3V5QA

Discovery of a selective trk inhibitor with efficacy in rodent cancer tumor models
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
292
structure length
263
Chain Sequence
GIHVQHIKRRDIVLKRELKVFLAECYNLSPTKDKMLVAVKALPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMDVYSTDYYRTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of GNF-5837, a Selective TRK Inhibitor with Efficacy in Rodent Cancer Tumor Models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords NT-3 growth factor receptor
total genus 84
structure length 263
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v5qA01
2C1BA 3ORIA 4DGOA 4D4YA 4O21A 2G01A 3FMDA 3MH1A 2YLFA 1W82A 3O8UA 1LP4A 4FV8A 4FNZA 4FTLA 4KKEA 3LFAA 5DT4A 5HBEA 3GC7A 3WYYA 1ATPE 4FOBA 4JNWA 2YM8A 1OVEA 4OTIA 3I0QA 4X3FA 3B2TA 3DB6A 4IB3A 5AA8A 5F9EA 4ZJIA 3MSSA 5AP2A 1LEWA 3RJCA 4GMYA 5ETFA 4EOPA 4YU2A 3NAXA 4JVGA 4AQCA 2HYYA 2P3GX 3PJ2A 4RQKA 3W55A 1KUTA 1QPDA 4YUQA 3IPHA 5EQPA 2H96A 5CSHA 3C4FA 2G2HA 3E3BX 2VWUA 5KKRB 4W9XA 3OW4A 4BDDA 5DGZA 1IR3A 2RG5A 2QG5A 4YJOA 4PL5A 3GCQA 5KMLA 5B0XA 2VWVA 3NEWA 2XK7A 3FI3A 5CSWA 3QD4A 3K5VA 4WNPA 4O96A 2F2CB 4WNOA 2C3KA 2PMIA 3QX2A 4BDCA 2CGWA 3R0TA 3DU8A 4RIYA 3TDVA 5LCKA 4IC7A 1SVHA 3F5XA 4GVAA 5FXQA 3F2RA 5AAEA 5A14A 2R3RA 2OH4A 2GNHA 3I5NA 3NUPA 4RFZA 1YWVA 5D7VA 1DS5A 1UKIA 4I5MA 4NEUA 4K1BA 2OJFE 2HZIA 3VS7A 3DZOA 3DQXA 4C36A 4Z3VA 1JSVA 3MPAA 5L3AA 2R0IA 2WD1A 4RVTA 5CAUA 3L8PA 3QUEA 5EI8A 3OROA 4RX8A 1UVRA 4ZS0A 4G5JA 3IGOA 4J7BA 3TZMA 3BELA 3TG1A 4ASXA 2ITQA 4E20A 3PXZA 3VS2A 3E87A 1NW1A 1DI8A 4YZ9A 5KMMA 5ANKA 1Q99A 2XMYA 3U9CA 5IUIA 1ZYCA 3E63A 3NW5A 2X2KA 5FEDA 4MNEA 4NT4A 3ZXZA 3IO7A 3ZLXA 3BYVA 1R0EA 2C0TA 2BRNA 4IQ6A 1YDRE 2IVTA 3PIXA 4PPBA 4DEDA 4EI4A 4FV3A 1WCCA 4BDIA 1OBGA 4TYEA 3OCBA 3SQQA 3C51A 1Q8UA 3SXSA 3VO3A 4C35A 3NGAA 4C4JA 4DFZE 5CU0A 4GFOA 4C4EA 2ZJWA 4L67A 4GU9A 4X6QC 4D2SA 3GVUA 3PLSA 2QOHA 5L2WA 2JBPA 3SW7A 3MV5A 4FUYA 4JAIA 2W4KA 4EWQA 5KMOA 4G6OA 1APME 1OM1A 3KMWA 2HENA 3ZLWA 5ANEA 5GINE 1PXLA 4QPAA 4PQNA 3VAPA 4XEYA 4TWNA 3NYOA 3AMBA 2XNGA 3O51A 3T3UA 2VZ6A 3O0GA 3LE6A 2XCHA 4NIFA 5AM7A 3ZFMA 1U54A 3MESA 1S9IA 4NTSA 4XP2A 4MAOA 3EN7A 1IA8A 3QA8A 3GFEA 4FIHA 4FT7A 4XP3A 3VIDA 5EM8A 5CVHA 4ZMEA 2W7XA 3A99A 1KOBA 2JKKA 4FT3A 4KKHA 3UC4A 3PG3A 2YIQA 4FX3A 5IA5A 3GT8A 4FG8A 4CD0A 4I93A 4G3FA 3F3UA 3MDYA 4IJ9A 3TN8A 3ZC6A 4C33A 4G6LA 4LUDA 2OO8X 4GEOA 5DT0A 3QZHA 4FIIA 2PMLX 5ANDA 3SG9A 4RIYB 4RZVA 1M2RA 2WZJA 3AQVA 3WZUA 4NH1A 4QP4A 1YOJA 3BPRA 3P7BA 3ZUTA 3UOJA 3QD0A 2EB3A 2GNFA 3R7OA 2B7AA 5CAPA 4MK0A 2Y0AA 2OZAA 4J99A 5E8UA 4ZTSA 5KZIA 3LCSA 5A9UA 4C7TA 2OKRA 1PMUA 5ANJA 5J79A 3C50A 4QMNA 1Q3DA 4YC3A 4WRSA 5ETIA 3DS6A 4C2VA 3F3TA 1LR4A 4EJ7A 4OTQA 5CWZA 3B2WA 4N6YA 4EOSA 3CIKA 4L8MA 2VU3A 1VJYA 1W0XC 2UW3A 1M17A 5CU3A 3SC1A 4IVAA 4X21A 2R2PA 5CAVA 5L6OA 2GQSA 4NM5A 2ZYBA 5BMMA 4EQMA 3H9OA 4O1OA 1B38A 3R7EA 4RX9A 5HI2A 4ACHA 1UU7A 5HVKA 3UYTA 2PZRA 3NR9A 4ZY5A 4L6QA 2HOGA 5L4QA 1F3MC 4A4XA 3KRRA 4XG4A 4L3PA 3ZXTA 5A6NA 4QMWA 3UG1A 4DTBA 4TYHA 3POOA 2WMRA 4XG8A 3NPCA 3JPVA 2BIYA 2R7BA 3O17A 5EQEA 4BCQA 3C5UA 5EDPA 5C26A 1MRUA 2GS7A 3NW6A 5HCZA 3BU3A 4F1MA 4ZTNA 4E4MA 1GZKA 3OF0A 3T9IA 5J9LA 4JDJA 2X81A 2DWBA 4QNYA 5IH5A 2R5TA 4OTHA 2O64A 3MJ2A 4LMNA 1OMWA 5E7RA 4DH5A 5B2LA 3GU8A 4LGGA 5HO7A 4D4RA 2GTNA 4GIIA 4E6CA 1JNKA 2BAJA 4W8EA 2XKFA 3ALOA 3W2QA 3QQHA 3NWWA 3V3VA 4EOLA 2R3MA 3QFVA 3KL8A 4MD9E 3QQUA 2ETRA 4TZRA 3ZC5A 2PMOX 4Q9SA 2YIXA 5CX9A 2VNWA 3WI6A 4E5WA 3FL5A 2BFXA 4UMRA 4D0XA 5LOHA 4NKSA 3NVMB 4IAYA 3TUDA 4O2ZA 1OKVA 2ITVA 5BVNA 5L2IA 4IW0A 5L6WL 3PVUA 4O0YA 1M52A 4NM3A 5CY3A 1KOAA 2C30A 3ZU7A 5EHYA 4QMOA 2PULA 3LFEA 3MY0A 5KZ0A 4YZBA 3ENMA 2XK3A 4RIOA 3D5WA 4B6LA 4J8NA 4P5ZA 3D9VA 2UZUE 2X7GA 3EFWA 5FEEA 4EOQA 3OXTA 3AGLA 2WMXA 4QMSA 5HLNA 3PXFA 2ERKA 3P4KA 4CFNA 1OKZA 3SOCA 5HNIX 3G33A 5F1ZA 5IA4A 2E9VA 5CEIA 3I1AA 2OH0E 2WB8A 2Z8CA 4AA4A 5ITAA 3GQIA 1FQ1B 3OXZA 3ZZWA 3UZTA 4PWNA 4JQEA 4ZAUA 3Q2MA 2E9UA 3LQ8A 4AF3A 4UX9A 3OY1A 2YIYA 3KMMA 5EHLA 4LMUA 2ZM4A 4O84A 3HRBA 5HIDA 2JDSA 1REKA 4NCTA 5J7BA 3DOGA 5E91A 4DBNA 3CQWA 5DHJA 3DTCA 1ZMWA 3KXZA 3E88A 5HE0A 1GAGA 4NFNA 4D9TA 5F4NA 2OJIA 4HGSA 5JZNA 4BTFA 4HVHA 3ATSA 3PY0A 4LUEA 4G5PA 1QL6A 1OL1A 4RWIA 1ZARA 5FDXA 5HKMA 1ZOGA 2HZ4A 4EC8A 4IZAA 3FSKA 3QKMA 3F7WA 4BDAA 4NU1A 3NS9A 4KAOA 4TY1A 4PMPA 3R22A 3I79A 4A4OA 5JQ8A 2HZ0A 5AR7A 4CKJA 4MH7A 2JITA 4TPTA 5AUYA 1BMKA 2YITA 3UG2A 2YDKA 2ESMA 4CT2A 3IQ7A 2UW8A 4WA9A 5BVKA 1OPKA 3BX5A 4FNWA 3ODYX 4WSQA 2I1MA 4ANMA 2PVNA 2YM3A 1ZYSA 3ATTA 4J8MA 1AGWA 4ANSA 4M67A 5HGIA 5IMEA 2XKEA 4S33A 4U41A 4Z55A 1TQIA 2C5NA 2JGZA 4DF3A 4NWMA 3AC5A 4AU8A 5BPYA 2ITOA 2IN6A 1PHKA 4ASZA 4JT3A 1OL5A 2F49A 4G9CA 4QT1A 4O0VA 3FKNA 3ZSHA 2X8EA 2P2IA 1KE5A 5AUWA 3NSZA 3IGGA 4P7EA 3S2PA 3W2SA 2VTIA 3KULA 3V5TA 1FVVA 3QRUA 4D1SA 2VO3A 2VTJA 2XK6A 1KV1A 3LHJA 4I22A 4BBMA 4BZOA 1PXOA 2BRMA 2B0QA 3VQUA 2O8YA 2G2FA 4GU6A 4JBPA 5A4QA 4APPA 3DKCA 3ENHA 3DXQA 2XIZA 3HV4A 3VHEA 4DEBA 5AV4A 4I3ZA 4FVRA 3GB2A 4BN1A 2HXLA 4LI5A 