAA 4ZLYA 3FI4A 1YI4A 2XNBA 3NCZA 3NUXA 3RCJA 3R7GA 4NZWB 4F7SA 4GMYA 3IKAA 4LG4A 5JFWA 4FKGA 4EH7A 3OXIA 4A9RA 5TO8A 1KSWA 2NO3A 4G2FA 2FH9A 3S2PA 1SMHA 3W16A 4DA5A 5DVRA 3FUPA 3MTFA 1FOTA 2Z8CA 3GU6A 4NKSA 3POZA 2QO9A 5DYJA 2PVNA 2R64A 3PE1A 5E1EA 4DEGA 2ZAZA 3ULZA 4P90A 4YJPA 3G5DA 4Z16A 3Q2JA 4BCQA 4FEVA 5J87A 4FK3A 4KKEA 5A3XA 4HCUA 4E6CA 2CCIA 4JR7A 1A48A 2OIBA 3HAMA 2RKUA 4ZLZA 4AWIA 3IDPA 2ZB0A 2W9ZB 1Q3DA 3KXNA 4HGTA 4O1OA 3VS5A 3VRYA 3ZXZA 4J98A 1NW1A 2C0IA 3BLHA 3F3TA 3OS3A 4I24A 2CN8A 4D4VA 3LJ1A 5F4NA 4DLJA 4Z3VA 1BYGA 2PVKA 2QOKA 1OPLA 4MYGA 5F9EA 3HL7A 4QMSA 3ZOSA 5JGBA 4D2RA 4MQ2A 1OGUA 3PLSA 5EW3A 4E4XA 3EQBA 5JQ8A 2PUIA 1YXXA 2J5FA 4R7IA 3EFLA 3FHRA 3UJGA 3BYUA 2IVTA 3MESA 4CKRA 2O5KA 1Q8UA 2UVXA 2PYWA 2W99B 5HIEA 1E1VA 4EH2A 5IA4A 2XYNA 5JRSA 2VGPA 3T8OA 2PZRA 3GCQA 4PP9A 4EH9A 5L2TA 3SXRA 2PSQA 3EOCA 3GOPA 2A4LA 2OI4X 3I79A 2UW7A 3TNQB 3MB7A 4J95A 4FMQA 5KHWA 4RFMA 4S33A 3KXZA 2BIKB 3RZBA 1Q4LA 5FD2A 4DC2A 4WG4A 3PP0A 3LCTA 4S30A 3NVMB 3HV6A 4FIIA 4EWHA 5J5TA 2GCDA 1YVJA 3KA0A 3C1XA 3LIJA 3MB6A 1MUOA 2QU5A 3OT3A 3PZHA 3G51A 3KN6A 4NWMA 4W8EA 5CVGA 5DEYA 4DFBA 3JY0A 4MD7E 1FGKA 3VS0A 1W84A 1H24A 3UC4A 4LV5A 4PTEA 4FBXA 2C6KA 2PZ5A 3UIMA 4XCUA 3N4VA 3FQHA 3IOKA 1PXJA 4YZCA 5DR2A 3QU0A 4FOCA 4QMVA 2IPXA 3NNUA 4CFXA 1LEWA 4G3FA 3HNGA 4XLVA 4MHAA 2UZOA 3ZTXA 4IX5A 3LOKA 3DCVA 5FEQA 1OECA 1FQ1B 2EU9A 2X6DA 4C02A 4HPUE 4MVFA 5AV3A 3KRWA 3DFAA 3FQSA 2WMSA 2XUUA 5AR7A 2ZYBA 3HRFA 3MGYA 1YHSA 3AT3A 3ORZA 4BI1A 1Z9XA 3D15A 4J53A 2C68A 2GHGA 4O6LA 5EOLA 2J0MB 3BHTA 1S9JA 3QQKA 3C4WA 3OOMA 5AP4A 1UNLA 5IA2A 3R2BA 3AC3A 2BTRA 5IH5A 2UVZA 2YM5A 1R0EA 1XH7A 2GFSA 4QTCA 4IFGA 4FIFA 5CXZA 4D5KA 5B7VA 3ZFMA 4FKLA 4MBJA 1QPDA 4LGDA 3OEFX 4UZHA 4FT3A 4MEDA 3V04A 3QRKA 5JN2A 1U59A 3HUCA 5K5XA 4O2PA 3RM7A 5E92A 4O7ZA 2YERA 4EKLA 3BKBA 4JX7A 4FTKA 4ZTNA 4E6DA 5CSVA 5GIOE 2X7GA 4JG6A 2WIHA 3EN4A 2JAVA 4BKJA 3LFDA 4DFYA 4L3LA 3FLYA 4I6HA 2Z7QA 4C4EA 5IEYA 1PMEA 3DKFA 3FYKX 5CVHA 3OMVA 4ANMA 2CGWA 2W05A 5TR6A 4DH8A 5LMKA 2HYYA 4FKJA 5FTOA 4V0GA 2ZV8A 1DAWA 4FVPA 3TTJA 4EUUA 3VUIA 5KMOA 2GMXA 5AX3A 4CG9A 4UMRA 5HVKA 4A07A 3EN9A 3O17A 3HUBA 5B2KA 3UYTA 2ZMCA 4UALA 1H8FA 1W98A 3VS2A 3PA4A 2WMBA 4FKWA 3GFEA 1HCLA 5AUVA 3MPMA 2XNNA 4EOSA 3F2NA 5KHXA 2FSOX 4EHZA 3PVBA 3ZS5A 4YC8A 3R8UA 4Y73A 4A9TA 3AT4A 3ORMA 2H34A 4KSPA 5FBNC 2VWUA 2CHLA 4RIOA 4P5QA 2OZAA 3DKOA 4XP2A 4CLIA 4CT2A 3BX5A 3LCSA 3UIUA 2ZV7A 4NM5A 2YAKA 4IMYA 4LRJA 4D2PA 3ZO1A 1H1QA 4N6YA 1IRKA 5T6KA 1VYWA 3E5AA 3PVUA 4AT5A 3FHIA 3BZ3A 4PWNA 2OH0E 3AMYA 4UX9A 4MNEA 1JQHA 4LV8A 1WVYA 3Q5ZA 4QMZA 3TKHA 3FL4A 2WTCA 1LP4A 3NGAA 1KV2A 3FZRA 5D7AA 4C3FA 1WBSA 2JDTA 4AP7A 3M11A 2WMTA 3VQUA 4ZSGA 2WQMA 4V0GB 4GK4A 4FKRA 4KS8A 4BYIA 4BZOA 4E6AA 3AMBA 5B2LA 5HD4A 3REPA 1OIRA 4IC7A 5E8WA 4RSSA 5GJGA 2IW8A 2LAVA 2GS6A 3UQCA 3NUSA 3HZTA 1KE6A 3RZFA 3UOHA 4DEIA 3N51A 3HKOA 3UVQA 3V5TA 4DTAA 3RPYA 3FV8A 1PHKA 3EFKA 5ANEA 2ZM4A 4L46A 3IGGA 4PUZA 3W2OA 4CXAA 5BUEA 3UPZA 3FMJA 2XK4A 3FPQA 3GC0A 1ZYJA 3U8WA 4D2TA 4DFLA 4KINA 3Q4UA 3SA0A 2B0QA 4GJ3A 4EK6A 5LVNA 3LCDA 4R7HA 3ORTA 1W7HA 4BDAA 2R3OA 2OG8A 3TNHA 3HMOA 3BWFA 4ZMFA 3OXZA 2FB8A 2Z02A 4O86A 2BRMA 3ORPA 4WUAA 3SG8A 3M42A 4DEEA 2J0IA 2YM6A 2VAGA 3DBDA 4H36A 4RVMA 5HNBA 4YTIA 3RINA 2VTQA 4IZ7A 4QPSA 3FZTA 3P23A 2C3KA 2OJGA 3NSZA 4TPTA 3VS1A 2R0UA 4XX9A 3UP7A 4MNEB 1YXUA 5HE3A 5AR5A 3CC6A 3PY3A 2XKEA 2C4GA 4NTTA 3DV3A 3TV7A 3ODYX 5IF1A 4FKVA 4UB7A 2IZSA 4D9UA 4YNOA 3H0YA 4MXCA 3RWQA 5KMKA 1WCCA 5KBQA 3CTQA 4ANBA 3U4UA 2VO3A 3VBTA 5IEVA 5M44A 4C35A 5IISA 2WMUA 4WNKA 1BUHA 5BVFA 5J79A 1JPAA 5HNGA 5CASA 4IVAA 1IASA 4APPA 1GIIA 1SNUA 3AC8A 4UMTA 5FBOA 3MBLA 3CCNA 4ZZNA 4IZAA 4EC8A 4UMUA 5BUIA 3KU2A 4QQTA 4N70A 3LKMA 2QNJA 5JEBA 2C0TA 1W82A 2JGZA 5EQYA 1M17A 4QMOA 4CYJA 5CF4A 5CTPA 2QOCA 4B9DA 5FRIA 3P78A 3V5WA 3DU8A 4X2NA 3FXZA 2XIKA 4HCTA 3NYOA 2OFVA 3FI3A 4F0FA 4FTQA 3IDBA 2UZTA 