1VEBA

Crystal structure of protein kinase a in complex with azepane derivative 5
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
338
Chain Sequence
EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structure-based optimization of novel azepane derivatives as PKB inhibitors
pubmed doi rcsb
source organism Bos taurus
total genus 100
structure length 338
sequence length 340
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1vebA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1vebA02
4OTQA 3Q6UA 2YJSA 3QZIA 3BYMA 3QQGA 4J99A 1XBAA 1O6YA 4XV1A 2SRCA 5C8NA 5FUTA 2XIRA 3TUCA 5HTCA 2ITWA 4QNYA 2VO7A 3IW4A 1U54B 5EQEA 4TKSA 2WTVA 4MNFA 4FEWA 3ZM4A 4Z7GA 5B2MA 2VO6A 1BL6A 4MF0A 3QZFA 3KXMA 3ZC5A 3IDCA 4LMUA 4BCIA 3BYSA 4WBOA 4BB4A 3SVVA 3HP5A 5HOAA 4FG9A 4D2SA 4WNKA 4YLLA 4FTJA 5CXHA 5HG7A 2WPAA 3VJOA 2Y8OA 4C61A 4FKRA 3LW0A 3P7CA 4BDCA 3IKAA 4CNHA 4DFYA 5LMAA 2OWBA 4BIDA 3L8PA 5TR6A 5A4LA 4QTDA 3TV6A 3VS6A 3BBTB 4LM5A 2BFYA 3OW4A 4FTIA 4RZWA 4BWKA 2O65A 4IAAA 2NRUA 4BKJA 3PWDA 3V5PA 1WBPA 4EK5A 5EW3A 1T45A 1QL6A 3ANRA 4FT5A 3OBJA 5HE2A 2B7AA 3MA6A 3NUAA 4LGDA 1DAWA 3R7UA 3TKHA 4E6CA 5CF6A 3FC2A 1KWPA 2V5QA 2VWYA 4L3JA 5CQWA 2BRHA 2R3NA 3OXIA 3MB7A 4B4LA 5LMKA 4YZNA 1YI4A 4RVMA 4ZSLA 3IPHA 4EOMA 5JSMA 4U41A 4E4NA 2CKPA 5E8SA 2X1NA 3F66A 4TYIA 1KV1A 5IQFA 5L6OA 2ZMDA 4MCVA 3FUPA 3VUHA 1V0OA 4XUFA 4BTJA 4DFZE 3PIZA 4HNFA 3VS3A 3OF0A 3R8PA 2QOOA 2BFXA 4X6RA 4BCKA 1XH9A 4FSQA 4TWOA 3HRBA 4L68A 4BDHA 3EQGA 4QMNA 5HE0A 4F9WA 5CEPA 3OXTA 3FLZA 2Z7QA 5M57A 1IG1A 5CZIA 4IZ5A 5I9WA 4OTDA 4RJ6A 4Z7HA 3K54A 3FSKA 4ITJA 5EDRA 2CGXA 3FZRA 2XKEA 2XYNA 4M3QA 5IA5A 1WBOA 3IGOA 4WNOA 3TWJA 4UMRA 5IG1A 4A4XA 3ZDUA 5H8GA 2CNQA 4U6RA 2XEZA 3DB6A 3E5AA 5A4TA 2EB2A 2F7ZE 2ITYA 5CAVA 4NTTA 2Y9QA 3MIYA 3O7LB 4O96A 3Q6WA 2VNYA 4C59A 4NM5A 3V01A 5HG8A 4U80A 4KSQA 5CVHA 1J1CA 3EMGA 4L45A 5C4LA 3ACJA 1IA8A 4PMPA 1O6KA 4GJ3A 1H1WA 2WMAA 3ZMMA 3CXWA 3EFWA 3QGYA 4YBJA 4GYGA 4YHJA 4YMJA 4B0GA 4LOQA 5JGDA 3COKA 5FTQA 5AP3A 3DGKA 5EYKA 4YSJA 5CSVA 2R4BA 4OTGA 2JFLA 3P5KA 4DGGA 2C6EA 2W05A 5M06A 4E8AA 5DR6A 3DTWA 2XBAA 3T9IA 1OIRA 3CJFA 3E87A 3FJQE 5E8YA 3ZFYA 3F82A 3NNVA 1VZOA 2J7TA 3EYGA 4CV8A 4O7LA 5E8TA 3VS4A 4BBMA 4BKZA 3DS6A 2XRWA 3R04A 1OZ1A 3Q53A 1ZMUA 2XS0A 4DFNA 5LXMA 5EW8A 1H0WA 5FM2A 3NUSA 4EYMA 4X21A 4DLJA 3BBWA 3ALNA 3LFFA 3B8RA 5FXSA 3NLBA 4CTCA 2BRBA 2J4ZA 2W96B 4FV7A 4TRLA 3WYXA 3ODYX 4CFUA 4AAAA 1LEWA 4RPVA 4ASZA 3V04A 5DEWA 4AXAA 4CLIA 4QTCA 4MQ1A 1YXXA 4HYIA 4CYJA 1W83A 4AOJA 4EZ5A 1QCFA 3EQBA 5ANEA 3VN9A 1ZZ2A 4F7LA 3MTLA 5F4NA 3NNUA 2C5NA 2XIZA 3DAKA 4E3CA 1QPCA 1I44A 5IF1A 2X8DA 2QO7A 4D2PA 1R39A 4BZNA 3ELJA 5IPJA 1OKYA 1H08A 2R3LA 4IADA 2UZOA 2PVHA 1Q8TA 5KBQA 3H30A 4U44A 2QHMA 3PPZA 4K77A 3PSCA 1A06A 3IK3A 4O7SA 2QOFA 2RFDA 4EJNA 2IVTA 2BMCA 3HA8A 5KCVA 3RGFA 4QMYA 1K3AA 2C3LA 3SA0A 2VWBA 3SW4A 2PE0A 5ANIA 3KCFA 4ZY5A 3HV7A 1PXIA 1UKHA 4YJQA 2CPKE 3VBVA 2W1DA 4XG4A 4K18A 1OBDA 2B1PA 3GXLA 3VRZA 4Q2AA 3UVRA 2PVJA 4E20A 5M51A 4V0GA 4FTQA 3QLGA 4IB5A 4BBEA 3A7FA 3UO6A 3N4VA 3U51A 2A0CX 3DNDA 3GU4A 3NUUA 4HJOA 1J3HA 4MYGA 3T9TA 3QALE 4EZ3A 5CYIA 4R8QA 3QRJA 3DDQA 4D4VA 3GQLA 4QYHA 2REIA 5HORA 3KCKA 1LR4A 5EK7A 1OUYA 3DJ6A 5HZNA 2BDJA 5KZIA 3WZEA 3I1AA 2YN8A 5BUEA 4TWCA 2CGVA 3LJ2A 2BIKB 4XMOA 2IWIA 3KVXA 3QAME 5HNBA 5DA3A 2OLCA 2V0DA 2YZAA 3RM7A 2YFXA 4R7HA 2R2PA 3F2NA 5HLPA 2XYUA 3ZEPA 1E1VA 4QQCA 3UVQA 3FXWA 3UZPA 3HVCA 3U6HA 4LUDA 1FMKA 3U6IA 3CP9A 4USFA 1UA2A 1XH6A 3DKCA 4ZSGA 5CX9A 3EN7A 2QOIA 4R5SA 3ZFMA 5A4EA 4FX3A 4FZAB 3PA3A 3U9CA 4BDJA 2PVYA 3Q2JA 1U59A 3HDNA 3DJ5A 4BR3A 3H9RA 5AX9A 1FVVA 3PXZA 4AP7A 3MA3A 2J2IB 2XUUA 4BL1A 1Y8GA 3G0EA 3FAAA 4FT0A 2R0IA 4MNEB 5KMNA 4WG5A 2UW5A 3N4TA 2WEVA 5JFXA 3MDYA 4YHFA 1KE7A 5E8VA 4Z16A 5C9CA 5KO1A 2FUMA 3OZ6A 3BHUA 3RNYA 4C33A 5ANJA 1W98A 4GT4A 1OKWA 3TIZA 1H28A 4PL4A 4FK6A 2PZYA 2KULA 4QPMA 4PMTA 4XV9A 5C1QB 5LVNA 1NA7A 3NIEA 3QD2B 1BKXA 2ZYBA 1GIHA 4BGQA 1ZMVA 4J1RA 1JOWB 2YIRA 1PKDA 5ACBC 4X7QA 2X6EA 4FBXA 4JBPA 3ZSHA 3R8VA 3UMXA 4JX3A 2ZVAA 2Z2WA 2HZIA 3MVJA 2R5TA 5IA0A 4O38A 4BGGA 4ID7A 3TTJA 3KXHA 3MIAA 5HO8A 3ZYAA 3DFAA 1FQ1B 3DAEA 3UP2A 4F1OA 3K2LA 3W8LA 1WZYA 3F69A 3C4CA 3Q04A 2CSNA 4UMPA 4FZ6A 1E9HA 5DRDA 2EU9A 2QOHA 4BCGA 4BDIA 2W4OA 5D12A 1Q61A 3BEGA 3EQRA 3FL5A 5AUYA 5C01A 3ZDIA 4IM2A 2W9ZB 4CZYB 5B2KA 1G8SA 5DVRA 5FTGA 2A4LA 4RIXB 2QI8A 2ITVA 4ONAA 4E73A 3SV0A 1XH4A 4K9YA 4IANA 2P2IA 4C4FA 2VUWA 2BHEA 3Q9XA 1R1WA 2CLXA 2Z7RA 1PXKA 3H4JA 4I1ZA 4DE4A 4ASEA 3NSZA 2OIQA 3OD6X 4JG8A 1ZMWA 3KVWA 2GHGA 4AZTA 3NIZA 5CAUA 3I7CA 1P14A 2WTJA 2X9FA 2C69A 1OIYA 1QPDA 3OCTA 4FGBA 3F3TA 1WBSA 4M0YA 4YLJA 5IA1A 4IHPA 3VS7A 3QD3A 3T3VA 2PU8A 3CQWA 3DQWA 4L67A 2DYLA 3IOKA 4DT8A 2ETRA 4WKQA 4D1ZA 4MNEA 3EKKA 1PYXA 1WVWA 3CGOA 2J0MB 4GMYA 3R7EA 2F7XE 4E4LA 4O0UA 4WNPA 2V55A 2VTPA 4FKGA 4HOKA 2CN5A 3TCPA 4EHGA 3LQ5A 2UZNA 1UU7A 3NYXA 2E9VA 4W9WA 4C02A 3VQUA 5AUUA 3GU8A 3GFWA 2GDOA 1YHSA 3MSSA 3NYVA 2XK7A 3QTIA 3OMVA 4LL5A 2DS1A 3G0FA 4JL9A 4PF4A 5CTPA 4ANBA 2B52A 4ZZNA 3BU6A 4HZRA 4QP8A 