1YHWA 4BCFA 4V05A 4D5HA 3S0OA 3LMIA 4HNIA 3R7YA 4PDYA 4EH6A 4LM5A 1OIYA 2WMBA 2LAVA 3BKBA 3VN9A 3HL7A 4QP7A 5CZIA 1URCA 2FO0A 3F69A 4M68A 2XNNA 5DR6A 3C0GA 4CT1A 4PY1A 4DEIA 2ITZA 4AW0A 1IA9A 3UQGA 2WMSA 2BDWA 4YNEA 3D0EA 2B1PA 2YWVA 4CKIA 3MVMA 4N57A 2X7OA 3GXLA 4KBAA 5FWKK 5IQHA 3DCVA 3HECA 3PTGA 5LWNA 1Q8WA 2AUHA 3Q4ZA 4FTKA 4UBAA 5TR6A 2XEZA 4F09A 3NUUA 3FSFA 4GT5A 3A7IA 1FVRA 3AG9A 5LMKC 2NNWB 4X0MA 3RCDA 2IVSA 3RPRA 3VBYA 5KO1A 4RJ4A 3QYWA 4QYHA 3QTUA 3HDNA 5CENA 4DG2E 2UZTA 3HGKA 3MTLA 4X3JA 5AAFA 1UWHA 5CVGA 2EVAA 1YWNA 3MB6A 4O0WA 4YJPA 4QP2A 3AC3A 3WZDA 2BHEA 3VW6A 3DFAA 4W8DA 4QTAA 2E2BA 4E6DA 5JZJA 5JKGA 4GIHA 2GHMA 4JR7A 4DFBA 2BUJA 4FV5A 3K3JA 2CSNA 1YHSA 2ZOQA 3OWKA 4BICA 4D4SA 5CAQA 5JFVA 2A0CX 3W32A 3QKLA 2J51A 4M3QA 1RDQE 2WGJA 3F2AA 2FSTX 2UZNA 2F7XE 2ITYA 2XF0A 2Y4IB 5DIAA 5HD4A 5D12A 4H3PA 2WFYA 4O0XA 4WO5A 4BCJA 4M0YA 4F9CA 3MFUA 4EHGA 3LVPA 3JUHA 4AA5A 2BZKB 3OWJA 1R1WA 2A27A 3BWJA 1LPUA 4Y72A 3QTRA 2EXCX 3QQJA 3LLTA 1PXIA 3SXFA 2C6LA 2GHLA 4KBCA 5FUTA 4RIWB 4GG7A 4DFUA 2SRCA 3MA3A 4WD5A 3UTOA 4FKRA 3CTJA 2P33A 4AGDA 4PTCA 2V22A 3QQFA 5CEOA 5AIRA 3ZFXA 3HEGA 3G6HA 3OTUA 3PSCA 4ANNA 4FV6A 3ZO2A 1YXTA 4HPUE 3M42A 3W10A 3P5KA 3PG1A 4I21A 2OIBA 3ANQA 5L6PA 3QRIA 4FNXA 4ZJVA 3U8WA 2B9IA 3RI1A 3NIZA 5HIBA 1WZYA 4J71A 3L9NA 5IQDA 2PVYA 2OBJA 3EOCA 4RJ6A 4AOTA 3ACKA 2PVKA 2V7AA 2PSQA 3ZFYA 2PE2A 2XJ2A 3MA6A 3LJ1A 4AOIA 4NJ3A 2QOOA 1OL7A 2CNUA 2IG7A 3MY5A 2J5FA 1XH7A 4MXCA 4UMUA 5JQ5A 3GCSA 4BWXA 1G8SA 3QTWA 2DS1A 2QOFA 1CM8A 2C3LA 2PUPA 1M14A 4U97A 5BVOA 2DYLA 3R63A 3RCJA 3LCOA 3MI9A 5AIKA 3LXPA 3KF7A 3ORLA 4QMLA 5ACKA 2VRXA 1WVXA 3GU5A 4M69A 3AT3A 5DI1A 1ZMVA 4EBWA 3WF7A 4O86A 1URWA 1QPJA 5AAGA 2J4ZA 4BTMA 1WBPA 4CGAA 3NUXA 4IIRA 3RK9A 4DC2A 1U5QA 2UZDA 4EQUA 3W2CA 5TE0A 3L8XA 3ORTA 4EZ7A 1WBWA 2IJMA 3MTFA 4RQVA 1VYZA 4XH6A 4F0FA 1DI9A 2JEDA 1YDTE 2CHLA 4M7IA 4IB5A 4WT6A 1JVPP 3BLQA 4QMYA 4U42A 4IZ7A 2YN8A 3TV7A 4BDGA 2GS6A 3AT2A 3UQCA 4UMQA 4CQEA 2Z2WA 4JIAA 2IW9A 3ZO4A 4WUAA 2VTQA 2BTRA 2IVVA 2ZVAA 3SOAA 4NKAA 3HRCA 3G51A 4EH8A 3TL8A 2UW0A 4L45A 4R78A 2W0JA 5J7HA 4YZNA 3VC4A 4GW8A 3FPMA 2J90A 4J97A 4E5AX 4K8AA 4AGWA 4YHJA 4U5JA 3ZO1A 4ENXA 4HVDA 2V0DA 3ET7A 5KBQA 4FSMA 1DAWA 1RQQA 2REIA 5HHWA 5HG8A 4YHTA 3F7ZA 5HG7A 3WZKA 4FKGA 3BYUA 5ANGA 5FP5A 4C3PA 3C9WA 4QNAA 3KGAA 5GJGA 2JD5A 3GFWA 3Q4UA 1XWSA 2CCIA 2WEVA 3NLBA 4LQMA 3UIXA 4ZLZA 4DBXA 1H1SA 3HUBA 5DN3A 1OUKA 4F6UA 5K5NA 5DRDA 4BYJA 4GFMA 4HGTA 2XM8A 3EZRA 4KABA 1YXXA 4L3JA 3F3WA 4YTIA 2YAKA 3WOWA 1H07A 3CSVA 2VO7A 5E92A 3ORNA 2VWWA 4HVIA 2XJ1A 1T46A 2WIHA 2OJJA 4I41A 4C2WA 5B2MA 3PIZA 3HA6A 5KKRC 2WNTA 3KCKA 2X6DA 2HIWA 4I23A 3R9RA 3QKKA 4H3BA 3IW7A 3VVHA 4FV7A 4FL1A 5EKOA 1Q5KA 3FYJX 5AR5A 4D2RA 4R1VA 4ZXTA 3VS4A 3CPBA 2ZV7A 1JBPE 3D7TB 4EL9A 5IH4A 4MQ1A 3P1AA 4AE6A 3MVJA 2KTYA 2P0CA 1G8AA 4V0GB 1YDSE 1TKIA 3FZOA 4ZY4A 2R3JA 4UZHA 4R3CA 3PA3A 1LUFA 2P55A 5EYCA 1XJDA 4CFVA 2F7EE 2XCKA 4FG7A 4RVKA 4JDKA 4HW7A 3QZFA 3VS5A 4HYIA 3BHTA 4FKWA 2C69A 2BILB 5AUXA 3OD6X 4OTWA 2I0VA 5E1EA 5EYDA 3U6HA 1LEZA 5LVOA 4QMXA 4J52A 3I0OA 4F9AA 2FVDA 3QQGA 3R8LA 3JR1A 3L1SA 3OG7A 4RSSA 4GV1A 1F5QA 4J96A 5AP7A 4AE9A 3E8DA 3HV7A 4RC2A 3EQDA 3DKOA 1EH4A 3CGFA 5AP0A 2YDIA 4CFWA 4XYFA 4P4CA 3L9MA 4E26A 5E8VA 5I0BA 2OU7A 5IDNA 3VBWA 2VV9A 2BPMA 3O2MA 3JYAA 4YZCA 4IWOA 2YM5A 2JC6A 1PXNA 4ZZMA 4UYNA 4AZVA 3QBNA 3QXOA 1XQZA 4Y83A 4TN6A 4XRLA 4JX7A 4U6RA 2PZIA 5CF6A 4XV1A 4DLIA 5HTCA 3VBXA 4QOXA 3AC1A 3KQ7A 3QZGA 5GZ9A 3V8TA 4DYMA 3ZEPA 2EXEA 5A4EA 5CF4A 3IOPA 2CNQA 4MXYA 4WG5A 5DPVA 2F4JA 5H9BA 4TWOA 5LVPA 1ZZLA 4FR4A 4I92A 2XRUA 2C6KA 4YP8A 4ZTRA 5DH3A 4WNKA 4OTFA 1OIRA 2VTOA 3FLZA 4FG9A 4I5HA 3MWUA 4RIXB 4XUFA 3W16A 2HWPA 3A7HA 4BI0A 4ACGA 1Y8YA 1OUYA 1MRYA 4JG7A 4U45A 3FE3A 3BEGA 3CD3A 3TZ8A 4D2PA 3MH2A 3QRJA 4K2RA 1PYEA 3NYVA 4BCHA 1ZOHA 3NZ0A 3ORMA 1JPAA 2IVUA 2WIPA 4PV0A 3ZRLA 3BV3A 4FVPA 4MKCA 2VO6A 4ANQA 3RM6A 4J95A 1AD5A 3IDPA 5M51A 5IH6A 4O7VA 2ZDTA 4AGUA 4EUTA 3HV5A 3KRLA 4E73A 3FXWA 4E8AA 2BZIB 4ZMFA 3R28A 2R4BA 1M2QA 4M69B 3OS3A 4YSJA 3UPXA 1XKKA 3KU2A 2E9PA 2ZB1A 3D7TA 4FZFB 2R3PA 1K2PA 3FMMA 4TWCA 5FTQA 4QQ5A 1PJKA 1CKIA 3I5ZA 2C3JA 3MVHA 3RHKA 3RNYA 4DCAA 2I0HA 3VUKA 1A9UA 4OW8A 4QPSA 3QX4A 3KA0A 5LCJA 1XO2B 5JGBA 4JDIA 3OC1A 5DLSA 5HTBA 3EQHA 4P2KA 4XG2A 3RAWA 4M12A 4DN5A 2UUEA 5KBRA 2HZNA 3FZPA 3MBLA 4U7ZA 3DDPA 4D55A 2OW3A 5AUZA 4E4XA 1PXPA 3PXQA 4MX9A 2YM4A 2XRWA 3DBEA 4HGEA 5AP4A 3VUIA 3L9PA 3R8PA 4E3CA 4FK3A 3MIYA 4BTJA 1UNGA 2VWYA 1KE6A 3DGKA 3ZHPC 3V5PA 3ZOSA 1H8FA 5E8YA 4AW2A 4GH2A 5A3XA 4O27B 4YJNA 3DPKA 4HYUA 4J98A 3SRVB 3PWYA 4E6AA 3LXKA 4TL0A 2VX1A 4PUZA 2P4IA 1OIQA 3MN3A 3V01A 2PWLA 2WTKC 1JSTA 4TYGA 3RMFA 4G2FA 2XK8A 2WQBA 4FSUA 1XH8A 1U4DA 4NTTA 2X9EA 4ITIA 3RPVA 3S4QA 3TM0A 4RFMA 3PVGA 4RX7A 4F7JA 5CLPA 4YTHA 3DAKA 5HG9A 4E1ZA 5AR2A 1PRYA 2QO2A 4V01A 3VJNA 3WBLA 2Q83A 2NPQA 2W1FA 3UNJA 1H1QA 2BROA 4DGMA 3OUNB 1BI8A 4KRDA 1SVGA 1PMVA 3P86A 3REPA 3HX4A 3UIUA 4EONA 3R8MA 4BIEA 4JIKA 4TKSA 3C13A 1MRVA 4EOJA 4F4PA 4DITA 2WTJA 1W98A 2BTSA 1UU9A 2WKMA 