1VEBA

Crystal structure of protein kinase a in complex with azepane derivative 5
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structure-based optimization of novel azepane derivatives as PKB inhibitors
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 100
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1vebA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1vebA02
3MA3A 1PW2A 2FVDA 2XF0A 2OXXA 4XG3A 3RWQA 3WZDA 2Y0AA 4FTNA 2ETMA 5H8EA 3ZRMA 2DYLA 3ALNA 4A4XA 2EB3A 2VRXA 1H0WA 4RG0A 2Y8OA 4KIKB 3BV2A 3SOAA 4EOLA 3F2RA 4JQEA 4F7JA 2Y4PA 2YIWA 2LGCA 4FNZA 5CASA 4HVHA 5JFSA 4YJTA 3UOJA 3Q53A 3FKLA 4FL2A 5IMXA 2YA9A 4L3LA 3TNQB 3AG9A 3GVUA 2B54A 1WBTA 4EQMA 2Z60A 4GFOA 2R3QA 3T9IA 3POOA 3EN7A 4DBNA 3OW3A 2WPAA 2QLUA 3QLFA 5L8JA 5HNIX 2OH4A 3K5UA 5IMEA 3UODA 2JDVA 5HBEA 4FMQA 4USDA 5GIPE 2J9MA 1M2QA 4M15A 5CEQA 3OF0A 3QRJA 4EWHA 4RA4A 2QG7A 4LRMA 4GRBA 4CTBA 5EM5A 4EQUA 1H0VA 5D41A 4D5HA 5BUIA 2HELA 3F7WA 1P5EA 3BYSA 4FOBA 3MFTA 4AE9A 1YRPA 3PPJA 3UGCA 4RZVA 3G2FA 4HJOA 4FIHA 3K2LA 5HO8A 5GZAA 4QD6A 5JFXA 4HCTA 1NW1A 4BWXA 3PTGA 1W7HA 2BAKA 3BBWA 3ZBFA 4CFVA 4O1OA 4ASXA 4NM7A 4AW5A 1A48A 3GC9A 1B38A 4FYNA 2FYSA 4E3CA 3GCQA 2GS7A 3BLRA 4NZWB 4S30A 4YLKA 1MQ4A 3EQFA 3VS7A 4D0XA 4HVIA 5KHWA 3ZC5A 2J7TA 4IAZA 3WI6A 4E1ZA 2AUHA 3CKWA 3G0FA 4QMWA 4D1SA 4QT1A 3O0GA 2YHVA 3DAJA 3CQWA 4YTHA 2PVJA 3W2QA 3QD3A 3NPCA 3TNIA 3H0ZA 4IVAA 2OH0E 3DJ7A 4P90A 3WOWA 4DEGA 3Q2MA 4EYMA 3R1NA 4W8EA 2QHNA 4WO5A 3LFDA 4BCKA 3M1SA 4KUJA 3SVVA 4YSMA 3PJ3A 4FL1A 4E4NA 4FZ6A 1U5RA 4U8ZA 2WMUA 4ZEGA 4R1YA 2BDWA 4AW2A 5DEWA 4C58A 4UV0A 1BI8A 4I22A 1M2PA 1XWSA 4FV3A 3P4KA 1UVRA 2VX1A 1YXXA 1Z5MA 2P2IA 3S0OA 5HNGA 4IJPA 4Y8DA 3DZQA 2QOCA 3MH0A 3LMHA 2XNPA 3ZS5A 4R5YA 2W5HA 2OKRA 4LYNA 1P4FA 2RFEA 2UW7A 3AC5A 3D5XA 2J0LA 1YOLA 4J98A 1Q3WA 2C6KA 4RFMA 2BIKB 2W1ZA 1O6YA 3QCSA 5JEBA 3RI1A 4PMSA 5AV1A 4Z16A 5DE2A 2B9JA 4P4CA 3BU3A 4N6YA 4DTBA 3AXWA 4MKCA 3PP1A 4KKEA 4KSQA 4QP8A 4D4YA 3M2WA 2XIKA 5FUTA 2YCQA 5IKWA 2X2KA 1OECA 4OTRA 2CN5A 3W1FA 4NW5A 1OITA 4V05A 3UOKA 3ROCA 4EQCA 3TNHA 3RCDA 1QPEA 1VYZA 4I5MA 4UMQA 4DGLC 2FO0A 3NCZA 4CMOA 3G6GA 2IW8A 4QTEA 2G15A 3C4EA 1H01A 3HP2A 1MQBA 5KBRA 3PA3A 2BALA 4A4OA 4CYIA 4FSWA 2VWBA 3PXQA 4CRLA 2ZJWA 4BCQA 2HYYA 3IONA 1G8SA 2WTJA 3UYSA 5JZJA 4FX3A 5K5NA 5DN3A 2ZV2A 2WU6A 5HBHA 3LAUA 2ESMA 2WQMA 4NCTC 1UKHA 4TZRA 3RZBA 3O50A 5IUIA 3EQIA 3QTIA 3BZ3A 4JJRA 4FKIA 1URWA 2CLXA 2Q0BA 3F9NA 4XLIA 3ZEWA 3A8XA 5H8BA 4EK3A 5CF6A 1K2PA 2JKOA 3L8VA 4BVUA 4EK5A 4EONA 3RKBA 3OY1A 3P86A 2PVHA 4R7IA 4XP2A 2W1IA 5ANJA 1E1XA 4IVCA 2A19B 5IQEA 2VX0A 1P14A 4BDCA 5LVMA 1TQMA 3IW6A 2ITWA 3PJ8A 1REJA 4OUCA 4QMLA 3E7OA 3W2RA 1GAGA 4I24A 1P2AA 2OIBA 3ANQA 3KK9A 2O8YA 4L7FA 5CENA 4HGEA 5EHYA 3R7EA 2CKQA 3QX2A 3BHYA 4YZBA 2JLDA 3F3UA 4K2RA 4YUQA 3QQJA 3Q5ZA 2E9PA 2JAVA 2P2HA 1H07A 2VWIA 1VJYA 2OJ9A 3R8MA 4UN0C 1RQQA 3L9NA 2CKOA 3AD4A 2C6TA 4F7LA 3RZFA 5M44A 2B4SB 2CGVA 2JBPA 3ODZX 4KS8A 1X8BA 4GU9A 3FYKX 4IJ9A 3EHAA 3SW4A 4E6DA 4FEUA 3H30A 3R9OA 3ZOSA 4BCOA 4QMYA 4IX6A 3Q2JA 5CZHA 3REPA 3V5WA 5DGZA 2PTKA 1FQ1B 1ZLTA 3TACA 2XA4A 1UWHA 2J90A 5L2IA 4J52A 1CM8A 4K33A 4A4LA 2IZTA 2PWLA 4TYGA 5BMSA 2OFUA 4I0SA 4IBMA 2UUEA 4FT9A 3QZGA 3C7QA 4BDGA 4DH5A 4E5AX 3AOXA 1GOLA 2W1CA 3LJ1A 3DGKA 4CVAA 4QQJA 4Y5QA 4M7IA 1M52A 4EHVA 3IW8A 4FK6A 4U97A 5JQ5A 4ZS4A 1Z9XA 4PRJA 3MH3A 3VJOA 4EH7A 3QXPA 3DKGA 4QMXA 4EZ5A 1OIYA 1H1SA 2UZOA 3BE2A 4JOAA 2QO9A 3H0YA 5KBQA 4D2SA 4E8AA 4EH5A 2CDZA 5FBOA 3OT8A 5KMLA 1ERKA 1UU3A 3V01A 3A62A 5HGIA 4FSRA 5D7VA 3ZRKA 2X9FA 3Q9ZA 4BCHA 4U41A 4YJVA 5F4NA 3ZM9A 4L8MA 5H8GA 3RTPA 3PRFA 1H1RA 2I0HA 4O38A 2H34A 2PY3A 5TE0A 2QKRA 4BCFA 4F0FA 5C8KA 5IH5A 5J5TA 1KOAA 3FC2A 5A4CA 4X2KA 2BVAA 2HCKA 3NYVA 3PJCA 3F3VA 3VS0A 2VTIA 1XJDA 5TF9A 2QOOA 4RT7A 2Y7JA 5JH6A 5DNRA 2YIXA 4LGDA 1FINA 2HZIA 3TJCA 4ALVA 3SLSA 4RVLA 5KX8A 3F2AA 5BX0A 4UB7A 4ZZNA 3E87A 3MGYA 4H39A 1FOTA 2X7GA 4O84A 5TKDA 4PP9A 2YWPA 2Z8CA 2OBJA 3PG3A 3VJNA 5J8IA 4CFNA 3DZOA 3SG9A 4W9XA 4WT6A 1Y8GA 3N4TA 4FL3A 2GFCA 4UZDA 5EK7A 3S4QA 1ZXEA 4AZEA 5CWZA 5HLPA 2VUWA 4ZTMA 2BRBA 4Q5HA 3PUPA 4D0WA 3FQHA 3IECA 3O8TA 3QZFA 2PU8A 2UW8A 4L67A 3LQ5A 5E7RA 3BYOA 4B8LA 1JOWB 3A99A 3AMYA 3QD4A 3ORNA 5GHVA 1Q3DA 4XUFA 3BELA 1PHKA 3H9OA 4UMUA 4LM5A 2VN9A 5ACBC 1HCLA 4DC2A 5IQBA 3R71A 3MIYA 3FLWA 5JQ8A 4U45A 1YKRA 5C4LA 3D94A 3FXWA 4XG6A 5I9ZA 2JDSA 5HO7A 3OCTA 4RIYA 4TW9A 2UW6A 3MW1A 4FV5A 1NVSA 4ZLZA 5IH6A 3DV3A 3COKA 5L8KA 1OKYA 1J3HA 4BI2A 4C4IA 1O9UA 3QRTA 3RP9A 1OL1A 2ONLA 4NYEA 1QL6A 2VTTA 2XNBA 3P23A 4G9CA 4YSJA 2OZAA 4W4YA 1SMHA 3UE4A 4H1MA 2BFXA 4KIQA 1FVRA 2QO7A 2JKQA 2HAKA 3RAWA 3ZXTA 3KVWA 5LVNA 3H3CA 4DGMA 2HENA 3ORMA 4LRKA 3DXQA 4X0MA 1PXIA 3PZHA 2OJGA 4BIEA 4CFWA 3VUKA 3TG1A 4U6RA 3DDPA 5IEXA 3QTWA 4MD8E 5GNKA 2ZM1A 5CX9A 5HKMA 4IM2A 3ZMMA 4RIYB 4AAAA 5J1WA 3F7ZA 3QA0A 3LFEA 1U54B 4FBXA 3QTRA 4FVRA 4BKJA 4ZJVA 3QD0A 3E64A 3ATSA 3PY3A 1WBNA 2E9VA 2GNIA 1FGKA 3QWKA 3WIGA 4G9RA 3ORLA 4X2GA 3CGFA 5HORA 2C5YA 2BHHA 4YTIA 2YDJA 4DCAA 4BBMA 3BGPA 2OZAB 