3QC4A 4ALWA 5AWMA 1YI3A 2XCHA 2YZLA 3PE2A 1UV5A 3BHUA 4I5MA 1R3CA 4IJPA 3L9PA 2PUPA 3ZH8A 2LGCA 4WUNA 2C6OA 4O7YA 2WGJA 2X2MA 4D58A 2A27A 3TACA 4YNEA 3SW4A 4AOIA 4QMWA 1OITA 3UVPA 1Q41A 2J0LA 3O50A 2Y4PA 4JI9A 4X0MA 4BDIA 2IJMA 4QP2A 5GNKA 3C51A 2KULA 3ROCA 5EM5A 3DPKA 4AFJA 5BVDA 5EHYA 3ZRLA 4DGOA 4FZAB 4H05A 3Q52A 3GVUA 3R8VA 3KREA 3ZZEA 4FV1A 4IX3A 5EQEA 5E4HA 3G2FA 5FTQA 4AGDA 5CSXA 3C5UA 5GIPE 2BZIB 4ZY4A 4LUDA 2NRUA 2B55A 4AOTA 1B6CB 4UMPA 3DFCB 4HGLA 3O71A 5AUXA 4WBOA 3KRLA 4YJQA 4AA0A 3ALOA 2X1NA 4G3DA 3BYVA 3IW4A 3NS9A 2JIVA 5D1JA 3VBXA 2PK9A 3R9DA 4AW2A 4DGGA 4EHGA 3DXQA 3EHAA 3W18A 5K4IA 4XBUA 1ZMUA 2VTSA 2GPHA 5K9IA 5JFVA 3CXWA 4FTCA 1IA9A 1J91A 1O6KA 4ZMEA 4R3CA 3I7BA 3CJFA 3MFRA 2DS1A 4F09A 2UW6A 4JRNA 2BRHA 4IFCA 5BVEA 4B0GA 2HOGA 3LQ3A 3KULA 1UU8A 3MIYA 4ZJIA 5H2UA 4BB4A 4NKAA 4O96A 2X81A 3Q04A 4HZSA 2W5HA 4ZTQA 1U5QA 3F66A 3WF6A 1XQZA 3ERKA 4I20A 4OBPA 4PL4A 1UA2A 2B53A 1Y8GA 3F7ZA 4GJ2A 4XHKB 4BTFA 4Y5QA 3PUPA 3VUDA 3GQLA 4F99A 1ZMWA 4C34A 1BKXA 3QLFA 3IS5A 5AAEA 1JKLA 3MN3A 4O7LA 4B8LA 1FMKA 2JDOA 3T9IA 4N0SA 1G8AA 4PTGA 2X9FA 4C58A 5C8MA 4CV8A 4QTBA 4M8TA 3G9LX 3ROYA 4DT8A 4ZY5A 5CZHA 3ZXTA 3O8UA 1OKZA 4DGLC 4F9AA 3U51A 2JKMA 3KRXA 3MFTA 3G0EA 3ZRKA 4D55A 4ERKA 3ORIA 3UNJA 4YSJA 4ITJA 1Q8ZA 1WBWA 2ITYA 3LVPA 3A7GA 4FYNA 4EK4A 4L53A 3DLZA 3KKVA 3QD3A 4FVQA 1ZYSA 2BFXA 1OUYA 1H27A 2HXQA 4L42A 5DLSA 4ANOA 1TVOA 3MDYA 4TYJA 2IWIA 3FPMA 3PXRA 5DGZA 4D2VA 3M2WA 1K9AA 2E9VA 1H01A 2RG6A 4BIDA 3RPRA 4ZK5A 2ITPA 2HWPA 2JLDA 2R3PA 4PPCA 5AV1A 3V5LA 1R39A 4MQ1A 5ETAA 1OL7A 4RIXA 3KK8A 2ITQA 4MXZA 4BGHA 4FTJA 1H4LA 3TUBA 2IW9A 4QMMA 1Z57A 3TWJA 3KULB 1H1RA 3R73A 3TNIA 4NW5A 4CGAA 4AF3A 2FVDA 4G34A 4AZSA 4XV2A 4FEWA 2J4ZA 2GNFA 2BFYA 2OXDA 2VTOA 4J1RA 3ZO4A 4AZFA 5GHVA 3GB2A 2AYPA 1YWVA 4N6ZA 4KS7A 4PL3A 4ZY6A 2WMQA 3COKA 4IIRA 4NFNA 5H9BA 3E7VA 3LHJA 2ERKA 2OZOA 3D83A 3FMDA 4D0XA 1O6LA 2OJFE 2OK1A 3Q96A 5KX8A 3QWKA 4GVAA 4IADA 3HMMA 3IDCA 3PXKA 4KABA 3WYXA 4JX3A 3MH1A 4O7RA 3VUGA 4ANQA 4N4SA 2REIA 2VWBA 4ZTHA 1FGIA 3CP9A 2JDVA 5FUTA 4DE4A 5IA3A 1CKJA 2AUHA 3OUKA 4JDIA 4OBQA 1ZOGA 4Z55A 2VWIA 4D28A 3CPCA 1RDQE 4W4XA 4RVKA 1ZY5A 4ZXTA 5M53A 3TV4A 4DHFA 2IW6A 2QONA 4QYYA 1WBVA 3HMIA 1R78A 4QP4A 5CEMA 5HO6A 3CQUA 5IU2A 3GI3A 4MF1A 4OTIA 2ZDTA 5AUYA 4O38A 4C4FA 3V01A 3PZEA 5LVMA 1XHAA 5IPJA 2VTHA 3RWPA 3WF8A 4I5CA 2WQNA 3VUMA 4F6SA 4JJRA 2W06A 3DKGA 4KD1A 3CE3A 4H3QA 2Q0BA 3Q2MA 1QPEA 2XRUA 4FSRA 1MRUA 3MVMA 3NW7A 3NLBA 4K1BA 4L3JA 4QNAA 4RBLA 4C2WA 4GT4A 4BCJA 1KE5A 3SW7A 4U80A 3MH0A 4JRVA 4GEOA 5GJFA 3RP9A 3TZMA 1OVEA 1DAYA 1V1KA 5BVWA 5HQ0A 1KE8A 2QC6A 4HZRA 2VZ6A 3EQDA 4RX7A 5CAPA 4CVAA 4QTAA 3O8PA 5T68A 4I4EA 3CD8A 3L8XA 3UZRA 3IOPA 2BIYA 3QZIA 3IW5A 4NK9A 2A0CX 1VEBA 1YQJA 4TRLA 5KMLA 4BIEA 1NVRA 3COHA 4YJRA 4D4YA 1PXOA 4FTRA 2OF2A 4FT0A 4K33A 3HV5A 3EKKA 4FTUA 5AP7A 3DBEA 4QYHA 4B4LA 2QOBA 3GU4A 4ASZA 5L6PA 3LFBA 4I23A 2R3JA 2WQBA 2F57A 2HIWA 3KMUA 3R7YA 5JMSA 2BRGA 4FSYA 5I9UA 5BPYA 3TDVA 1NY3A 2YM3A 4Z7GA 3FWQA 3BI6A 3P08A 4R6VA 4QMQA 3CSVA 2UZEA 4MXXA 5ETIA 2XA4A 3A8XA 4NM3A 4TTHB 3RK7A 4BN1A 3DS6A 5AX9A 1CSNA 2I1MA 3G33A 4ENXA 5HNIX 4C37A 2GQRA 4KB8A 4F64A 4R3PA 4BF2A 3LM5A 3KGAA 4KIPA 4CQEA 1H1SA 3QZFA 4YBJA 4G6LA 4BICA 4EUTA 5J7BA 3PY1A 3WZUA 5CAVA 2WMWA 4PL5A 3S00A 1JNKA 3UZTA 3DJ7A 3R7EA 3JVRA 3UC3A 4GFOA 3Q6UA 4E4MA 4EYMA 4FL3A 2YACA 3C13A 2YM7A 4F1MA 2ETKA 3TDWA 2ESMA 3E3PA 5M4IA 2YJRA 3KK9A 4D2WA 4IB5A 4X2KA 5DA3A 4GIHA 4XG9A 3R8MA 3F2AA 4FKTA 4LGGA 4UYNA 2HZNA 3E64A 5HTIA 3R9HA 4JVGA 2P55A 4J97A 5ACKA 3HX4A 4TWCA 1BMKA 3EYHA 4M14A 1PXIA 1H28A 4AGUA 3PVGA 4HVGA 4AE9A 4DH3A 5ITAA 3QX2A 4JL9A 3DAKA 2C47A 4KRDA 2Y6MA 3E8CA 4AN3A 3RTPA 4K0YA 1B38A 2FA2A 1ZRZA 5TT7A 3DK6A 2OFUA 1VJYA 3MVLA 3R22A 1WBNA 3ITZA 3DB6A 2A1AB 2FSLX 4FSNA 3FLNC 3LJ0A 4EOKA 2EB3A 1HCKA 2WMVA 3F7WA 2E9PA 5C9CA 5JQ5A 3OCBA 3V8SA 4WA9A 4LM5A 5HEZA 3PXFA 2HZIA 2C6EA 4E20A 3OW4A 