4X2FA 4EKKA 5K4IA 2BIKB 4IX5A 4CCUA 3Q9XA 2R3FA 1QCFA 4DFYA 3BEAA 4EEVA 1B6CB 4HJOA 2W9FB 4U79A 3QHWA 1VZOA 2QO7A 2VTLA 3LJ0A 2I7QA 4J1RA 3ZMMA 2C1AA 4MHAA 2GSFA 4AZEA 3FMEA 2ERZE 3IOKA 1E1VA 5E90A 4D58A 4BI1A 3F5GA 3CKXA 3BIZA 4FZDB 1A06A 2B55A 1O9UA 2KULA 4QD6A 4B4LA 4BCKA 3R01A 3R8VA 4WIHA 2F57A 3UO6A 3DKGA 4L00A 4NCTC 3LXLA 1U5RA 5IUGA 2R64A 3VUTA 4USFA 5LVLA 3Q6UA 2X8DA 4X7QA 2V7OA 4W9WA 1OPJA 2VWZA 1R78A 2J2IB 2QD9A 2WMWA 3KXHA 5AP6A 4S32A 4BCIA 3W8LA 3GBZA 3LMHA 5A4LA 3PDTA 5DMZA 3FC2A 2JAMA 2OXXA 3I4BA 3BBTB 4AZWA 4BIBA 2OJGA 5H8EA 4FIFA 4ANOA 4O83A 3QGWA 4FSZA 1YQJA 4R3PA 4G3CA 4UALA 3HAVA 5FXSA 4FEUA 3R73A 4R6VA 3MIAA 2VO0A 2W4OA 2XJ0A 3TT0A 5HD7A 5IA1A 2HXQA 3PY1A 5D41A 4ZLYA 3E7OA 3Q4TA 2UVXA 4FICA 2CGXA 4PX6A 2YZAA 3G6GA 3EQIA 3ZUUA 4EH5A 3BBWA 4BKZA 1JOWB 1WBVA 3AD4A 3COKA 3L9LA 4PPAA 4CMTA 4EOKA 1WBTA 1IASA 2W17A 3VBTA 4XX9A 3SXRA 4XBRA 4GG5A 4U3YA 1UNHA 3FLQA 2CGUA 3QALE 1W7HA 3FPQA 5FG8A 1XH4A 5CNNA 5GJDA 4GSBA 4BZNA 3P23A 3SG8A 2HY81 3NX8A 3DK7A 4HZRA 3UMWA 3DT1A 3E8CA 1XR1A 3GUBA 2YFXA 4MNFA 4OBOA 3TEIA 3UP2A 4O6EA 3F88A 5TO8A 5CVFA 1OBDA 3EQRA 2W1DA 4ZSAA 3Q3BA 2FB8A 2WMUA 3G0EA 4UEUA 2YHVA 1Z9XA 4AW1A 3CTHA 3PRIA 1OPLA 4CKRA 4RJ5A 4CV8A 3GQLA 4MBLA 2W1CA 4DFXE 3LM0A 2C0IA 1JLUE 3A62A 5AWMA 4XLVA 5HOAA 4CTBA 3OFMA 3KXMA 4EWHA 1PXKA 1OL6A 4CV9A 2W1EA 4FSYA 4PMTA 2QOQA 5K5XA 4GUEA 5IG1A 3WARA 1SZMA 2ETMA 3PSBA 3C4ZA 3DBCA 3IW8A 3T8OA 4ANLA 3SAYA 5I9ZA 1J7IA 5KE0A 3HLLA 4F7SA 3KF4A 2EB2A 4QQCA 4DLJA 4NW6A 4B0GA 1NA7A 3H30A 4X2JA 4WOVA 5AR3A 5TKDA 4F6WA 2O65A 3LPBA 2HAKA 2C5VA 4DH1A 3ZRMA 5C4LA 3CQEA 3R2BA 4DFNA 3LQ5A 2Z02A 2R7IA 3BU5A 4FOCA 2X9FA 4WBOA 4EQCA 3DXPA 2CKQA 4GT4A 2X7FA 5FBOA 2V62A 2B9HA 3BHVA 3G2FA 4QP9A 4E5BA 3HA8A 4K18A 2FYSA 3TNQB 3EN4A 4BZDA 3LLAA 5J95A 3QWKA 4RZWA 3ROCA 3T9TA 1K3AA 2OK1A 5BYZA 2YIWA 2C5OA 4U44A 3VJOA 3Q32A 3UVQA 3PPKA 4L43A 3TUBA 4FKVA 4FZ6A 4A9YA 2ITXA 2OFVA 3TIZA 3NNUA 4YSMA 4C3RA 4I24A 4MQ2A 3ZONA 4AW5A 3LXNA 5HCXA 3DAJA 4P90A 3KN5A 5HE2A 3PE1A 4YJVA 4S30A 4O7RA 3TUCA 3DY7A 3QTQA 3R02A 2YACA 4II5A 4L3LA 1XBCA 3HMMA 1HCKA 4DG3E 4O1PA 2J0LA 4N0SA 2DQ7X 4D9UA 3GENA 4NSTA 3R9DA 4FF8A 4KS7A 3UPZA 1KE7A 4M15A 2OWBA 2YIRA 3FLYA 4QMMA 3WF5A 2GNJA 3K3IA 3R8UA 3OEZA 3QGYA 3R83A 3ITZA 3U51A 2OZOA 2I40A 3F6XA 3LFCA 5M08A 1WMKA 2GDOA 3ORZA 4PTGA 5EYKA 4IB0A 4B9DA 4EH3A 3V51A 4WBBB 2UW5A 4D0WA 4IADA 2FGIA 2VWBA 4TWPA 4DEEA 5C8KA 4R77A 3LCKA 4BC6A 1OGUA 3FZ1A 3EFJA 2WEIA 4Q5EA 2GQGA 5HU3A 4O7LA 3VS0A 4TXCA 1TQPA 4YJRA 3BLHA 4NM7A 3BZ3A 3PRFA 4F6SA 2WOTA 3BE2A 4PL3A 5H8GA 3TI1A 3FQHA 4YPDA 4IVDA 4HVSA 1IAJA 3NYNA 4MTAA 3I60A 4JS8A 4Y95A 5BUEA 3AGMA 2XZSA 4MCVA 3UO5A 5KNJA 2NRUA 4CQGA 5L2QA 4C4IA 3NNXA 1PMEA 3VS3A 3VWAA 3DJ7A 4FT5A 4BF2A 4MD8E 5AP1A 4UB7A 1U59A 4EJNA 4YJTA 3FI8A 2XBAA 1A48A 1J1BA 3FYKX 3QZIA 5EM6A 2GFCA 2B54A 4EBVA 5C03A 5JT2A 3EFLA 2W9ZB 4PDPA 1OKWA 2R3GA 4IAAA 3M2WA 3PZEA 2F2UA 3D2IA 5DG5A 5H2UA 2A4LA 4M97A 1L8TA 1FPUA 2QOCA 5BVEA 4CNHA 4OTRA 4XV3A 5DNRA 3RWQA 5EM5A 4PPCA 5IDPA 3FC1X 2VGOA 4CFUA 5L8KA 4GRBA 3R9NA 1PW2A 4I0TA 3MVLA 4M84A 4NW5A 4AT5A 4NIFB 5IISA 3FMLA 3U4WA 3C4CA 3WYXA 3FAAA 1STCE 2RFSA 5BQ0A 3CJFA 4FTIA 3AD6A 3D83A 3VUDA 4IXPA 5JGAA 2QU6A 2ZB0A 4D28A 2VWIA 2PZYA 2JFMA 3GC8A 3RGFA 3D7ZA 1MQ4A 4RWLA 4FTOA 2YISA 5KHWA 3RP9A 5LARA 3TZ7A 4Y8DA 5HZNA 3WE4A 5M4UA 2UZLA 1WVYA 2ACXA 1Z57A 1FINA 5GIOE 4FKUA 2C5XA 4RWJA 2H9VA 2HK5A 4EKLA 3CGOA 4ZS4A 2ITUA 4EYMA 1PXMA 4F7LA 3DJ6A 3PXRA 3OCSA 4O81A 4FEXA 3EN5A 4DHFA 3FJQE 2BAKA 5EDRA 4AWIA 4JBVA 5EFQA 2XNPA 5GZ8A 2UVYA 5I5ZA 4BDEA 3IW5A 3LAUA 4XS2A 5JRSA 2OXYA 1BYGA 1SMHA 2XYUA 2EU9A 3OTVA 2W5AA 5FTGA 3D5VA 5ANOA 2XKCA 3TNIA 4MYGA 1ZYJA 1J7LA 4JI9A 3AC8A 4IFGA 3BHUA 3FQEA 3CY2A 4CEGA 5GZAA 1CKJA 3CKWA 4G1WA 4XJ0A 5HO8A 1K9AA 4ZK5A 3FV8A 4BCGA 2PUUA 2IZUA 4NM0A 5CF5A 4DEAA 4U0IA 4O7SA 4LGHA 4IAZA 3PE2A 2ONLC 5DFPA 5LMAA 2XIYA 3OP5A 3BV2A 5KMNA 4G3GA 4PTEA 3BGQA 3Q9YA 4BYIA 4IM3A 4IBMA 4G31A 2CKPA 3A8XA 2W1IA 3BWFA 4YBJA 4G17A 2VTNA 5EYMA 3TXOA 3ZSGA 3FZTA 4CZUA 1GNGA 1F0QA 1ZZ2A 5E8XA 4R7IA 4ZZOA 2OI4X 1JAMA 3P08A 4IM0A 2B9FA 5EK7A 3V8SA 3LOKA 3WF9A 3V6SA 2PVJA 3E8EA 3I7BA 4GK3A 2GNLA 4UMPA 2ONLA 2CGVA 2W1HA 3G9NA 3V5WA 5AP5A 5AUTA 4FGRA 4DTAA 1OECA 4XP0A 4JRNA 4AACA 5HO6A 1QPEA 4JJRA 5ACBC 5IPJA 4ZTHA 3UZPA 3ULIA 2ZMDA 4Y85A 5IQBA 4X2KA 2ZM1A 4YZMA 5F94A 2P2HA 2W5BA 3KRJA 3FXXA 1DM2A 3GGFA 1O6LA 1Y57A 2CKOA 4GYIA 3JS2A 3MFSA 1JQHA 2WQEA 4CMUA 2VGPA 4YJSA 4RX5A 5LQFA 5L2TA 3A7GA 4G9RA 4RA4A 2W05A 4R1YA 3UP7A 5AUUA 3OEFX 3ELJA 2RIOA 3TJCA 1BUHA 2VTSA 3A4OX 3N4TA 4UZDA 2A2AA 4FKTA 4IVBA 4IZYA 3ZM9A 2QURA 4OBPA 2OICA 4C34A 4K11A 3RZFA 5CASA 4QPMA 3F61A 4U81A 4YR8A 2A1AB 3HV6A 4QP1A 3V5LA 4BDHA 5BYLA 4X6RA 4USDA 4ENYA 3OCGA 2B53A 5IQIA 3LW0A 2WU7A 2UZWE 2WQMA 4O7ZA 1KV2A 1GIJA 1H1RA 3PVWA 4WG3A 2BR1A 2YEXA 5CALA 5IEXA 4TYHB 1KE9A 3U87A 2GQRA 2JIIA 5C8MA 3ZEWA 4JG6A 2X2MA 5FTOA 3ZLYA 4GL9A 4M0ZA 4A9RA 4ASDA 4D4VA 2PK9A 1FGIA 4CMOA 5M09A 4BI2A 4C4GA 2BCJA 3W2PA 1SYKA 2E9OA 3OW3A 4ID7A 5HICA 5D9HA 4A9SA 2BZJA 2YCRA 