3KRJA 4R78A 3FMLA 3PRIA 4RVMA 4WG5A 1JSVA 1XHAA 4DFUA 2R3NA 4ANLA 4QMMA 4YBKA 2VNYA 3SXRA 3PYYA 3DKCA 3TNWA 3PZEA 4HCUA 3ZSHA 2G2FA 2RGPA 2XNEA 2IWIA 3R73A 5FGKA 2VGPA 4I23A 1IAJA 3U87A 4DEDA 4MXAA 4A7CA 2NO3A 3H4JA 3FZOA 4NM3A 4RFYA 4Z3VA 3CPBA 3GQIA 4O7LA 4UMPA 5L8LA 3MN3A 3L9MA 1PXLA 5HCYA 2WMVA 2VTNA 1H8FA 4XRLA 5IEVA 3D5VA 3TWJA 2RIOA 3D4QA 5AR4A 4FV7A 3KKVA 3R9RA 3MWUA 5IQIA 1U5QA 4ARKA 3CGOA 4FUYA 2RFNA 4PDOA 5EM8A 5AR5A 2X8IA 2YAKA 4I5CA 1LUFA 2NPQA 5CALA 2VTSA 2QU6A 5A4LA 3ORXA 5AP0A 4ANNA 3HKOA 4AZVA 2YIYA 3K5VA 1SVEA 2X4FA 4IWOA 3VS6A 5KUPA 2XH5A 3LLAA 3A4OX 1PXNA 3RALA 4HZRA 4WKQA 4FTTA 2F7ZE 5ETCA 5DG5A 3QKMA 4O0VA 1FVTA 4IC8A 2BKKA 3TZMA 3ZCLA 3B8QA 1APME 4I3ZA 4HPUE 4RVKA 3BIZA 2YIRA 4F08A 2RFDA 3U51A 1W0XC 4O96A 4C3RA 2ETKA 5I3OA 2XVDA 3BHHA 3DBFA 4RJ5A 5ETAA 4APCA 3OT3A 4PL3A 4W9WA 4IMYA 1H1WA 1YWRA 1OZ1A 5BMMA 4ZZOA 1ATPE 4LFIA 4XG4A 4J8NA 4G6NA 3ZDIA 4BB4A 3BKBA 5A6NA 5TT7A 2XIXA 3LQ3A 1JSUA 4GVJA 4O2ZA 2R3OA 3HV3A 3N9XA 3U9NA 3TI1A 4O86A 4BC6A 2FUMA 3CLYA 3QRUA 4MD9E 4I6BA 3FZRA 4QQ5A 2ZOQA 3OCSA 4IE9A 1H1QA 1S9JA 2W99B 4GIHA 4EH9A 2F49A 4GFGA 4XYFA 1FVVA 1ZZLA 3BWJA 4FKSA 2HW6A 4MHAA 4EORA 1Y6BA 4OT6A 3CY2A 5AUVA 3KGAA 4JG7A 2YZLA 3I7BA 2JAMA 4F9BA 3ZUUA 4ORKA 4BGHA 4QQTA 3BLQA 4APPA 4EKLA 5A4EA 2VD5A 5J1VA 4ERWA 2DS1A 3W18A 2HY81 2PMLX 3DJ5A 4C4FA 1JKKA 2PVKA 1ZOEA 2JIUA 1OI9A 3QRKA 5C26A 3D0EA 3VWAA 5EFQA 4RC4A 1Y57A 3DJ6A 3Q52A 2W1HA 2V62A 2ZV8A 4FIIA 4TTHB 3V6SA 4OTQA 2IG7A 2OZOA 2CNUA 4EOPA 3ORZA 4I6HA 2C6OA 4F1TA 4GS6A 1WBOA 3AD6A 5C01A 3CY3A 5I9YA 3CJFA 1FBNA 1B39A 3GT8A 4TY1A 2XIYA 4U43A 2YM5A 2B1PA 3FY2A 4GW8A 5GINE 5IG1A 4QYFA 5J9LA 2PMNX 2VO0A 3ORTA 4FV8A 4YJUA 3UOLA 3FSKA 3ZSIA 4JG6A 4DFLA 3Q9YA 4RC3A 4Y73A 5DPVA 3TNPC 4HYIA 3VS5A 1PXMA 3AD5A 3EJ1A 4RX8A 4X3FB 2O64A 3OWJA 4A06A 3D15A 5EI2A 3BQRA 4WA9A 3O2MA 1Q62A 3FYJX 2XM9A 4W8DA 4N70A 3D83A 4ZSLA 4ANBA 4MYGA 1ND4A 5LARA 3ZLYA 3Q4UA 3TEIA 3IG7A 2R4BA 2X7FA 4G3FA 1YI4A 2XKCA 3QQLA 4N0SA 4Y72A 4USFA 2VTRA 1J91A 2R3RA 2YCFA 3GGFA 4G3DA 2Z7QA 4O2PA 1P4OA 4AT5A 2NRUA 4LMUA 2QO2A 3V8SA 3GCPA 3JVRA 1R39A 2C4GA 3U9CA 3QGWA 2OF4A 3C4WA 4HVSA 2CNQA 3G90X 2YM7A 2OW3A 3O51A 5IQGA 3OEZA 1BMKA 5AIRA 4MXZA 3BU5A 1J7LA 3NCGA 2WOUA 4L3JA 3MFSA 1WAKA 4M0YA 5M55A 3VS4A 2YZAA 1OL6A 4LL5A 1E9HA 3FZTA 4MXYA 4L42A 5ACKA 4C4EA 5GIOE 4BWKA 3I79A 2JD5A 4FNXA 2OSCA 4LI5A 5CSHA 2GNFA 2UVXA 2WTKB 5CEIA 4ZTLA 3TKIA 2ZV7A 3A60A 5IH4A 5ANOA 3Q6UA 5IQHA 5I5ZA 3NUNA 4G2FA 5IDNA 4ALUA 2BDFA 2XM8A 3VBYA 5JGBA 3HZTA 2QU5A 3PFQA 4KD1A 5DH3A 3BHTA 4TRLA 3R00A 5HX6A 3IGOA 5KMNA 3BQCA 3FMDA 2V7OA 4EH8A 3VRZA 2C0OA 1KE9A 2KTYA 3ZSGA 2A2AA 3PVGA 5HU3A 2XYUA 5FTGA 2YITA 4FSYA 3GP0A 3UNJA 3TN8A 4ENYA 4DLJA 4EUUA 5BUJA 2IO6A 4M8TA 3IDPA 2W7XA 4CLIA 2WO6A 1CSNA 3ZFXA 4X2NA 4CXAA 3MVHA 2QOQA 3BI6A 5J79A 3VN9A 4J71A 3UZPA 4K0YA 2XS0A 5AWMA 5AP3A 3W55A 4BDBA 5ITAA 4A9SA 2OJJA 4P2KA 4Q5EA 3VBVA 3VBWA 3FXZA 3QQFA 4YNOA 2WMAA 4AA5A 2WQBA 4IXPA 4C59A 3DB6A 1W8CA 4R3CA 5BVEA 3M42A 3NR9A 5M57A 3IQ7A 2X8EA 3E8EA 5E8ZA 3LCOA 3WYXA 1UU8A 5IQFA 4DLIA 3MPTA 3NZ0A 4PTEA 4H36A 3F61A 3Q3BA 3TL8A 2C6DA 5FDPA 4I21A 1VZOA 3LFFA 4YZMA 4BWPA 5CF5A 4IZ5A 4PX6A 3U4WA 4KWPA 3ZDUA 4GIIA 3R21A 3MDYA 1U59A 3OWPA 5CEKA 1UNHA 1ZMVA 1WVWA 3ERKA 3UVPA 2OF2A 4WSYA 5AUZA 2WELA 4QP1A 2LAVA 1GZ8A 2B0QA 3KULB 2O63A 3D7ZA 2WGJA 5BVWA 2GQRA 4FF8A 5A3XA 3FBVA 4O0YA 4PWNA 3UC4A 3FE3A 4HCVA 3P7BA 4QMTA 3PP0A 3VS3A 2JDRA 4O1PA 5JT2A 4FTAA 4MNEA 3KN6A 4U40A 2QNJA 1SNUA 3WIKA 2XKFA 3HMNA 3MS9A 3O7LD 4KAOA 4UWCA 1MRUA 3V04A 3NYXA 4PDSA 3HEGA 4ASEA 1CKJA 1T45A 1ZYDA 4X2FA 5BVOA 4NL0A 4OBOA 3UNKA 3HAMA 1M17A 2VTHA 2Y4IC 3OUNB 2OO8X 2XBJA 3L9LA 3ZU7A 2FH9A 4GH2A 1XBAA 4F9AA 4UBAA 3MESA 3TKHA 5L6PA 3VHKA 1R0PA 5HBJA 4KIKA 4XG8A 3AT3A 3CIKA 3FLSA 4GK2A 4I92A 4I41A 4CV9A 4AA0A 2ZYBA 3OFMA 5J7HA 2F2UA 3HV7A 4ACCA 5HVKA 4J96A 5E91A 4GK4A 4G3EA 4ITJA 3RMFA 3UIUA 4CCUA 3AC4A 3QHRA 5CU3A 4FTCA 3SDJA 4FV0A 5BYZA 3Q9WA 2YJRA 2R3KA 3WE4A 3HX4A 4NTSA 2VV9A 3SXSA 3PXZA 4S33A 1SNXA 4I94A 1NVRA 4H58A 4W4XA 1OM1A 3HL7A 3NAXA 2BZKB 3WF5A 4C2VA 5HTIA 3C51A 2F7EE 2W1FA 2X7OA 4O7WA 4FSUA 3HA6A 4PL4A 3S95A 1YW2A 2E2BA 2G9XA 3LJ0A 4O83A 5CU4A 2PUNA 3MTFA 4UYNA 4M3QA 3A7HA 4RWJA 1IASA 4JRVA 2GNHA 4FT3A 5HOAA 4KNBA 4FTOA 3HVCA 4B6LA 4FI1A 1OB3A 2CLQA 5CT7A 3WF7A 3EN9A 1YWNA 3FL4A 3KMMA 4GT3A 3NEWA 3PY1A 3MSSA 3UO6A 3OBGA 3SGCA 1OPKA 2XCKA 3KRXA 4M69B 5FM2A 2UZNA 1ZAOA 4FV2A 3DK3A 4R1VA 1KV2A 3MIAA 4DFBA 4Q2AA 5EYKA 5K0XA 3NLBA 3I5NA 4BI0A 3EKNA 4IX4A 5J5SA 3ATTA 4S2ZA 1SZMA 4FKGA 5EG3A 3TDWA 3VVHA 3QQKA 2VTJA 3MFRA 5EW8A 2B7AA 4ZS0A 5FXSA 2W17A 5A54A 2OIQA 3UPXA 4FA2A 2JFMA 4EHEA 1YDTE 4JRNA 3SAYA 3MVMA 3SW7A 5FXRA 1E1VA 4BL1A 3MB7A 1OIUA 2OK1A 5G6VA 4M97A 5IU2A 4ZJIA 2Z02A 3GOKA 5DRDA 4ZSGA 5J95A 3DU8A 3RK7A 3C5IA 4FT0A 3U6IA 1OUYA 2PUUA 2C47A 4DA5A 4OBQA 3ZZWA 1YXSA 4KBKA 1REKA 4L01A 2BILB 4BDFA 2R2PA 5CSWA 4C3PA 4DH1A 2NRYA 2WMWA 1DI9A 4J8MA 3BGZA 4C38A 3NDMA 5HTBA 5EYCA 3GUBA 3V8WA 3G9NA 3W32A 4CFFA 1JKTA 3BYVA 1K9AA 3MYGA 3UIBA 5BQ0A 