3FI2A 4UV0A 2VX0A 2B9IA 3R7VA 2YLEA 3Q4ZA 5CT0A 2G01A 5KNJA 1F5QA 2W17A 5I0BA 3MH3A 4PF4A 3UQGA 3FL5A 2PE2A 1U54B 4DFNA 2O3PA 2XBAA 1DI8A 1H07A 3O51A 4HOKA 3FY2A 4RJ3A 2GNHA 2BROA 2P4IA 3T3UA 3K5VA 2C30A 4IVBA 4KA3A 1EH4A 4C8BA 4CG8A 3NVKI 3W2SA 5HTBA 3MJ1A 4P2KA 3Q4CA 3QUEA 3OY3A 3V6SA 5FDXA 4RIWB 3EYGA 3WZJA 4ANNA 3FEGA 4E8AA 4JAJA 4IAIA 3QGYA 2UZWE 4YZDA 3AT2A 4M84A 4UYAA 2OICA 3VUHA 4DAWA 4CQGA 4RWIA 4GS6A 4DTKA 3FKLA 5GZ9A 3DNEA 3RK9A 4L7SA 4WT6A 5CU0A 2ETRA 4GVJA 3VS6A 1GIJA 3KL8A 4PMSA 5FQDC 3VBYA 2WMAA 4TKSA 5K5NA 2WMRA 4J71A 4O7WA 5J9YA 4QO9A 4YJTA 4BBFA 4G9RA 2QOHA 4JXFA 3LCKA 4LYNA 3G15A 2CGUA 4G3CA 4PMTA 2YIQA 4GFMA 2R3LA 4FZDB 4K11A 3CR0A 3QYWA 4U44A 3ZBXA 2ITNA 5AA9A 1XH4A 4IANA 4X6RA 3SHEA 2ITOA 4F0IA 3WE8A 4QMNA 3D7TA 2Y7JA 4OBOA 5C8NA 1YDSE 4ONAA 2YM8A 2R3FA 5CSHA 3LQ8A 5I9ZA 5L2IA 4ZTRA 4FK6A 4DG2E 4Q2AA 4EWQA 3KXMA 5BYZA 3RPVA 2EXCX 5C01A 3UOJA 5CF6A 4UBAA 5L8JA 1YXTA 4U79A 4W8DA 4H3BA 1LPUA 1SVGA 2GS7A 3NCGA 2WTWA 4XJ0A 3EMGA 3R30A 3IW7A 4I93A 4YJNA 4CSVA 5EM6A 3PY0A 4GUBA 4HGEA 3ZDUA 3AC5A 1YXVA 5K0KA 5HD7A 3BYMA 3IPHA 3C4CA 3I1AA 3I5ZA 4EH4A 3G6GA 2YCRA 2ZDUA 4UEUA 4B99A 4HVHA 1PW2A 4D1XA 4XG4A 4QMXA 4WSYA 4DCAA 4QYFA 4YLKA 3C0GA 4CCBA 2F4JA 2W0JA 4LOOA 5AP3A 1PXMA 4KKHA 1T46A 3HV3A 4K9YA 2X9EA 2YLFA 4PDYA 4Q9ZA 5ACBC 5CU2A 2PVJA 1ERKA 1TQPA 5KMMA 3QA8A 1ZAOA 2JIUA 3U9NA 4P4CA 5J5SA 2DUVA 4YJSA 4FV3A 4FZ6A 3RGFA 1JBPE 3AD6A 3OCGA 4FNXA 4ZTMA 3D7TB 4MKCA 4G5JA 4BI0A 2PPQA 3BHHA 1CDKA 4BTMA 3U54A 4AG8A 2FUMA 2YJSA 2PTKA 3RM6A 4USEA 5HX6A 3QQUA 3O96A 3NUYA 2FSTX 3BIZA 3OBGA 1Y57A 2YAAA 4TNBA 5IQEA 2VO0A 2O2UA 3KMMA 3TKUA 4FV9A 4PDPA 4I6BA 1S9IA 3L8VA 4RC2A 1LEZA 3PIXA 4QP7A 1E9HA 3F3ZA 4EZ5A 3CY3A 3I6WA 3SOAA 5EHOA 3ALNA 1GZKA 5AP1A 3ODZX 4RQVA 3QZHA 3F3WA 4FKPA 5AMNA 2W9FB 3TV6A 5HVJA 4II5A 4BDGA 2WMXA 3BGQA 4BCKA 3NUUA 4YPDA 3RVGA 4BHNA 2PVYA 1OI9A 3C0IA 4AN2A 5AP0A 1OIUA 4L45A 1H1WA 2B7AA 4TN6A 5C26A 1YOMA 3HVCA 4OTHA 4EONA 3DZQA 5CF8A 3UNKA 3HP5A 2XK3A 2OF4A 4BWXA 5JZNA 3PPJA 4TYHB 3PJ3A 3E3BX 4I0SA 5EDRA 4BRXA 2XYUA 5EYCA 3I0QA 4I0RA 3TNWA 3UIBA 4CMUA 1WBTA 4J8NA 5AP2A 4QPAA 3GCUA 1T45A 2V55A 4FTIA 3PVWA 2NRYA 3BU3A 1VR2A 4AX8A 3R02A 4JIKA 4PMMA 4RA4A 3E87A 4HW7A 5DN3A 2RL5A 3OF0A 3TNPC 5IH4A 2YHVA 3JYAA 2W1HA 4YHFA 1YW2A 4RZWA 5AM6A 2BZHB 3PA3A 4PDSA 4QP6A 2R3GA 3WIKA 3CGOA 4FV4A 2PMLX 3SV0A 3F9NA 2CNVA 2OJJA 2UZDA 2XBJA 4NSTA 5KO1A 4CFNA 1U46A 1TKIA 3MTLA 3RNIA 3VS3A 3SKCA 2C5XA 1Q5KA 3QBNA 1OIQA 4RQKA 1Q8TA 4IEBA 4I22A 3ZFXA 5JGDA 4GU6A 1ZYLA 2YIYA 1OM1A 4OTPA 4GSBA 4AS0A 3GUBA 3QRUA 1MQBA 2XCKA 3ZRMA 4CNHA 5EKNA 5M06A 4R5SA 3GQIA 4FOBA 4IB3A 2R3IA 3QQLA 3VHEA 2Q0NA 2CLXA 1BI8A 3Q4TA 3C4XA 1P4OA 3GENA 4OTQA 3VF9A 5M4FA 1IAJA 5E8XA 3QCXA 4NUSA 3UZPA 2HW6A 2W4JA 4E4LA 4LMNA 3VVHA 4E5AX 4C4HA 2JKQA 2GFCA 3LCOA 3QLGA 4G31A 1UVRA 3MWUA 1CMKE 3R04A 5J9LA 4FUXA 5A54A 1XH6A 2BCJA 2ONLC 4JBVA 3QRTA 4BDCA 3P0MA 4YU2A 3CKXA 4BCOA 4YC3A 4KNBA 4KAOA 3QWJA 4GIIA 2OBJA 5F1ZA 5HLWA 1Y91A 3F69A 4RIYA 5K4JA 3HMNA 1G8SA 5IQDA 4C4JA 3JVSA 2XNPA 2YISA 4IH8A 5ANGA 4XV9A 2RF9A 5HBHA 1ZOEA 2Z2WA 3SGCA 4PV0A 3E8EA 4AUAA 4ZZOA 1PXLA 2PL0A 5H8EA 1W0XC 3PFQA 4BVUA 2RFSA 5CNOA 5BVOA 4CLJA 1PMUA 1XBCA 3PJ8A 1XBBA 4FSQA 4M67A 3I81A 2BVAA 2G1TA 2BRNA 3QRIA 5BUJA 4FSMA 4L68A 1JKKA 2G2FA 3BHYA 1MRVA 4QNYA 4EJNA 5B0XA 1KOAA 4IX4A 4MWIA 2QKWB 2X0GA 3EQHA 2C6TA 5EFQA 4FV2A 4RX8A 3NZ0A 5BNJA 3QTRA 5AUZA 2UZLA 4I92A 2VWZA 3FMHA 2B1PA 3C0HA 4M15A 3AG9A 3OOGA 3FLWA 4RFZA 3ZU7A 3V8TA 4GKHA 4V01A 4KBAA 3R1SA 3UPXA 4MD8E 2QO2A 4M12A 5CAUA 2E9NA 2OGVA 1XH8A 2QOFA 4B8MA 5IQCA 4M68A 3DDQA 4BKZA 3RMFA 3FMEA 4MTAA 2HZ0A 1A9UA 2VTIA 5EHLA 4MXYA 2PULA 3VNTA 2VWXA 3GC8A 4X7QA 3AC2A 3C9WA 4RIYB 4U3ZA 2WTKC 3FBVA 3R7OA 1LR4A 4ASDA 4M13A 2XNMA 3VHKA 3UDBA 1ZOHA 3KVWA 3H9FA 4EBVA 4EEVA 1O9UA 5HICA 4DLIA 3MVHA 5AV0A 2XEYA 3QCYA 1P14A 2WZJA 5DRDA 1P5EA 1JSUA 1UNGA 3FZPA 4FTAA 2P3GX 4JDKA 4ORKA 