3EKNA 1Z5MA 2ZDUA 2J6MA 3A4PA 5CSPA 2JDOA 5FP6A 5DWRA 4OTGA 1YRPA 4UN0C 3AMYA 4GT3A 1IEPA 2QC6A 2Z7QA 5CS6A 3M11A 2CKEA 4ZEGA 5HU9A 4EH9A 1YXVA 2VD5A 3OT3A 5CEKA 3RBWA 5M44A 4O7YA 1FGKA 1H0WA 1OITA 3UDBA 2RF9A 1HCLA 4FL2A 3TV6A 4QMQA 1Q8TA 5A46A 4AN2A 5GIPE 4Z9LA 4E7WA 4BR3A 2BVAA 4EOMA 5DEYA 4XHKB 3F9NA 2XH5A 4M8TA 4G34A 5CF8A 5J5TA 3PYYA 2Z7RA 3QLGA 3ZBXA 4C57A 3CCNA 2YERA 4DH8A 3Q04A 4NFMA 2UW9A 1V0OA 5IQGA 4UXQA 4NK9A 5CI6A 2WO6A 2V55A 1J91A 3RZBA 4V04A 1W84A 3H4JA 3LMGA 3PJ8A 4RBLA 3EJ1A 3HMPA 4TT7A 5CQWA 3UVPA 2RSVA 2YCSA 4KINA 4GUBA 4D5KA 4R8QA 4R7HA 1YKRA 4WKQA 4FSRA 4QMTA 4IVCA 4OR5A 4FV2A 2JDRA 5C01A 2XK4A 5FXRA 5AV1A 3BQRA 4L46A 1S9JA 4XMOA 3N9XA 1H27A 5JMSA 2QONA 4JG8A 2J9MA 5BX0A 2AC5A 4O0RA 4C61A 4D2WA 4EZ5A 3LFSA 3UNZA 3C7QA 4QQJA 2IZTA 1VYWA 3A7FA 4Q5HA 4BKJA 1NY3A 2G1TA 2WMQA 3FI4A 4A9UA 4HOKA 2GPHA 5DR2A 4IANA 3QCXA 3SKCA 4FEQA 2PZPA 3H0YA 5ETAA 3HP2A 4S34A 1O6KA 3EWHA 3HMNA 2WAJA 4LYNA 1WFCA 2R9SA 4L42A 5HQ0A 5C1QB 2BKKA 1YI6A 4TRLA 3DBFA 5HNGA 2WTVA 5IQCA 3QXPA 3UIBA 1P4OA 4G6NA 4ZSLA 4Z7GA 2WHBA 3C0IA 4KKGA 4RJ7A 1PXJA 2GS2A 2YAAA 3O7LB 1KSWA 3PJ3A 4MXAA 2QKWB 4XBUA 4FTTA 3ZH8A 4AOJA 4IACA 3HZTA 1YHVA 3H9FA 3O7LD 2F7ZE 3Q2JA 2PE0A 3R7GA 2R3QA 2CMWA 5HG5A 2VNYA 3GEQA 3NRMA 3D15A 2XIKA 4I6QA 5K0XA 2RGPA 4K77A 4KBKA 3MFTA 3MW1A 2YDJA 3I81A 3PPJA 1SNXA 3EQFA 2JFLA 3BLRA 3CS9A 4HCTA 4O2PA 2WOUA 2ZV8A 4C58A 2J50A 2QODA 5A6OA 5ETCA 4F1OA 2XNEA 5J1WA 5DOSA 5HBHA 3ZM4A 3U6JA 3NUNA 3V5QA 2WTIA 2YA9A 4UYAA 3VUHA 2Y6MA 3MB7A 4HVGA 3Q52A 2PVMA 3ORXA 4L01A 3ODZX 3FLSA 3HNGA 3TNPC 3W1FA 3FEGA 2QU5A 3S3IA 3RPYA 4ZLOA 3IS5A 5IKWA 4K9YA 3EQBA 3SLSA 4G3EA 3IW4A 4HCUA 3TJDA 2YABA 2PL0A 3FDNA 4MXZA 5E1SA 5EW9A 1M7NA 5DRBA 2HCKA 4ASEA 5IEVA 1JKKA 4FBXA 5CQUA 5K4JA 2YJRA 2WTCA 5E9EA 1ZOEA 2OGVA 4QMUA 2OF2A 1YOMA 3IONA 3OHTA 3ZDUA 2XNMA 3NAYA 3R30A 3JVSA 1REJA 4NUSA 3CR0A 5EG3A 4IX6A 3VS6A 2J7TA 4IMYA 1Q24A 4W4VA 4CTCA 4RPVA 3II5A 4KIKA 3EFKA 4QYEA 3F66A 1GIHA 1YWRA 3BI6A 3IW6A 4CLIA 4IM2A 4GKHA 4O7NA 4W4XA 4ZTLA 4QYGA 4U40A 1V0PA 3UMXA 4TYJA 2GHGA 3AC2A 4G16A 3U4UA 3U6IA 4FTRA 4KRCA 3PUPA 4JXFA 2ITNA 4BCOA 5T68A 2Q0NA 2OFUA 3Q9WA 3CLYA 2PZ5A 2VX0A 2C6EA 4WHZA 1H1PA 1XH9A 5DEWA 2QI8A 4FZ7A 4JX3A 5HX8A 3Q9ZA 3KVWA 3CC6A 5BMSA 3QRTA 1Y8GA 4XV9A 3ZZEA 5M53A 5I9YA 4HCVA 4IHPA 1ZRZA 4FKLA 3DZQA 1NVSA 4BIDA 1I44A 3F82A 3QL8A 4H1MA 4ACCA 3HAMA 4Y5QA 2Y6OA 3DJ5A 3VS1A 5AV0A 4S2ZA 5DT3A 5EH0A 2RG6A 4RG0A 2Y4PA 5M4FA 4FKJA 4ALVA 4L68A 2GTMA 3RHXA 3NCZA 4GS6A 4JL9A 3O8PA 3P79A 5JH6A 4PMMA 4QP8A 4BBEA 5CU4A 5E8TA 3UC3A 2BFYA 2WQNA 3MJ1A 4EOOA 3PA4A 4CG9A 4Z16A 5B7VA 2WTKB 5EI2A 4B8LA 1WBOA 5CSVA 3ZUVA 5DR9A 4XOYA 3TZ9A 3DQWA 2QVSE 3OUKA 5CNOA 1CSNA 4GCJA 4UMTA 5AV2A 3EIDA 4RC3A 4IH8A 4FSNA 2H34A 1P5EA 3E93A 1WBSA 3UOLA 3RPSA 2QCSA 2C6MA 3W8QA 2YCQA 1UV5A 3QCSA 4MF0A 3VUGA 3QQKA 3QTIA 2OIDA 4C37A 4H1JA 2QLUA 4TNDA 4FTMA 2X2LA 5IF1A 1H08A 3QAME 3OY3A 4KIPA 4B7TA 4C4HA 3VHKA 3BQCA 2X4FA 3FL4A 4AT4A 3C4XA 4A4LA 2HW7A 3THBA 4YMJA 3N4VA 4EC9A 2YWPA 2UVZA 4IWPA 2OG8A 3QHRA 4G3DA 4WNMA 2FH9A 4F9WA 4YJUA 5I9UA 1ZYDA 3BYSA 2BKZA 2H6DA 3ZBFA 3KVXA 4RVMA 1BX6A 4IEBA 2GU8A 3HYHA 5D1JA 2QKRA 4I20A 3EL7A 4U8ZA 2OLCA 3FI2A 3RAKA 4BBFA 3WZJA 4LFIA 5LVNA 2W5HA 3PXKA 4JBQA 4LG4A 4L44A 4RMZA 4ZSGA 3TTJA 4XG3A 3UBDA 4ALUA 1X8BA 3G90X 3D5UA 2JAVA 3R1NA 4DH7A 4ITJA 3KCFA 5CEMA 4OAUC 4Y5HA 5GHVA 4FV0A 5AX3A 4QYYA 3P7AA 4BGGA 3UVRA 3DNDA 5J1VA 4OTPA 3S00A 4UV0A 4H05A 2H8HA 2R0UA 3QQLA 5I9WA 1YI4A 3H0ZA 3MH3A 3R00A 5HNBA 2C6IA 5AJQA 3ZTXA 4CYJA 3QTSA 5E8SA 2DUVA 2PYWA 5KCVA 3C0HA 4FA2A 3HVCA 5BVWA 4FUXA 4KIQA 4I4FA 5C27A 2GCDA 2IZSA 4CXAA 3PPZA 4CCBA 2HW6A 1RE8A 4ZY6A 4AA0A 3R1SA 4JAJA 4H36A 2BALA 2ITTA 5HORA 1H4LA 1WBNA 3POZA 1CTPE 3VW8A 4DH3A 4YNOA 4QYFA 3EH9A 4FNYA 4USEA 4NYEA 3GU7A 3WF6A 3PJ1A 3LKMA 3L8SA 2R3KA 5EW8A 3DKFA 4OBQA 1MUOA 4YO4A 4DEGA 3OBGA 3TWJA 3FZRA 4ZJJA 4PP9A 3QYZA 3COMA 4XG7A 4BHNA 5AFVA 3ZS5A 2IO6A 3G0FA 4B8MA 2WELA 1Y91A 2XEYA 5K9IA 3KKVA 4YC6A 4DG0E 5KMJA 3NUAA 3U9NA 1H00A 4F99A 5AUVA 3CBLA 4UWCA 4ERWA 1G5SA 4IAKA 3LJ2A 4FTJA 3WF8A 4EORA 4AT3A 4I6HA 2W1GA 4ZIMA 5AR8A 4PDOA 4RRVA 1H24A 4ZOGA 5FBNC 2WMTA 4KSPA 3TCPA 2WXVA 2O63A 4BCPA 3ETAA 3P9JA 3EMGA 4S31A 4UWYA 3ZO3A 3ULZA 1NT2A 4PRJA 2J0MB 5JFXA 2VTRA 2CN5A 5FGKA 4N4SA 2ITWA 4YGAA 4LOQA 5T6KA 3VF8A 4C62A 4RGJA 4JLCA 4AX8A 3BGPA 4BY9E 3DK3A 2GNGA 3BHHA 3WE8A 1BL7A 1QPCA 2XIRA 3EZVA 3K5UA 4JQ7A 3DA6A 4CG8A 4BB4A 2CN8A 3V8WA 3PLAE 2C6OA 4FC0A 4LRJA 1PYXA 2QOLA 1H0VA 1NXKA 2EXMA 4H58A 3U54A 3K2LA 4FEVA 2GNIA 3N51A 3KY2A 3PZHA 4KIOA 3WZEA 3LFNA 4RLLA 2C5YA 3M1SA 4AN9A 3MY1A 4JDHA 3E7VA 3RAIA 2ZV2A 2GFSA 4BGQA 1BLXA 1FVTA 2X6EA 4IZ5A 3FXZA 4JQ8A 1OL2A 5IMXA 2C6DA 4QP3A 1ND4A 3VULA 1Q8YA 5CXHA 3DXNA 4IDTA 4EH2A 5EKNA 3PP0A 4C4FA 3Q53A 3R71A 2FSLX 4LL5A 4D1XA 3N4UA 3MPTA 3QC4A 3SHEA 4DE4A 5D11A 3DK6A 3KULB 2ITPA 2PUNA 4FE2A 3G9LX 3PP1A 1CKPA 3NIEA 5HLPA 2Y8OA 4WRGA 3RK7A 5BVDA 1VEBA 4W4WA 5C8NA 3HP5A 4FYNA 3DBDA 4NZWB 3IDBA 3ROYA 5I9XA 5M4CA 4JR3A 2O5KA 4RVLA 2BRHA 1H28A 4FTUA 1GZ8A 5I4NA 3RM7A 