5F94A 2J51A 5FG8A 5JMSA 2RG6A 3EH9A 3V51A 5TO8A 4FSZA 1ZYCA 4CD0A 3NWWA 2WTIA 4YTCA 4GVAA 3DQXA 3PG1A 4AGCA 3DNEA 4HGLA 2X39A 5B0XA 4DG0E 3IW4A 2P55A 5K5XA 2CGWA 4WD5A 4FNWA 4GJ3A 3ZEPA 5CAQA 2W4KA 1WFCA 2PVRA 4D9UA 3U6JA 4X7QA 4ZMEA 3QQUA 5AX9A 3EFLA 3R7VA 3ZO1A 5BNJA 4AZFA 2UZEA 4DFZE 4NTTA 5HVYA 3R9NA 2I40A 2ETRA 3OOGA 4GUEA 4RJ6A 2W0JA 5CXZA 2X6EA 4HNFA 2JITA 3C0HA 5T3QA 2YEXA 4QMNA 3ZZEA 4UMRA 5KKRC 2BHEA 3DDQA 4YHJA 3FZPA 3DPKA 4ACHA 3LFQA 3GENA 4QQCA 1BL6A 4ZTHA 5CF8A 3O96A 3D9VA 4DEHA 3DTCA 3QZIA 4A9UA 3ZO2A 1LPUA 4IIRA 2OJIA 1ZMWA 2XYNA 2XKDA 3QAME 1IRKA 4H1JA 2WAJA 3FQSA 4NWMA 4J99A 5EI8A 2WD1A 4X21A 2I1MA 4X3FC 4IWPA 4ANQA 3RPSA 5CSPA 3G15A 4DH8A 5JGDA 4QTDA 3GCUA 2W06A 3BRBA 4TN6A 4U0IA 2GS6A 5ANKA 5DMZA 1BLXA 4BCPA 2QD9A 3OEFX 3II5A 4K6ZA 3ACKA 4ZSAA 1IAHA 3LCTA 1OPLA 4FVPA 3OCBA 4U5JA 3ZO4A 1OL5A 3VF8A 5LWNA 1YDRE 4C02A 4OGRA 4IX3A 2WOTA 2RG5A 1OBGA 1PXOA 3GOPA 4BYIA 4C3FA 4HOKA 4G3CA 5E8WA 2VWVA 3W2PA 5AP5A 3DY7A 1GNGA 2XRWA 4OTDA 5EKNA 4PPCA 1V1KA 2H9VA 4RIOA 5AIKA 4IB0A 4XH6A 5HE0A 4JAIA 3ZHPC 5KMJA 2HW7A 3I1AA 3FUPA 5CAPA 2UVZA 3NSZA 2QONA 3KRWA 4FUXA 2WTKC 2P4IA 4NSTA 5E1EA 2ITNA 4BY9E 3BHVA 1YI3A 4TYJA 3F3TA 5CXHA 4P7EA 3PIYA 3MJ1A 5ANDA 2WTCA 4CKRA 3PXKA 4DH3A 3ULZA 3UZRA 3IKAA 5JSMA 3FI3A 3RM7A 5K4IA 4BCJA 4I5PA 3G0EA 5AUWA 5A14A 3ET7A 3PXYA 1QPCA 5CNNA 4CCBA 3IS5A 4E26A 3UQFA 3IO7A 2ERZE 3HV5A 2XUUA 4OAUC 4RJ7A 2IJMA 2P3GX 4D55A 4FTUA 4GFMA 5HD4A 2CSNA 3LCSA 2PMOX 4OTPA 4J53A 3LFSA 1U4DA 4YBJA 4BYJA 2R7BA 5EI6A 4XOYA 4TYEA 5B2KA 4PPBA 4L68A 3PXFA 5HD7A 2HXQA 2W05A 2WTVA 3B8RA 4RBLA 3N4VA 2PUPA 3AC1A 4DT8A 4NW6A 1GIJA 4MNFA 4P5ZA 4FTKA 3COHA 4RWLA 4C37A 5CVFA 3TZ9A 3SA0A 2V5QA 4YZCA 2OI4X 4D2VA 3MFUA 4C2WA 1PXKA 2FB8A 3CS9A 4MEDA 4RZWA 2I7QA 2OIDA 5AR8A 5EOBA 5FEDA 4XBRA 2V0DA 4A9YA 3AT2A 4DH7A 4EYJA 2HZ4A 3E62A 3QX4A 4RRVA 3KB7A 5DVRA 1BKXA 1R0EA 4GUBA 3R8VA 3LFBA 3ITZA 4ERKA 1I09A 1S9IA 3LCKA 4FKPA 3GCSA 4QRCA 3B2TA 3FLZA 4NT4A 2YDKA 4F0GA 1W82A 4JVGA 4G6LA 3SX9A 3ORKA 3PWYA 3ZFYA 1JKLA 2ITPA 1ZZ2A 3LE6A 4YNEA 3LVPA 2I0VA 2BCJA 2DWBA 3E93A 4DTKA 4OR5A 3S3IA 3QYWA 2XNGA 2VO6A 2HXLA 2J50A 3ZRLA 4BDJA 2WMRA 2I0YA 3DBDA 2V22A 4XLVA 5CSVA 3VUMA 4H3QA 4FZFB 2UW0A 3Q32A 4Y85A 4YZNA 5AJQA 4AZTA 4KABA 1Y8YA 1YXTA 2ITOA 4MD7E 4ZY6A 2QC6A 4AZWA 2E9OA 2EB2A 3FV8A 3OY3A 3OWKA 4E6AA 4FOCA 3CCNA 2PZPA 3R7UA 4JT3A 4M14A 4GT4A 2VTOA 3N4UA 2ZAZA 4BDHA 4CMUA 4U79A 3KC3A 5AP7A 5EHOA 3ZFMA 2VTPA 4I4EA 3VBXA 4MVFA 2ZV9A 3FDNA 4E6CA 3U55A 1PXPA 4F9WA 2BDJA 4PL5A 3WZEA 3WF9A 5K9IA 1NA7A 4BDEA 3I4BA 4M0ZA 4LRJA 5BVNA 4AGUA 4E4LA 3PE1A 3O71A 3ZLSA 3PA5A 4GEOA 5HIBA 3HLLA 2C5OA 3R04A 4XV1A 2QKWB 3QC9A 4XRJA 4K11A 1SVGA 3C4ZA 5JRSA 5ETIA 5HE1A 5HG7A 4C7TA 1H24A 4YTFA 3OXTA 5BVFA 2VX3A 3I60A 4TT7A 5AEPA 3M11A 4NK9A 4CG8A 3U54A 2IZSA 2CJMA 1YOMA 1UV5A 4IAKA 1ZY5A 1LR4A 4AFJA 3R1SA 3MH2A 4AOIA 3HECA 4CQEA 5AUUA 4DAWA 3COMA 4KINA 3VNTA 4Z55A 2GHMA 4TWNA 3CD3A 4RQKA 4AS0A 2HOGA 3HRFA 3TT0A 4XEYA 2WMBA 4PNKA 1V0BA 5A4TA 3UQGA 2C6IA 1STCE 1U54A 2J0MB 4A9TA 1DS5A 3JVSA 3Q6WA 4FSQA 4HGSA 3QF9A 2RL5A 2BAJA 2JIVA 2O3PA 2WMTA 4JI9A 3FMHA 4PV0A 2XMYA 3EQHA 5AMNA 2ITUA 3FL5A 2PE0A 4YC8A 5HE3A 5IUGA 5CYIA 3H9FA 4UMTA 5C4KA 5AUYA 5EQEA 1IG1A 3QTQA 3R7OA 1M14A 3EQGA 3RHXA 3RINA 5AADA 3QCQA 3K54A 3FMMA 2UZVA 4XG2A 3A4PA 2W9FB 4X2JA 3VIDA 4B9DA 4CRSA 4DEAA 4M12A 5F20A 4BTMA 3G51A 1U46A 4RFZA 4YGAA 4JS8A 4QMQA 1KE8A 4G5JA 2Y4IB 4MX9A 1W84A 2X8DA 4FKJA 4Z7HA 3V3VA 2R3JA 3F66A 4UWBA 5JKGA 3MPMA 4ONAA 1XH8A 1ZOGA 2YWVA 3L8XA 1XR1A 3TV4A 5AP1A 3VUTA 5HQ0A 5CY3A 1Q99A 3KXHA 1ZY4A 4HVDA 3PDTA 5I9WA 4L7SA 2CNVA 3RPYA 3ULIA 2XNMA 4FV1A 1AGWA 3BYUA 3LMIA 4II5A 4AQCA 1OKZA 5HG5A 2F57A 2R3PA 4FG8A 4CZUA 3E8DA 3QCXA 3EMGA 1YHVA 2WKMA 1R1WA 3NUUA 3EB0A 3EZRA 4FSTA 4FZDB 5E4HA 2GMXA 4MQ1A 5FM3A 3KVXA 5DT3A 3DB8A 3HA8A 1PKGA 5B7VA 5M4CA 3LFCA 3MA6A 2QOBA 4IWDA 2FSOX 4IM3A 4FSNA 5M06A 1M2RA 4FVQA 5IQDA 3BGQA 3F5XA 4W4WA 5EW9A 3R7IA 4Y83A 4PF4A 3TZ7A 4DG3E 4E7WA 4F6UA 5L6OA 4XP0A 4WSQA 1CMKE 1EH4A 1TKIA 4USEA 4WG4A 4IC7A 5DHJA 3P08A 4FV6A 4DTAA 5KMMA 2ACXA 3I6WA 3NW6A 4D1XA 3NVMB 2W4JA 3UG1A 4ZLYA 3KXNA 4O7NA 3O8UA 3QKLA 4JIKA 3VF9A 3W2CA 4YZDA 3R7YA 4B8MA 5LVPA 4IACA 3TIYA 2VTQA 4YU2A 3LXNA 4L43A 3W2SA 5CS6A 3OWLA 4DCEA 1TVOA 2PVLA 3GC8A 4YPDA 1PKDA 3RCJA 2RFSA 3EKKA 1MUOA 3NNVA 3UC3A 4E6QA 3LM0A 3FMEA 3VBQA 3OTVA 3KFAA 4FKVA 4DF3A 2CCIA 4FTLA 3HRCA 4YO6A 1ZOHA 5IUHA 3RPVA 5FP6A 4AW0A 3D2KA 3DKOA 3V5JA 3QXOA 4YURA 5L2WA 5K3YA 3QA8A 1Q61A 2VU3A 3DKFA 3DAKA 3HMOA 5E8SA 5I9XA 4O81A 2OXYA 4CFUA 1QCFA 4EOMA 5KCVA 4EC9A 5AAFA 4B7TA 3E92A 2DQ7X 3IW7A 4G16A 5D1JA 2CCHA 3UVRA 2QOHA 3R63A 2HIWA 3KMUA 4DE4A 4FEXA 1DAYA 2FSMX 3NIEA 1XH6A 4P5QA 4IFGA 5CVHA 1NXKA 1GZNA 3PVWA 4ZTQA 2Y6OA 3RNIA 4YJQA 4KBCA 2GNLA 2BFYA 3V8TA 3P9JA 2PULA 2J0JA 3F3WA 1UNLA 2Q0NA 3QHWA 4K9YA 3VBTA 1L3RE 4U3YA 3NW7A 4Q9SA 5L3AA 4C34A 3C9WA 4D28A 3R0TA 3DTWA 4G31A 4K77A 1IA8A 2OJFE 3DT1A 3VUIA 2HY0A 2C3LA 2FSLX 2KULA 1PYEA 3F5GA 4AA4A 4EOOA 5DR6A 3OHTA 2AC5A 4EHGA 2Y6MA 3HP5A 2XJ0A 