4ZSAA 3NUNA 3C50A 4F9YA 3VW8A 3UODA 5E91A 1O6YA 5BX0A 1XR1A 4O0YA 3GXLA 3G0FA 4FGBA 1IAHA 4LOPA 4F70A 1I44A 5HOAA 4F7JA 4RJ5A 3VIDA 1J1BA 2GNJA 4G5PA 4GK3A 3QHWA 4EJ7A 5IMXA 4UZDA 5I9XA 4DTBA 5HTCA 3ZLXA 2OIQA 2GHLA 3DJ5A 4O7TA 1OKVA 3B8RA 5EDQA 3GC7A 4YGAA 5D7VA 3TKIA 4AE6A 4XLIA 4F0GA 3PJ1A 4KIKA 2I7QA 4G6NA 3TUCA 4FG8A 3UQFA 3DA6A 3R7IA 4AW1A 5ANIA 4DFUA 5CQWA 3TJCA 4I41A 3N9XA 4CEGA 1CKIA 3ANRA 4FIGA 3BGPA 2J0JA 4OTWA 2BDWA 2UZBA 3VW6A 3B8QA 5KZIA 3PLAE 5M55A 2O0UA 3UO5A 5AIKA 3GCSA 3UO6A 2CDZA 5TOZA 3P7AA 2QOQA 2XNEA 2C3IB 3AD4A 4ZAUA 1JKSA 3OWJA 1UWJA 4TW9A 4IZ5A 3BE2A 4XP3A 4A9UA 3TT0A 4HVSA 4DN5A 2R7IA 5CVFA 4BDKA 3ANQA 3HA8A 2FGIA 5A46A 4ZJJA 3VQHA 3GU8A 5CEKA 5CLPA 3VC4A 5IKWA 4MD9E 4ZSEA 4FUYA 4MCVA 5HCYA 3K2LA 4RX5A 4Y72A 3KXHA 4AZTA 4BBMA 3LQ5A 1YRPA 3I4BA 4UWYA 1WMKA 4HVIA 5IQIA 2P2IA 4EORA 3PXYA 4JDJA 1TQMA 1Q61A 4FODA 2XZSA 3RKBA 2UZVA 2J9MA 2PMNX 4LOQA 4AW5A 5KMNA 1J7IA 3LMHA 2IO6A 4DBXA 4KIKB 4WBBB 4QQJA 4AXAA 4TWNA 2VO6A 3RPSA 4D9TA 2BR1A 3LFSA 3WBLA 1V0OA 1XH5A 4Y95A 3JS2A 4PDOA 2XK9A 3DT1A 5FXQA 1JSVA 2C5NA 2G15A 3ZC6A 1IR3A 1K3AA 4FICA 2R0IA 4LI5A 2GTMA 4WRGA 3CQWA 4A4OA 4FF8A 3EN5A 3K3IA 5FWKK 1WVXA 4IW0A 3EH9A 1IG1A 3I6UA 4S2ZA 4UWBA 4CKJA 4PQNA 1FVTA 4QP8A 2J5EA 3K54A 4FKQA 4BCMA 3E7OA 3I5NA 3TCPA 3MFUA 2YIWA 3E8DA 4JQ7A 4U9AA 5EOBA 3AC1A 4CCUA 3R83A 5CX9A 4CFWA 3ORLA 1P2AA 4I94A 4BR3A 3ORNA 1Q24A 4H39A 2F9GA 2ZJWA 4KWPA 5AR8A 1YHVA 3TJDA 4IDTA 5HE0A 4BDEA 4EZ7A 4NCTC 2R9SA 2W1DA 3VWAA 1WBOA 2JFLA 1AGWA 2XM9A 5FEDA 5GINE 2B52A 2VWVA 4DG3E 2NPQA 3QFVA 2V7OA 3QRJA 4N57A 3R1QA 5BVKA 4E26A 3T3VA 4QPMA 2ZV9A 3HRCA 4FX3A 4L8MA 2JC6A 4QT1A 4QMUA 3C4ZA 4NW6A 4O91A 4R7BA 4EBWA 2EWAA 2QHMA 3PG3A 4HYIA 4R3RA 5AAGA 3DXPA 5IQFA 4CRSA 4ANLA 2PUUA 3UE4A 2UZNA 3PSBA 2QLUA 5CI6A 2BPMA 1KV1A 4FIJA 4C2VA 1M7QA 3LXKA 4QP9A 2V5QA 4HYUA 4QP3A 5DEWA 2WXVA 1QL6A 4EQCA 2J7TA 1UKIA 4BI2A 4EOOA 2BKZA 5DR6A 2ZOQA 2ERZE 4G17A 5IMEA 4YZ9A 2W5AA 3RAHA 1A06A 4A06A 5D9HA 3CJGA 2W1EA 3VBVA 3WZDA 4E5WA 4JDHA 4TNDA 3QZGA 2QG7A 2ACXA 3D2IA 3PSCA 3Q9XA 1H00A 4RMZA 5J1WA 2VTMA 1G3NA 2CMWA 2ZM1A 3R8PA 2XIXA 3LMGA 3EFWA 4HPTE 2PZPA 4O0XA 5G6VA 3II5A 4R1YA 2VWYA 1WAKA 3R2YA 4DG0E 3KVXA 3R01A 3GBZA 4M66A 4RVLA 1RJBA 4FGRA 5DFPA 2R3QA 4EI4A 4FVRA 3MI9A 5DT0A 1M7NA 3DTCA 4PTCA 3WIGA 3O2MA 4AA5A 3T9TA 5HBJA 3VAPA 4EK5A 4EK3A 3S95A 5CZIA 4S32A 2R3RA 4F1TA 4EOLA 4HNIA 4IVDA 1H0VA 3EWHA 4EOQA 4WOVA 3W2RA 3LXNA 3RHXA 4YO4A 4O81A 2O64A 4DITA 3WF7A 4QOXA 1BI7A 1CKPA 4YBKA 3AXWA 3EQFA 3HV7A 1WFCA 3LXLA 5BYYA 2R5TA 4J99A 3WE4A 4WD5A 1I09A 4GU9A 4USFA 3G90X 5DE2A 2J90A 3W10A 1Q8YA 2XF0A 3U87A 1ZARA 2XJ1A 2HAKA 4XOYA 5CALA 4RFYA 4QTEA 4NM0A 5HVYA 3VJOA 3Q3BA 4XOZA 3GP0A 2RFNA 2X8EA 5CAQA 4U41A 3BU5A 4FE2A 5J8IA 1Y8YA 3NAXA 2XJ2A 5AUTA 1GNGA 3BHVA 5EM8A 3TUDA 3MY0A 1GAGA 3FLQA 4Y46A 3C5IA 3SXFA 3A60A 2YA9A 2WU7A 3L9MA 3TI1A 3A7FA 5KBRA 5L8LA 1BL7A 2O65A 3G6HA 4M3QA 4QD6A 4FG9A 3S4QA 1YHWA 2GNIA 4GT5A 4ITHA 3FI8A 3B2WA 1STCE 2CLQA 3O7LD 4RJ6A 4FG7A 3LLAA 4M7IA 2ZMDA 3QTSA 2Y0AA 2F2UA 5EKOA 4CRLA 3FSFA 5LARA 5FM3A 2WD1A 3ZM4A 5HI2A 3CIKA 3EZVA 3PIYA 2BHHA 3DQWA 5IDPA 2PMOX 4YHJA 4UXQA 5D41A 3C4FA 4W4WA 3RI1A 1RQQA 2CSNA 2JBOA 4EH8A 4F4PA 3BU6A 5IQAA 4IX6A 4C4IA 3EB0A 2IZRA 4HJOA 4IAZA 3AGMA 3KC3A 4G3EA 2RFDA 3L1SA 4X6QC 4X21A 2ETMA 5C03A 3OP5A 2BAKA 5C1QB 4XEYA 5A6NA 1H26A 2JDRA 2QR7A 5IA0A 3EN6A 3KRRA 1NXKA 1M14A 2VV9A 2Y4IC 4NTSA 5I3OA 3VN9A 4F6UA 4W4YA 1Z5MA 3NNXA 2GTNA 3NMUF 2XVDA 2UW9A 2XRWA 2XMYA 1PXKA 3KFAA 2R3NA 2OKRA 4QYEA 3DQXA 4OAUC 4AZWA 3OC1A 1WBPA 2JKKA 4BDFA 3P5KA 5IG1A 4JG7A 2VU3A 4IZYA 5HCXA 5DOSA 3CKWA 3EQPA 3QA0A 1XBAA 2PE0A 5CEPA 3DBCA 3DNDA 4IAYA 3VULA 4D0WA 1Y6AA 3PXZA 3RAWA 3WOWA 4TL0A 2JFMA 4Q5EA 1APME 4RC4A 3WI6A 5HG9A 2CKPA 1OUKA 2X8IA 4D1SA 2JKOA 4KBKA 3VF8A 4DBNA 5A4LA 2BZKB 5IUIA 3S3IA 2QO7A 3V3VA 2ITUA 3W2PA 2I0YA 4JS8A 1UU9A 4EZ3A 4X3FC 3NR9A 1E1XA 4R78A 4U6RA 