4IX4A 5FM3A 4UWBA 1OZ1A 1UKHA 4J53A 4Y46A 5I9VA 1WVWA 4YLKA 4X2NA 3R7UA 3FY2A 5F20A 2C3IB 4EK5A 4EZ3A 5CAOA 2JIVA 4I1ZA 3BYMA 3EQCA 4ONAA 4RIWA 3ZSIA 2A19B 3EKKA 4D1ZA 3H3CA 4RA5A 3Q5ZA 5DE2A 2FSOX 3E8NA 4GYGA 3T3VA 3S95A 4C02A 5JN2A 3RINA 4A06A 4BKYA 2X8IA 4RIXA 3EHAA 4IE9A 1XH6A 2BDJA 3ZDIA 5HLWA 3S1HA 3COHA 4IAIA 3VNTA 2UV2A 3R7VA 5CEQA 4CVAA 1ZYLA 4BDBA 5I3RA 3CTQA 2WTDA 5AA9A 3OMVA 3EB0A 3C1XA 2PMNX 2I0YA 4F65A 3KK9A 3CE3A 3V04A 2VTMA 3LQ3A 1J3HA 3KMUA 4I0RA 4I5CA 2I0EA 3F3VA 4YHFA 5EQYA 4HGLA 4B99A 3LFFA 5I3OA 3FKLA 1R39A 3PIYA 1Q62A 4FKPA 3EN9A 4ZTMA 3TKIA 2J0JA 2QG7A 5LMKA 1SM2A 5KHXA 3P78A 3KREA 3C4EA 3RWPA 5D10A 4BL1A 4D2VA 3VBQA 4BDFA 3D5XA 3TKHA 1YI3A 4Y73A 4ERKA 1V0BA 2OIQA 1B39A 3AD5A 5EM7A 3TTIA 5HEZA 2G15A 2NO3A 3FUPA 3NMUF 4FKOA 4HZSA 3HMIA 2JLDA 1QMZA 3FMHA 3NNWA 3KXGA 4JOAA 3VRYA 4I6FA 4EK4A 2IWIA 3GU6A 4MF1A 3KB7A 5AMNA 3QUPA 3R9HA 4UY9A 3G5DA 1O6YA 3PA5A 4KNBA 4PF4A 3CPCA 1I09A 1H01A 3DBQA 4K0YA 4O0UA 5CU2A 3TNHA 5BVFA 2UW7A 4EH7A 2YM7A 2JIUA 3HDMA 3I6WA 3Q60A 5KUPA 2W06A 4CFXA 2VTTA 4O0SA 4EH4A 3NUYA 5LJJA 3SVVA 1AQ1A 1IAHA 5JSMA 2BZHB 2QNJA 3QUDA 3RNIA 5KMKA 2EUFB 2JKOA 4QMVA 2OXDA 3W2OA 3VRZA 3ZCLA 2BRGA 4BGHA 2R3HA 2RFEA 5E8ZA 5EHOA 1XHAA 4D2TA 3VF9A 4KS8A 4M66A 3NVKI 1T45A 2B52A 1W8CA 1Y6AA 3UJGA 2G9XA 4EUUA 1XBAA 4F1TA 1M2PA 3QF9A 1FMOE 2Z7SA 4ZTQA 4GKIA 3UIMA 4DT8A 2R3LA 4QTDA 2JKMA 2W1ZA 1R0PA 1P4FA 4BCNA 3O71A 2JDTA 3ERKA 3TIYA 5DYJA 4O38A 5HCYA 4C38A 1FMKA 4NJDA 3F3ZA 3CY3A 4IWDA 1PMNA 4I4EA 4YURA 3PY3A 1RW8A 3F5UA 3OT8A 3SX9A 1GZOA 1JKTA 2QQ7A 2XNBA 3EYHA 4XG9A 3EN6A 2VTPA 4XRJA 3MGYA 5FEQA 3DV3A 5AEPA 1Q97A 5EI6A 1Q8ZA 3CQUA 3IKAA 5K3YA 3W18A 4BCMA 5F95A 4EHVA 3R7IA 2IW6A 2JDVA 2R3NA 3AOXA 1ZAOA 2J0IA 3OXIA 3OZ6A 4K33A 4MWHA 4E4NA 4AFEA 2WMVA 4F9BA 4OT6A 3QU0A 4QTEA 5IUHA 1J7UA 4FTCA 4O7WA 3Q6WA 4FMQA 4KUJA 4BDKA 4CFFA 3A2CA 1R3CA 4WG4A 4X2GA 4BWPA 3UNKA 3PWDA 4AZFA 2ZV9A 1P14A 2CPKE 2QOKA 5L8LA 2Y9QA 4W4YA 3E5AA 4CFMA 4LOPA 4DAWA 4CZTA 5JFSA 3UODA 1ZLTA 5HE1A 3RALA 3I6UA 3D2KA 3AT4A 2IPXA 4A07A 3Q96A 2VWXA 2O3PA 1CMKE 3FZSA 3IECA 5CTPA 3BU6A 3OOGA 4ZSEA 4AFJA 3I7CA 3P7CA 4TNBA 4EOIA 5FLFA 4A9TA 5DA3A 3AC4A 5FM2A 3VBVA 1CDKA 2OF4A 2WQOA 2XIXA 5TOZA 2ETKA 5HVYA 4C0TA 2VX3A 2HY0A 3ID6C 4CZYB 3OWPA 2QHNA 5EW3A 4YO6A 1ZY4A 3BE9A 4M14A 2XBJA 4GVJA 4AP7A 5D7AA 4O0TA 5FDPA 4DA5A 2PHKA 1GJOA 3ORPA 3WILA 4FI1A 3KXNA 1IG1A 4QTBA 5A4CA 4RJ8A 3O23A 3IDCA 3KRXA 2PVLA 1ZMUA 4I94A 4CRSA 4FEWA 4C3FA 3FMJA 3R6XA 5HESA 2B4SB 4DINA 3R1QA 3EQGA 5J9ZA 2CNVA 1XH5A 3D14A 2R3OA 2PU8A 5K0KA 5LMBA 4GJ2A 4XCUA 4DTKA 4BRXA 3PFQA 4LV5A 1Q41A 4DGLC 4RT7A 4F64A 5LWMA 2PVRA 5BYYA 4C8BA 1PKDA 4E6QA 2QO9A 3FQSA 5HTIA 2CLXA 4MXOA 4R5SA 2C47A 4DEHA 4OTDA 2Y4IC 3R2YA 5ANIA 5EDQA 4QMPA 4CYIA 4CLJA 2PUIA 3O96A 3A7JA 1JWHA 3EQPA 3JY9A 3A61A 3AXWA 3CEKA 3GU4A 4I5PA 2LGCA 2AYPA 3QC9A 2YJSA 3DLZA 3QRKA 5DBXA 3BGZA 1E9HA 4LRMA 4HNFA 2WPAA 3BYOA 4QRCA 5GNKA 3ORKA 5AX9A 5L2SA 4LRKA 2BMCA 3SD0A 4FSTA 3DFCB 4DGGA 3R04A 4O22A 3FHIA 4PP7A 2Y7JA 3CP9A 4FODA 4QP6A 3QA0A 2B9JA 2WU6A 3UE4A 2XS0A 2UZBA 5JK3A 3WIGA 3IG7A 5IEYA 4BFMA 3B8RA 2R3IA 3F5PA 3NDMA 4U3ZA 4A7CA 2BDFA 3QLFA 3KN6A 3GCPA 4FZAB 3QD3A 3V6RA 5AP3A 5GJFA 4ARKA 2BRBA 3D94A 2G2IA 3GCVA 4F70A 4N70A 5J87A 1V1KA 3A8WA 3HRFA 4IWQA 2RKUA 5CI7A 3E64A 4F08A 4FVQA 3TACA 4KWPA 3LFDA 3LFBA 2QLQA 3EYGA 4ZP5A 5E8WA 3UGCA 4F0IA 4IAFA 5A54A 3R9OA 4OLIA 4JRVA 4AG8A 3QD2B 4F63A 5KX8A 3RKBA 1BI7A 4FIJA 5T3QA 2PVFA 4DT9A 2C6TA 3C4WA 3H10A 4APCA 5IZFA 1ZXEA 2XP2A 2Z60A 3QWJA 2W96B 3OBJA 5CU6A 1OIUA 3KEXA 2XNOA 3QTZA 3NNVA 3FY0A 4PNKA 2VTAA 3TV4A 4FGBA 2QR8A 4Q9ZA 4IJPA 5M07A 1UU8A 2WTWA 3LFQA 4CSVA 5KMIA 5AV3A 4YC8A 4ACMA 1U54B 3DAEA 2XVDA 4FV1A 3V5JA 4DCEA 4QTCA 4TYIA 4BTKA 4OAVB 3FKOA 3LZBA 3TKUA 5M4IA 3IK3A 4FL3A 4XV2A 4XNEA 2HELA 4IB1A 1YVJA 1Q3WA 2UW4A 4PNIA 3CD8A 5LXMA 1Y6BA 4WUNA 3JXWA 2JBOA 2PE1A 3E3PA 2NRYA 4IC8A 4XOZA 5AM6A 3SDJA 1U46A 3HUCA 4AAAA 3RTPA 5CANA 4GK4A 1GY3A 2QHMA 4E93A 1DAYA 3O50A 4QMZA 3FBVA 3PVBA 1YXUA 2QOBA 2CDZA 4IFCA 3WIKA 3TDWA 2E9NA 3FLNC 3UZRA 1YXSA 5AR4A 4BHZA 3GOPA 3GI3A 3P0MA 4TTHB 3O8TA 5LVMA 3JY0A 3L8VA 5IQAA 3MYGA 3ACJA 4X3FC 1E1XA 1UNLA 1ZWSA 3W2RA 2UW6A 2CCHA 4MXXA 1NVQA 4EK6A 4R7BA 1NVRA 2VTHA 2YLEA 4PMSA 4AZSA 2OSCA 3LIJA 2VN9A 3KC3A 2HWOA 3E92A 4MVFA 4RWKA 4ACDA 4FKIA 3PXYA 4U9AA 4F0GA 1G3NA 4ORKA 4KSQA 5H3QA 2RFDA 4PL4A 1GZNA 4FTQA 5J5SA 3Q4CA 3GOKA 5CT0A 3UO4A 1GIIA 4PDSA 1SNUA 5AADA 1FBNA 1HOWA 3COIA 3LCDA 4H39A 3SW4A 4RC4A 3OOMA 4FK6A 5H8BA 4DFLA 4EYJA 1KWPA 1SVEA 5G6VA 3SA0A 3CJGA 3C5IA 4YTFA 4GFGA 4H3QA 3RPOA 3B8QA 3QCQA 4IDVA 1MP8A 5CXZA 5IA3A 5JGDA 3GC0A 2FUMA 3R21A 5IA2A 2CJMA 4FKQA 2W99B 4YJQA 4L7FA 1KE8A 3HV3A 4OUCA 4X3FB 3VQHA 2J5EA 1J1CA 4WSYA 4I6BA 4FTAA 3UYSA 5A4TA 3FLWA 3EL8A 1UA2A 2X0GA 4LGDA 3LM5A 4EHZA 5JEBA 4NL0A 4KIKB 2C68A 2AC3A 3DTWA 3NCGA 5M55A 4M13A 1UU3A 3DNEA 4YLLA 3MS9A 5IQFA 3NUSA 4MEDA 5JFWA 1H25A 4AXAA 4YPSA 4QQTA 3KFAA 1ZY5A 3RVGA 4BVUA 4EHEA 4MNEB 4YZDA 4CRLA 3QCYA 1PY5A 3BRBA 2XKDA 2V5QA 3MFRA 3KK8A 3ANRA 3GP0A 4KA3A 