3NUXA 2A4LA 2HWOA 1CKIA 1JNKA 4LOPA 3NNWA 4CFMA 3BYMA 4X3FA 4F65A 1OVEA 3EOCA 3TV7A 4F7SA 2ITYA 2OICA 3OZ6A 1ZYLA 4CLJA 3CC6A 4IZYA 4BCMA 1IA9A 4TYHB 2QI8A 4GCJA 4L9IA 3P0MA 5KKRB 3GU4A 1XH4A 5J9YA 4NIFA 1KUTA 3FI2A 4NFMA 4EK8A 3AQVA 3I5ZA 4QYHA 4U81A 4UALA 3W2OA 4BICA 2BR1A 5JFWA 1W98A 4FGRA 5KZ0A 3NVKI 5FP5A 4FK3A 4FEVA 2O2UA 4I1ZA 2B9IA 5LWMA 2IVTA 3D7TA 4D4SA 3A7FA 4PDYA 3NUSA 4N6ZA 2X81A 3UO4A 3WBLA 1NY3A 2PYWA 2IZUA 2ZMDA 1IR3A 2WHBA 2WQEA 3FHIA 3P5KA 3QC4A 5AV2A 4YMJA 2WEVA 2XNOA 4WHZA 4FEWA 1GZOA 4NIFB 4IAYA 2QOLA 3P7AA 4MWIA 4JBOA 5DWRA 5IQCA 3EL8A 3R1YA 3V5TA 2HK5A 4EKKA 3OROA 3KF4A 2CHLA 3AC2A 4AGDA 4L6QA 3D7TB 4NEUA 2BRNA 3EIDA 5EYMA 4B99A 4RIWA 4L44A 1Q97A 4LQMA 3QTXA 4Y5HA 5AM7A 4ZY4A 3RM6A 3KN5A 3FPQA 2W5AA 3TCPA 3I7CA 4BCNA 5H2UA 4PUZA 1AQ1A 4AGWA 2VZ6A 2XIRA 5CEPA 4I0TA 4AACA 3F3ZA 4XX9A 5HTCA 5IEYA 3PVBA 1UU7A 3EN4A 4XBUA 3LLTA 2OU7A 5AM6A 4QMZA 4CGAA 4MAOA 4R3PA 3THBA 1OIQA 1QMZA 4BCGA 3UTOA 5BVKA 3T3UA 4I20A 4PTGA 3F82A 1XBBA 5L2QA 3UP2A 3DFAA 4C62A 5GZ8A 4RIWB 3R2YA 2VAGA 3C0IA 4GYIA 3PVUA 4FTRA 3OD6X 4WRSA 3HMPA 2QURA 3EWHA 4O0SA 1UU9A 3MPAA 3NS9A 4PMTA 3O17A 4N57A 4XMOA 4A07A 4Q9ZA 3DXPA 2PZIA 4YJNA 1PMEA 5E9EA 2XJ2A 5JFVA 4NKAA 4XJ0A 4EBWA 1DAWA 4G5PA 5KO1A 1J7IA 3R2BA 2OGVA 2H96A 3A2CA 3KRLA 1OGUA 5C1QB 2B9FA 4IVDA 3P79A 5FDXA 3KF7A 1HOWA 4ZSEA 3SQQA 4PQNA 1SM2A 4I5HA 3AC8A 2Z7RA 4WNKA 2YJSA 4EK4A 3KULA 4ID7A 4KKHA 4AU8A 2YLEA 2VTAA 3RAKA 3QTZA 1LP4A 4HYUA 2R64A 3Q4TA 1F5QA 3E88A 4LGHA 5CU2A 3W16A 4DHFA 5B2MA 4FKOA 5CI6A 3FSFA 4U3ZA 2E9UA 5E8UA 1G5SA 3A7IA 2JKMA 3QALE 3KXXA 3TV6A 3VQHA 3MY5A 2CN8A 2GNJA 3QU0A 2UV2A 1JQHA 5AV3A 3R8PA 3WZJA 2F4JA 4EWQA 5HLWA 3QQHA 4DBXA 4IAAA 4KKGA 3BCEA 3E63A 4OBPA 5CAOA 1OL7A 4QYGA 1I44A 4JG8A 4V0GB 4BI1A 2O0UA 2ZB0A 3CBLA 3MTLA 3ELJA 2PZYA 2W1GA 3D5WA 4UYAA 5KZIA 1DM2A 2Q83A 2B53A 5EM7A 4MTAA 3Q60A 4F1OA 1KE5A 1XKKA 2E9NA 2W1EA 5HESA 4LGGA 3TXOA 5IDPA 2HZ0A 3LM5A 1Q8WA 2QOFA 3C4CA 2ERKA 4O0UA 5FWKK 3VQUA 3CTQA 4GK3A 4LMNA 3UG2A 5EYDA 4RWIA 2C30A 1J7UA 3FEGA 3NX8A 3F88A 4QMPA 4WUNA 4XV3A 3RJCA 5AA9A 3NGAA 5CQUA 5LJJA 2UZWE 2XK3A 3EQBA 4K8AA 3UO5A 5FTQA 2C6EA 3F6XA 1RW8A 4I0RA 3L9PA 4JBVA 5M51A 2XK7A 1ZYSA 2V55A 1HCKA 2GDOA 5E1SA 4ALWA 1O6LA 3WARA 4NUSA 5DEYA 2Z7LA 2C5NA 5CT0A 4AW1A 4L45A 5HCZA 3ZTXA 2R3HA 3KA0A 4C36A 1NT2A 1Q5KA 2RSVA 4U7ZA 4BDDA 4CMTA 4KSPA 5HICA 3TTJA 3E3PA 2WMXA 3ZUVA 2EXEA 1CTPE 5FLFA 4BDAA 3IDBA 1PRYA 3O8PA 2X0GA 3EFKA 1XQZA 3FMJA 3I0QA 3CPCA 3E8CA 4ZK5A 4FICA 3VRYA 5E92A 4H05A 4L00A 2VWWA 5HZNA 3QCYA 5AFVA 4AN3A 4C4HA 4EEVA 4M69A 3DK7A 2X2LA 3HV4A 2ZMCA 4F09A 1XH9A 5AA8A 1SVHA 2RKUA 3NNXA 2UZUE 3QUDA 4DINA 4RSSA 4H3PA 4JQ8A 5EOLA 4QMSA 1GY3A 4C8BA 1M7NA 5AAGA 3EN6A 1TQPA 4FKTA 4C33A 4ZMFA 4U9AA 4D2WA 3BX5A 2YN8A 4KIPA 3RK9A 1Y91A 5FTOA 4RJ8A 5DR2A 2J0IA 2UW3A 1WZYA 5M4FA 5AR7A 4FR4A 3QTSA 4DFYA 3I0OA 1KE6A 5KMOA 3POZA 4FGBA 4FKQA 4EI4A 2BZIB 4XG7A 2R9SA 3PSCA 4WUAA 3PXRA 4GJ2A 3A61A 4IB1A 3UDBA 1WBPA 4GMYA 2GCDA 2PVNA 3EQDA 3FPMA 4HYSA 4IDTA 4YC6A 4ZXTA 3ZBXA 4BHZA 1WBVA 4WG3A 3UYTA 3CD8A 2PSQA 4BIDA 1PJKA 3EQPA 2WXVA 3AMBA 4MBIA 4DEEA 3EQCA 5IPJA 4DGGA 2IW9A 5JRQA 4M13A 4OT5A 4F70A 1H1PA 3K3IA 2WIHA 5ICPA 5M4UA 3GFWA 1YHWA 4ZLOA 1JSTA 4WBBB 4BR3A 3ORPA 4KA3A 5BPYA 4MXCA 4RIXA 1YXUA 3KRRA 4TWPA 4O7VA 4G3GA 4X6RA 5HNBA 4ZAUA 2EXMA 2C68A 4DEBA 2FGIA 2BTSA 2EUFB 2VTMA 1PMVA 4XHKB 5AV4A 1F3MC 2F7XE 2OG8A 3SOCA 3ZLXA 4OTFA 5GJGA 5EM6A 4F0IA 1YQJA 5T6KA 2C3JA 3QLGA 5CNOA 5M4IA 2G2HA 3FQEA 5CAUA 4ZJJA 4CQGA 3H10A 2QCSA 2C0TA 4FSMA 4JR3A 4GG5A 3Q5IA 4FKWA 2GSFA 4FTMA 5CAVA 1MRYA 4JIAA 2UVYA 5DRBA 3FKOA 4B0GA 3KXMA 4TXCA 4NKSA 4RIXB 3R22A 3GC7A 3WYYA 4ACMA 2AC3A 5CU6A 4DGOA 5M07A 4F6SA 2QOKA 1B6CB 2HWPA 2C6LA 3GI3A 3DQWA 5FRIA 2XNNA 2ZM3A 2J5FA 3DCVA 4TYIA 2G1TA 2XK8A 2WTWA 4F7NA 1UA2A 3QQGA 3FMNA 1XO2B 3JXWA 4GU6A 4J97A 4ANOA 4O7RA 3NMUF 3K3JA 2PHKA 5CLPA 5M09A 2J6MA 3A7GA 4OTGA 4RC2A 3DA6A 3QKKA 5KE0A 3T9TA 2XK9A 4DEIA 3KEXA 4IZAA 5A4QA 3EL7A 4CKJA 2WEIA 3GU5A 4GV1A 5HI2A 3LMGA 4R77A 2W96B 3PIXA 2IZRA 4LUEA 3C13A 4FG9A 3OCGA 2C5XA 5G1XA 3VW8A 3W10A 3UIMA 4TWOA 4O0XA 5HIEA 4ENXA 3R8UA 1PY5A 3LHJA 1TQIA 3RHKA 4GSBA 4EK6A 2YERA 4EH6A 2XBAA 3CTHA 3LXPA 2PZRA 4IQ6A 3HV6A 2WMSA 3CXWA 5LMBA 3KU2A 4ZTNA 1OL2A 3Q4CA 3GNIB 4F63A 3O23A 3BPRA 3RWPA 4UY9A 4W4VA 3PJ1A 3GC0A 5HLNA 4JBQA 4YLJA 3WZKA 4D58A 4FIGA 5E8YA 4EOSA 5AP2A 4LL0A 3LJ2A 4JAJA 2R0IA 4CZTA 4OAVB 2QQ7A 5D12A 4AG8A 3CTJA 5C03A 4XG9A 3SXFA 3F2NA 4K1BA 4UXQA 4CTCA 4JNWA 2CKEA 3RPOA 4CG9A 5CZIA 4GG7A 3TM0A 1H00A 3LFNA 2ZDUA 3OP5A 5AAEA 4PPAA 4E73A 3VULA 4DN5A 3EFJA 3GQLA 4L53A 3MJ2A 1WCCA 4O22A 4AWIA 5IA2A 2C0IA 3I6UA 3RNYA 4TL0A 5AX3A 1M7QA 3VS2A 2XEZA 2YFXA 4IAIA 4QPSA 3COIA 3OMVA 3R6XA 5K0KA 1Q8ZA 5EQPA 3NYNA 3ZXZA 2DUVA 4L46A 5DT4A 2PE1A 2ZB1A 3WE8A 3F5PA 3FAAA 2H6DA 2YAAA 4S31A 1LEWA 3G9LX 3BBTB 2VO3A 3L8PA 2GS2A 4GYGA 3L8SA 5FEEA 3KCKA 4D4RA 1Q4LA 4UEUA 1K3AA 3F5UA 4JDKA 1YWVA 3KL8A 1PYXA 1FGIA 3OS3A 4V01A 4ACDA 4AFEA 1KV1A 4HGTA 4O0TA 1KSWA 5BVDA 3PLAE 5E8VA 5EDRA 2NNWB 2BRHA 