5A54A 4G3GA 4NTSA 3DZQA 2FSOX 4ITHA 1AGWA 2PPQA 3E3BX 1Q41A 3QA8A 4KINA 3R83A 5AA9A 4LRMA 1BYGA 2VTOA 3UZTA 3W2PA 3D7ZA 3KRXA 4ZOGA 2VO0A 4O27B 4MEDA 5AP1A 5DBXA 3SQQA 4EONA 3HKOA 5CANA 4EH4A 3ENMA 4DG3E 1XWSA 4JS8A 4O86A 2Y6OA 4TN6A 2WNTA 3EN5A 5KE0A 4IX3A 2QCSA 2PE2A 3NAXA 4RJ7A 1PXMA 3OUKA 5HKMA 4IX5A 4KSPA 4JR7A 5KMMA 4RLKA 2YM5A 4RIXA 4CMOA 4ZMFA 3LQ3A 3DTCA 5EM5A 3R7OA 2WTKC 2P3GX 2WMTA 1H1RA 2C0IA 2WTKB 1ZYDA 4FOBA 4YC6A 5DH3A 3S4QA 1DM2A 1U5QA 3QKMA 4KB8A 2XNNA 4FYNA 5DE2A 3CTJA 3UG2A 1YXSA 3LFDA 2BRNA 3CD3A 3FLSA 3PVUA 4N70A 1FOTA 4TNBA 5D7VA 3RPOA 3VIDA 4YR8A 3ZCLA 3F2RA 1XH7A 2HZ0A 2XIYA 4P5QA 3EZVA 3E8CA 3EB0A 4AWIA 5AR8A 4DGOA 4PPCA 3ZO4A 2QNJA 3QKKA 2UZEA 2XJ1A 3MI9A 5TKDA 3TIYA 5LWNA 3W2OA 3K3JA 4BYIA 1YQJA 5EQPA 5LWMA 4PDSA 3PVBA 1ERKA 3GQIA 3FZOA 2IW9A 3CY3A 4D2RA 4AT5A 2G01A 2VV9A 2WU7A 3CS9A 4EZ7A 5KNJA 4F0FA 2B9IA 4F1TA 2P4IA 2WXVA 3GB2A 2CDZA 3EFLA 4WT6A 3BQRA 5DT0A 5EHLA 3HEGA 1PXOA 3R21A 3RPVA 5AAEA 4ZTLA 3CE3A 2PUUA 3A60A 2WQEA 4PP9A 3TV7A 5JEBA 1Q3DA 2BTSA 4ZAUA 4XNEA 4RX7A 4ZS4A 4FZ7A 1MP8A 3CJGA 5AM7A 3HUBA 1FMOE 3I79A 4PL5A 3TDWA 2VWZA 3IG7A 3HDMA 3DDPA 3A7JA 5IDPA 2G2IA 4DC2A 5JT2A 3FQEA 5GHVA 1F0QA 4PUZA 4I5CA 2B55A 4X6QC 4EUUA 4YUQA 1SVGA 2V22A 5HNIX 5IA3A 5JK3A 2B0QA 2O8YA 1YVJA 4FV6A 2PHKA 4R3RA 3S00A 4LFIA 3MY0A 5E91A 2Z8CA 4C7TA 5E8UA 1ZOEA 1PY5A 3BQCA 3D7TB 3VNTA 4AN2A 3DU8A 2RF9A 4BVUA 4GW8A 4QQTA 2X4FA 3D5XA 3EKNA 3GCVA 3C4EA 4RGJA 1Q8UA 2QOLA 2IO6A 3GVUA 4PV0A 3VVHA 2JAMA 2JKOA 3HYHA 4G6LA 4EL9A 3V6SA 1CKJA 2YERA 3GC9A 4FGRA 2BPMA 2BRMA 2YZLA 3NVKI 3V5LA 1DAYA 3E8EA 3QQJA 4PPAA 3DK7A 3VAPA 4RWKA 2JDTA 3EOCA 4FIHA 5BNJA 3ZTXA 2OXDA 3CD8A 1VEBA 2XK3A 4QP6A 3ORPA 2Y4IC 4RC3A 4DTAA 1ATPE 4YJNA 3UZRA 3DNEA 1TVOA 4O0SA 2EUFB 3LCTA 1JQHA 2JDSA 2FSMX 3G33A 4FSUA 4QMMA 4J8NA 3NMUF 4YTFA 5HU3A 4YPSA 1YXUA 2WMUA 1B39A 3MN3A 1OGUA 5CNNA 4IAKA 3PP0A 4QP9A 3ZXZA 5IEXA 4EOIA 4YJOA 1BX6A 3SHEA 2OJGA 3TNQB 5IQBA 3BRBA 3EYHA 4MH7A 4CRLA 4I0RA 5EDQA 3KMUA 3ZO1A 5K0KA 4J71A 2OO8X 1XO2B 4O0XA 4KS7A 3EN4A 2FGIA 3QX4A 3UYSA 2O3PA 4X2KA 2ACXA 4X2JA 4C62A 3PXFA 5HLNA 2H34A 4UMUA 4I93A 3SXRA 2YLFA 3D5UA 4BC6A 4CFWA 2RL5A 3G6HA 4JBQA 3ORTA 2X2LA 4RVTA 3UP7A 5TE0A 5DR2A 5ANGA 4NW6A 5A4QA 2EXMA 4PWNA 2ZOQA 2G2FA 3OP5A 2YM6A 2B9FA 3P23A 4JG6A 5EOBA 1IAHA 1KV2A 2RFNA 4ZIMA 3F2AA 4WNMA 4XBRA 3W1FA 2Y4PA 4ACGA 5KX8A 4C36A 3BLQA 5CZHA 1K9AA 3UIMA 4L7SA 4GG5A 4DH5A 4IB1A 4FKWA 1R0EA 3L8XA 4OBPA 4FV4A 3ZOSA 4IVBA 3NGAA 5I9YA 5IQEA 3CGFA 4H1MA 3KKVA 4IJPA 2HOGA 2C3IB 3HL7A 4CTBA 3ORMA 4ANSA 3V6RA 3M42A 3R8MA 3GCSA 4APCA 2WFYA 4O81A 4JVGA 2IZRA 3BI6A 2QVSE 4S31A 3R8UA 3EN6A 3KMWA 5BUJA 2PMNX 2OZAB 2VWUA 2ZB0A 2OZOA 4FTAA 4JX7A 3UNJA 3ZHPC 1HCLA 4PMSA 2UUEA 4EH8A 3ZS5A 3OWLA 4FTRA 3FHIA 5HIBA 3FHRA 4EOKA 4M8TA 5TOZA 3CBLA 4P2KA 5EFQA 5CF8A 2BAKA 1X8BA 2QLUA 3W55A 2YM7A 2EWAA 3HNGA 4EH2A 4AA0A 1B38A 3T8OA 2E9NA 4I5MA 1VJYA 5EYMA 2R3JA 1V0BA 2XNMA 3RPSA 4O91A 1J7IA 5I9ZA 4ZTSA 4ZSAA 4EC8A 3E62A 4P4CA 3FI8A 5D7AA 5KHXA 2XK8A 5EI6A 3FYJX 3LFAA 4O0RA 1YOLA 4FT9A 4BCJA 3PG1A 2XKCA 4LV5A 3VS2A 4BDAA 2ZDTA 3KEXA 2XK6A 3OY3A 5I9VA 3VS1A 3CIKA 3HV6A 4NJ3A 4QNAA 5EH0A 3RAIA 4RT7A 5DPVA 4JOAA 4UN0C 3PG3A 3NUPA 5J7HA 4EH5A 3QWJA 4NZWB 1CMKE 2YITA 5A3XA 3PLSA 4V05A 2GS7A 4IDVA 4ANMA 4C37A 1Q4LA 3C9WA 3PE1A 2C0TA 3C4FA 5J95A 4RWLA 4A4OA 4BIEA 2OF4A 4NT4A 5ACKA 3WARA 5BVDA 4O21A 2VTAA 4ACCA 2YEXA 3R73A 5L2QA 3DK6A 4A4LA 4H36A 3A61A 3ACKA 5AUWA 2J0LA 2OJ9A 4DTKA 3QGWA 5KKRC 1WCCA 2R7IA 3L8VA 4ACMA 3R63A 4HPUE 2DWBA 2I7QA 4I4FA 4O6LA 3TT0A 5I9UA 5EDPA 5GJFA 4LRJA 2W17A 3GFEA 3QCQA 5AUVA 4CVAA 1GIJA 2PMLX 3R7GA 4UV0A 4TYEA 4IB0A 4OBQA 2C3JA 2VWIA 2BZJA 5LMKC 2B54A 3MH3A 5L6WL 4CCUA 4AOIA 4GL9A 3QUDA 5HIDA 1SMHA 4XLVA 2W5BA 1M2QA 2C3KA 4FT3A 1S9IA 3ANQA 4KD1A 1ZAOA 4WRGA 3QHRA 4ERKA 5M4IA 2ITXA 4RIYA 4XP2A 5E1SA 1GZ8A 2PZPA 2W99B 2BZKB 3C4ZA 3JY9A 4M84A 1KSWA 1HCKA 4EYJA 3RAWA 3VO3A 4BTKA 4C4JA 2IVSA 3BV2A 3AC5A 2PZRA 2YAAA 3OTVA 4OW8A 4X2NA 5AV4A 4IJ9A 3GNIB 3UNZA 2IVVA 1M14A 5K5XA 4CFNA 4JDKA 4FTOA 4TXCA 4JQ7A 3SC1A 5I3OA 4QMQA 4FE2A 1TQIA 3ORZA 3QCSA 5E8XA 4QD6A 4RWJA 3NX8A 1PF8A 5CEIA 4BIBA 4DAWA 5JMSA 3O7LD 3GU7A 3TJDA 3TEIA 4LOPA 2Z02A 3DLSA 2JKKA 2ETKA 2W4KA 2X7FA 3C0HA 4DBNA 3QBNA 1J91A 3L1SA 3VBYA 5GZAA 4QO9A 4W4VA 3QC9A 2R9SA 4FSWA 3NYNA 3DBQA 2H96A 4YU2A 2OFUA 3F7ZA 4DBXA 4RA5A 4DH1A 1MUOA 4KBCA 4GKHA 2JEDA 3DBFA 4IH8A 5A6NA 4YJRA 4QTEA 3NUYA 4NM0A 3VRYA 4EORA 5AV1A 3ZLYA 3PUPA 3VF8A 4XG6A 1SYKA 3PVWA 4RFZA 5FDXA 5IUGA 1IRKA 3BLHA 4QMUA 4Y8DA 4AZEA 3GC8A 2IZUA 3C50A 3PY1A 5D9HA 4K6ZA 5GJGA 5AADA 3BU5A 2YCSA 4PQNA 3ORIA 3LXNA 4U3YA 2QKRA 2PSQA 3I0OA 3UG1A 3EFJA 4QMPA 4A9YA 3NVMB 4QMVA 2JLDA 5HQ0A 3UBDA 3WF9A 4OBOA 3RCDA 5FEDA 3CKWA 4ZJJA 2GU8A 4RJ4A 4L8MA 4FV1A 4DEHA 1G8AA 3LFQA 3NPCA 3PY3A 1YI3A 3LMIA 5JGBA 4TTHB 4IIRA 2QODA 4O7NA 3DKOA 2Z7SA 4DGMA 1HOWA 3LJ1A 3VHEA 3PSDA 4CT2A 1Q97A 2VWWA 3B8QA 3QHWA 4FTUA 4J52A 1JSUA 4FF8A 4ZTHA 3QQKA 4FR4A 3A4PA 1A9UA 5AUTA 3I6WA 2H8HA 4QQ5A 4F6SA 5IUIA 2XM9A 2W1IA 3RJCA 2UW7A 3W2RA 3KC3A 