4RFYA 3LCTA 3MPMA 2J0KA 4FT9A 1VR2A 2X39A 4R3RA 5BUIA 3HMOA 4IX3A 4ZSJA 5E4HA 3DB8A 2PTKA 1PKGA 4FIGA 4AN3A 3D4QA 2C0OA 4MBIA 4LV8A 2IZRA 3Q5IA 1ERKA 4TW9A 4E4LA 3SGCA 3H9RA 5C4KA 2XYNA 2UZOA 3GCUA 3K54A 2C4GA 4KD1A 4HPTE 3RK5A 3SRVA 2QOIA 3PSDA 4U80A 3U55A 1PF8A 2X1NA 4L7SA 5JRQA 3FMKA 2GMXA 3GC9A 3PJCA 4R5YA 2W4JA 4HYHA 2IW8A 4ITHA 1WAKA 5HBJA 1IRKA 1YOLA 3FHRA 4K6ZA 4U43A 1JKSA 2PVHA 4BDJA 2XA4A 4XLIA 1Q61A 1L3RE 2PY3A 4EK3A 5CT7A 3ZYAA 4EK8A 3DDQA 4FTNA 4AS0A 1OB3A 3KXXA 1JSUA 2FSMX 4AUAA 4DGNA 4UXLA 4GJ3A 4C59A 1H1WA 4O7TA 4FIEA 5M06A 3OWLA 4I0SA 5FD2A 4KB8A 2YM6A 2ZAZA 4OGRA 4F9YA 4XG6A 3ZRKA 3MH0A 3OVVA 5IA0A 1BL6A 2BHHA 2JKQA 3FMNA 5B2KA 3R8ZA 3DLSA 3BCEA 2XM9A 1TQMA 3GNIB 4FV9A 3HKOA 2OZAB 3R1YA 3VUMA 4YBKA 2RFNA 1FOTA 1OKYA 2OJ9A 2QR7A 2XK9A 3NYXA 5CEPA 4AZTA 2O2UA 3UOHA 4HYSA 2EWAA 2ZMCA 5HE3A 2Q0BA 5FRIA 5HVJA 4FSQA 4Q2AA 5DVRA 1M7QA 4O91A 4L52A 5BNJA 5M56A 1MQBA 2FA2A 4MD7E 4QO9A 3A60A 5L8JA 4AGCA 2XB7A 4FT0A 4YTCA 4ZZNA 4FSWA 4O6LA 4ANBA 2NP8A 4V0GA 5HX6A 3F2NA 2YZLA 3OCTA 5ICPA 4L9IA 3TNWA 2VAGA 2I6LA 3CXWA 2PPQA 5IQEA 1H26A 4P5QA 3ZLSA 5IU2A 4JBOA 4N6ZA 1JKLA 2Z7LA 5BUJA 4FYOA 3E62A 5G1XA 5M57A 5CSXA 4RLKA 3UQFA 5J9YA 1GOLA 3QTXA 5CZHA 2XUUA 4MWIA 4YLJA 1Q4LA 4MBJA 4BWKA 2WMAA 1P2AA 5EOBA 3NW7A 2BAQA 3W33A 4O82A 2UZEA 4L53A 2X4ZA 3SV0A 4F7NA 5CYIA 2YCFA 2O0UA 2ZM3A 5C9CA 3AMAA 3FWQA 3UOKA 2CLQA 4LOOA 5J8IA 5TT7A 1BKXA 4FV4A 1OI9A 1YW2A 3KRWA 2RL5A 4ALWA 3RAHA 4Z7HA 3BHYA 1XBBA 2F9GA 3ALNA 1RJBA 4GK2A 1W83A 4OT5A 4LL0A 5FQDC 1UWJA 2UZVA 4RJ3A 3G15A 1TVOA 5HIEA 3JVRA 5EOLA 5TF9A 2VUWA 4FKSA
chains in the Genus database with same CATH superfamily
2C1BA 3ORIA 4DGOA 4D4YA 4O21A 2G01A 3FMDA 3MH1A 2YLFA 1W82A 3O8UA 1LP4A 4FV8A 4FNZA 4FTLA 4KKEA 3LFAA 4O4FA 5DT4A 5HBEA 3GC7A 3WYYA 1ATPE 4FOBA 4JNWA 2YM8A 3UDZA 1OVEA 4OTIA 3I0QA 4X3FA 3B2TA 3DB6A 4IB3A 5AA8A 5F9EA 4ZJIA 3MSSA 5AP2A 1LEWA 3RJCA 4GMYA 5ETFA 4EOPA 4YU2A 3NAXA 4JVGA 4AQCA 2HYYA 2P3GX 3PJ2A 4RQKA 3W55A 1KUTA 1QPDA 4YUQA 3IPHA 5EQPA 2H96A 5CSHA 3C4FA 2G2HA 3E3BX 2VWUA 5KKRB 4W9XA 3OW4A 4BDDA 5DGZA 1IR3A 2RG5A 2QG5A 4YJOA 4PL5A 3GCQA 5KMLA 5B0XA 2VWVA 3NEWA 2XK7A 3FI3A 5CSWA 3QD4A 3K5VA 4WNPA 2AEGA 4O96A 2F2CB 4WNOA 2C3KA 2PMIA 3QX2A 4BDCA 2CGWA 3R0TA 3DU8A 4RIYA 3TDVA 5LCKA 4IC7A 1SVHA 3F5XA 4GVAA 5FXQA 3F2RA 5AAEA 5A14A 2R3RA 2OH4A 2GNHA 3I5NA 3NUPA 4RFZA 1YWVA 5D7VA 1DS5A 1UKIA 4I5MA 4NEUA 4K1BA 2OJFE 2HZIA 3VS7A 3DZOA 3DQXA 4C36A 4Z3VA 1JSVA 3MPAA 5L3AA 2R0IA 2WD1A 4RVTA 3W0RA 5CAUA 3L8PA 3QUEA 5EI8A 3OROA 4RX8A 1UVRA 4ZS0A 4G5JA 3IGOA 4J7BA 3TZMA 3BELA 3TG1A 4ASXA 2ITQA 4E20A 3PXZA 3VS2A 3E87A 1NW1A 1DI8A 4YZ9A 5KMMA 5ANKA 1Q99A 2XMYA 3U9CA 5IUIA 1ZYCA 3E63A 3NW5A 2X2KA 5FEDA 4MNEA 4NT4A 3ZXZA 3IO7A 3ZLXA 3BYVA 1R0EA 2C0TA 2BRNA 4IQ6A 1YDRE 2IVTA 3PIXA 4PPBA 4DEDA 4EI4A 4FV3A 1WCCA 4BDIA 1OBGA 4TYEA 3OCBA 3SQQA 3C51A 1Q8UA 3SXSA 3VO3A 4C35A 3NGAA 4C4JA 4DFZE 2ZFYA 5CU0A 4GFOA 4C4EA 2ZJWA 4L67A 4GU9A 4X6QC 4D2SA 3GVUA 3PLSA 2QOHA 5L2WA 2JBPA 3SW7A 3MV5A 1G8JA 4FUYA 4JAIA 2W4KA 4EWQA 5KMOA 4G6OA 1APME 1OM1A 3KMWA 2HENA 3ZLWA 5ANEA 5GINE 1PXLA 4QPAA 4PQNA 3VAPA 4XEYA 4TWNA 3NYOA 3AMBA 2XNGA 3O51A 3T3UA 2VZ6A 3O0GA 3LE6A 2XCHA 4NIFA 5AM7A 3ZFMA 1U54A 3MESA 1S9IA 4NTSA 4XP2A 4MAOA 3EN7A 1IA8A 3QA8A 3GFEA 4FIHA 4FT7A 4XP3A 3VIDA 5EM8A 5CVHA 4ZMEA 2W7XA 3A99A 1KOBA 2JKKA 4FT3A 4KKHA 3UC4A 3PG3A 2YIQA 4FX3A 5IA5A 3GT8A 4FG8A 4CD0A 4I93A 4G3FA 3F3UA 3MDYA 4IJ9A 3TN8A 3ZC6A 4C33A 4G6LA 4LUDA 2OO8X 4GEOA 5DT0A 3QZHA 4FIIA 2PMLX 5ANDA 3SG9A 4RIYB 3UDTA 4RZVA 1M2RA 2WZJA 3AQVA 3WZUA 4NH1A 4QP4A 1YOJA 3BPRA 3P7BA 3ZUTA 3UOJA 3QD0A 2EB3A 2GNFA 3R7OA 2B7AA 5CAPA 4MK0A 2Y0AA 2OZAA 4J99A 5E8UA 4ZTSA 5KZIA 3LCSA 5A9UA 4C7TA 2OKRA 1PMUA 5ANJA 5J79A 3C50A 4QMNA 1Q3DA 4YC3A 4WRSA 5ETIA 3DS6A 4C2VA 3F3TA 1LR4A 4EJ7A 4OTQA 3ML1A 5CWZA 3B2WA 4N6YA 4EOSA 3CIKA 4L8MA 2VU3A 1VJYA 1W0XC 2UW3A 1M17A 5CU3A 3SC1A 4IVAA 4X21A 3UDSA 2R2PA 5CAVA 5L6OA 2GQSA 4NM5A 2ZYBA 5BMMA 4EQMA 3H9OA 4O1OA 1B38A 3R7EA 4RX9A 5HI2A 4ACHA 1UU7A 5HVKA 3UYTA 2PZRA 3NR9A 4ZY5A 4L6QA 2HOGA 5L4QA 1F3MC 4A4XA 3KRRA 4XG4A 4L3PA 3ZXTA 5A6NA 4QMWA 3UG1A 4DTBA 4TYHA 3POOA 2WMRA 4XG8A 3NPCA 3JPVA 2BIYA 2R7BA 3O17A 5EQEA 4BCQA 4AXFA 3C5UA 5EDPA 5C26A 1MRUA 2GS7A 3NW6A 5HCZA 3BU3A 4F1MA 4ZTNA 4E4MA 1GZKA 3OF0A 3T9IA 5J9LA 4JDJA 2X81A 2DWBA 4QNYA 5IH5A 2R5TA 4OTHA 2O64A 3MJ2A 4LMNA 1OMWA 5E7RA 4DH5A 5B2LA 3GU8A 4LGGA 5HO7A 4D4RA 2GTNA 4GIIA 4E6CA 1JNKA 2BAJA 4W8EA 2XKFA 3ALOA 3W2QA 3QQHA 3NWWA 3V3VA 4EOLA 2R3MA 3QFVA 3KL8A 4MD9E 3QQUA 2ETRA 4TZRA 3ZC5A 2PMOX 4Q9SA 2YIXA 5CX9A 2VNWA 3WI6A 4E5WA 3FL5A 2BFXA 4UMRA 4D0XA 5LOHA 4NKSA 3NVMB 4IAYA 3TUDA 4O2ZA 4FJVA 1OKVA 2ITVA 5BVNA 5L2IA 4IW0A 5L6WL 3PVUA 4O0YA 1M52A 4NM3A 5CY3A 1KOAA 2C30A 3ZU7A 5EHYA 4QMOA 2PULA 3LFEA 3MY0A 5KZ0A 4YZBA 3ENMA 2XK3A 4RIOA 3D5WA 4B6LA 4J8NA 4P5ZA 3D9VA 2UZUE 2X7GA 3EFWA 5FEEA 4EOQA 3OXTA 3AGLA 2WMXA 4QMSA 5HLNA 3PXFA 2ERKA 4DDGA 3P4KA 4CFNA 1OKZA 3SOCA 5HNIX 3G33A 5F1ZA 5IA4A 2E9VA 5CEIA 3I1AA 2OH0E 2WB8A 2Z8CA 4AA4A 5ITAA 3GQIA 3P5JC 1FQ1B 