1REJA 3DBFA 3GNIB 4FL2A 5GJDA 4RT7A 1U54A 2CGVA 4NT4A 4C36A 3CY2A 4XH6A 3VS4A 3LFAA 2AC3A 2WQEA 3FMKA 4ARKA 4DGMA 1KE7A 4PP7A 3A99A 3EJ1A 4IC8A 3MVJA 4O83A 4TXCA 3ACJA 4K8AA 4BFMA 2J0KA 3MA3A 3QXPA 3NYNA 3A61A 4RIWA 3M1SA 4K77A 2WEIA 3PYYA 4GK2A 2RIOA 5T3QA 3UVRA 3VJNA 4A9SA 5BMSA 4O1PA 5KMIA 4O82A 3Q5IA 3EQCA 1ZZ2A 4Q9SA 4ANSA 1PYEA 2V7AA 3NYXA 3FXWA 3UTOA 2ITZA 1R0PA 2UW0A 3BCEA 2R2PA 5HO8A 4PPBA 3FMMA 4KSQA 4XMOA 5A4TA 3LFEA 5ANOA 3MJ2A 2BDJA 4FTNA 2OSCA 3RCDA 4WO5A 1NT2A 3COIA 2PMIA 3ORXA 4I6QA 3UO4A 5AV2A 3A62A 4NIFA 5H8BA 5IEXA 5DMZA 4U40A 3VRZA 3W1FA 4FI1A 2PY3A 5HU9A 2C6IA 1GOLA 3KXGA 3NPCA 4G3GA 4JQ8A 5M08A 3QKMA 3JY9A 5FM2A 2VTPA 4GV1A 4Y5HA 3BEGA 3ZM9A 1NVSA 2PU8A 3E63A 3CS9A 3KF4A 3V6RA 2I6LA 2RFEA 2QD9A 3ZHPC 5AADA 4FV0A 3CBLA 2CKOA 2X7OA 3BYSA 3F61A 3MY1A 4BGQA 2XKCA 4XG3A 2EUFB 5AP5A 4CT1A 2RGPA 4CMOA 1B39A 4O6EA 4KUJA 4LRMA 5DG5A 3QGWA 3OEZA 4DGNA 2X8DA 4FNWA 3IONA 3U6IA 4TT7A 4U45A 1XJDA 3FDNA 1PYXA 5ANJA 5LVLA 3OWKA 2OXYA 3I7CA 3QALE 4BWPA 3DGKA 4TYEA 2CGXA 4GKIA 3SRVA 4I1ZA 4HVDA 1H08A 4YZBA 4L52A 5I9YA 3FE3A 3FJQE 3NX8A 4YSMA 4ZSJA 2YDKA 3HEGA 4GG7A 4QTDA 4O21A 5DIAA 3FKNA 4FYOA 2JITA 4ZS0A 4EK8A 3L8PA 3Q53A 1KWPA 4ACDA 4JR3A 3E62A 3ZZWA 3V5JA 4AOJA 3HGKA 2VTJA 3L9LA 4L01A 2QCSA 3OT8A 3WYYA 3A7HA 2WKMA 5M07A 3R8ZA 4NIFB 3LPBA 3S1HA 4APCA 4DEHA 4YLLA 3VUKA 3NRMA 5HG5A 5DNRA 2BALA 3ZSGA 2E9OA 4CFMA 2C5OA 5FLFA 5L4QA 2GQSA 2CJMA 5LWNA 3OWLA 5JFSA 5AEPA 4DEAA 3RAKA 4ACHA 4FSTA 3FLZA 4OAVB 5ANKA 4M0YA 2IZUA 4DYMA 5CSWA 4YP8A 4O7SA 2BZJA 3V8WA 5LQFA 3LMIA 2E2BA 2XK6A 3TIZA 1JOWB 2CNUA 5EYKA 2FO0A 5CT7A 5CU3A 5CEOA 5EM7A 4RWJA 3LAUA 4ZLOA 3D2KA 4YJOA 3TIYA 1ZY4A 5A4CA 5IQHA 4O0WA 4ASEA 3D4QA 2QU6A 3DJ6A 3GU5A 3F5GA 5EYMA 5A14A 2R7BA 1ZYCA 4IWDA 5L8KA 3HMPA 4WIHA 4ACGA 2PUNA 3ZO3A 3F3UA 3Q9YA 4MWHA 4EOMA 5CSPA 4NL0A 5HLPA 3ZMMA 4I21A 1BX6A 3SRVB 5C4KA 2IVUA 2PZYA 2C5YA 3QD0A 5CU6A 1WZYA
chains in the Genus database with same CATH superfamily
1YDTE 2YIXA 3DLSA 5CWZA 3SD0A 5CNNA 5M51A 1PMNA 2HXLA 5TKDA 5DT3A 3WZEA 1FPUA 1YOLA 1SNXA 3R1NA 4TYHA 2PVMA 4YLJA 4CYIA 4BJJB 4BZNA 3LJ2A 3SXSA 2XJ0A 4EQUA 2C69A 2X4FA 5F94A 3PG1A 2B54A 3QTWA 4MK0A 4XG6A 1SM2A 3KXXA 4WHZA 5G1XA 3R8LA 2WNTA 2H96A 4U81A 3ZYAA 3VBQA 4AGWA 3QCQA 4FSWA 3H9OA 5K0XA 4AW0A 4GYGA 5KCVA 2YABA 4WG3A 1K2PA 2IN6A 3U6JA 1KE9A 3H4JA 3ZLSA 4WRSA 5EI8A 3RAIA 4Z7HA 1GIHA 2VRXA 5CEIA 2Y8OA 2UVYA 2V0DA 3QXOA 3OUNB 5I5ZA 1PKDA 3GOKA 3KN5A 4LL5A 4C62A 3ID6C 5E90A 3SQQA 2XK7A 4RZVA 4YZMA 4E5BA 4MXOA 3U6HA 1ZZLA 2W5BA 3POOA 2WQOA 4FKIA 3QTQA 3R9OA 4V05A 3TG1A 4GYIA 4DT9A 5GZ8A 4EOIA 2HY0A 5IDNA 3SG9A 3R71A 4LGHA 1OL1A 5HO7A 3WZKA 1PMVA 5AUWA 4YMJA 5EK7A 2ITTA 3OG7A 1VYZA 1DI9A 3Q60A 2QQ7A 3EQRA 3FZOA 3OWPA 4ZIMA 2P0CA 2XH5A 5L6OA 4OTFA 3KEXA 4R5YA 4F08A 3UG2A 1OPJA 1XO2B 4BTKA 3CEKA 4OUCA 1REKA 4YJVA 4WNMA 3NW6A 4NU1A 3OCSA 3V51A 4EKKA 2VX1A 5I4NA 2EB2A 4C59A 2FYSA 1PXPA 5LMBA 2Z7SA 5FDPA 3ML1A 3AD5A 1J3HA 3PA5A 2X0PA 2YN8A 3MA6A 4GH2A 3UIXA 1H1PA 5JK3A 4F78A 4P7EA 5CF5A 1H0WA 3LXPA 3PIZA 3ET7A 1YDRE 2J50A 1XWSA 4IE9A 1BLXA 3ZUTA 5E8SA 3ZLWA 5FXRA 2PHKA 5AR4A 2YWVA 3IK3A 4D4SA 4FV6A 5IA5A 3D5UA 3F82A 5J9ZA 5AFVA 3E8NA 2VTAA 5E8VA 1P4FA 4FT7A 3DB8A 4HYHA 3R9NA 3SOCA 3LFFA 2OLCA 4FTTA 4E93A 2XS0A 4Y85A 4DH1A 4RGJA 4R8QA 3TZ7A 1IEPA 3R9RA 2ITXA 3CGFA 4LQMA 4ENYA 4O0TA 3D5VA 4DFXE 4YTHA 2QI8A 5JT2A 3WILA 3TYKA 2ONLA 4A4XA 4BCPA 4R1VA 5EYDA 3LFNA 4PPAA 5LMAA 4D4RA 3PTGA 1X8BA 4YUQA 3ZFYA 4H1JA 3DKCA 4D1ZA 2C5VA 1CTPE 3NAYA 3QD2B 5L2QA 2OXXA 4U43A 4EL9A 2ZB1A 2GQGA 4I5HA 3KCFA 3EZRA 4UMQA 4NH1A 2VO7A 3R00A 1Q97A 4CZUA 2JEDA 1QCFA 2W4OA 3D5XA 5HGIA 3QC9A 4IJ9A 4XV1A 4ACMA 4U0IA 4O4FA 2IG7A 5J7HA 3ATSA 4QQ5A 3EN7A 4U5JA 5E7RA 4EH3A 4TY1A 3SLSA 5JSMA 5KZ0A 3ETAA 4NJDA 2Q83A 2GDOA 4FT5A 4XG2A 4AU8A 3UNZA 2PVRA 4X3JA 2GNGA 3H0ZA 4H58A 4ZOGA 3W55A 4U97A 3A4OX 4XRLA 3NNWA 3QD4A 4EHEA 3HECA 4HCVA 4YPSA 4BCGA 1OKWA 5EG3A 