3QQHA 4KRDA 4ALWA 3U6JA 4IMYA 3O51A 3GUBA 2EVAA 1JWHA 3GU6A 2CMWA 4Y5QA 3VUGA 5AR7A 1YDRE 4HGSA 5HGIA 5IQIA 4N6ZA 4NUSA 1QPJA 4QMZA 3PZEA 3CSVA 4TYJA 4F65A 1RDQE 4I3ZA 4M69B 3EL7A 3MH0A 4G3FA 4J98A 4MXCA 4ANQA 1XBCA 3E63A 2I0VA 4FTMA 5L8JA 3SAYA 2HK5A 3OROA 3OTUA 3LM0A 1MRUA 4XV2A 2JITA 3MESA 3PLAE 3QTRA 1ZYJA 1OITA 3BEAA 3PJ3A 4F6WA 1WBTA 3NW5A 4BGHA 2WOUA 3POOA 4N6YA 4B7TA 3DCVA 3L9LA 1ZOHA 5AP7A 1YHVA 3EHAA 1Y6BA 4GU6A 4XP0A 4YJVA 4AA5A 3MFTA 4R3PA 4JIKA 4MF1A 3RCJA 4DGLC 3ORNA 4EI4A 3OOGA 3LFSA 3W32A 5I0BA 3TJCA 5M4UA 2P33A 1E1XA 4KS8A 4TY1A 1F3MC 2UVZA 2ITNA 3SW7A 4NJDA 5HNGA 2W1CA 2OGVA 5FBNC 5I4NA 2OFVA 4AN9A 1Z5MA 1PXPA 2Y7JA 3QZGA 4W9XA 4O7RA 5EI8A 4QMWA 2XB7A 4DEAA 4AT4A 3JXWA 4DITA 4BFMA 1GIIA 4V0GB 1QPEA 1UKIA 4EEVA 3PIYA 2BVAA 4H3QA 5BVFA 3P1AA 3V5TA 3CCNA 4F99A 1VR2A 5D11A 1TKIA 1ZYSA 3I5ZA 5FWKK 4C2WA 4ZLYA 5IDNA 4AGWA 1U46A 4ZLZA 3ZRLA 3BYVA 3UPXA 3VWAA 1P2AA 3CLYA 3LKMA 2RSVA 2UVXA 3AC4A 4X2GA 5HVKA 2R3HA 1BI8A 4BHNA 4HZSA 2C6LA 5EM7A 2VTJA 3ROYA 4CKIA 5HTBA 1H1SA 5HO6A 3WZDA 4HNIA 4DFLA 2P2HA 3UOLA 4RVKA 2OXYA 5IUHA 2VWXA 3L9NA 4AX8A 1BUHA 2ITUA 1F5QA 3A8XA 3DPKA 3EFKA 2WEIA 3Q96A 4M69A 4LMNA 4D55A 4EWHA 5J1WA 2X6DA 4S32A 3DXPA 3TZMA 4MXYA 5HX8A 4FV5A 3H9FA 2HWPA 4MXZA 2CLQA 3KMMA 2BDWA 1OECA 2ZV2A 3FLQA 2F9GA 4Y72A 4AGUA 5EQYA 3WF6A 3NW6A 2OH0E 4FL1A 2W1FA 4XH6A 3IOPA 4IVAA 5J79A 3SX9A 2YAKA 4F6UA 4F1MA 3CTHA 4AE6A 5F9EA 2HW7A 2NNWB 3CQUA 4FV2A 1YXTA 4P7EA 5AR5A 4ZXTA 1VYWA 3FZPA 3BHYA 4IVCA 3D2IA 4U40A 3ID6C 4BI2A 3A7HA 4F0GA 4BCPA 5C26A 3R9DA 2OJFE 2XM8A 4GH2A 5AFVA 2WQOA 2XP2A 4Y83A 1M7QA 4EWQA 2QD9A 2ITTA 2YHVA 2C6KA 3VUDA 3WIKA 5M53A 5M56A 3QQLA 1AQ1A 2RG5A 2X8IA 4KIOA 2X9EA 4M68A 4FKIA 4XG2A 4JQ8A 4C3FA 4QOXA 2YM8A 2CN8A 2WGJA 4JAJA 2XNPA 3R8LA 4NKSA 4D4RA 2HXQA 2QU6A 4TL0A 3AD4A 4RQKA 3AT2A 4NM3A 2OW3A 2RGPA 5JRQA 2X39A 4E5AX 5IZFA 4FVPA 3B2TA 4IXPA 3WOWA 5FXRA 3P78A 1S9JA 3KK9A 5GINE 3LQ8A 4PP7A 3RZFA 3JVRA 5BMSA 2PTKA 4P5ZA 3HLLA 2C5YA 4MBLA 4F9BA 1LP4A 5T3QA 3MJ2A 5F95A 5CI6A 1STCE 2JDRA 3AC2A 4OTHA 3FLWA 4GVJA 4BI0A 1Q8WA 4G34A 3FZSA 4YZBA 2V7OA 2OU7A 3HMIA 3BHHA 1PXLA 1OIUA 3D2KA 4FSYA 4L42A 3Q4ZA 3ITZA 5DIAA 3UJGA 3SLSA 3ZC6A 4E5BA 3K5UA 4MHAA 4Z3VA 4OTIA 3WE4A 4CFXA 4MAOA 4UYNA 4M67A 3NEWA 4FSRA 3FE3A 5IKWA 3FMMA 3DBCA 2O0UA 3TNHA 4N57A 4NH1A 4Y5HA 4WRSA 5IQGA 3HMMA 1MQ4A 4NW5A 1OPKA 5HBEA 4O7TA 3FQHA 3Q5IA 5IEVA 1K2PA 2PY3A 4KAOA 4RZVA 4PL3A 2VGOA 2BHHA 2QC6A 4FKUA 2XIKA 3P0MA 4L52A 3QTZA 1ZARA 3DJ7A 3V5JA 3MPTA 2QR7A 3FV8A 3I81A 3C0IA 2XCKA 4MD9E 4NK9A 1NY3A 3FMKA 3OCBA 4TYGA 4FEQA 2BRGA 2PE1A 3PE2A 1TQMA 4LOOA 2G9XA 4UZDA 5HCYA 2VTRA 2ZMCA 4LYNA 3KK8A 2PZIA 3UODA 3S1HA 1ZRZA 2A27A 5EHOA 5JQ5A 4UBAA 4GT3A 4PDPA 4E4MA 4NKAA 4EQMA 4KUJA 2YIYA 5LCJA 4F7NA 5IQAA 5CI7A 4LGHA 5CQUA 3WF5A 4D0XA 5IMEA 3F5XA 2R3KA 2O64A 1BLXA 3RM6A 4JRNA 4QP2A 4K8AA 4YZDA 5AA8A 1SM2A 2YDIA 4IZAA 1PMVA 4FNZA 5DR9A 1FINA 2BIYA 2UW9A 3EQPA 3KXNA 4H39A 2I6LA 4DHFA 4EKKA 1ZY4A 4Q9ZA 4JNWA 5HG9A 4XG3A 2HENA 4QPSA 4UZHA 4IBMA 4IAIA 5KMKA 4CT1A 5H8EA 4QT1A 4B8MA 5CNOA 3TL8A 3E64A 3UQFA 4FNYA 4AN3A 4F7JA 1H01A 3TTIA 1U5RA 2VGPA 4GK4A 3D9VA 4FICA 3UGCA 4UWCA 4B6LA 1MRVA 2HW6A 2UV2A 3IW6A 4N0SA 5HE3A 2GCDA 4Z55A 3UO5A 3RI1A 4KBKA 3PZHA 5ETIA 3UVPA 4CZUA 3R1NA 1W7HA 4ZZMA 4KA3A 4FIEA 3QQUA 4ACDA 4FKLA 1NT2A 3I4BA 1KE6A 2VNWA 3FZTA 4FL3A 5HD4A 1XQZA 2I0YA 4QPAA 4AGDA 4F64A 5LVOA 3AQVA 4GS6A 5ETFA 3UOKA 4YURA 3OCGA 1JSTA 4F9YA 3AD5A 1H8FA 2R3RA 4C4IA 2WKMA 5CU2A 1UU8A 4O1OA 5J87A 2VTTA 2VTMA 2W5HA 3R7VA 1UU9A 5LVMA 1FBNA 4FSZA 2ITZA 3QD4A 3TACA 3SXSA 4FIJA 4Y73A 2F49A 3UNKA 1YWNA 2UW3A 3COHA 3F61A 5HBJA 3KFAA 3OHTA 5D10A 5FXQA 3ZUVA 4BTFA 3LHJA 4EC9A 1IASA 4D2TA 4F70A 4L53A 4MX9A 4Y95A 3SG8A 4FKJA 3W8QA 4M13A 4EK8A 4M7IA 3R00A 4QMTA 4WUNA 5CS6A 3O23A 3EQFA 2JDVA 4YPDA 1H1PA 2G15A 2Q0NA 2W1GA 1G5SA 2KTYA 4H3BA 2C5VA 3LCSA 5C8KA 2X7OA 4CQGA 3S2PA 3OT3A 5FDPA 5AP2A 5K4JA 3UPZA 2VWVA 3UMWA 1XJDA 4U8ZA 4RG0A 3RK9A 2XBJA 2ZM4A 2CHLA 3Q32A 4FTCA 5HCZA 3UE4A 5IH6A 2CJMA 3NWWA 2XK4A 2Q0BA 4NFMA 2J5FA 4UXQA 3AG9A 3D5VA 3KF7A 3V5QA 3Q60A 1H1QA 4F9CA 3O50A 4AW1A 4AZSA 3DY7A 2BAJA 1PYEA 3EJ1A 2GQRA 2GHMA 4Z9LA 4E6DA 4IAFA 5DYJA 3SD0A 4C38A 5BPYA 2CNUA 1KE5A 3JVSA 4R7IA 4RSSA 1ZY5A 3GEQA 5IEYA 4XOZA 2GS6A 5LJJA 3JPVA 4FK3A 4W8DA 5E8WA 3W18A 3H0ZA 4CQEA 2Z7LA 3N9XA 4XBUA 3GCPA 3SGCA 3JS2A 5K5NA 5FEQA 4AZWA 4HYSA 4O7WA 3BKBA 3QRKA 5AP4A 1UVRA 5EI2A 3BLRA 3QWKA 2WMSA 2HIWA 3W2QA 4KKEA 4DLIA 3KRWA 2F2CB 2YA9A 4GEOA 1A48A 2QKWB 1YI6A 3IGGA 1WBWA 2G1TA 3FPMA 4BF2A 1KE8A 1CKIA 3C4WA 5AP5A 3ULIA 4AG8A 5EYCA 3MGYA 3R30A 1CKPA 2OJIA 5E7RA 4NL0A 4FV9A 2XJ0A 3OWJA 1Q99A 3DXNA 4JBVA 4DG0E 4EKLA 5KHWA 1UNGA 1NVRA 1Y91A 2RIOA 2BZIB 3R1QA 2C6OA 2IW6A 3KL8A 1SZMA 3FBVA 3P9JA 1O9UA 4EHVA 3HAVA 2BTRA 1BL7A 2RKUA 4IWQA 2NP8A 2QG5A 5CLPA 5DN3A 3OT8A 1H07A 5BX0A 3Q2MA 3GOKA 4CLJA 5HG5A 2JIVA 4FYOA 5CF5A 1O6LA 4WO5A 3ERKA 4HYUA 1WBNA 3M2WA 4ZSJA 5FEEA 2W06A 4YTIA 3C5IA 1R3CA 4DEEA 4RIWA 4A9TA 4C4GA 2E2BA 2FSLX 2JC6A 4WUAA 3UIUA 2HZ4A 1GZOA 2YCFA 3VBTA 2X4ZA 3TZ7A 