3OXZA 3ZZWA 3UZTA 4PWNA 3TMOA 4JQEA 4ZAUA 3Q2MA 2E9UA 3LQ8A 4AF3A 4UX9A 3OY1A 2YIYA 3KMMA 5EHLA 4LMUA 2ZM4A 4O84A 3HRBA 5HIDA 2JDSA 1REKA 4NCTA 5J7BA 3DOGA 5E91A 3AKJA 4DBNA 3CQWA 5DHJA 3DTCA 1ZMWA 3KXZA 3E88A 5HE0A 1GAGA 4NFNA 4D9TA 5F4NA 2OJIA 4HGSA 5JZNA 4BTFA 4HVHA 3ATSA 3PY0A 4LUEA 4G5PA 1QL6A 1OL1A 4RWIA 1ZARA 5FDXA 5HKMA 1ZOGA 2HZ4A 4EC8A 4IZAA 3FSKA 3QKMA 3F7WA 4BDAA 4NU1A 3NS9A 4KAOA 4TY1A 4PMPA 3R22A 3I79A 4A4OA 5JQ8A 2HZ0A 5AR7A 4CKJA 4MH7A 2JITA 4TPTA 5AUYA 1BMKA 2YITA 3UG2A 2YDKA 2ESMA 4CT2A 3IQ7A 2UW8A 4WA9A 5BVKA 1OPKA 3BX5A 4FNWA 3ODYX 4WSQA 2I1MA 4ANMA 2PVNA 2YM3A 1ZYSA 3ATTA 4J8MA 1AGWA 4ANSA 4M67A 5HGIA 5IMEA 2XKEA 4S33A 4U41A 4Z55A 1TQIA 2C5NA 2JGZA 4DF3A 4NWMA 3AC5A 4AU8A 5BPYA 2ITOA 2IN6A 1PHKA 4ASZA 4JT3A 1OL5A 2F49A 4G9CA 4QT1A 4O0VA 3FKNA 3ZSHA 2X8EA 2P2IA 1KE5A 5AUWA 3NSZA 3IGGA 1W2CA 4P7EA 3S2PA 3W2SA 2VTIA 3KULA 3V5TA 1FVVA 3QRUA 4D1SA 2VO3A 3W0PA 2VTJA 2XK6A 1KV1A 3LHJA 4I22A 4BBMA 4BZOA 1PXOA 2BRMA 2B0QA 3VQUA 2O8YA 2G2FA 4LDTA 4GU6A 4JBPA 5A4QA 4APPA 3DKCA 3ENHA 3DXQA 2XIZA 3HV4A 3VHEA 4DEBA 5AV4A 4I3ZA 4FVRA 3GB2A 2X0QA 2HXLA 4LI5A 1YHWA 4BN1A 4BCFA 4V05A 4D5HA 3S0OA 3LMIA 4HNIA 3R7YA 4PDYA 4EH6A 4LM5A 1OIYA 2WMBA 2LAVA 3BKBA 3VN9A 3HL7A 4QP7A 5CZIA 1URCA 2FO0A 3F69A 4M68A 2XNNA 5DR6A 3C0GA 4CT1A 4PY1A 4DEIA 2ITZA 4AW0A 1IA9A 3UQGA 2WMSA 2BDWA 4YNEA 3D0EA 2B1PA 2YWVA 4CKIA 3MVMA 4N57A 2X7OA 3GXLA 4KBAA 5FWKK 5IQHA 3DCVA 3HECA 3PTGA 5LWNA 1Q8WA 2AUHA 3Q4ZA 4FTKA 4UBAA 5TR6A 2XEZA 4F09A 3NUUA 3FSFA 4GT5A 3A7IA 1FVRA 3AG9A 5LMKC 2NNWB 4X0MA 3RCDA 2IVSA 3RPRA 3VBYA 5KO1A 4RJ4A 3QYWA 4QYHA 3QTUA 3HDNA 5CENA 4DG2E 2UZTA 3HGKA 3MTLA 4X3JA 5AAFA 1UWHA 5CVGA 2EVAA 1YWNA 3MB6A 4O0WA 4YJPA 4QP2A 3AC3A 3WZDA 2BHEA 3VW6A 3DFAA 4W8DA 4QTAA 2E2BA 4E6DA 5JZJA 5JKGA 4GIHA 2GHMA 4JR7A 4DFBA 2BUJA 4FV5A 3K3JA 2CSNA 1YHSA 2ZOQA 3OWKA 4BICA 4D4SA 5CAQA 5JFVA 2A0CX 3W32A 3QKLA 2J51A 4M3QA 1RDQE 2WGJA 3F2AA 2FSTX 2UZNA 2F7XE 2ITYA 2XF0A 2Y4IB 5DIAA 5HD4A 5D12A 4H3PA 2WFYA 4O0XA 4WO5A 4BCJA 4M0YA 4F9CA 3MFUA 4EHGA 3LVPA 3JUHA 4AA5A 2BZKB 3OWJA 1R1WA 2A27A 3BWJA 1LPUA 4Y72A 3QTRA 2EXCX 3QQJA 3LLTA 1PXIA 3SXFA 1ST4A 2C6LA 2GHLA 4KBCA 5FUTA 4RIWB 4GG7A 4DFUA 2SRCA 3MA3A 4WD5A 3UTOA 4FKRA 3CTJA 2P33A 4AGDA 4PTCA 2V22A 3QQFA 5CEOA 5AIRA 3ZFXA 3HEGA 3G6HA 3OTUA 3PSCA 4ANNA 4FV6A 3ZO2A 1YXTA 4HPUE 3TYKA 3M42A 3W10A 3P5KA 3PG1A 4I21A 2OIBA 3ANQA 2XARA 5L6PA 3QRIA 4FNXA 4ZJVA 3U8WA 2B9IA 3RI1A 3NIZA 5HIBA 1WZYA 4J71A 3L9NA 5IQDA 2PVYA 2OBJA 3EOCA 4RJ6A 4AOTA 3ACKA 2PVKA 2V7AA 2PSQA 3ZFYA 2PE2A 2XJ2A 3MA6A 3LJ1A 4AOIA 4NJ3A 2QOOA 1OL7A 2CNUA 2IG7A 3MY5A 2J5FA 1XH7A 4MXCA 4UMUA 5JQ5A 3GCSA 4BWXA 1G8SA 3QTWA 2DS1A 2QOFA 1CM8A 2C3LA 2PUPA 1M14A 3W0QA 4U97A 5BVOA 2DYLA 3R63A 3RCJA 3LCOA 3MI9A 5AIKA 3LXPA 3KF7A 3ORLA 4QMLA 5ACKA 2VRXA 1WVXA 3GU5A 4M69A 3AT3A 5DI1A 1ZMVA 4EBWA 3WF7A 4O86A 1URWA 1QPJA 5AAGA 2J4ZA 4BTMA 1WBPA 4CGAA 3NUXA 4IIRA 3RK9A 4DC2A 1U5QA 2UZDA 4EQUA 3W2CA 5TE0A 3L8XA 3ORTA 4EZ7A 1WBWA 2IJMA 3MTFA 4RQVA 1VYZA 4XH6A 4F0FA 1DI9A 2JEDA 1YDTE 2CHLA 4M7IA 4IB5A 4WT6A 1JVPP 3BLQA 4QMYA 4U42A 4IZ7A 2YN8A 3TV7A 4BDGA 2GS6A 3AT2A 3UQCA 4UMQA 4CQEA 2Z2WA 4JIAA 2IW9A 3ZO4A 4WUAA 2VTQA 2BTRA 2IVVA 2ZVAA 3SOAA 4NKAA 3HRCA 3G51A 4EH8A 3TL8A 2UW0A 4L45A 4R78A 2W0JA 5J7HA 4YZNA 3VC4A 4GW8A 3FPMA 2J90A 4J97A 4E5AX 4K8AA 4AGWA 1OGYA 4YHJA 4U5JA 3ZO1A 4ENXA 4HVDA 2V0DA 3ET7A 5KBQA 4FSMA 1DAWA 1RQQA 2REIA 5HHWA 5HG8A 4YHTA 3F7ZA 5HG7A 3WZKA 4FKGA 3BYUA 5ANGA 5FP5A 4C3PA 3C9WA 4QNAA 3KGAA 5GJGA 2JD5A 3GFWA 3Q4UA 1XWSA 2CCIA 2WEVA 3NLBA 4LQMA 3UIXA 4ZLZA 4DBXA 1H1SA 3HUBA 5DN3A 1OUKA 4F6UA 5K5NA 5DRDA 4BYJA 4GFMA 4HGTA 2XM8A 3EZRA 4KABA 1YXXA 4L3JA 3F3WA 4YTIA 2YAKA 3WOWA 1H07A 3CSVA 2VO7A 5E92A 3ORNA 2VWWA 4HVIA 2XJ1A 1T46A 2WIHA 2OJJA 4I41A 4C2WA 5B2MA 3PIZA 3HA6A 5KKRC 2WNTA 3KCKA 2X6DA 2HIWA 4I23A 3R9RA 3QKKA 4H3BA 3IW7A 3VVHA 4FV7A 4FL1A 5EKOA 1Q5KA 3FYJX 5AR5A 4D2RA 4R1VA 4ZXTA 3VS4A 3CPBA 2ZV7A 1JBPE 3D7TB 4EL9A 5IH4A 4MQ1A 3P1AA 4AE6A 3MVJA 2KTYA 2P0CA 1G8AA 4V0GB 1YDSE 1TKIA 3FZOA 4ZY4A 2R3JA 4UZHA 4R3CA 3PA3A 1LUFA 2P55A 5EYCA 1XJDA 4CFVA 2F7EE 2XCKA 4FG7A 4RVKA 4JDKA 4HW7A 3QZFA 3VS5A 4HYIA 3BHTA 4FKWA 2C69A 2BILB 5AUXA 3OD6X 4OTWA 2I0VA 5E1EA 5EYDA 3U6HA 1LEZA 5LVOA 4QMXA 4J52A 3I0OA 4F9AA 2FVDA 3QQGA 3R8LA 3JR1A 3L1SA 3OG7A 3PFYA 4RSSA 4GV1A 1F5QA 4J96A 5AP7A 4AE9A 3E8DA 3HV7A 4RC2A 3EQDA 3DKOA 1EH4A 3CGFA 5AP0A 2YDIA 4CFWA 4XYFA 4P4CA 3L9MA 4E26A 5E8VA 5I0BA 2OU7A 5IDNA 3VBWA 2VV9A 2BPMA 3O2MA 3JYAA 4YZCA 4IWOA 2YM5A 2JC6A 1PXNA 4ZZMA 4UYNA 4AZVA 3QBNA 3QXOA 1XQZA 4Y83A 4TN6A 4XRLA 4JX7A 4U6RA 2PZIA 5CF6A 4XV1A 4DLIA 5HTCA 3VBXA 4QOXA 3AC1A 3KQ7A 3QZGA 5GZ9A 3V8TA 4DYMA 3ZEPA 2EXEA 5A4EA 5CF4A 3IOPA 2CNQA 4MXYA 4WG5A 5DPVA 2F4JA 5H9BA 4TWOA 5LVPA 1ZZLA 4FR4A 4I92A 2XRUA 2C6KA 4YP8A 4ZTRA 5DH3A 4WNKA 4OTFA 4F78A 1OIRA 2VTOA 3FLZA 4FG9A 4I5HA 3MWUA 4O4CA 4RIXB 4XUFA 2HWPA 3A7HA 3W16A 4BI0A 4ACGA 1Y8YA 1OUYA 1MRYA 4JG7A 4U45A 3FE3A 3BEGA 3CD3A 3TZ8A 4D2PA 3MH2A 3QRJA 4K2RA 1PYEA 3NYVA 4BCHA 1W2FA 1ZOHA 3NZ0A 3ORMA 