4U44A 5DYJA 3NAYA 3C4XA 1YDSE 1VR2A 4G6OA 4NM5A 4CEGA 2JGZA 3O7LB 5DIAA 4BCIA 4C57A 4MBLA 3ORIA 3G5DA 3P7CA 2VWYA 4OW8A 3NW5A 5KMKA 4YR8A 4FC0A 3AGLA 4PTCA 4YZ9A 3TZ8A 4F9YA 2BMCA 3TTIA 4QPMA 1URCA 4IHPA 1ZWSA 2VTLA 4OTIA 4E5BA 1CDKA 3G6HA 4YLLA 2BZHB 2C3IB 3LXKA 2CPKE 2W5BA 4Z7GA 3DK6A 3R7GA 4BTJA 5HO6A 4QP6A 5KMIA 3D14A 3VUHA 2GTNA 4IM0A 5HVJA 1KOBA 3MV5A 3WILA 3CKXA 4AN2A 4CZYB 4IFCA 4EHZA 3ZH8A 2YM6A 5KNJA 4O82A 3R01A 3DLSA 4FG7A 2IN6A 4QTAA 1BYGA 3KMWA 3QUPA 2P0CA 4QYYA 4KRDA 3ROYA 2XCHA 4XV2A 3FI8A 5KHXA 3C4FA 2J2IB 3C1XA 3UMXA 4ASZA 1OBDA 3L1SA 2IW6A 1FPUA 3ALOA 5AUXA 4PY1A 4QOXA 4QP7A 4R8QA 5C27A 3FLYA 3QD2B 4HPTE 2FA2A 3DNDA 5DT0A 5AUTA 3QBNA 4BGGA 1JBPE 2WB8A 4LOQA 4GL9A 2PL0A 2X1NA 4YJSA 2O5KA 3EFWA 4HNIA 4QNYA 3RVGA 3CSVA 4ITIA 4AF3A 3MBLA 4MXOA 5DLSA 4ZTRA 4KS7A 2BAQA 4UZHA 3OBJA 1MRVA 4XV9A 5JZNA 2PPQA 4IWQA 4RX9A 4G17A 1WBSA 3VHEA 4BZNA 4D9TA 5L2TA 2PUIA 2C6MA 3OC1A 4WNMA 5IISA 1Q8YA 2JDTA 4L3PA 3QL8A 3F69A 1J1BA 3OG7A 4MK0A 3RBWA 3PPKA 5LMKC 1OKVA 4YJRA 3R9DA 3C5UA 4AN9A 4PP7A 4N4SA 5DFPA 5LMAA 4B4LA 3FLNC 2C1AA 3TDVA 3EZVA 4AXAA 3NUAA 4XCUA 3VO3A 4O7SA 4BKZA 1KE7A 3PY0A 3A7JA 3QGYA 2YM3A 5LCKA 1Y6AA 1UWJA 4RVTA 4Y46A 4XP3A 3D5UA 3NUPA 4RJ3A 3BHUA 4AOJA 4GKHA 3BEAA 2UW4A 2C1BA 5M56A 5DI1A 2B52A 2BRMA 4CV8A 5CTPA 3MY0A 3MI9A 1H28A 4QMVA 3FZSA 5EH0A 4C35A 1ZARA 4EOJA 3TUBA 3FKNA 5FEQA 5LVLA 2X6DA 4CFXA 4FV9A 3E5AA 3OUKA 4D2PA 5I3RA 4EJ7A 3R9HA 4O0RA 4J1RA 3R02A 4JQ7A 4TNBA 4YJPA 3CQEA 5CQWA 4F4PA 1PMUA 2YACA 4RA5A 4PMPA 3G33A 4QO9A 2IVVA 1Q24A 4R7BA 2XIZA 4BKYA 4QTCA 2CGXA 4TPTA 5HG8A 5HHWA 3SKCA 5B2LA 1LEZA 3OXIA 3OVVA 3VC4A 2G2IA 3C0GA 1ZRZA 1WMKA 1J1CA 3DS6A 2V7AA 2YCRA 3GU7A 2IPXA 4C61A 2QR7A 3UVQA 4BBFA 4FEQA 4R5SA 4YHFA 4EUTA 5LVOA 3V6RA 4MF0A 2X2MA 3KCFA 3DBCA 5DA3A 4BIBA 3I81A 4O0WA 3HUBA 3ODYX 2QOIA 4K18A 3QYZA 2UZDA 3KQ7A 3Q4ZA 4IZ7A 4QMOA 5HIDA 4AOTA 4ZIMA 4LV8A 2VWXA 1PMNA 4O27B 4L52A 2F2CB 1G8AA 2R3FA 3HMMA 2XP2A 3FWQA 3V5LA 4FODA 1Q8TA 1UKIA 3BE9A 4PMMA 3IOKA 2ZM4A 2BROA 3W33A 5F95A 4O21A 3LXLA 5AV0A 5AP4A 2GQGA 1VYWA 3SD0A 2G01A 4JR7A 4BBEA 4OLIA 5JK3A 3AGMA 4GT5A 3UPZA 4XS2A 2UZLA 5E8TA 4JDJA 3U8WA 3PE2A 2QG5A 3T8OA 3UBDA 4EL9A 5FD2A 4TWCA 4ZZMA 5M08A 2C5VA 2X4ZA 4BF2A 3N51A 2YABA 4F1MA 4BRXA 4IANA 2WMQA 1JAMA 5DBXA 3DAEA 2P33A 1JLUE 4ZSJA 4O7TA 3UJGA 4ZOGA 4X6QC 2RF9A 3AC3A 4GKIA 5E8XA 2C69A 4ASDA 3KXZA 3LFAA 5IA1A 5I4NA 5E90A 4H3BA 5J9ZA 4O7YA 2GFSA 2PK9A 3QZHA 4UXLA 1BUHA 4F6WA 4S32A 5FQDC 3R1QA 5TOZA 4FNYA 1KWPA 4ANMA 4CT1A 5CEOA 1YHSA 3PLSA 1AD5A 2CMWA 5L2SA 3A8WA 2WZJA 5GZ9A 2GNGA 3JYAA 4I93A 2QODA 3QRIA 3JUHA 2VNWA 3R28A 4M68A 4IH8A 2F9GA 3UMWA 3FI4A 3OXZA 1Q8UA 1W83A 3OW4A 4PNIA 4YHTA 4D2RA 5EKOA 3EYGA 5C8MA 2NP8A 4RLKA 3ZO3A 1GIHA 3E7VA 3ZUTA 2JC6A 3BWFA 4JX7A 4ZP5A 2ITTA 4C0TA 3S1HA 4NJDA 3HDMA 3NNUA 4FYOA 3WF8A 3E3BX 5I9VA 4EBVA 3ZONA 3E8NA 2BPMA 3S00A 4BHNA 1MP8A 4I4FA 4WBOA 4IB5A 3LW0A 4D5KA 1T46A 4Z9LA 3IDCA 2J5EA 3DXNA 4OTWA 2JBOA 4NFNA 5D9HA 2YCSA 2Y9QA 3JS2A 4CSVA 4JDHA 3V5PA 3GU6A 2XK4A 4AX8A 4D4VA 4O6EA 3DOGA 3FLQA 2WIPA 1YVJA 4PDPA 4RQVA 4Y95A 2VO7A 2XKEA 4FE2A 4FT7A 5IA5A 4C4GA 1R3CA 5EQYA 4BTFA 3T3VA 4NU1A 1FMKA 1L8TA 4EZ7A 4EH4A 1Z57A 2W9ZB 2JFLA 3BEGA 4MQ2A 1RE8A 3IGGA 4O7ZA 2SRCA 3BV3A 4DFNA 1IEPA 4EH2A 5M53A 5CF4A 3B2WA 4FZ7A 4IADA 4QMUA 3WZUA 4EH3A 5IF1A 4CYJA 4FIFA 3LKMA 3R30A 2R3IA 2REIA 4TYHA 5A6OA 4RPVA 4AZSA 5J87A 3BU6A 5D10A 2J0KA 2Z2WA 3KK8A 2BZJA 2H8HA 2B9HA 3HGKA 2R3GA 3IW5A 2UW5A 4RMZA 4U80A 5HEZA 5I0BA 2YLFA 3ACJA 2WTDA 4RJ4A 4HVGA 2HZNA 4FKRA 5CSXA 4S34A 4LOOA 3GXLA 3GFEA 4O91A 5GJFA 4BN1A 3FJQE 3CP9A 2XJ1A 2YDIA 3VW6A 4BDKA 3HDNA 1R78A 1OKWA 3GB2A 4HYHA 2EVAA 3ZM4A 3SC1A 4BZOA 2ITZA 1WVYA 4E4XA 2QHMA 3BLHA 2PE2A 3HMIA 3JY0A 4LG4A 3LZBA 2PVFA 3CEKA 5IQAA 4YJOA 3ZYAA 3U4UA 4WRGA 2GQSA 4R7HA 4ITHA 3VS1A 1SYKA 4M67A 3EN5A 3PA4A 4AT4A 2I6LA 4QYEA 1GZKA 4FKUA 4IDVA 5HE2A 2QVSE 3JPVA 4DGNA 4MBJA 2EXCX 4QTBA 4V04A 3VUDA 3AMAA 1XH7A 2C3KA 4WNPA 4BFMA 4XNEA 1NVQA 3ANRA 5L6WL 3WF6A 3FY0A 3DLZA 4IEBA 3PWDA 3DBEA 4JBPA 4R6VA 3P1AA 5EDQA 2R0UA 3DBQA 1H26A 4M66A 5D11A 4UWYA 4E93A 2UW9A 3MY1A 3TJDA 5J7BA 1JVPP 1YI6A 4I6FA 3QTUA 1JKSA 4YO4A 4JDIA 5AR3A 4KIOA 3Q96A 5HG9A 3SHEA 4EC8A 1G3NA 2JDOA 1V0PA 3Q9XA 5IZFA 3OTUA 4EOQA 2FSTX 2XEYA 4QPAA 2ITQA 4NH1A 4X3JA 2EU9A 2PVYA 4DITA 3ZC6A 3ENHA 4NCTA 3LPBA 2ITXA 2CGUA 1GIIA 5IA0A 2UZTA 4I6QA 3RGFA 3HYHA 2WFYA 4RGJA 5JN2A 3C50A 1H08A 3NYOA 5GJDA 2XB7A 5BUEA 1PXJA 4AE6A 3CR0A 1OIRA 4TNDA 3HNGA 3NRMA 2ITVA 5EDPA 4MCVA 3JR1A 4IB3A 5CI7A 4YPSA 2A0CX 4R3RA 4KB8A 1VEBA 4LUDA 3D2IA 2WU7A 4FT5A 4RX7A 4BGQA 1XH5A 5LCJA 5H3QA 3NUYA 4FTQA 1H25A 4EJNA 3VUGA 3PJ2A 4QP9A 4AT3A 1BI7A 3HUCA 3W8LA 4WIHA 1YXVA 1A9UA 5CVGA 4NJ3A 4RWKA 1RDQE 4DG2E 5IA4A 5HX8A 2WQOA 2XRUA 5I9UA 1ZMUA 1DI8A 3RK5A 2XK6A 4G1WA 1ZYJA 3S2PA 1A06A 5ANEA 4FZAB 3SRVA 4EOIA 5C9CA 3JY9A 3FC1X 3V5QA 5EW3A 1XBCA 4ACGA 4F99A 2BKZA 4DFXE 4E5WA 3RPRA 3CJGA 5D7AA 4J7BA 3RAHA 5L4QA 1BX6A 1H4LA 2A1AB 3CE3A 3UQCA 3MVLA 1QPDA 2UZBA 3GU8A 4E4MA 1WVXA 3ENMA 4MF1A 2R7IA 