3FLYA 4D4YA 2O5KA 5AP0A 2H9VA 1T46A 4GIHA 5EW9A 1NW1A 4DF3A 5FLFA 5HICA 1JBPE 3I6UA 4TNDA 2NO3A 4B99A 2YLEA 1JSVA 3KB7A 3ZH8A 2OI4X 4EUTA 3AGMA 3QXPA 4BCFA 2IVUA 4TZRA 4BCMA 5HLWA 4G1WA 4UWYA 2C5OA 4LRKA 4FV0A 4UMTA 5FM3A 3EQCA 3A2CA 4S2ZA 4O0YA 5BVNA 1XH8A 2Y4IB 5E9EA 3RKBA 2BZHB 3OG7A 2XRUA 4BHZA 3KN6A 3MY1A 5L8KA 1XR1A 5M09A 2ITPA 4D1XA 4Y46A 3PJ8A 4EOLA 3AXWA 2VTHA 5J1VA 4NEUA 3GGFA 5HCXA 2IW8A 3TV4A 4L9IA 4HVSA 1M7NA 3OCSA 3PXQA 4UALA 4MBJA 4I6BA 4R6VA 3ZUTA 5BVWA 5ITAA 3VULA 4AU8A 3II5A 3V8WA 3FSFA 2PUIA 5HHWA 1YOMA 4ZEGA 2IG7A 5HTIA 5FGKA 4QP7A 2JBPA 4XRJA 3DK3A 5FRIA 3HRFA 3Q4TA 3I5NA 3G2FA 3PPJA 2IPXA 3PVGA 4CG8A 2HXLA 3HGKA 3FI2A 4J53A 4NSTA 4QMSA 4AT3A 1YXVA 3HV3A 4NU1A 4IE9A 5L2SA 2HAKA 4GFGA 4Q5EA 1PW2A 5AWMA 3TZ8A 5A46A 1PXJA 2R3GA 4IAZA 2NRYA 4ZLOA 4G3DA 4HCTA 2PVFA 3CC6A 2DUVA 2FA2A 5HIEA 2CGWA 4PNIA 2UZDA 3E92A 4JDJA 1H00A 3W16A 1RW8A 2B53A 3QYZA 2UW0A 2R3OA 3GENA 3JYAA 4RQVA 4YJTA 3O71A 4XG7A 2JDOA 4E6AA 2WZJA 4ASDA 4AZVA 5DNRA 4BICA 2WQBA 3FMLA 4V01A 2XNOA 2XH5A 3LM5A 5DG5A 3A62A 4DFUA 3ZLWA 4RJ8A 2VX3A 1Q24A 2QOQA 4G9RA 4HVHA 2JKMA 4LUEA 5GIOE 3I7BA 3F3WA 4EH3A 1OVEA 1W82A 4GG7A 5CU3A 4E7WA 3N4UA 2WMQA 4ZK5A 2A2AA 4KIKB 3C1XA 1FGIA 1R0PA 2YABA 4QP4A 3H3CA 4GFOA 4YLKA 5J5SA 5CWZA 1OL7A 3QTUA 5HBHA 3DKGA 1KOAA 2XA4A 3NNXA 4EBVA 5CAOA 3R9OA 2WOTA 4FZDB 4E6QA 5AX3A 4W8EA 5E1EA 5J5TA 1MQBA 1WMKA 3I0QA 3QTSA 4YSMA 3R9HA 3RVGA 1VYZA 3R9RA 4MXAA 3NW7A 3QXOA 2OK1A 4R3CA 3BPRA 3CKXA 4RIYB 2XJ2A 2C0OA 4USDA 1SVHA 4K0YA 4BCNA 5EM8A 1M52A 2W9FB 4RRVA 3R22A 4CFVA 2ZM1A 3TG1A 3GI3A 4MD7E 2CGUA 2X2KA 1M17A 4XV3A 2XF0A 3ZU7A 1OKVA 4MTAA 5CY3A 1JKLA 2I40A 2PK9A 4E4XA 3WZKA 3S0OA 3BCEA 5K3YA 4LGGA 4XCUA 5CVGA 1DS5A 3MH2A 2GMXA 2JIUA 4BDGA 3FLNC 4C3RA 4D2VA 4J7BA 3FI4A 3RAKA 3BE9A 4OT5A 2I0HA 1IA9A 4CG9A 3BGQA 2R3IA 2IZSA 3WIGA 5JKGA 4U97A 5FD2A 5M08A 2DQ7X 2ZM3A 4OGRA 3DT1A 3KRJA 4WSQA 3R7IA 2WTCA 3F7WA 5CSXA 3MVHA 3IW5A 3RK5A 5EKNA 4XYFA 4J8MA 4U9AA 3VF9A 3VS5A 3K3IA 3A8WA 4RJ5A 4FTLA 2A19B 5CU0A 4R1YA 2BDFA 2PVKA 2R3PA 3EH9A 1J1BA 5CEKA 4Q9SA 3O96A 3OY1A 4ITIA 4KBAA 5EYDA 2WHBA 4JI9A 4S33A 2BKKA 3MFUA 2FSTX 4DN5A 4U42A 3RBWA 3SG9A 4C34A 3P4KA 3FY2A 2J6MA 2WMRA 4H3PA 3LLAA 4OTPA 2WIHA 5K0XA 5T6KA 2UZWE 5KKRB 5FP6A 4RFYA 4L7FA 1OBGA 1WVXA 1Z57A 3FMJA 2XZSA 2C47A 4RC2A 3F3ZA 2UW6A 3G9LX 5CVFA 4YBKA 4KIKA 2C6MA 4CRSA 5BQ0A 4MXXA 4F7SA 5HX6A 5M4CA 5CALA 1JKSA 4YC3A 5H2UA 4ZY6A 3ZUUA 3Q4CA 1CTPE 4J96A 4DEDA 3EZRA 1ZYCA 3DA6A 3O2MA 4TWPA 5KBRA 3GT8A 1FGKA 3C51A 3F9NA 3RAHA 3HMOA 4MK0A 4O2PA 2ERZE 2J0IA 1WAKA 2JAVA 4PNKA 3VBXA 4HCVA 1KOBA 4TWNA 4YP8A 2VZ6A 2B4SB 4GKIA 4PX6A 4I4EA 3VBWA 3SXFA 1J7LA 4R78A 4RC4A 5ANDA 4EOSA 4FKPA 2C68A 4IAYA 4FODA 3ULZA 2BUJA 3FMNA 3ZFXA 4C4EA 2QU5A 4JIAA 4O83A 3EWHA 4WHZA 5CEOA 4HCUA 3DXQA 3IDBA 4YTHA 3LCOA 3AGLA 4B9DA 4O0WA 3IDPA 2YWVA 5E4HA 3WF7A 4C3PA 3BGZA 4NFNA 5IMXA 1OIQA 2W5AA 3EQDA 5DFPA 2PUNA 3QUEA 3TI1A 1JKTA 4FVQA 3PP1A 4G16A 4IQ6A 4AF3A 4I94A 4WIHA 1Q5KA 3IECA 5FTOA 3PFQA 5DMZA 4ALUA 1H0VA 5M4FA 4QP1A 2PMOX 4GK2A 3DFCB 4IWOA 4HGEA 2HY81 3LOKA 2C1BA 3OVVA 3RWPA 5LOHA 2GNGA 1DI9A 1ZZLA 1P4OA 3OEFX 4RX9A 4FNXA 4F63A 5CSWA 4EH7A 3ZEWA 4RVLA 4KKGA 4F08A 3WILA 2WELA 3ETAA 3MWUA 2JD5A 2HYYA 3D14A 1H26A 2C30A 2YDJA 3AC1A 3NS9A 4IW0A 3RPRA 4U43A 3SDJA 1OKZA 2IN6A 3CPCA 4L3LA 4QTAA 4ZTRA 3VW8A 4Y85A 3AT3A 2XK9A 1YHWA 4XRLA 4ORKA 1BMKA 3GCQA 5C03A 4CD0A 3U55A 1Q3WA 2Q83A 4ZJVA 3ET7A 4A9RA 3RNIA 4AACA 2UZTA 2WIPA 4O2ZA 2YJRA 5CU6A 3KN5A 5CENA 3V51A 4O0TA 4D9TA 5IA2A 3O17A 2RFEA 3RPYA 4D1SA 1J7UA 4HGLA 4DINA 2GNHA 2OJJA 2XIXA 1OL6A 4F0IA 4M0ZA 5E92A 2UW8A 4MWHA 3VUIA 3G90X 3KXZA 4IZYA 4L43A 4FTKA 3PXKA 5HEZA 3VHKA 5FQDC 2E9OA 4IB3A 4CZTA 4LL0A 3CQEA 3LJ0A 4GUBA 3ZLXA 3TDVA 2EXCX 3FWQA 3QX2A 5LCKA 4DG2E 5IU2A 2CCIA 2WMBA 4UX9A 4ZZOA 2WMXA 4BI1A 3AC3A 1BI7A 5BMMA 1YWVA 2C6DA 1UU3A 3F5PA 3E7VA 5J9YA 4ZMEA 4IDTA 4UYAA 3V8SA 3NR9A 5CAPA 3AMYA 3DBDA 1ZXEA 4PPBA 2QO2A 5AR4A 4JQEA 4XG9A 1UV5A 2JKQA 5CT7A 3VUKA 5JQ8A 2GQSA 4IC8A 2GNJA 4QYEA 4BDDA 4ZSEA 5J9ZA 5D41A 5FG8A 4FSMA 5HVJA 5KMLA 4UB7A 3D4QA 1OUKA 2PL0A 3MPAA 5T68A 2VTSA 2FB8A 3O8PA 3ODZX 4RWIA 4BCHA 3PA5A 3EL8A 4GT5A 5AP6A 3E7OA 3RK7A 1U54A 4G3EA 1GJOA 2PYWA 1Z9XA 3ORKA 1FPUA 4TPTA 5AAGA 2XKFA 3HAMA 3D94A 4FG8A 4MBIA 4OAVB 4C58A 5DEYA 5DGZA 3SKCA 1G3NA 4IX4A 3ENHA 1EH4A 4FSTA 4H1JA 5L2WA 5IQHA 3VBQA 3QRIA 3FL4A 4EOOA 3V8TA 4S30A 5L4QA 3IONA 1NXKA 2VRXA 2X81A 4ANLA 2CNVA 3R2BA 3QA0A 3UTOA 4LI5A 3FZ1A 4LG4A 4UWBA 3BZ3A 4ALVA 3ZLSA 3LIJA 3PXYA 3IW7A 4OR5A 3TKIA 2JFMA 2YIQA 3TZ9A 4FTNA 4HGTA 5AAFA 1RJBA 3CY2A 2F7EE 2O63A 4L00A 1MRYA 3ZONA 1IEPA 4D5HA 3FDNA 3LXLA 4D9UA 3AC8A 4E93A 1SVEA 3G9NA 3VUMA 5HD7A 1U4DA 3W2SA 2ITOA 4FUXA 4FC0A 3ZM9A 3LXKA 4IWPA 3R6XA 4YJSA 1ZYLA 2OF2A 4BCQA 5KMJA 5ETAA 5HU9A 2GPHA 1R78A 2Y6MA 3UQCA 2F57A 2GTMA 3S95A 1SNXA 2OH4A 3PWYA 5JGAA 3NAYA 1PKGA 1ND4A 3QC4A 3ZSIA 4BZOA 5JH6A 2CKQA 2QONA 2WQMA 2VTNA 3BWJA 4M66A 5DOSA 3E88A 2AUHA 1KUTA 1YKRA 3R2YA 4G31A 3TM0A 3OXZA 4XOYA 3L9MA 2FYSA 4M14A 3NCGA 3F3UA 2HZNA 4EQUA 3UOHA 4G9CA 