5AM7A 1GZ8A 1UNHA 5ETCA 5LXMA 5L3AA 4D5HA 4L9IA 5AV4A 3UYSA 2VTTA 2R3KA 1OPKA 4JBOA 4D2SA 3AOXA 4DINA 3PWYA 5D11A 3MH2A 3OY1A 2XNGA 2VX3A 4HYSA 4BCNA 1JLUE 1OBDA 4L3PA 4O0VA 4AQCA 4FV5A 4JT3A 2X7FA 5DT4A 4Q5HA 5FP5A 2QLQA 4U42A 2YM4A 3TL8A 3SDJA 3UG1A 2YCSA 4O84A 4FSUA 4EH6A 4YTCA 5LWMA 4FKUA 2GSFA 3BQRA 2I0EA 4EYJA 4JQEA 4FV7A 3BLQA 3G9NA 5EW8A 1M52A 1Y6BA 4EOJA 2PZIA 3D14A 5B2MA 4L44A 2ITWA 4ACCA 3Q32A 2C6DA 4AT3A 1ST4A 3P79A 4IM3A 1KUTA 3FMNA 3F5PA 3L9NA 3ZO2A 5LMKC 3Q9ZA 4MNFA 4FKOA 4JIAA 1QPJA 5CI7A 2PVLA 4ALUA 2CNQA 3QKLA 1M2PA 1YI6A 1OGYA 1ZYDA 2XM8A 2R3MA 4FTOA 4ZTSA 1R1WA 2BILB 3LLTA 2UW8A 3E93A 2BRBA 4E1ZA 4GCJA 4JAIA 2B9HA 3HA6A 5FXSA 5JZJA 1OZ1A 5F20A 2W1IA 1UU7A 2WIPA 4F9CA 3RPOA 2QOIA 5JRQA 2HW7A 3IO7A 4XRJA 2WFYA 3DTWA 3CD3A 1PXNA 2P33A 3TM0A 3UDZA 3RJCA 4K6ZA 4GL9A 4BZDA 3FY0A 3IG7A 2QHNA 2DQ7X 3IW8A 1BL6A 2IZTA 3FSKA 3H3CA 4H3PA 2DYLA 2X39A 4OW8A 4DF3A 2AC5A 4F9WA 3TZ9A 2WHBA 4CFUA 3AMAA 2HK5A 4M97A 3O8TA 2OIDA 3FZSA 4QQCA 2OH4A 3WF9A 2BAQA 4BIBA 4FTMA 2WTKB 1ZWSA 2O8YA 2YCQA 3P1AA 4BTJA 1KOBA 2C1BA 2EXMA 4NEUA 2XK8A 4IB0A 1GZNA 2HWOA 2HELA 4FEQA 3LZBA 3UMXA 4FC0A 5KKRC 3WARA 2PVFA 4RVTA 2QODA 4AFEA 3S0OA 2A2AA 5FEEA 3W8QA 1FBNA 2SRCA 3P7CA 5AR3A 2OZAB 5AP6A 5AA8A 2JD5A 2CPKE 2EVAA 3NDMA 5JH6A 3EIDA 3SAYA 4C3PA 2E9UA 3QQGA 1U5RA 5CXHA 3TEIA 3U4WA 4AQKA 3D0EA 5TF9A 4IWOA 3FKOA 3NIZA 4I4FA 4QMTA 3O5AA 3DZOA 4ITIA 4Y83A 2C3LA 5A9UA 3QHRA 4QMYA 4FA2A 5IH6A 2P2HA 4RJ4A 5KKRB 3TXOA 2J51A 3LFCA 4J7BA 4U3YA 4DCEA 2G2IA 2XANA 4IB1A 5AJQA 4FEXA 5KMJA 2Z7LA 5L2SA 4L7FA 1VLRA 2VN9A 2W1FA 1GZOA 3DK3A 4F1OA 2QKRA 4CKIA 2C6MA 3EKNA 2QR8A 3HLLA 5LCKA 3RALA 4AZEA 4CTBA 2UUEA 3A8WA 3BRBA 2UW3A 4F9BA 4MXAA 4PRJA 1IA8A 4IAFA 3OXTA 1JAMA 2H8HA 2EXEA 3O7LB 5C8KA 2C3JA 4QYGA 2XEZA 4ZSLA 4C33A 4I3ZA 4GFGA 2VD5A 2W1ZA 3KRJA 3QQHA 1FINA 4XV3A 5M57A 3N4UA 1RE8A 1G8KA 1DS5A 4BDHA 5HLNA 1YOJA 5ETFA 5F95A 2YDJA 4AN9A 4C4GA 3RK5A 1URWA 5CS6A 4JLCA 3FXXA 3NEWA 4V04A 5DHJA 2Y9QA 3TN8A 3COMA 4NYEA 2VTNA 3W0MA 1M2RA 5JFXA 1FVRA 1GJOA 2WELA 3H10A 3MS9A 3PWDA 4NFMA 3O0GA 2V22A 3BV2A 4Y8DA 3V5QA 1J7LA 2DWBA 3JR1A 1PY5A 3A7IA 3SC1A 5AUUA 2UV2A 3HV4A 3QKKA 5HHWA 2HY81 4AT4A 2R3HA 4YJUA 4DH7A 2VNWA 4IWPA 3SX9A 2CN5A 3W33A 2VUWA 5DPVA 5DWRA 1QPCA 3CTHA 4MBIA 4BWKA 3FYJX 2OW3A 1OL2A 3PRIA 2W1GA 4ZZMA 3QF9A 4NM7A 3R1YA 5HIBA 4NCTA 1OL5A 5M4CA 1AD5A 4JNWA 1M2QA 2YDIA 3BYOA 3OFMA 3FQEA 4GUEA 1OBGA 3CLYA 4OGRA 4MUQA 1L3RE 1QMZA 2C1AA 3OBJA 4C57A 4KBCA 3PSDA 3ZSHA 3AKJA 1SVEA 4L43A 1JVPP 4O22A 4ZTLA 2VGOA 2QURA 4YC6A 1URCA 2ZV2A 3NUPA 5IUGA 2O63A 3EL8A 3TTIA 1Q99A 5E8TA 4X2FA 4E4NA 4FTLA 3BQCA 3MW1A 3HRBA 4LMUA 5HX8A 2OO8X 2F7ZE 4PNKA 2YZAA 5EDPA 1H25A 3F5XA 3HYHA 4KKGA 1J1CA 5HU3A 3UMWA 5J1VA 5FTGA 3IECA 4K2RA 5E8ZA 3NUAA 3QAME 2Z7RA 1ATPE 3CPBA 4J52A 5HESA 5CEQA 5A4QA 4I6FA 3H30A 3LFQA 4FT9A 4KIOA 3H9RA 5HZNA 4RJ8A 5CAOA 4M0ZA 3PFYA 3D94A 4PX6A 4PMPA 2HENA 3HAVA 1PJKA 5H3QA 2ZFYA 4JMQA 2GU8A 2G9XA 4FL1A 4FKSA 4A4LA 1XKKA 3PP1A 2YITA 2BTSA 4G1WA 5D10A 4QMPA 4C3RA 3RHKA 1YKRA 4FNZA 5CENA 3KY2A 4YTFA 3MPAA 4AGCA 1MRYA 2WAJA 4EOPA 4WNPA 2WOTA 2OU7A 4RA5A 3NNVA 3A4PA 3QCSA 4BBEA 5KE0A 4M69A 3MIAA 4GW8A 3GEQA 4IAKA 4FSZA 2OJ9A 2WO6A 4OT6A 5EI6A 5JGAA 1V0BA 4IM0A 2XKFA 4UN0C 5C27A 5M56A 5E8YA 1YWRA 4JBPA 2C6LA 3UOLA 1U4DA 4G6OA 1TQIA 3FLSA 2B4SB 3D9VA 2AEGA 3E92A 3GCVA 3I0OA 3A2CA 3OROA 4CD0A 2NP8A 3B2TA 5DR9A 5IZFA 5IQBA 4WKQA 5DI1A 2XIRA 3BEAA 4F7LA 1Q3WA 4BY9E 2I0HA 4K18A 2W96B 4TYIA 3ULIA 4OLIA 3ENMA 5A4EA 4IBMA 3JPVA 4QDVA 4A9YA 3RNYA 5KUPA 4DHJA 2I40A 4G9CA 4RWKA 3W32A 2VNYA 2IVSA 3OHTA 4UWCA 3DY7A 2GHMA 4IDVA 1F3MC 1JWHA 3QUPA 3NYVA 1Q8WA 3L8SA 5I9VA 4BDJA 3FC2A 3GU7A 3FAAA 4ID7A 4HGSA 4U7ZA 1FVVA 4GRBA 5C4LA 1W8CA 4BGGA 1Q62A 5LVPA 2F49A 3HP2A 4X2JA 3D7ZA 3BPRA 4M69B 3NW5A 4P5ZA 4BHZA 2RSVA 3MV5A 5EW9A 1AQ1A 1PRYA 3QX4A 2BDFA 3EFJA 4RLLA 4RRVA 2X4ZA 3OD6X 4FNYA 2HZ4A 3WF5A 3EQGA 4ZEGA 