4V0GA 5T68A 2OLCA 3H9RA 3MH1A 3UOHA 4XOZA 4FIJA 2IVSA 2YISA 2IVUA 3P78A 1RJBA 3EYHA 3GBZA 1QPJA 5AR2A 4CKIA 4D1ZA 3TUCA 4KRCA 2WNTA 5BYLA 3IPHA 4A9RA 3SRVB 3RAIA 3TUDA 4IAFA 2GPHA 3Q04A 4QP4A 4DT9A 3UP7A 1JWHA 4ZY5A 2GU8A 3UZTA 3EQRA 3NIZA 4AP7A 4E20A 4QP3A 1O6KA 2YIQA 3LOKA 2BRGA 4MWHA 1V0OA 2BIYA 3FZ1A 2CKPA 1F0QA 3QUEA 1WBWA 4J95A 3AT4A 1YOJA 1Q41A 3IOPA 2WQNA 4OTHA 4YC3A 4LV5A 4BZDA 5ANGA 5TR6A 3U6HA 2BTRA 4UX9A 3KREA 3CQUA 5CANA 5DR9A 2QR8A 3R83A 4CT2A 5LMKA 5FXQA 2Z7SA 2OFVA 3LCDA 4NM0A 4AUAA 1OUKA 2W1DA 3ID6C 3LIJA 5A46A 1PF8A 2VWUA 4IVBA 1UNGA 2O65A 4FTJA 5LOHA 3R8ZA 2EWAA 5HU9A 4RX5A 4FV4A 2AYPA 5LQFA 2JEDA 2ZDTA 3TKUA 3PPZA 4BTKA 4C4JA 2XZSA 4TKSA 3ZLWA 3FXXA 3SG8A 4MH7A 3UIXA 3HRBA 3KXGA 3MB6A 3R8LA 4IX5A 3IK3A 3UNZA 4ANSA 4D2TA 5CU0A 4CNHA 1OPJA 2PMIA 3QFVA 5LXMA 4O6LA 4JX3A 3MVJA 3VAPA 3KY2A 4FIEA 3HAVA 2B55A 4HZSA 5JGAA 2BUJA 2GTMA 2YM8A 3FMKA 1H27A 3TIZA 5A9UA 5CEMA 2J4ZA 1FMOE 2YM4A 5BYYA 4F9CA 5ETFA 3GCVA 2VWZA 4JLCA 2JIIA 4YP8A 3DFCB 1OMWA 2PVMA 4RLLA 2A27A 4G34A 4BDIA 2R3MA 3ETAA 5HCXA 2X9EA 3PSBA 4WOVA 5F9EA 3GEQA 2GHLA 4F64A 2ONLC 4EOKA 5DOSA 4MXXA 3SV0A 5IA3A 2QLQA 3FHRA 1JPAA 2I0EA 5ANIA 4M84A 3LQ8A 5EHLA 2GHGA 2OXDA 3QWJA 5FBNC 2OWBA 4FKLA 1GJOA 2W4OA 3OOMA 4KBAA 4HW7A 2JKKA 3W8QA 4QP2A 4U42A 4ZTSA 3PSDA 4JL9A 4MNEB 4IW0A 2R3LA 1CKPA 5H9BA 5AP6A 2R5TA 3PIZA 2ZVAA 5C8NA 4WNOA 4DYMA 5K4JA 5F1ZA 4JXFA 4QNAA 2PZ5A 4EZ3A 2VGOA 1BL7A 4FTIA
chains in the Genus database with same CATH superfamily
3MA3A 1PW2A 2FVDA 2XF0A 2OXXA 4XG3A 3RWQA 3WZDA 4QDVA 2Y0AA 4FTNA 2ETMA 5H8EA 3ZRMA 2DYLA 3ALNA 4A4XA 2EB3A 2VRXA 1H0WA 4RG0A 2Y8OA 4KIKB 3BV2A 3SOAA 4EOLA 3F2RA 4JQEA 4F7JA 2Y4PA 2YIWA 2LGCA 4FNZA 5CASA 4HVHA 5JFSA 4YJTA 3UOJA 3Q53A 3FKLA 4AXFA 4FL2A 5IMXA 2YA9A 4L3LA 3TNQB 3AG9A 3GVUA 4BJJB 2B54A 1WBTA 4EQMA 2Z60A 4GFOA 2R3QA 3T9IA 3POOA 3EN7A 4DBNA 3OW3A 2WPAA 2QLUA 3QLFA 5L8JA 5HNIX 2OH4A 3K5UA 5IMEA 3UODA 2JDVA 5HBEA 4FMQA 4USDA 5GIPE 2J9MA 1M2QA 4M15A 5CEQA 3OF0A 3QRJA 4EWHA 4RA4A 2QG7A 4LRMA 4GRBA 4CTBA 5EM5A 4EQUA 1H0VA 5D41A 2X0QA 4D5HA 5BUIA 2HELA 3F7WA 1P5EA 3BYSA 4FOBA 3MFTA 4AE9A 1YRPA 3PPJA 3UGCA 4RZVA 3G2FA 4HJOA 4FIHA 3K2LA 5HO8A 5GZAA 4QD6A 5JFXA 4HCTA 1NW1A 4BWXA 3PTGA 1W7HA 2BAKA 3BBWA 3ZBFA 4CFVA 4O1OA 4ASXA 4NM7A 4AW5A 1A48A 3GC9A 1B38A 4FYNA 2FYSA 4E3CA 3GCQA 2GS7A 3BLRA 4NZWB 4S30A 4YLKA 1MQ4A 3EQFA 3VS7A 4D0XA 4HVIA 5KHWA 4DDGA 3ZC5A 2J7TA 4IAZA 3WI6A 4E1ZA 2AUHA 3CKWA 3G0FA 4QMWA 4D1SA 4QT1A 3O0GA 2YHVA 3DAJA 3CQWA 4YTHA 2PVJA 3W2QA 3QD3A 3NPCA 3TNIA 3H0ZA 4IVAA 2OH0E 3DJ7A 4P90A 3WOWA 4DEGA 3Q2MA 4EYMA 3R1NA 4W8EA 2QHNA 4WO5A 3LFDA 4BCKA 3M1SA 4KUJA 3SVVA 4YSMA 3PJ3A 4FL1A 4E4NA 4FZ6A 1U5RA 4U8ZA 2WMUA 4ZEGA 4R1YA 2BDWA 4AW2A 5DEWA 4C58A 4UV0A 1BI8A 4I22A 1M2PA 1XWSA 4FV3A 3P4KA 1UVRA 2VX1A 1YXXA 1Z5MA 2P2IA 3S0OA 5HNGA 4IJPA 4Y8DA 3DZQA 2QOCA 3MH0A 3LMHA 2XNPA 3ZS5A 4R5YA 2W5HA 2OKRA 4LYNA 1P4FA 2RFEA 2UW7A 3AC5A 3D5XA 2J0LA 1YOLA 4J98A 1Q3WA 2C6KA 4RFMA 2BIKB 2W1ZA 1O6YA 3QCSA 5JEBA 3RI1A 2NYAA 4PMSA 5AV1A 4Z16A 5DE2A 2B9JA 4P4CA 3BU3A 4N6YA 4DTBA 3AXWA 4MKCA 3PP1A 4KKEA 4KSQA 4QP8A 4D4YA 3M2WA 2XIKA 5FUTA 2YCQA 5IKWA 2X2KA 1OECA 4OTRA 2CN5A 3W1FA 2AQXA 1OITA 4NW5A 4V05A 3UOKA 3ROCA 4EQCA 3TNHA 3RCDA 1QPEA 1VYZA 4I5MA 4UMQA 4DGLC 2FO0A 3NCZA 4CMOA 3G6GA 2IW8A 4QTEA 2G15A 3C4EA 1H01A 3HP2A 1MQBA 5KBRA 3PA3A 2BALA 4A4OA 4CYIA 4FSWA 2VWBA 3PXQA 4CRLA 2ZJWA 4BCQA 2HYYA 3IONA 1G8SA 2WTJA 3UYSA 5JZJA 4FX3A 5K5NA 5DN3A 2ZV2A 2WU6A 5HBHA 3LAUA 2ESMA 2WQMA 4NCTC 1UKHA 4TZRA 3RZBA 3O50A 5IUIA 3EQIA 3QTIA 3BZ3A 4JJRA 4FKIA 1URWA 2CLXA 2Q0BA 3F9NA 4XLIA 3ZEWA 3A8XA 5H8BA 4EK3A 5CF6A 1K2PA 2JKOA 3L8VA 4BVUA 4EK5A 4EONA 3RKBA 3OY1A 3P86A 2PVHA 4R7IA 4XP2A 2W1IA 5ANJA 1E1XA 4IVCA 2A19B 5IQEA 2VX0A 1P14A 4BDCA 5LVMA 1TQMA 3IW6A 2ITWA 3PJ8A 1REJA 4OUCA 4QMLA 3E7OA 3W2RA 1GAGA 4I24A 1P2AA 2OIBA 3ANQA 3KK9A 2O8YA 4L7FA 5CENA 4HGEA 5EHYA 3R7EA 2CKQA 3QX2A 3BHYA 4YZBA 2JLDA 3F3UA 4K2RA 4YUQA 3QQJA 3Q5ZA 2E9PA 2JAVA 2P2HA 1H07A 2VWIA 1VJYA 2OJ9A 3R8MA 4UN0C 1RQQA 3L9NA 2CKOA 3AD4A 2C6TA 4F7LA 3RZFA 5M44A 2B4SB 2CGVA 2JBPA 3ODZX 4KS8A 1X8BA 4GU9A 3FYKX 4IJ9A 3EHAA 3SW4A 3TYKA 4E6DA 4FEUA 3H30A 3R9OA 3ZOSA 4BCOA 4QMYA 4IX6A 3Q2JA 5CZHA 3REPA 3V5WA 5DGZA 2PTKA 1FQ1B 1ZLTA 3TACA 2XA4A 1UWHA 2J90A 5L2IA 4J52A 1CM8A 4K33A 4A4LA 2IZTA 2PWLA 4TYGA 5BMSA 2OFUA 4I0SA 4IBMA 2UUEA 4FT9A 3QZGA 3C7QA 4BDGA 4DH5A 4E5AX 3AOXA 1GOLA 2W1CA 3LJ1A 3DGKA 4CVAA 4QQJA 4Y5QA 4M7IA 1M52A 2XAOA 4EHVA 3IW8A 4FK6A 4U97A 5JQ5A 4ZS4A 1Z9XA 4PRJA 3MH3A 3VJOA 4EH7A 3QXPA 3DKGA 4QMXA 4EZ5A 1OIYA 1H1SA 2UZOA 3BE2A 4JOAA 2QO9A 3H0YA 5KBQA 4D2SA 4E8AA 4EH5A 4DHZA 2CDZA 5FBOA 3OT8A 5KMLA 1ERKA 1UU3A 3V01A 3A62A 5HGIA 4FSRA 5D7VA 3ZRKA 2X9FA 3Q9ZA 4BCHA 4U41A 4YJVA 5F4NA 3ZM9A 4L8MA 5H8GA 3RTPA 3PRFA 1H1RA 2I0HA 4O38A 2H34A 2PY3A 5TE0A 2QKRA 4BCFA 4F0FA 5C8KA 5IH5A 5J5TA 1KOAA 3FC2A 5A4CA 4X2KA 2BVAA 2HCKA 3NYVA 3PJCA 3F3VA 3VS0A 2VTIA 1XJDA 5TF9A 2QOOA 4RT7A 2Y7JA 5JH6A 5DNRA 2YIXA 4LGDA 1FINA 2HZIA 3TJCA 4ALVA 3SLSA 4RVLA 5KX8A 