2VD5A 5TT7A 3QTQA 3QQFA 4IX6A 4BYJA 5BYYA 2GNIA 3MBLA 2YACA 4I0SA 2WO6A 4FMQA 4YZMA 5AR3A 5FP5A 1LUFA 5GJDA 1APME 2FO0A 1W0XC 4P90A 4B8LA 4MD8E 5F1ZA 2QOCA 5DRBA 2QR8A 4L44A 3MV5A 4JRVA 5F20A 5JFWA 5AJQA 4KIQA 3U4UA 3BWFA 3MJ1A 4CGAA 4DEIA 2PVLA 2QO9A 1AD5A 3EN9A 3HV4A 4FEXA 4L3PA 4KRCA 3RINA 1W8CA 4ENXA 3QKLA 3ORXA 4CYIA 4BTMA 4IC7A 5CSPA 4XG8A 4NWMA 5D1JA 4EH6A 5I5ZA 4GUEA 5C4KA 1PXNA 3C7QA 5JFVA 4DH7A 4O82A 5EKOA 1XH5A 1XKKA 3EQIA 3FQSA 3PRIA 1KE9A 3MVMA 5ETCA 5C8MA 3S3IA 4V04A 2PULA 4JAIA 4HW7A 4BDBA 1YDTE 4TYHB 4FIIA 2RG6A 2I0EA 1OB3A 3QRTA 3BHTA 3TNPC 1OI9A 4N4SA 2FVDA 5L3AA 1RQQA 3RZBA 5GIPE 3QZHA 1JVPP 3E3PA 4FVRA 4L01A 1L8TA 4EHEA 4NM7A 4QYGA 4PDYA 3O8TA 2F4JA 3GCUA 2GFSA 3HP2A 3NYOA 3PRFA 2ZV9A 4WG4A 4A7CA 4ASXA 1OMWA 4MWIA 4U7ZA 4WD5A 5AM6A 4K11A 2OIBA 4HVDA 2YWPA 4RX5A 3QF9A 3KY2A 4TW9A 4I5PA 5J8IA 3FPQA 5LVLA 2UVYA 3R28A 4ANOA 4BCOA 4KABA 2YCRA 4KNBA 3JUHA 4D5KA 4FV3A 5HVYA 3C5UA 4U81A 1WFCA 4CXAA 5B7VA 3CEKA 5E90A 4C8BA 3R9NA 4YGAA 4XX9A 2JIIA 2J5EA 1WBVA 2GNFA 2XMYA 3P86A 4K33A 5IISA 2HELA 4ZTQA 5H8BA 5KMIA 5BYZA 2GHLA 4GK3A 4YZCA 2BAQA 4I0TA 5KUPA 2BKZA 3G15A 3R71A 4I6HA 3HMNA 3PTGA 3MVLA 2RFSA 3PJ2A 4EK6A 3L9PA 1XHAA 3NUXA 5CEQA 4EHZA 3C4XA 3OEZA 4AW0A 4BDKA 5BVEA 2YIXA 4F9AA 4APPA 3JR1A 3KGAA 3O0GA 3G5DA 4RLLA 2ZV8A 4MQ2A 5DI1A 2P0CA 5ANOA 4FKQA 3ZZEA 5AEPA 3A7IA 4BKYA 2ZB1A 3FMDA 1GY3A 3KXXA 4IM0A 4BN1A 3BELA 2C6TA 1PMEA 3PJ1A 3ZBFA 4O0VA 5CXZA 5L6PA 5LQFA 4M97A 2J90A 3AMAA 5M55A 4OTWA 1I09A 3CPBA 4I5HA 4AFEA 2J50A 2R3QA 3MPMA 3POZA 2O2UA 3IW8A 4FV8A 4FZFB 4G17A 4G3CA 5EOLA 1P4FA 4TYHA 3A7GA 3VUTA 4RFMA 5CF4A 3P08A 5EHYA 1M2RA 3U54A 2PVRA 2PVMA 3FI3A 2GNLA 3ROCA 5B0XA 5L2TA 4FIFA 1V0PA 4LQMA 2QQ7A 2VAGA 2GSFA 3FXXA 5H9BA 5HESA 3TN8A 2C1AA 5CASA 4IWDA 4XEYA 3F88A 2OBJA 3W33A 1Q8YA 3QU0A 2WAJA 5JZNA 4HVIA 4AFJA 4CKJA 5M07A 3RWQA 2R64A 2ZAZA 1URWA 4I20A 4H58A 2X8EA 4O7ZA 3R7YA 4GV1A 4DT9A 1Q62A 3A4OX 2UW4A 1JNKA 3WE8A 1H24A 3PA4A 4CKRA 4FT7A 4YC8A 1P5EA 3Q9YA 3VC4A 3NDMA 2E9PA 2XVDA 3HRCA 2EB3A 3QYWA 4BZDA 2QG7A 3Q9WA 4AQCA 4QYFA 2AC3A 3CTQA 3E8DA 4AE9A 4UMQA 1JAMA 5TF9A 1NVSA 4QYYA 2GFCA 2X2MA 4DCAA 2VO3A 2ZDUA 3BYUA 2Z60A 2XKDA 3PYYA 2VU3A 3ZXTA 4HPTE 2ONLC 3WYYA 4CFFA 3AT4A 3BGPA 2WMWA 4FKTA 4U3ZA 4D4SA 4ENYA 3BU3A 3PPKA 4YTCA 1L3RE 5GNKA 2QHNA 3T3UA 5JRSA 3FY0A 5K9IA 3M1SA 4Q5HA 3DB8A 3OFMA 4EOPA 5LVPA 2J9MA 5FBOA 1V1KA 4PTGA 2VTLA 3BIZA 2R0UA 2YM3A 2XCHA 3AOXA 4X3JA 2A1AB 3FKNA 1UNHA 1YWRA 4G2FA 4DYMA 3FKOA 4RIOA 3W10A 5A9UA 3MTFA 3RHXA 2UZUE 3ZRKA 4W4XA 2ITQA 4CMUA 5DT3A 3ZZWA 4NCTC 3THBA 5K4IA 1RE8A 3C13A 4ZP5A 4EBWA 2CCHA 3UDBA 3ZSGA 3DQXA 5CT0A 4C0TA 1PMNA 3L8SA 3OW3A 4OTRA 5CSHA 2PVNA 4QRCA 3HX4A 3ZO3A 1GZNA 5IH5A 4RIWB 3AD6A 3PY0A 2CKOA 2AC5A 2Y0AA 4WG3A 1M2PA 5DT4A 4ZS0A 1YOJA 3R8ZA 4JR3A 4EK4A 3A99A 4JJRA 3KRRA 5I3RA 2W1ZA 1FVRA 2W7XA 2WTWA 3F3VA 3GOPA 4K1BA 3LFBA 4DH8A 3FEGA 4O7YA 4EJ7A 4I6QA 3OUNB 4DEBA 2P55A 3NCZA 3FMEA 4ZTNA 3WZJA 4QMXA 4PRJA 5EG3A 4FKSA 4FL2A 4I92A 5LARA 4D0WA 5EM6A 3R01A 4GU9A 4KWPA 4I21A 5J7BA 3UOJA 4AW5A 3DKFA 5A14A 2WTDA 3ALOA 2X0GA 5ANKA 5JZJA 3LFNA 2EXEA 4FTTA 4RBLA 3D5WA 5AV2A 5HI2A 5I9XA 1OPLA 2W4JA 3KQ7A 2XNEA 3P7BA 4IZ7A 5BVKA 4IACA 5DWRA 1FVTA 1YW2A 1H4LA 4QMLA 4KIPA 3TUBA 5A4CA 3HMPA 2VTQA 3BE2A 3HUCA 3QRUA 5L8LA 4TT7A 2ZJWA 3E8NA 4AGCA 1UWJA 2ONLA 4C57A 3D83A 2J0JA 2E9UA 3SOAA 1OM1A 4PY1A 4I23A 4DFXE 4YO4A 2OSCA 2ZV7A 1CM8A 4O22A 4IM3A 2J0KA 4WSYA 5IH4A 2IJMA 1H25A 4R7BA 4FUYA 3MY5A 5LMBA 4I41A 4U45A 2V62A 3OWKA 2VTIA 3SRVB 4G6OA 4EOQA 4RX8A 4GVAA 5BUIA 3KREA 3LE6A 4YHTA 1GOLA 4NCTA 3QD0A 4DA5A 4RA4A 3DBEA 3MW1A 4J95A 3WBLA 4CV9A 4E5WA 3IS5A 5CU4A 1UNLA 4A9UA 3WF8A 1CSNA 1REKA 5L2IA 1URCA 4IVDA 4E1ZA 1SNUA 4DH3A 3QCXA 3I60A 3ORLA 2OG8A 3VW6A 3REPA 3LXPA 1JKKA 1PJKA 1QMZA 3K5VA 4JDHA 4JG7A 4U0IA 4FNWA 2YDKA 4UY9A 3M11A 2QOBA 4J97A 2G2HA 3QTWA 4O84A 1OL1A 3UIXA 4YO6A 4C2VA 1JPAA 4RMZA 2R7BA 3RHKA 3OS3A 3V5WA 4USEA 4ANNA 3GU5A 3KA0A 4DCEA 2NPQA 4OLIA 3HECA 2C6IA 3G51A 1ZLTA 2YCQA 1OPJA 3QCYA 4PDOA 3DLZA 3W2CA 3WZUA 5AIRA 4AA4A 4BDFA 2BR1A 5IA4A 4JBOA 4GRBA 4GJ2A 3QFVA 4R1VA 4JDIA 4C35A 1B6CB 3LFCA 3QLFA 4I24A 4X3FC 4XJ0A 4BWPA 4JXFA 3R02A 4FIGA 4X3FB 4EQCA 4W4YA 3UIBA 5JFSA 2QLQA 3RALA 3O8UA 3MYGA 1WVYA 3GC0A 4LV8A 3CR0A 3IO7A 3NNWA 2OXXA 3PSBA 3KULB 2B9JA 3LAUA 3KRLA 4DGNA 4CFMA 3UYTA 2WMVA 3KU2A 3TNIA 5HO7A 4H05A 2AYPA 1PMUA 3Q4UA 1Y6AA 2WD1A 3LZBA 3R0TA 4G5JA 4UXLA 3ZBXA 2HCKA 1H27A 3OOMA 4OUCA 3LLTA 3SRVA 2FH9A 4GYIA 3U4WA 5F94A 3AMBA 3PIXA 5A6OA 3OC1A 4FEVA 4NIFB 2GS2A 3GP0A 2W1EA 4HYHA 3D0EA 3LCDA 1GAGA 4IFGA 4JT3A 4R77A 1W84A 5AR2A 2VN9A 4X0MA 4M15A 2BILB 4D58A 4A07A 2R3FA 5ICPA 5GZ9A 2JGZA 5AV0A 2HY0A 4R5YA 5DHJA 3U9NA 4EH9A 4FKVA 2I1MA 3E93A 4L6QA 2UZBA 4BY9E 2BROA 4MKCA 2VX0A 1JLUE 4BRXA 5AUZA 2OIDA 4GSBA 4QMOA 4QP3A 4ZTMA 3H10A 2XNGA 3OWPA 4MXOA 1Y8YA 3D7TA 3IQ7A 1XBBA 3QTXA 2XEYA 4DTBA 4AOTA 5GZ8A 2C5XA 3LVPA 3EIDA 4AS0A 3DZOA 3FMHA 2VX1A 2YIWA 4G6NA 2BCJA 2WTIA 3G6GA 2QURA 4X3FA 3ZRMA 2PUPA 4NYEA 4FKOA 4I22A 4PTEA 3BHVA 2OKRA 5AIKA 5G1XA 3EQHA 