3ACKA 5LOHA 4DEDA 5TE0A 1NA7A 3TZ8A 1V0PA 2YWPA 2UW5A 3ENHA 3QYZA 4BDDA 5HG7A 4S31A 4AAAA 4BCHA 4E6QA 3BLAA 3R6XA 4XNEA 2PE1A 2JIIA 4ALVA 3PPZA 3Q6WA 1OMWA 2ZM3A 3JXWA 4E3CA 4H1MA 2XKDA 2VTRA 3DDPA 3ZCLA 2JBPA 4DH5A 4ZS4A 4CFVA 3OW3A 2CCHA 2BHEA 3V5PA 1MQ4A 4RIXB 3ZEWA 2YEXA 3BBWA 5BQ0A 4MBLA 3ZDIA 3FC1X 2OJIA 2QOOA 4JBQA 4DEBA 3W2QA 2XP2A 1FMOE 3OZ6A 3VUTA 3ZSIA 4F65A 4LL0A 3ZONA 2A19B 4FIHA 4RX9A 5FGKA 1G5SA 4RLKA 3GT8A 2F2CB 4IXPA 2RG5A 5EH0A 5IQGA 3ZEPA 2R4BA 2H6DA 4EHVA 4B7TA 3P7BA 4A7CA 4C7TA 5AR2A 3W2CA 2J2IB 2X2KA 4C61A 3KIOC 2WEVA 5LVOA 3OCTA 3NWWA 5BYLA 2WPAA 2BKKA 4CZYB 4I0TA 3MSSA 4FRFA 3THBA 4PNIA 2QOLA 4BKYA 3I60A 2CKQA 4RWLA 2X2LA 4RPVA 4O27B 5FG8A 4JG8A 2WOUA 2YFXA 2XAOA 3BLRA 4CFFA 4TWPA 4EC9A 3KQ7A 4X3FA 5HIDA 4AA4A 2GNLA 1ZLTA 4Z9LA 5CY3A 2XIZA 4BDBA 4L00A 5CQUA 3K3JA 3DOGA 4R77A 2Z60A 4XBRA 3QTUA 4MX9A 3UP2A 1PKGA 2WTDA 4DFZE 5ANDA 2FSMX 3UOKA 2Y4IB 3QTXA 4WNOA 2ITVA 3LM0A 4OR5A 3ZLYA 3KCKA 1CM8A 1ZXEA 3QL8A 4OTGA 3OTVA 5H8GA 4CMTA 4TZRA 4LRKA 3AQVA 3C7QA 3MYGA 2QG5A 1JKTA 3C4EA 3NIEA 5DRBA 1XMLA 2W1CA 1DM2A 3QQFA 3KMWA 4GG5A 4XYFA 4E73A 2JDSA 4YR8A 4USDA 5CANA 3PJ2A 4O0RA 4EQMA 2BUJA 4KRCA 4PY1A 3FZ1A 5D12A 5J95A 5GZAA 5EQPA 4EH5A 4AACA 4W9XA 4WSQA 2XB7A 2YCFA 3DBQA 4XP0A 2NNWB 3K5UA 2WU6A 3BV3A 5L6WL 5HORA 5E1SA 4BCIA 4L67A 4IQ6A 4WG5A 3UGCA 3PXQA 5HE1A 3QTZA 4XG8A 4O0UA 3R0TA 2C0OA 2Y6OA 5ICPA 4O4CA 4W9WA 4JOAA 2GS2A 3AC4A 5L2WA 4AZVA 2HCKA 2UW4A 5CU4A 3F5UA 1YWNA 2I0VA 4I5PA 5E8UA 4XS2A 1SVHA 5AIRA 4FEUA 3OTUA 4O7VA 3F6XA 3GFWA 3F3VA 4BL1A 1LUFA 3F2RA 5FP6A 5LCJA 1ZMVA 3GC9A 4RJ7A 4UXLA 4X3FB 1SYKA 4MF0A 3MPTA 5I3RA 2WTJA 5A6OA 3VO3A 3AKLA 4IVCA 1VZOA 4MAOA 3QQJA 4TYGA 5HKMA 4O2ZA 3KB7A 3VBWA 4RG0A 4XG7A 1OB3A 3Q9WA 2JAMA 3P4KA 2WB8A 2W4KA 4OT5A 4YZNA 5DBXA 5HBEA 4RC3A 2J6MA 3D5WA 3R63A 4KIQA 1SZMA 2W7XA 5HCZA 3MY5A 4YO6A 1PF8A 4C38A 2CKEA 1YXSA 3IQ7A 2VWWA 3F88A 3LE6A 4J96A 5HG8A 5K3YA 4G16A 4F6WA 3IGOA 4FIEA 1OIYA 3A7JA 4FR4A 2F7XE 3HDMA 4L6QA 3E88A 5IUHA 5HE2A 3QUDA 5LJJA 5EI2A 4YURA 5M4UA 3DK7A 2B9JA 3GGFA 2UZUE 4B6LA 4ZJVA 1L8TA 4O7NA 5M09A 4IACA 5IA1A 3DAEA 4QP1A 4F7NA 5CYIA 3N4TA 3BE9A 3DAJA 3QTIA 4BYJA 2PVHA 4IWQA 1JSTA 2F7EE 3ZUVA 3KF7A 2V62A 2XNOA 3U55A 2WTVA 4FZFB 5DH3A 1W83A 4LUEA 5AAFA 5E9EA 2KTYA 4J8MA 2XIYA 3U9CA 3VONA 2QVSE 3OVVA 3FMLA 3DXNA 4E7WA 3EQIA 4GT3A 2BAJA 3BELA 5I9WA 1OL6A 5BMMA 1MP8A 1F0QA 2WTIA 3CQEA 1HOWA 3IW6A 3ORKA 3EL7A 3GCPA 1WVWA 3P9JA 1UKHA 4OTRA 4QRCA 3LW0A 3R7UA 3BBTB 2G2HA 3CTJA 4UY9A 3VS7A 4BCFA 4X2GA 3ZBFA 4FV8A 1J7UA 2BMCA 3UBDA 5JKGA 4F63A 4OTDA 2X6EA 4LFIA 3BWJA 4IHPA 2VTLA 5BVNA 2IEWA 2IVVA 2OWBA 4NJ3A 4CTCA 4ERWA 4O0SA 3RBWA 1ND4A 3R28A 1OKYA 4CZTA 3SVVA 4MH7A 3W0QA 2YIRA 4ZP5A 4YHTA 1GY3A 1RW8A 3HDNA 3PPKA 3PJCA 4BC6A 4CV9A 3JUHA 4W4VA 2H9VA 4HNFA 3ELJA 4S34A 3PDTA 4QMLA 1UU3A 4XUFA 3AGLA 3MFSA 4U8ZA 1UWHA 1XH9A 3O23A 2ZVAA 4FZ7A 2B9FA 4C0TA 3ATTA 3W8LA 3ZC5A 4IM2A 4TWOA 3ZUUA 4ASXA 3P86A 2PWLA 3BGZA 1NVQA 3PRFA 3R21A 4IAAA 4ZLYA 3FI4A 1YI4A 2XNBA 3NCZA 3NUXA 3RCJA 3R7GA 4NZWB 4F7SA 4GMYA 3IKAA 4LG4A 5JFWA 4FKGA 4EH7A 3OXIA 4A9RA 5TO8A 1KSWA 2NO3A 4G2FA 2FH9A 3S2PA 1SMHA 3W16A 4DA5A 5DVRA 3FUPA 4DHIB 3MTFA 1FOTA 2Z8CA 3GU6A 4NKSA 3POZA 2QO9A 5DYJA 2PVNA 2R64A 3PE1A 5E1EA 4DEGA 2ZAZA 3ULZA 4P90A 4YJPA 3G5DA 4Z16A 3Q2JA 4BCQA 4FEVA 5J87A 4FK3A 4KKEA 5A3XA 4HCUA 4E6CA 2CCIA 4JR7A 1A48A 2OIBA 3HAMA 2RKUA 4ZLZA 4AWIA 3IDPA 2ZB0A 2W9ZB 1Q3DA 3KXNA 4HGTA 4O1OA 3VS5A 3VRYA 3ZXZA 4J98A 1NW1A 2C0IA 3BLHA 3F3TA 3OS3A 4I24A 2CN8A 4D4VA 3LJ1A 5F4NA 4DLJA 4Z3VA 1BYGA 2PVKA 2QOKA 1OPLA 4MYGA 5F9EA 3HL7A 4QMSA 3ZOSA 5JGBA 4D2RA 4MQ2A 1OGUA 3PLSA 5EW3A 4E4XA 3EQBA 5JQ8A 2PUIA 1YXXA 2J5FA 4R7IA 3EFLA 3FHRA 3UJGA 3BYUA 2IVTA 3MESA 4CKRA 2O5KA 1Q8UA 2UVXA 2PYWA 2W99B 5HIEA 1E1VA 4EH2A 5IA4A 2XYNA 5JRSA 2VGPA 3T8OA 2PZRA 3GCQA 4PP9A 4EH9A 5L2TA 3SXRA 2PSQA 3EOCA 3GOPA 2A4LA 2OI4X 3I79A 2UW7A 3TNQB 3MB7A 4J95A 3W0OA 