3F2AA 5BX0A 4UB7A 4ZZNA 3E87A 3MGYA 4H39A 1FOTA 2X7GA 4O84A 5TKDA 4PP9A 2YWPA 2Z8CA 2OBJA 3PG3A 3VJNA 5J8IA 4CFNA 3DZOA 3SG9A 4W9XA 4WT6A 1Y8GA 3N4TA 4FL3A 2GFCA 4UZDA 5EK7A 3S4QA 1ZXEA 4AZEA 5CWZA 5HLPA 2VUWA 4ZTMA 4AAYA 2BRBA 4Q5HA 3PUPA 4D0WA 3FQHA 3IECA 3O8TA 3QZFA 2PU8A 2UW8A 4L67A 3LQ5A 5E7RA 3BYOA 4B8LA 1JOWB 3A99A 3AMYA 3QD4A 3ORNA 5GHVA 1Q3DA 4XUFA 3BELA 1PHKA 3H9OA 4UMUA 4DHIB 4LM5A 2VN9A 5ACBC 1HCLA 4DC2A 5IQBA 3R71A 3MIYA 3FLWA 5JQ8A 4U45A 1YKRA 5C4LA 3D94A 3FXWA 4XG6A 5I9ZA 2JDSA 5HO7A 3OCTA 4RIYA 4TW9A 2UW6A 1TZDA 3MW1A 4FV5A 1NVSA 4ZLZA 5IH6A 3DV3A 3COKA 5L8KA 1OKYA 1J3HA 4BI2A 4C4IA 1O9UA 3QRTA 3BL9A 3RP9A 1OL1A 2ONLA 4NYEA 1QL6A 2VTTA 2XNBA 3P23A 4G9CA 4YSJA 2OZAA 4W4YA 1SMHA 3UE4A 4H1MA 2BFXA 4KIQA 1FVRA 2QO7A 2JKQA 2HAKA 3RAWA 3ZXTA 3KVWA 5LVNA 3H3CA 4DGMA 2HENA 3ORMA 4LRKA 3DXQA 4X0MA 1PXIA 3PZHA 2OJGA 4BIEA 4CFWA 3VUKA 3TG1A 4U6RA 3DDPA 5IEXA 3QTWA 4MD8E 5GNKA 2ZM1A 5CX9A 5HKMA 4IM2A 3ZMMA 4RIYB 4AAAA 5J1WA 3F7ZA 3QA0A 3LFEA 1U54B 4FBXA 3QTRA 4FVRA 4BKJA 4ZJVA 3QD0A 3E64A 3ATSA 3PY3A 1WBNA 2E9VA 2GNIA 1FGKA 3QWKA 3WIGA 4G9RA 3ORLA 4X2GA 3CGFA 5HORA 2C5YA 2BHHA 4YTIA 2YDJA 4DCAA 4BBMA 3BGPA 2OZAB 3KRJA 4R78A 3FMLA 3PRIA 4RVMA 4WG5A 1JSVA 1XHAA 4DFUA 2R3NA 4ANLA 4QMMA 4YBKA 2VNYA 3SXRA 3PYYA 3DKCA 3TNWA 3PZEA 4HCUA 3ZSHA 2G2FA 2RGPA 2XNEA 2IWIA 3R73A 5FGKA 2VGPA 4I23A 1IAJA 3U87A 4DEDA 4MXAA 4A7CA 2NO3A 3H4JA 3FZOA 4NM3A 4RFYA 4Z3VA 3CPBA 3GQIA 4O7LA 4UMPA 5L8LA 3MN3A 3L9MA 1PXLA 5HCYA 4F78A 2WMVA 2VTNA 1H8FA 4XRLA 5IEVA 3D5VA 3TWJA 2RIOA 3D4QA 5AR4A 4FV7A 3KKVA 3R9RA 3MWUA 5IQIA 1U5QA 4ARKA 3CGOA 4FUYA 2RFNA 4PDOA 5EM8A 5AR5A 2X8IA 2YAKA 4I5CA 1LUFA 2NPQA 5CALA 2VTSA 2QU6A 5A4LA 3ORXA 5AP0A 4ANNA 3HKOA 4AZVA 2YIYA 3K5VA 1SVEA 2X4FA 4IWOA 3VS6A 5KUPA 2XH5A 3UDTA 3LLAA 3A4OX 1PXNA 3RALA 4HZRA 4WKQA 4FTTA 2F7ZE 5ETCA 4QEBA 5DG5A 3QKMA 4O0VA 1FVTA 4IC8A 2BKKA 3TZMA 3ZCLA 3B8QA 1APME 4I3ZA 4HPUE 4RVKA 3BIZA 2YIRA 4F08A 2RFDA 3U51A 1W0XC 4O96A 4C3RA 2ETKA 5I3OA 2XVDA 3BHHA 3DBFA 4RJ5A 5ETAA 4APCA 1OGYA 3OT3A 4PL3A 4W9WA 4IMYA 1H1WA 1YWRA 1OZ1A 5BMMA 3O5AA 4ZZOA 1ATPE 4LFIA 4XG4A 4J8NA 4G6NA 3ZDIA 4BB4A 3BKBA 5A6NA 5TT7A 2XIXA 3LQ3A 1JSUA 4GVJA 4O2ZA 2R3OA 3HV3A 3N9XA 3U9NA 3TI1A 4O86A 1G8KA 4BC6A 2FUMA 3CLYA 3QRUA 4MD9E 4I6BA 3FZRA 4QQ5A 2ZOQA 3OCSA 4IE9A 1H1QA 1S9JA 2W99B 4GIHA 4EH9A 2F49A 4GFGA 4XYFA 1FVVA 1ZZLA 3BWJA 4FKSA 2HW6A 4MHAA 4EORA 2XANA 1Y6BA 4OT6A 3CY2A 5AUVA 3KGAA 4JG7A 2YZLA 3I7BA 2JAMA 4F9BA 3ZUUA 4ORKA 4BGHA 4QQTA 3BLQA 4APPA 4EKLA 5A4EA 2VD5A 5J1VA 4ERWA 2DS1A 3W18A 2HY81 2PMLX 3DJ5A 4C4FA 1JKKA 2PVKA 1ZOEA 2JIUA 1OI9A 1ST4A 3QRKA 3W0QA 5C26A 3D0EA 3VWAA 4O4FA 5EFQA 4RC4A 1Y57A 3DJ6A 3Q52A 2W1HA 2V62A 2ZV8A 4FIIA 4TTHB 3V6SA 4OTQA 2IG7A 2OZOA 2CNUA 4EOPA 3ORZA 4I6HA 2C6OA 4F1TA 4GS6A 1WBOA 3AD6A 5C01A 3CY3A 5I9YA 3CJFA 1FBNA 1B39A 3GT8A 4TY1A 2XIYA 4U43A 2YM5A 2B1PA 3FY2A 4GW8A 5GINE 5IG1A 4QYFA 5J9LA 2PMNX 2VO0A 3ORTA 4FV8A 4YJUA 3UOLA 3FSKA 3ZSIA 4JG6A 4DFLA 3Q9YA 4RC3A 4Y73A 5DPVA 3TNPC 4HYIA 3VS5A 1PXMA 3AD5A 3EJ1A 4RX8A 4X3FB 2O64A 3OWJA 4A06A 3D15A 5EI2A 3BQRA 4WA9A 3O2MA 1Q62A 3FYJX 2XM9A 4W8DA 4N70A 3D83A 4ZSLA 4ANBA 4MYGA 1ND4A 5LARA 3ZLYA 3Q4UA 3TEIA 3IG7A 2R4BA 2X7FA 4G3FA 1YI4A 2XKCA 3QQLA 4N0SA 4Y72A 4USFA 2VTRA 1J91A 2R3RA 2YCFA 3GGFA 4G3DA 2Z7QA 4O2PA 1P4OA 4AT5A 2NRUA 4LMUA 2QO2A 3V8SA 3GCPA 3JVRA 1R39A 2C4GA 3U9CA 3QGWA 2OF4A 3C4WA 4HVSA 2CNQA 3G90X 2YM7A 2OW3A 3O51A 5IQGA 3OEZA 1BMKA 5AIRA 4MXZA 3BU5A 1J7LA 3NCGA 2WOUA 4L3JA 3MFSA 1WAKA 4M0YA 5M55A 3VS4A 2YZAA 1OL6A 4LL5A 1E9HA 3FZTA 4MXYA 4L42A 5ACKA 4C4EA 5GIOE 4BWKA 3I79A 2JD5A 4FNXA 2OSCA 4LI5A 5CSHA 2GNFA 2UVXA 2WTKB 5CEIA 4ZTLA 4DDIA 3TKIA 2ZV7A 3A60A 5IH4A 5ANOA 3Q6UA 5IQHA 5I5ZA 3NUNA 4G2FA 5IDNA 4ALUA 2BDFA 2XM8A 3VBYA 5JGBA 3AKLA 3HZTA 2QU5A 3PFQA 4KD1A 5DH3A 3BHTA 4TRLA 3R00A 5HX6A 3IGOA 5KMNA 3BQCA 3FMDA 2V7OA 4EH8A 3VRZA 2C0OA 1KE9A 2KTYA 3ZSGA 2A2AA 3PVGA 5HU3A 2XYUA 5FTGA 2YITA 4FSYA 3GP0A 3UNJA 3TN8A 4ENYA 4DLJA 4EUUA 5BUJA 2IO6A 4M8TA 3IDPA 2W7XA 4CLIA 2WO6A 1CSNA 3ZFXA 4X2NA 4CXAA 3MVHA 2QOQA 3BI6A 5J79A 3VN9A 4J71A 3UZPA 4K0YA 2XS0A 5AWMA 5AP3A 3W55A 4BDBA 5ITAA 4A9SA 2OJJA 4P2KA 4Q5EA 3VBVA 3VBWA 3FXZA 3QQFA 4YNOA 2WMAA 4AA5A 2WQBA 4IXPA 4C59A 3DB6A 1W8CA 4R3CA 5BVEA 3M42A 3NR9A 5M57A 3IQ7A 2X8EA 3E8EA 5E8ZA 3LCOA 3WYXA 1UU8A 5IQFA 4DLIA 3MPTA 3NZ0A 4PTEA 4H36A 3F61A 3Q3BA 3TL8A 2C6DA 5FDPA 4I21A 1VZOA 3LFFA 4YZMA 4BWPA 5CF5A 4IZ5A 4PX6A 3U4WA 4KWPA 3ZDUA 4GIIA 3R21A 3MDYA 1U59A 3OWPA 5CEKA 1UNHA 1ZMVA 1WVWA 3ERKA 3UVPA 2OF2A 4WSYA 5AUZA 2WELA 4QP1A 2LAVA 1GZ8A 2B0QA 3KULB 2O63A 3D7ZA 2WGJA 5BVWA 2GQRA 4FF8A 5A3XA 3FBVA 4O0YA 4PWNA 3UC4A 3FE3A 4HCVA 3P7BA 4QMTA 3PP0A 3VS3A 2JDRA 4O1PA 5JT2A 4FTAA 4MNEA 3KN6A 4U40A 2QNJA 1SNUA 3WIKA 2XKFA 3HMNA 3MS9A 3O7LD 4KAOA 4UWCA 1MRUA 3V04A 3NYXA 4PDSA 3HEGA 4ASEA 1CKJA 1T45A 1ZYDA 4O4CA 4X2FA 5BVOA 4NL0A 4OBOA 3UNKA 3HAMA 1M17A 2VTHA 2Y4IC 3OUNB 2OO8X 2XBJA 3L9LA 3ZU7A 2FH9A 4GH2A 1XBAA 4F9AA 4UBAA 3MESA 3TKHA 5L6PA 3VHKA 1R0PA 5HBJA 4KIKA 4XG8A 3AT3A 