2B9HA 2PZ5A 5TO8A 4FOCA 1TQPA 3DAJA 4HVGA 4U79A 4ERWA 3VJNA 3KULA 5BYLA 4BDEA 3VQHA 4FSNA 2WU6A 1UWHA 4D2WA 3BYOA 2PWLA 5AUXA 3TKUA 5BVOA 3ATTA 3F5GA 2UZLA 1OL2A 2ESMA 4GIIA 4A06A 3BV3A 5J9LA 2WQNA 4XHKB 4CSVA 3LMGA 4AZFA 3TUDA 2V7AA 3QUPA 3ATSA 4WBBB 1Y57A 3UC3A 1ZOGA 3P7AA 3RMFA 3HZTA 3Q3BA 4O6EA 4WOVA 3NRMA 4YJUA 4NIFA 5CEMA 5M44A 2UZVA 3HA6A 3GBZA 4EK3A 1YRPA 4OAUC 5C27A 4GFMA 4JLCA 4GCJA 4E26A 1REJA 4DFBA 2ERKA 3B2WA 5G6VA 3UC4A 3KF4A 3MFRA 1IAJA 2W0JA 2OICA 3H9OA 1CDKA 3BX5A 4FEUA 3HV5A 3PJCA 3LPBA 4CMTA 5IQCA 2YM4A 2PMIA 4ARKA 2W1HA 4CCBA 4AW2A 2YISA 1DI8A 4XP3A 3TXOA 5JN2A 3R1SA 4A9SA 1NVQA 4C4HA 4PTCA 4MVFA 4RJ3A 4CEGA 3DOGA 1GZKA 4FG7A 3MFSA 3ZO2A 3V3VA 1PHKA 1Q8ZA 3H0YA 2WB8A 3Q5ZA 4S34A 3RTPA 4YNOA 4M12A 2CKEA 3LMHA 4UEUA 4DEGA 3MH1A 4YJPA 2J51A 3UO4A 4I6FA 4IEBA 2R3MA 4XS2A 4ZJIA 3TNWA 3LFEA 4F4PA 3F5UA 5HE1A 3N51A 3WI6A 1LPUA 2QOKA 5CAQA 5AV3A 4BWXA 3FXZA 5IQDA 3U87A 2LAVA 1LEZA 1ZWSA 2OZAA 5KMOA 2H6DA 4D28A 3COIA 5DLSA 3JY0A 4IFCA 3FYKX 3Q9ZA 4K2RA 3PDTA 2ETMA 2LGCA 4PMMA 2X7GA 3F6XA 2GQGA 3COMA 4XLIA 1IR3A 2F2UA 3FC1X 3R1YA 4BBFA 1GNGA 2XNBA 3GC7A 3MB6A 5H3QA 1PRYA 4F09A 2IZTA 4FA2A 3D15A 2BALA 3VS0A 5AMNA 4AUAA 3OBGA 3LCKA 3DV3A 1OL5A 4L46A 4ACHA 4X2FA 3NUNA 4O1PA 4U5JA 2GTNA 3FKLA 4QQJA 2JBOA 4II5A 3QL8A 4ZY4A 3UQGA 4EOJA 3P79A 3Q52A 3MS9A 3RP9A 4KKHA 2C4GA 4OTFA 2HWOA 4YZ9A 3U8WA 4OT6A 3NZ0A 5B2LA 4FI1A 4G5PA 4W4WA 4YNEA 3SOCA 4O7VA 5E8ZA 4WA9A 3C0GA 4QTBA 5KZ0A 3PXRA 1YDSE 3KXGA
chains in the Genus database with same CATH superfamily
4OTQA 3Q6UA 2YJSA 3QZIA 3BYMA 3QQGA 4J99A 1XBAA 1O6YA 4XV1A 2SRCA 5C8NA 5FUTA 2XIRA 3TUCA 5HTCA 2ITWA 4QNYA 2VO7A 3IW4A 1U54B 5EQEA 4TKSA 2WTVA 4MNFA 4FEWA 3ZM4A 4Z7GA 5B2MA 2VO6A 1BL6A 4MF0A 3QZFA 3KXMA 3ZC5A 3IDCA 4LMUA 4BCIA 3BYSA 4WBOA 4BB4A 3SVVA 3HP5A 5HOAA 4FG9A 4D2SA 4WNKA 4YLLA 4FTJA 5CXHA 5HG7A 2WPAA 3VJOA 2Y8OA 4C61A 4FKRA 3LW0A 3P7CA 4BDCA 3IKAA 4CNHA 4DFYA 5LMAA 2OWBA 4BIDA 3L8PA 5TR6A 5A4LA 4QTDA 3TV6A 3VS6A 3BBTB 4LM5A 2BFYA 3OW4A 4FTIA 4RZWA 4BWKA 2O65A 4IAAA 2NRUA 4BKJA 3PWDA 3V5PA 1WBPA 4EK5A 5EW3A 1T45A 1QL6A 3ANRA 4FT5A 3OBJA 5HE2A 2B7AA 3MA6A 3NUAA 4LGDA 1DAWA 3R7UA 3TKHA 4E6CA 5CF6A 3FC2A 1KWPA 2V5QA 2VWYA 4L3JA 5CQWA 2BRHA 2R3NA 3OXIA 3MB7A 4B4LA 5LMKA 4YZNA 1YI4A 4RVMA 4ZSLA 3IPHA 4EOMA 5JSMA 4U41A 4E4NA 2CKPA 5E8SA 2X1NA 3F66A 4TYIA 1KV1A 5IQFA 5L6OA 2ZMDA 4MCVA 3W0PA 3FUPA 3VUHA 1V0OA 4XUFA 4BTJA 4DFZE 3PIZA 4HNFA 3VS3A 3OF0A 3R8PA 2QOOA 2BFXA 4X6RA 4BCKA 1XH9A 4FSQA 4TWOA 3HRBA 4L68A 4BDHA 3EQGA 4QMNA 5HE0A 4F9WA 5CEPA 3OXTA 3FLZA 2Z7QA 5M57A 1IG1A 5CZIA 4IZ5A 5I9WA 4OTDA 4RJ6A 4Z7HA 3K54A 3FSKA 4ITJA 5EDRA 2CGXA 3FZRA 2XKEA 2XYNA 4M3QA 5IA5A 1WBOA 3IGOA 4WNOA 3TWJA 4UMRA 5IG1A 4A4XA 3ZDUA 5H8GA 2CNQA 4U6RA 2XEZA 3DB6A 3E5AA 5A4TA 2EB2A 2F7ZE 2ITYA 5CAVA 4NTTA 2Y9QA 3MIYA 3O7LB 4O96A 3Q6WA 2VNYA 4C59A 4NM5A 3V01A 5HG8A 4U80A 4KSQA 5CVHA 1J1CA 3EMGA 4L45A 5C4LA 3ACJA 1IA8A 4PMPA 1O6KA 4GJ3A 1H1WA 2WMAA 3ZMMA 3CXWA 3EFWA 3QGYA 4YBJA 4GYGA 4YHJA 4YMJA 4B0GA 4LOQA 5JGDA 3COKA 5FTQA 5AP3A 3DGKA 5EYKA 4YSJA 5CSVA 2R4BA 4OTGA 2JFLA 2ZFYA 3P5KA 4DGGA 2C6EA 2W05A 5M06A 4E8AA 5DR6A 3DTWA 2XBAA 3T9IA 1OIRA 3CJFA 3E87A 3FJQE 5E8YA 3ZFYA 3F82A 3NNVA 1VZOA 4MUQA 2J7TA 3EYGA 4CV8A 4O7LA 5E8TA 3VS4A 4BBMA 4BKZA 3DS6A 2XRWA 3R04A 1OZ1A 3W0NA 3Q53A 1ZMUA 2XS0A 4DFNA 5LXMA 5EW8A 1H0WA 5FM2A 3NUSA 4EYMA 4X21A 4DLJA 3BBWA 3ALNA 3LFFA 3B8RA 5FXSA 3NLBA 4CTCA 2BRBA 2J4ZA 2W96B 4FV7A 1ST4A 4TRLA 3WYXA 3ODYX 4CFUA 4AAAA 1LEWA 4RPVA 4ASZA 3V04A 5DEWA 4AXAA 4CLIA 4QTCA 4MQ1A 1YXXA 4HYIA 4CYJA 1W83A 4AOJA 4EZ5A 1QCFA 3EQBA 5ANEA 3VN9A 1ZZ2A 4F7LA 3MTLA 5F4NA 3NNUA 2C5NA 2XIZA 3DAKA 4E3CA 1QPCA 1I44A 5IF1A 2X8DA 2QO7A 4D2PA 1R39A 4BZNA 3ELJA 5IPJA 1OKYA 1H08A 3UDZA 2R3LA 4IADA 2UZOA 2PVHA 1Q8TA 5KBQA 3H30A 4U44A 2QHMA 3PPZA 4K77A 3PSCA 1A06A 3IK3A 4O7SA 2QOFA 2RFDA 4EJNA 2IVTA 2BMCA 3HA8A 5KCVA 3RGFA 4QMYA 1K3AA 2C3LA 3SA0A 2VWBA 3SW4A 2PE0A 5ANIA 3KCFA 4ZY5A 3HV7A 1PXIA 1UKHA 4YJQA 2CPKE 3VBVA 2W1DA 4XG4A 4K18A 1OBDA 2B1PA 3GXLA 3VRZA 4Q2AA 3UVRA 2PVJA 2AEGA 4E20A 5M51A 4V0GA 4FTQA 3QLGA 4IB5A 4BBEA 3A7FA 3UO6A 3N4VA 3U51A 2A0CX 3DNDA 3GU4A 3NUUA 4HJOA 1J3HA 4MYGA 3T9TA 3QALE 4EZ3A 5CYIA 4BJJB 4R8QA 3QRJA 3DDQA 4D4VA 3GQLA 4QYHA 2REIA 5HORA 3KCKA 1LR4A 5EK7A 1OUYA 3DJ6A 5HZNA 2BDJA 5KZIA 3WZEA 3I1AA 2YN8A 5BUEA 4TWCA 2CGVA 3LJ2A 2BIKB 4XMOA 2IWIA 3KVXA 3QAME 5HNBA 5DA3A 2OLCA 2V0DA 2YZAA 3RM7A 4JMQA 2YFXA 4R7HA 2R2PA 3F2NA 5HLPA 2XYUA 3ZEPA 1E1VA 4QQCA 3UVQA 3FXWA 3UZPA 3HVCA 3U6HA 4LUDA 1FMKA 3U6IA 3CP9A 4LDTA 4USFA 1UA2A 1XH6A 3DKCA 4ZSGA 5CX9A 3KIOC 3EN7A 2QOIA 4R5SA 3ZFMA 5A4EA 4FX3A 4FZAB 3PA3A 3U9CA 4BDJA 2PVYA 3Q2JA 1U59A 3HDNA 3DJ5A 4BR3A 3H9RA 5AX9A 1FVVA 3PXZA 4AP7A 3MA3A 2J2IB 2XUUA 4BL1A 1Y8GA 3G0EA 3FAAA 4FT0A 2R0IA 4MNEB 5KMNA 4WG5A 2UW5A 3N4TA 2WEVA 5JFXA 3MDYA 4YHFA 1KE7A 5E8VA 4Z16A 5C9CA 5KO1A 2FUMA 3OZ6A 3BHUA 3RNYA 4C33A 5ANJA 1W98A 4GT4A 1OKWA 3TIZA 1H28A 4PL4A 4FK6A 2PZYA 2KULA 4QPMA 4PMTA 4XV9A 5C1QB 5LVNA 1NA7A 3NIEA 3QD2B 1BKXA 2ZYBA 1GIHA 4BGQA 1ZMVA 