4FMQA 4AXFA 5KHWA 4RFMA 4S33A 3KXZA 2BIKB 3RZBA 1Q4LA 5FD2A 4DC2A 4WG4A 3PP0A 3LCTA 4S30A 3NVMB 3HV6A 4FIIA 4EWHA 5J5TA 2GCDA 1YVJA 3KA0A 3C1XA 3LIJA 3MB6A 1MUOA 2QU5A 3OT3A 3PZHA 3G51A 3KN6A 4NWMA 4W8EA 5CVGA 5DEYA 4DFBA 3JY0A 4MD7E 1FGKA 3VS0A 1W84A 1H24A 3UC4A 4LV5A 4PTEA 4FBXA 2C6KA 2PZ5A 3UIMA 4XCUA 3N4VA 3FQHA 3IOKA 1PXJA 4YZCA 5DR2A 3QU0A 4FOCA 4QMVA 2IPXA 3NNUA 4CFXA 1LEWA 4G3FA 3HNGA 4XLVA 4MHAA 2UZOA 3ZTXA 4IX5A 3LOKA 3DCVA 5FEQA 1OECA 1FQ1B 2EU9A 2X6DA 4C02A 4HPUE 4MVFA 5AV3A 3KRWA 3DFAA 3FQSA 2WMSA 2XUUA 5AR7A 2ZYBA 3HRFA 3MGYA 1YHSA 3AT3A 3ORZA 4BI1A 1Z9XA 3D15A 4J53A 2C68A 2GHGA 4O6LA 5EOLA 2J0MB 3BHTA 1S9JA 3QQKA 3C4WA 3OOMA 5AP4A 1UNLA 5IA2A 3R2BA 3AC3A 2BTRA 5IH5A 2UVZA 2YM5A 1R0EA 1XH7A 2GFSA 4QTCA 4IFGA 4FIFA 5CXZA 4D5KA 5B7VA 3ZFMA 4FKLA 4MBJA 1QPDA 4LGDA 3OEFX 4UZHA 4FT3A 4MEDA 3V04A 3QRKA 5JN2A 1U59A 3HUCA 5K5XA 4O2PA 3RM7A 5E92A 4O7ZA 2YERA 4EKLA 3BKBA 4JX7A 4FTKA 4ZTNA 4E6DA 5CSVA 5GIOE 2X7GA 4JG6A 2WIHA 3EN4A 2JAVA 4BKJA 3LFDA 4DFYA 4L3LA 3FLYA 4I6HA 2Z7QA 4C4EA 5IEYA 1PMEA 3DKFA 3FYKX 5CVHA 3OMVA 4ANMA 2CGWA 2W05A 5TR6A 4DH8A 5LMKA 2HYYA 4FKJA 5FTOA 4V0GA 2ZV8A 1DAWA 4FVPA 3TTJA 4EUUA 3VUIA 5KMOA 2GMXA 5AX3A 4CG9A 4UMRA 5HVKA 4A07A 3EN9A 3O17A 3HUBA 5B2KA 3UYTA 2ZMCA 4UALA 1H8FA 1W98A 3VS2A 3PA4A 2WMBA 4FKWA 3GFEA 1HCLA 5AUVA 3MPMA 2XNNA 4EOSA 3F2NA 5KHXA 2FSOX 4EHZA 3PVBA 3ZS5A 4YC8A 3R8UA 4Y73A 4A9TA 3AT4A 3ORMA 2H34A 4KSPA 5FBNC 2VWUA 2CHLA 4RIOA 4P5QA 2OZAA 3DKOA 4XP2A 4CLIA 4CT2A 3BX5A 3LCSA 3UIUA 2ZV7A 4NM5A 2YAKA 4IMYA 4LRJA 4D2PA 3ZO1A 1H1QA 4N6YA 1IRKA 5T6KA 1VYWA 3E5AA 3PVUA 4AT5A 3FHIA 3BZ3A 4PWNA 2OH0E 3AMYA 4UX9A 4MNEA 1JQHA 4LV8A 1WVYA 3Q5ZA 4QMZA 3TKHA 3W0PA 3FL4A 2WTCA 1LP4A 3NGAA 1KV2A 3FZRA 5D7AA 4C3FA 1WBSA 2JDTA 4AP7A 3M11A 2WMTA 3VQUA 4ZSGA 2WQMA 4V0GB 4GK4A 4FKRA 4KS8A 4BYIA 4BZOA 4E6AA 3AMBA 5B2LA 1W2FA 5HD4A 3REPA 1OIRA 4IC7A 5E8WA 4RSSA 5GJGA 2IW8A 2LAVA 2GS6A 3UQCA 3NUSA 3HZTA 1KE6A 3RZFA 3UOHA 4DEIA 3N51A 3HKOA 3UVQA 3V5TA 4DTAA 3RPYA 3FV8A 1PHKA 3EFKA 5ANEA 2ZM4A 4L46A 3IGGA 4PUZA 3W2OA 4CXAA 5BUEA 3UPZA 3FMJA 2XK4A 3FPQA 3GC0A 1ZYJA 3U8WA 4D2TA 4DFLA 4KINA 3Q4UA 3SA0A 2B0QA 4GJ3A 4EK6A 4QEBA 5LVNA 3LCDA 4R7HA 3ORTA 1W7HA 4BDAA 2R3OA 2OG8A 3TNHA 3HMOA 3W0RA 3BWFA 4ZMFA 3OXZA 2FB8A 2Z02A 4O86A 2BRMA 3ORPA 4WUAA 3SG8A 3M42A 4DEEA 2J0IA 2YM6A 2VAGA 3DBDA 4H36A 4RVMA 5HNBA 4YTIA 3RINA 2VTQA 4IZ7A 4QPSA 3FZTA 3P23A 2C3KA 2OJGA 3NSZA 4TPTA 3VS1A 2R0UA 4XX9A 3UP7A 4MNEB 1YXUA 5HE3A 5AR5A 3CC6A 3PY3A 2XKEA 2C4GA 4NTTA 3DV3A 3TV7A 3ODYX 5IF1A 4FKVA 4UB7A 2IZSA 4D9UA 4YNOA 3H0YA 4MXCA 3RWQA 5KMKA 1WCCA 5KBQA 3CTQA 4ANBA 3U4UA 2VO3A 3VBTA 5IEVA 5M44A 4C35A 5IISA 2WMUA 4WNKA 1BUHA 5BVFA 5J79A 1JPAA 5HNGA 5CASA 4IVAA 1IASA 4APPA 1GIIA 1SNUA 3AC8A 4UMTA 5FBOA 3MBLA 3CCNA 4ZZNA 4IZAA 4EC8A 4UMUA 5BUIA 3KU2A 4QQTA 4N70A 3LKMA 2QNJA 5JEBA 2C0TA 1W82A 2JGZA 5EQYA 1M17A 4QMOA 4CYJA 5CF4A 5CTPA 2QOCA 4B9DA 5FRIA 3P78A 3V5WA 3DU8A 4X2NA 3FXZA 2XIKA 4HCTA 3NYOA 2OFVA 3FI3A 4F0FA 4FTQA 3IDBA 2UZTA 3QC4A 4ALWA 5AWMA 1YI3A 2XCHA 2YZLA 3PE2A 1UV5A 3BHUA 4I5MA 1R3CA 4IJPA 3L9PA 2PUPA 3ZH8A 2LGCA 4WUNA 2C6OA 4O7YA 2WGJA 2X2MA 4D58A 2A27A 3TACA 4YNEA 3SW4A 4AOIA 4QMWA 1OITA 3UVPA 1Q41A 2J0LA 3O50A 2Y4PA 4JI9A 4X0MA 4BDIA 2IJMA 4QP2A 5GNKA 3C51A 2KULA 3ROCA 5EM5A 3DPKA 4AFJA 5BVDA 5EHYA 3ZRLA 4DGOA 4FZAB 4H05A 3Q52A 3GVUA 3R8VA 3KREA 3ZZEA 1XMMA 4FV1A 4IX3A 5EQEA 5E4HA 3G2FA 5FTQA 4AGDA 5CSXA 3C5UA 5GIPE 4QDEA 2BZIB 4ZY4A 4LUDA 2NRUA 2B55A 4AOTA 1B6CB 4UMPA 3DFCB 4HGLA 3O71A 5AUXA 4WBOA 3KRLA 4YJQA 4AA0A 3ALOA 2X1NA 4G3DA 3BYVA 3IW4A 3NS9A 2JIVA 5D1JA 3VBXA 2PK9A 3R9DA 4AW2A 4DGGA 4EHGA 3DXQA 3EHAA 3W18A 5K4IA 4XBUA 1ZMUA 2VTSA 2GPHA 5K9IA 5JFVA 3CXWA 4FTCA 1IA9A 1J91A 1O6KA 4ZMEA 4R3CA 3I7BA 3CJFA 3MFRA 2DS1A 4F09A 2UW6A 4JRNA 2BRHA 4IFCA 5BVEA 4B0GA 2HOGA 3LQ3A 3KULA 1UU8A 3MIYA 4ZJIA 5H2UA 4BB4A 4NKAA 4O96A 2X81A 3Q04A 4HZSA 2W5HA 4ZTQA