3CIKA 3FLSA 4GK2A 4I92A 4I41A 4CV9A 4AA0A 2ZYBA 3OFMA 5J7HA 2F2UA 3HV7A 4ACCA 5HVKA 4J96A 5E91A 4GK4A 4G3EA 4ITJA 3RMFA 3UIUA 4CCUA 3AC4A 3QHRA 5CU3A 4FTCA 3SDJA 4FV0A 5BYZA 3Q9WA 2YJRA 2R3KA 3WE4A 3HX4A 4NTSA 2VV9A 3SXSA 3PXZA 4S33A 1SNXA 4I94A 1NVRA 4H58A 4W4XA 1OM1A 3HL7A 3NAXA 2BZKB 3WF5A 4C2VA 5HTIA 3C51A 2F7EE 2W1FA 2X7OA 4O7WA 4FSUA 3HA6A 4PL4A 3S95A 1YW2A 2E2BA 2G9XA 3LJ0A 4O83A 5CU4A 2PUNA 3MTFA 4UYNA 4M3QA 3W0PA 3A7HA 4RWJA 1IASA 4JRVA 2GNHA 4FT3A 5HOAA 4KNBA 4FTOA 3HVCA 4B6LA 4FI1A 1OB3A 2CLQA 5CT7A 3WF7A 3EN9A 1YWNA 3FL4A 3KMMA 4GT3A 3NEWA 3PY1A 3MSSA 3UO6A 3OBGA 3SGCA 3AKJA 1OPKA 2XCKA 3KRXA 4M69B 3UDZA 5FM2A 2UZNA 1ZAOA 4FV2A 3DK3A 4R1VA 1KV2A 3MIAA 2IF8A 4DFBA 4Q2AA 5EYKA 5K0XA 4O4BB 3NLBA 3I5NA 4BI0A 3EKNA 4IX4A 5J5SA 3ATTA 4S2ZA 1SZMA 4FKGA 5EG3A 3TDWA 3VVHA 3QQKA 2VTJA 3MFRA 5EW8A 2B7AA 4ZS0A 5FXSA 2W17A 5A54A 2OIQA 3UPXA 4FA2A 2JFMA 4EHEA 1YDTE 4JRNA 3SAYA 3MVMA 3SW7A 5FXRA 1E1VA 4BL1A 3MB7A 2X0PA 1OIUA 2OK1A 5G6VA 4M97A 5IU2A 4ZJIA 2Z02A 3GOKA 5DRDA 4ZSGA 5J95A 2XARA 3DU8A 3RK7A 3C5IA 4FT0A 3U6IA 1OUYA 2PUUA 2C47A 4DA5A 4OBQA 3ZZWA 1YXSA 4KBKA 1REKA 4L01A 2BILB 4BDFA 2R2PA 5CSWA 4C3PA 4DH1A 2NRYA 2WMWA 1DI9A 4J8MA 3BGZA 4C38A 3NDMA 5HTBA 5EYCA 3GUBA 3V8WA 3G9NA 3W32A 4CFFA 1JKTA 3BYVA 1K9AA 3MYGA 3UIBA 5BQ0A 5F94A 2J51A 5FG8A 5JMSA 2RG6A 3EH9A 3V51A 5TO8A 4FSZA 1ZYCA 4CD0A 3NWWA 2WTIA 4YTCA 4GVAA 3DQXA 3PG1A 4AGCA 3DNEA 4HGLA 2X39A 5B0XA 4DG0E 3IW4A 2P55A 5K5XA 2CGWA 4WD5A 4FNWA 4GJ3A 3ZEPA 5CAQA 2W4KA 3P5JC 1WFCA 2PVRA 4D9UA 3U6JA 4X7QA 4ZMEA 3QQUA 5AX9A 3EFLA 3R7VA 3ZO1A 5BNJA 4AZFA 2UZEA 4DFZE 4NTTA 5HVYA 3R9NA 2I40A 2ETRA 3OOGA 4GUEA 4RJ6A 2W0JA 5CXZA 2X6EA 4HNFA 2JITA 3C0HA 5T3QA 2YEXA 4QMNA 3ZZEA 4UMRA 5KKRC 3NFFB 2BHEA 3DDQA 4YHJA 3FZPA 3DPKA 4ACHA 3LFQA 3GENA 4QQCA 1BL6A 4ZTHA 5CF8A 3O96A 3D9VA 4DEHA 3DTCA 3QZIA 4A9UA 3ZO2A 1LPUA 4IIRA 2OJIA 3W0OA 1ZMWA 2XYNA 2XKDA 3QAME 1IRKA 4H1JA 2WAJA 3FQSA 4NWMA 4J99A 5EI8A 2WD1A 4X21A 2I1MA 4X3FC 4IWPA 4ANQA 3RPSA 5CSPA 3G15A 4DH8A 5JGDA 4QTDA 3GCUA 2W06A 3BRBA 4TN6A 4U0IA 2GS6A 5ANKA 5DMZA 1BLXA 4BCPA 2QD9A 3OEFX 3II5A 4K6ZA 3ACKA 4ZSAA 1IAHA 3LCTA 1OPLA 4FVPA 3OCBA 4U5JA 3ZO4A 1OL5A 3VF8A 5LWNA 1YDRE 4C02A 4OGRA 4IX3A 2WOTA 2RG5A 1OBGA 1PXOA 3GOPA 4BYIA 4C3FA 4HOKA 4G3CA 5E8WA 2VWVA 3W2PA 5AP5A 3DY7A 1GNGA 2XRWA 4OTDA 5EKNA 4PPCA 1V1KA 2H9VA 4RIOA 5AIKA 4IB0A 4AXDA 4XH6A 5HE0A 4JAIA 3ZHPC 5KMJA 2HW7A 3I1AA 3FUPA 5CAPA 2UVZA 3NSZA 2QONA 3KRWA 4FUXA 2WTKC 2P4IA 4NSTA 5E1EA 2ITNA 4BY9E 3BHVA 1YI3A 4TYJA 3F3TA 5CXHA 4P7EA 3PIYA 3MJ1A 5ANDA 2WTCA 4CKRA 3PXKA 4DH3A 3ULZA 3UZRA 3IKAA 5JSMA 3FI3A 3RM7A 5K4IA 4BCJA 4I5PA 3G0EA 5AUWA 5A14A 3ET7A 3PXYA 1QPCA 5CNNA 4CCBA 3IS5A 4E26A 3UQFA 3IO7A 2ERZE 3HV5A 2XUUA 4OAUC 4RJ7A 2IJMA 2P3GX 4D55A 4FTUA 4GFMA 5HD4A 2CSNA 3LCSA 2PMOX 4OTPA 4J53A 3LFSA 1U4DA 4YBJA 4BYJA 2R7BA 5EI6A 4XOYA 4TYEA 5B2KA 4PPBA 4L68A 3PXFA 5HD7A 2HXQA 2W05A 2WTVA 3B8RA 4RBLA 3N4VA 2PUPA 3AC1A 4DT8A 4NW6A 1GIJA 4MNFA 4P5ZA 4FTKA 3COHA 4RWLA 4C37A 5CVFA 3TZ9A 3SA0A 2V5QA 4YZCA 2OI4X 4D2VA 3MFUA 4C2WA 1PXKA 2FB8A 3CS9A 4MEDA 4RZWA 2I7QA 2OIDA 5AR8A 5EOBA 5FEDA 4XBRA 2V0DA 4A9YA 3AT2A 4DH7A 4EYJA 2HZ4A 3E62A 3QX4A 4RRVA 3KB7A 5DVRA 1BKXA 1R0EA 4GUBA 3R8VA 3LFBA 3ITZA 4ERKA 1I09A 1S9IA 3LCKA 4FKPA 3GCSA 4QRCA 3B2TA 3FLZA 4NT4A 2YDKA 4F0GA 1W82A 4JVGA 3W0MA 4G6LA 3SX9A 3ORKA 3PWYA 3ZFYA 1JKLA 2ITPA 1ZZ2A 3LE6A 4YNEA 3LVPA 2I0VA 2BCJA 2DWBA 3E93A 4DTKA 4OR5A 3S3IA 3QYWA 2XNGA 4AXEA 2VO6A 2HXLA 2J50A 3ZRLA 4BDJA 2WMRA 2I0YA 3DBDA 2V22A 4XLVA 5CSVA 3VUMA 4H3QA 4FZFB 2UW0A 3Q32A 4Y85A 4YZNA 5AJQA 4AZTA 4KABA 1Y8YA 1YXTA 2ITOA 4MD7E 4ZY6A 2QC6A 4AZWA 2E9OA 2EB2A 3FV8A 3OY3A 3OWKA 4E6AA 4FOCA 3CCNA 2PZPA 3R7UA 4JT3A 4M14A 4GT4A 2VTOA 3N4UA 2ZAZA 4BDHA 4CMUA 4U79A 3KC3A 5AP7A 5EHOA 3ZFMA 2VTPA 4I4EA 3VBXA 4MVFA 2ZV9A 3FDNA 4E6CA 3U55A 1PXPA 4F9WA 2BDJA 4PL5A 3WZEA 3WF9A 5K9IA 1NA7A 4BDEA 3I4BA 4M0ZA 4LRJA 5BVNA 4AGUA 4E4LA 3PE1A 3O71A 3ZLSA 3PA5A 4GEOA 5HIBA 3HLLA 2C5OA 3R04A 4XV1A 2QKWB 3QC9A 4XRJA 4K11A 1SVGA 3C4ZA 5JRSA 5ETIA 5HE1A 5HG7A 4C7TA 1H24A 4YTFA 3OXTA 5BVFA 2VX3A 3I60A 4TT7A 5AEPA 3M11A 4NK9A 4CG8A 3U54A 2IZSA 2CJMA 1YOMA 1UV5A 4IAKA 1ZY5A 1LR4A 4AFJA 3R1SA 3MH2A 4AOIA 3HECA 4CQEA 5AUUA 4DAWA 3COMA 4KINA 3VNTA 4Z55A 2GHMA 4TWNA 2A98A 3CD3A 4RQKA 4AS0A 2HOGA 3HRFA 3TT0A 4XEYA 2WMBA 4PNKA 1V0BA 5A4TA 3UQGA 2C6IA 1STCE 1U54A 2J0MB 4A9TA 1DS5A 3JVSA 3Q6WA 4FSQA 4HGSA 3QF9A 2RL5A 2BAJA 2JIVA 2O3PA 2WMTA 4JI9A 3FMHA 4PV0A 2XMYA 3EQHA 5AMNA 2ITUA 3FL5A 2PE0A 4YC8A 5HE3A 5IUGA 5CYIA 3H9FA 4UMTA 5C4KA 5AUYA 5EQEA 3KIOC 1IG1A 3QTQA 3R7OA 1M14A 3EQGA 3RHXA 3RINA 5AADA 3PFYA 3QCQA 3K54A 3FMMA 2UZVA 4XG2A 3A4PA 2W9FB 4X2JA 3VIDA 4B9DA 4CRSA 4DEAA 4M12A 5F20A 4BTMA 3G51A 1U46A 4RFZA 4YGAA 4JS8A 4QMQA 3W0NA 1KE8A 4G5JA 2Y4IB 4MX9A 1W84A 2X8DA 4FKJA 4Z7HA 3V3VA 2R3JA 3F66A 4UWBA 5JKGA 3MPMA 4ONAA 1XH8A 1ZOGA 2YWVA 3L8XA 1XR1A 3TV4A 5AP1A 3VUTA 5HQ0A 5CY3A 1Q99A 3KXHA 1ZY4A 4HVDA 3PDTA 5I9WA 4L7SA 2CNVA 3RPYA 3ULIA 2XNMA 4FV1A 1AGWA 3BYUA 3LMIA