4J1RA 1JOWB 2YIRA 1PKDA 5ACBC 4BJJA 4X7QA 2X6EA 4FBXA 4JBPA 3ZSHA 5BV3A 3R8VA 3UMXA 4JX3A 2ZVAA 2Z2WA 2HZIA 3MVJA 2R5TA 5IA0A 4O38A 4BGGA 4ID7A 3TTJA 3KXHA 3MIAA 5HO8A 3ZYAA 3DFAA 1FQ1B 3DAEA 3UP2A 4F1OA 3K2LA 3W8LA 1WZYA 3F69A 3C4CA 3Q04A 2CSNA 4UMPA 4FZ6A 1E9HA 5DRDA 2EU9A 2QOHA 4BCGA 4BDIA 2W4OA 5D12A 1Q61A 3BEGA 3EQRA 3FL5A 5AUYA 5C01A 3ZDIA 4IM2A 2W9ZB 4CZYB 5B2KA 1G8SA 5DVRA 5FTGA 2A4LA 4RIXB 2QI8A 2ITVA 4ONAA 4E73A 3SV0A 1XH4A 4K9YA 4IANA 2P2IA 4C4FA 2VUWA 2BHEA 3Q9XA 1R1WA 2CLXA 2Z7RA 1PXKA 3H4JA 4I1ZA 4DE4A 4ASEA 3NSZA 2OIQA 3OD6X 4JG8A 1ZMWA 3KVWA 2GHGA 4AZTA 3NIZA 5CAUA 3I7CA 1P14A 2WTJA 2X9FA 2C69A 1OIYA 1QPDA 3OCTA 4FGBA 3F3TA 1WBSA 4M0YA 4YLJA 5IA1A 3BL9A 4IHPA 3VS7A 3QD3A 3T3VA 2PU8A 3CQWA 3DQWA 4L67A 2DYLA 3IOKA 4DT8A 2ETRA 4WKQA 4D1ZA 4MNEA 3EKKA 1PYXA 1WVWA 3CGOA 2J0MB 4GMYA 3R7EA 1ST0A 2F7XE 4E4LA 4O0UA 4WNPA 2V55A 2VTPA 4FKGA 4HOKA 2CN5A 3TCPA 4EHGA 3LQ5A 2UZNA 1UU7A 3NYXA 2E9VA 4W9WA 4C02A 3VQUA 5AUUA 3GU8A 3GFWA 2GDOA 1YHSA 3MSSA 3NYVA 2XK7A 3QTIA 3OMVA 4LL5A 2DS1A 3G0FA 4JL9A 4PF4A 5CTPA 4ANBA 2B52A 4ZZNA 3BU6A 4HZRA 4QP8A 5A54A 4G3GA 4NTSA 3DZQA 2FSOX 4ITHA 1AGWA 2PPQA 3E3BX 1Q41A 3QA8A 4KINA 3R83A 5AA9A 3NFGB 4LRMA 1BYGA 2VTOA 3UZTA 3W2PA 3D7ZA 3KRXA 4ZOGA 2VO0A 4O27B 4MEDA 5AP1A 5DBXA 3SQQA 4EONA 3W0OA 3HKOA 5CANA 4EH4A 3ENMA 3W0QA 4DG3E 1XWSA 4JS8A 4O86A 2Y6OA 4TN6A 2WNTA 3EN5A 5KE0A 4IX3A 2QCSA 2PE2A 1VLRA 3NAXA 4RJ7A 1PXMA 3OUKA 5HKMA 4IX5A 4KSPA 4JR7A 5KMMA 4RLKA 2YM5A 4RIXA 4CMOA 4ZMFA 3LQ3A 3DTCA 5EM5A 3R7OA 2WTKC 2P3GX 2WMTA 1H1RA 2C0IA 2WTKB 1ZYDA 4FOBA 4YC6A 5DH3A 3S4QA 1DM2A 1U5QA 3QKMA 4KB8A 2XNNA 4FYNA 3BLAA 5DE2A 3CTJA 3UG2A 1YXSA 3LFDA 2BRNA 3CD3A 3FLSA 3PVUA 4N70A 1FOTA 4TNBA 5D7VA 3RPOA 3VIDA 4YR8A 3ZCLA 3F2RA 1XH7A 2HZ0A 2XIYA 4P5QA 3EZVA 3E8CA 3EB0A 4AWIA 5AR8A 4DGOA 4PPCA 3ZO4A 2QNJA 3QKKA 2UZEA 2XJ1A 3MI9A 5TKDA 3TIYA 5LWNA 3W2OA 3K3JA 4BYIA 1YQJA 5EQPA 5LWMA 4PDSA 3PVBA 1ERKA 3GQIA 3W0RA 3FZOA 2IW9A 3CY3A 4D2RA 4AT5A 2G01A 2VV9A 2WU7A 3CS9A 4EZ7A 5KNJA 4F0FA 2B9IA 4F1TA 2P4IA 2WXVA 3GB2A 2CDZA 3EFLA 4WT6A 3BQRA 5DT0A 5EHLA 3HEGA 1PXOA 3R21A 3RPVA 5AAEA 4ZTLA 3CE3A 2PUUA 3A60A 2WQEA 4PP9A 3TV7A 5JEBA 1Q3DA 2BTSA 4ZAUA 4XNEA 4RX7A 4ZS4A 4FZ7A 1MP8A 3CJGA 5AM7A 3HUBA 1FMOE 3I79A 4PL5A 3TDWA 2VWZA 3IG7A 3HDMA 3DDPA 3A7JA 5IDPA 2G2IA 4DC2A 5JT2A 3FQEA 5GHVA 1F0QA 4PUZA 4I5CA 2B55A 4X6QC 4EUUA 4YUQA 1SVGA 2V22A 5HNIX 5IA3A 5JK3A 2B0QA 2O8YA 1YVJA 4FV6A 2PHKA 4R3RA 3S00A 4LFIA 3MY0A 5E91A 2Z8CA 4C7TA 5E8UA 1ZOEA 1PY5A 3BQCA 3D7TB 3VNTA 4AN2A 3DU8A 2RF9A 4BVUA 4GW8A 4QQTA 2X4FA 3D5XA 3EKNA 3GCVA 3C4EA 4RGJA 1Q8UA 2XAOA 2QOLA 2IO6A 3GVUA 4PV0A 3VVHA 2JAMA 2JKOA 3HYHA 4G6LA 4EL9A 3V6SA 1CKJA 2YERA 3GC9A 4FGRA 2BPMA 2BRMA 2YZLA 3NVKI 3V5LA 1DAYA 3E8EA 3QQJA 4PPAA 3DK7A 3VAPA 4RWKA 2JDTA 3EOCA 4FIHA 5BNJA 3ZTXA 2OXDA 3CD8A 1VEBA 2XK3A 4QP6A 3ORPA 2Y4IC 4RC3A 4DTAA 1ATPE 4YJNA 3UZRA 3DNEA 1TVOA 4O0SA 2EUFB 3LCTA 1JQHA 2JDSA 2FSMX 3G33A 4FSUA 4QMMA 4J8NA 3NMUF 4YTFA 5HU3A 4YPSA 1YXUA 2WMUA 1B39A 3MN3A 1OGUA 5CNNA 4IAKA 3PP0A 4QP9A 3ZXZA 5IEXA 4EOIA 4YJOA 1BX6A 3SHEA 2OJGA 3TNQB 5IQBA 3BRBA 3EYHA 4MH7A 4CRLA 4I0RA 5EDQA 3KMUA 3ZO1A 5K0KA 4J71A 2OO8X 1XO2B 4O0XA 4KS7A 3EN4A 2FGIA 3QX4A 3UYSA 2O3PA 4X2KA 2ACXA 4X2JA 4C62A 3PXFA 5HLNA 2XAMA 2H34A 4UMUA 4I93A 3SXRA 2YLFA 3D5UA 4BC6A 4CFWA 2RL5A 3G6HA 4JBQA 3ORTA 2X2LA 4RVTA 3UP7A 5TE0A 5DR2A 5ANGA 4NW6A 5A4QA 2EXMA 4PWNA 2ZOQA 2G2FA 3OP5A 2YM6A 2B9FA 3P23A 4JG6A 5EOBA 1IAHA 1KV2A 2RFNA 4ZIMA 3F2AA 4WNMA 4XBRA 3W1FA 2Y4PA 4ACGA 5KX8A 4AXCA 4C36A 3BLQA 5CZHA 1K9AA 3UIMA 4L7SA 4GG5A 4DH5A 4IB1A 4FKWA 1R0EA 3L8XA 4OBPA 4FV4A 3ZOSA 4IVBA 3NGAA 5I9YA 5IQEA 3CGFA 4H1MA 3KKVA 4IJPA 2HOGA 2C3IB 3HL7A 4CTBA 3ORMA 4ANSA 3V6RA 3M42A 3R8MA 3GCSA 4APCA 2WFYA 4O81A 4JVGA 2IZRA 3BI6A 2QVSE 4S31A 3R8UA 3EN6A 3KMWA 5BUJA 2PMNX 2OZAB 2VWUA 2ZB0A 2OZOA 4FTAA 4JX7A 3UNJA 3ZHPC 1HCLA 4PMSA 2UUEA 4EH8A 3ZS5A 3OWLA 4FTRA 3FHIA 5HIBA 3FHRA 4EOKA 4M8TA 5TOZA 2X0OA 3CBLA 4P2KA 5EFQA 5CF8A 2BAKA 1X8BA 2QLUA 3W55A 2YM7A 2EWAA 3HNGA 4EH2A 4AA0A 1B38A 3BL7A 3T8OA 2E9NA 4I5MA 1VJYA 5EYMA 2R3JA 1V0BA 2XNMA 3RPSA 4O91A 1J7IA 5I9ZA 4ZTSA 4ZSAA 4EC8A 3E62A 4P4CA 3FI8A 5D7AA 5KHXA 1OGYA 2XK8A 5EI6A 3FYJX 4I6LA 3LFAA 4O0RA 1YOLA 4FT9A 4BCJA 3PG1A 2XALA 2XKCA 4LV5A 3VS2A 4BDAA 2ZDTA 3KEXA 2XK6A 3OY3A 5I9VA 3VS1A 3CIKA 3HV6A 4NJ3A 4QNAA 5EH0A 3RAIA 4RT7A 5DPVA 3W0MA 4JOAA 4UN0C 3PG3A 3NUPA 5J7HA 4EH5A 3QWJA 4NZWB 1CMKE 2YITA 5A3XA 3PLSA 4DDIA 4V05A 2GS7A 4IDVA 4ANMA 4C37A 1Q4LA 3C9WA 3PE1A 3W0SA 2C0TA 3C4FA 5J95A 4RWLA 4A4OA 4BIEA 2OF4A 4NT4A 5ACKA 3WARA 5BVDA 4O21A 2VTAA 4ACCA 2YEXA 3R73A 5L2QA 3DK6A 4A4LA 4H36A 3A61A 3ACKA 5AUWA 2J0LA 2OJ9A 4DTKA 3QGWA 5KKRC 1WCCA 2R7IA 3L8VA 4ACMA 3R63A 4HPUE 2DWBA 2I7QA 4I4FA 4O6LA 3TT0A 5I9UA 5EDPA 5GJFA 4LRJA 2W17A 3GFEA 3QCQA 5AUVA 4CVAA 1GIJA 2PMLX 3R7GA 4UV0A 4TYEA 1W2CA 4IB0A 4OBQA 2C3JA 2VWIA 2BZJA 5LMKC 2B54A 3MH3A 5L6WL 4CCUA 4AOIA 4GL9A 3QUDA 5HIDA 1SMHA 4XLVA 2W5BA 1M2QA 2C3KA 4FT3A 1S9IA 3ANQA 4KD1A 1ZAOA 4WRGA 3QHRA 4ERKA 5M4IA 2ITXA 4RIYA 4XP2A 5E1SA 1GZ8A 2PZPA 2W99B 2A98A 2BZKB 3C4ZA 3JY9A 4M84A 1KSWA 1HCKA 4EYJA 3RAWA 3VO3A 4BTKA 4C4JA 2IVSA 3BV2A 3AC5A 2PZRA 2YAAA 3OTVA 4OW8A 4X2NA 5AV4A 4IJ9A 3GNIB 3UNZA 2IVVA 1M14A 5K5XA 4CFNA 4JDKA 4FTOA 4TXCA 4JQ7A 3SC1A 5I3OA 4QMQA 4FE2A 1TQIA 3ORZA 3QCSA 5E8XA 4QD6A 4RWJA 3NX8A 1PF8A 5CEIA 4BIBA 4DAWA 5JMSA 3O7LD 3GU7A 3TJDA 3TEIA 4LOPA 2Z02A 3DLSA 2JKKA 2ETKA 2W4KA 2X7FA 3C0HA 4DBNA 3QBNA 1J91A 3L1SA 3VBYA 5GZAA 4QO9A 4W4VA 3QC9A 2R9SA 4FSWA 3NYNA 3DBQA 2H96A 4YU2A 2OFUA 3F7ZA 4DBXA 4RA5A 4DH1A 1MUOA 4KBCA 4GKHA 2JEDA 3DBFA 4IH8A 5A6NA 4YJRA 4QTEA 3NUYA 4NM0A 3VRYA 4EORA 5AV1A 3ZLYA 3PUPA 3VF8A 4XG6A 1SYKA 3PVWA 4RFZA 5FDXA 5IUGA 1IRKA 3BLHA 4QMUA 4Y8DA 4AZEA 3GC8A 2IZUA 3C50A 3PY1A 5D9HA 4K6ZA 5GJGA 5AADA 3BU5A 2YCSA 4PQNA 3ORIA 3LXNA 4U3YA 2QKRA 2PSQA 3I0OA 3UG1A 3EFJA 4QMPA 4A9YA 3NVMB 4QMVA 2JLDA 5HQ0A 3UBDA 3WF9A 4OBOA 3RCDA 5FEDA 3CKWA 4ZJJA 4FJVA 2GU8A 4RJ4A 4L8MA 4FV1A 4DEHA 1G8AA 3LFQA 3NPCA 3PY3A 1YI3A 3LMIA 5JGBA 4TTHB 4IIRA 2QODA 4O7NA 3DKOA 2Z7SA 4O4BB 1HOWA 3LJ1A 4FRFA 3PSDA 3VHEA 4DGMA 4CT2A 1Q97A 2VWWA 3B8QA 3QHWA 4FTUA 4J52A 1JSUA 4FF8A 4ZTHA 3QQKA 4FR4A 3A4PA 1A9UA 5AUTA 3I6WA 2H8HA 4QQ5A 4F6SA 4DHIB 5IUIA 2XM9A 2W1IA 3RJCA 2UW7A 3W2RA 3KC3A 3QQHA 4KRDA 4ALWA 3U6JA 4IMYA 3O51A 3GUBA 2EVAA 1JWHA 3GU6A 2CMWA 4Y5QA 3VUGA 5AR7A 4QEBA 1YDRE 4HGSA 5HGIA 5IQIA 4N6ZA 4NUSA 1QPJA 4QMZA 3PZEA 3CSVA 4TYJA 4F65A 1RDQE 4I3ZA 4M69B 3EL7A 3MH0A 4G3FA 4J98A 4MXCA 4ANQA 1XBCA 3E63A 2I0VA 4FTMA 5L8JA 3SAYA 2HK5A 3OROA 3OTUA 3LM0A 1MRUA 4XV2A 2JITA 3MESA 3PLAE 3QTRA 1ZYJA 1OITA 3BEAA 3PJ3A 4F6WA 1WBTA 3NW5A 4BGHA 2WOUA 3POOA 4N6YA 4B7TA 3DCVA 3L9LA 1ZOHA 5AP7A 1YHVA 3EHAA 1Y6BA 4GU6A 4XP0A 4YJVA 4AA5A 3MFTA 4R3PA 4JIKA 4MF1A 3RCJA 4DGLC 3ORNA 4EI4A 3OOGA 3LFSA 3W32A 5I0BA 3TJCA 5M4UA 2P33A 1E1XA 4KS8A 4TY1A 1F3MC 2UVZA 2ITNA 3SW7A 4NJDA 5HNGA 2W1CA 2OGVA 5FBNC 5I4NA 2OFVA 4AN9A 1Z5MA 1PXPA 2Y7JA 3QZGA 4W9XA 4O7RA 5EI8A 4QMWA 2XB7A 2X0QA 4DEAA 4AT4A 3JXWA 4DITA 4BFMA 1GIIA 1W2DA 4V0GB 1QPEA 1UKIA 4EEVA 3PIYA 2BVAA 4H3QA 5BVFA 3P1AA 3V5TA 3CCNA 4F99A 1VR2A 5D11A 1TKIA 1ZYSA 3I5ZA 5FWKK 4C2WA 4ZLYA 5IDNA 4AGWA 1U46A 4ZLZA 3ZRLA 3BYVA 3UPXA 3VWAA 1P2AA 3CLYA 3LKMA 2RSVA 2UVXA 3AC4A 4X2GA 5HVKA 2R3HA 1BI8A 4BHNA 4HZSA 2C6LA 5EM7A 2VTJA 3ROYA 4CKIA 5HTBA 1H1SA 5HO6A 3WZDA 4HNIA 4DFLA 2P2HA 3UOLA 4RVKA 2OXYA 5IUHA 2VWXA 3L9NA 4AX8A 1BUHA 2ITUA 1F5QA 3A8XA 3DPKA 3EFKA 2WEIA 3Q96A 4M69A 4LMNA 4D55A 4EWHA 5J1WA 2X6DA 4S32A 3DXPA 3TZMA 4MXYA 5HX8A 4FV5A 3H9FA 2HWPA 4MXZA 2CLQA 3KMMA 4AQKA 2BDWA 1OECA 2ZV2A 3FLQA 2F9GA 4Y72A 4AGUA 5EQYA 3WF6A 3NW6A 2OH0E 4FL1A 2W1FA 4XH6A 3IOPA 4IVAA 5J79A 3SX9A 2YAKA 4F6UA 4F1MA 3CTHA 4AE6A 5F9EA 2HW7A 2NNWB 3CQUA 4FV2A 1YXTA 4P7EA 5AR5A 4ZXTA 1VYWA 3FZPA 3BHYA 4IVCA 3D2IA 4U40A 3ID6C 4BI2A 3A7HA 4F0GA 4BCPA 5C26A 3R9DA 2OJFE 2XM8A 4GH2A 5AFVA 2WQOA 2XP2A 4Y83A 1M7QA 4EWQA 2QD9A 2ITTA 2YHVA 2C6KA 3VUDA 3WIKA 5M53A 5M56A 3QQLA 1AQ1A 2RG5A 2X8IA 4KIOA 2X9EA 4M68A 4FKIA 4XG2A 4JQ8A 4C3FA 4QOXA 2YM8A 2CN8A 2WGJA 4JAJA 2XNPA 3R8LA 4NKSA 4D4RA 2HXQA 2QU6A 4TL0A 3AD4A 4RQKA 3AT2A 4NM3A 2OW3A 2RGPA 5JRQA 2X39A 4E5AX 5IZFA 4FVPA 3B2TA 4IXPA 3WOWA 5FXRA 3P78A 1S9JA 3KK9A 5GINE 3LQ8A 4PP7A 3RZFA 3JVRA 5BMSA 2PTKA 4P5ZA 3HLLA 2C5YA 4MBLA 4F9BA 1LP4A 5T3QA 3MJ2A 5F95A 5CI6A 1STCE 2JDRA 3AC2A 4OTHA 3FLWA 4GVJA 4BI0A 1Q8WA 4G34A 3FZSA 4YZBA 2V7OA 2OU7A 3HMIA 3BHHA 1PXLA 1OIUA 3D2KA 4FSYA 4L42A 3Q4ZA 3ITZA 5DIAA 3UJGA 3SLSA 3ZC6A 4E5BA 3K5UA 4MHAA 4Z3VA 4OTIA 3WE4A 4CFXA 4MAOA 4UYNA 4M67A 3NEWA 4FSRA 3FE3A 5IKWA 3FMMA 3DBCA 2O0UA 3TNHA 4N57A 4NH1A 4Y5HA 4WRSA 5IQGA 3HMMA 1MQ4A 4NW5A 1OPKA 5HBEA 4O7TA 3FQHA 3Q5IA 5IEVA 1K2PA 2PY3A 4KAOA 4RZVA 4PL3A 2VGOA 2BHHA 2QC6A 4FKUA 2XIKA 3P0MA 4L52A 3QTZA 1ZARA 3DJ7A 3V5JA 3MPTA 2QR7A 3FV8A 3I81A 3C0IA 2XCKA 4MD9E 4NK9A 1NY3A 3FMKA 3OCBA 4TYGA 4FEQA 1G8KA 2BRGA 2PE1A 3PE2A 1TQMA 4LOOA 2G9XA 4UZDA 5HCYA 2VTRA 2ZMCA 4LYNA 3KK8A 2PZIA 3UODA 3S1HA 1ZRZA 2A27A 5EHOA 5JQ5A 4UBAA 4GT3A 4PDPA 4E4MA 4NKAA 4EQMA 4KUJA 2YIYA 5LCJA 4F7NA 5IQAA 5CI7A 4LGHA 5CQUA 3WF5A 4D0XA 5IMEA 3F5XA 2R3KA 2O64A 1BLXA 3RM6A 4JRNA 4QP2A 4K8AA 4YZDA 5AA8A 1SM2A 2YDIA 4IZAA 1PMVA 4FNZA 5DR9A 1FINA 2BIYA 2UW9A 3EQPA 3KXNA 4H39A 2I6LA 4DHFA 4EKKA 1ZY4A 4Q9ZA 4QDVA 4JNWA 5HG9A 4XG3A 2HENA 4QPSA 4UZHA 4IBMA 4IAIA 5KMKA 4CT1A 5H8EA 4QT1A 4B8MA 5CNOA 3TL8A 3E64A 3UQFA 4FNYA 4AN3A 4F7JA 1H01A 3TTIA 1U5RA 2VGPA 4GK4A 3D9VA 4FICA 3UGCA 4UWCA 4B6LA 1MRVA 2HW6A 2UV2A 3IW6A 4N0SA 5HE3A 2GCDA 4Z55A 3UO5A 3RI1A 4KBKA 3PZHA 5ETIA 3UVPA 4CZUA 3R1NA 1W7HA 4ZZMA 4KA3A 4FIEA 3QQUA 4ACDA 4FKLA 1NT2A 3I4BA 1KE6A 2VNWA 3FZTA 4FL3A 5HD4A 1XQZA 2I0YA 4QPAA 4AGDA 4F64A 5LVOA 3AQVA 4GS6A 5ETFA 3UOKA 4YURA 3OCGA 1JSTA 4F9YA 3AD5A 4DDGA 1H8FA 2R3RA 4C4IA 2WKMA 5CU2A 1UU8A 4O1OA 5J87A 2VTTA 2VTMA 2W5HA 3R7VA 1UU9A 5LVMA 1FBNA 4FSZA 2ITZA 3QD4A 3TACA 3SXSA 4FIJA 4Y73A 2F49A 3UNKA 1YWNA 2UW3A 3COHA 3F61A 5HBJA 3KFAA 3OHTA 5D10A 5FXQA 3ZUVA 4BTFA 3LHJA 4EC9A 1IASA 4D2TA 4F70A 4L53A 4MX9A 4Y95A 3SG8A 4FKJA 3W8QA 4M13A