2NYAA 1JPAA 2IVUA 2WIPA 4PV0A 3ZRLA 3BV3A 4FVPA 4MKCA 2VO6A 4ANQA 3RM6A 4J95A 1AD5A 3IDPA 5M51A 5IH6A 4O7VA 2ZDTA 4AGUA 4EUTA 3HV5A 3KRLA 4E73A 3FXWA 4E8AA 2BZIB 4ZMFA 3R28A 2R4BA 1M2QA 4M69B 3OS3A 4YSJA 3UPXA 1XKKA 1XMLA 3KU2A 2E9PA 2ZB1A 3D7TA 4FZFB 2R3PA 1K2PA 3FMMA 4TWCA 5FTQA 4QQ5A 1PJKA 1CKIA 3I5ZA 2C3JA 3MVHA 3RHKA 3RNYA 4DCAA 2I0HA 3VUKA 1A9UA 4OW8A 4QPSA 3QX4A 3KA0A 5LCJA 1XO2B 5JGBA 4JDIA 3OC1A 5DLSA 5HTBA 3EQHA 4AXCA 4P2KA 4XG2A 3RAWA 4M12A 4DN5A 2UUEA 5KBRA 2HZNA 3FZPA 3MBLA 4U7ZA 3W0MA 3KIOC 3DDPA 4D55A 5BV3A 2OW3A 5AUZA 4E4XA 1PXPA 3PXQA 4MX9A 2YM4A 2XRWA 3DBEA 4HGEA 5AP4A 3VUIA 3L9PA 3R8PA 4E3CA 4FK3A 3MIYA 4BTJA 1UNGA 2VWYA 1KE6A 3DGKA 3ZHPC 3V5PA 3NFFB 3ZOSA 1H8FA 5E8YA 4AW2A 4GH2A 5A3XA 4O27B 4YJNA 2A98A 3DPKA 4HYUA 4J98A 3PWYA 3SRVB 4E6AA 3LXKA 4TL0A 2VX1A 4PUZA 2P4IA 1OIQA 3MN3A 3V01A 2PWLA 2WTKC 1JSTA 4TYGA 3RMFA 4G2FA 2XK8A 2WQBA 4FSUA 1XH8A 1U4DA 4NTTA 2X9EA 4ITIA 3RPVA 3S4QA 3TM0A 4RFMA 3PVGA 4RX7A 4F7JA 5CLPA 4YTHA 3DAKA 5HG9A 4E1ZA 5AR2A 1PRYA 2QO2A 4V01A 3VJNA 3WBLA 2Q83A 2NPQA 2W1FA 3UNJA 1H1QA 2BROA 4DGMA 3OUNB 1BI8A 4KRDA 1SVGA 1PMVA 3P86A 3REPA 3HX4A 3UIUA 4EONA 3R8MA 4BIEA 4JIKA 4TKSA 3C13A 1MRVA 4EOJA 4F4PA 4DITA 2WTJA 1W98A 2BTSA 1UU9A 2WKMA 4X2FA 4EKKA 5K4IA 2BIKB 4IX5A 4CCUA 3Q9XA 2R3FA 1QCFA 4DFYA 3BEAA 4EEVA 1B6CB 4HJOA 2W9FB 4U79A 3QHWA 1VZOA 2QO7A 2VTLA 3LJ0A 2I7QA 4J1RA 3ZMMA 2AQXA 2C1AA 4MHAA 2GSFA 4AZEA 3FMEA 2ERZE 3IOKA 1E1VA 5E90A 4D58A 4BI1A 3F5GA 3CKXA 3BIZA 4FZDB 1A06A 2B55A 1O9UA 2KULA 4QD6A 4B4LA 4BCKA 3R01A 3R8VA 4WIHA 2F57A 3UO6A 3DKGA 4L00A 4NCTC 3LXLA 1U5RA 5IUGA 2R64A 3VUTA 4USFA 5LVLA 3Q6UA 2X8DA 4X7QA 2V7OA 4W9WA 1OPJA 2VWZA 1R78A 2J2IB 2QD9A 2WMWA 3KXHA 5AP6A 4S32A 4BCIA 3W8LA 3GBZA 3LMHA 5A4LA 3PDTA 5DMZA 3FC2A 2JAMA 2OXXA 3I4BA 3BBTB 4AZWA 4BIBA 2OJGA 5H8EA 4FIFA 4ANOA 4O83A 3QGWA 4FSZA 1YQJA 4R3PA 4G3CA 4UALA 3HAVA 5FXSA 4FEUA 3R73A 4R6VA 4FRFA 3MIAA 2VO0A 2W4OA 2XJ0A 3TT0A 5HD7A 5IA1A 2HXQA 3PY1A 5D41A 4ZLYA 3E7OA 3Q4TA 2UVXA 4FICA 2CGXA 4PX6A 2YZAA 3G6GA 3EQIA 3ZUUA 4EH5A 4LV7A 3BBWA 4BKZA 1JOWB 1WBVA 3AD4A 3COKA 3L9LA 4PPAA 4CMTA 4EOKA 1WBTA 1IASA 2W17A 3VBTA 4XX9A 3SXRA 4XBRA 4GG5A 4U3YA 1UNHA 3FLQA 2CGUA 3QALE 1W7HA 3FPQA 2IF8A 5FG8A 1XH4A 5CNNA 5GJDA 4GSBA 4BZNA 3P23A 4DHJA 3SG8A 2HY81 3NX8A 3DK7A 4HZRA 3UMWA 3DT1A 3E8CA 1XR1A 3GUBA 2YFXA 4MNFA 4OBOA 3TEIA 3UP2A 4O6EA 3F88A 5TO8A 5CVFA 4MUQA 1OBDA 3EQRA 2W1DA 4ZSAA 3Q3BA 2FB8A 2WMUA 3G0EA 4UEUA 2YHVA 1Z9XA 4AW1A 3CTHA 3PRIA 1OPLA 4CKRA 4RJ5A 4CV8A 3GQLA 4MBLA 2W1CA 4DFXE 3LM0A 2C0IA 1JLUE 3A62A 5AWMA 4XLVA 5HOAA 4CTBA 3OFMA 3KXMA 4EWHA 1PXKA 1OL6A 4CV9A 2W1EA 4FSYA 4PMTA 2QOQA 5K5XA 4GUEA 5IG1A 3WARA 1SZMA 2ETMA 3PSBA 3C4ZA 3DBCA 3IW8A 3T8OA 4ANLA 3SAYA 5I9ZA 1J7IA 5KE0A 3HLLA 4F7SA 3KF4A 2EB2A 4QQCA 4DLJA 4NW6A 4B0GA 1NA7A 3H30A 4X2JA 4WOVA 5AR3A 5TKDA 4F6WA 2O65A 3LPBA 2HAKA 2C5VA 4DH1A 3ZRMA 5C4LA 3CQEA 3R2BA 4DFNA 3LQ5A 2Z02A 2R7IA 3BU5A 4FOCA 2X9FA 4WBOA 4EQCA 3DXPA 2CKQA 4GT4A 2X7FA 4JMQA 5FBOA 2V62A 2B9HA 3BHVA 3G2FA 4QP9A 4E5BA 3HA8A 1ST0A 4K18A 2FYSA 3TNQB 3EN4A 4BZDA 3LLAA 5J95A 3QWKA 4RZWA 3ROCA 3T9TA 1K3AA 2OK1A 3VONA 5BYZA 2YIWA 2C5OA 4U44A 3VJOA 3Q32A 3UVQA 3PPKA 4L43A 3TUBA 4FKVA 4FZ6A 4A9YA 2ITXA 2OFVA 3TIZA 3NNUA 4YSMA 4C3RA 4I24A 4MQ2A 3ZONA 4AW5A 3LXNA 5HCXA 3DAJA 4P90A 3KN5A 5HE2A 3PE1A 4YJVA 4S30A 4O7RA 3TUCA 3DY7A 3QTQA 3R02A 2YACA 4II5A 4L3LA 2XALA 1XBCA 3HMMA 1HCKA 4DG3E 4O1PA 2J0LA 4N0SA 2DQ7X 4D9UA 3GENA 4NSTA 3R9DA 4FF8A 4KS7A 3UPZA 1KE7A 4M15A 2OWBA 2YIRA 3FLYA 4QMMA 3WF5A 2GNJA 3K3IA 3R8UA 3NFGB 3OEZA 3QGYA 3R83A 3ITZA 3U51A 2OZOA 2I40A 3F6XA 3LFCA 5M08A 1WMKA 2GDOA 3ORZA 4PTGA 5EYKA 4IB0A 4B9DA 4EH3A 3V51A 4WBBB 2UW5A 4D0WA 4IADA 2FGIA 2VWBA 4TWPA 4DEEA 5C8KA 4R77A 3LCKA 4BC6A 1OGUA 3FZ1A 3EFJA 2WEIA 4Q5EA 2GQGA 5HU3A 4O7LA 3VS0A 4TXCA 1TQPA 4YJRA 3BLHA 4NM7A 3BZ3A 3PRFA 4F6SA 2WOTA 3BE2A 4PL3A 5H8GA 3TI1A 3FQHA 4YPDA 4IVDA 4HVSA 1IAJA 3NYNA 4MTAA 3I60A 4JS8A 4Y95A 5BUEA 3AGMA 2XZSA 4MCVA 3UO5A 5KNJA 2NRUA 4CQGA 5L2QA 4C4IA 3NNXA 1PMEA 3VS3A 3VWAA 3DJ7A 4FT5A 4BF2A 4MD8E 5AP1A 4UB7A 1U59A 4EJNA 4YJTA 3FI8A 2XBAA 1A48A 1J1BA 3FYKX 3QZIA 5EM6A 2GFCA 2B54A 4EBVA 5C03A 5JT2A 3EFLA 2W9ZB 4PDPA 1OKWA 2R3GA 4IAAA 3M2WA 3PZEA 2F2UA 3D2IA 5DG5A 5H2UA 2A4LA 4M97A 1L8TA 1FPUA 2QOCA 5BVEA 4CNHA 4OTRA 4XV3A 5DNRA 3RWQA 5EM5A 4PPCA 1W2DA 5IDPA 3FC1X 2VGOA 4CFUA 5L8KA 4GRBA 3R9NA 1PW2A 4I0TA 3MVLA 4M84A 4NW5A 4AT5A 4NIFB 5IISA 3FMLA 3U4WA 3C4CA 3WYXA 3FAAA 1STCE 2RFSA 5BQ0A 3CJFA 4FTIA 3AD6A 3D83A 3VUDA 4IXPA 5JGAA 2QU6A 2ZB0A 4D28A 2VWIA 2PZYA 2JFMA 3GC8A 3RGFA 3D7ZA 1MQ4A 4O4DA 4FTOA 2YISA 4RWLA 5KHWA 3RP9A 5LARA 3TZ7A 4Y8DA 5HZNA 3WE4A 5M4UA 2UZLA 1WVYA 2ACXA 1Z57A 1FINA 5GIOE 4FKUA 2C5XA 4RWJA 2H9VA 2HK5A 1XMMA 4QDEA 4EKLA 3CGOA 4ZS4A 2ITUA 4EYMA 1PXMA 4F7LA 3DJ6A 3PXRA 3OCSA 4O81A 4FEXA 3EN5A 4DHFA 3FJQE 2BAKA 5EDRA 4AWIA 4JBVA 5EFQA 2XNPA 5GZ8A 2UVYA 5I5ZA 4BDEA 3IW5A 3LAUA 4XS2A 5JRSA 2OXYA 1BYGA 1SMHA 2XYUA 2EU9A 3OTVA 2W5AA 5FTGA 3D5VA 5ANOA 2XKCA 3TNIA 4MYGA 1ZYJA 1J7LA 4JI9A 3AC8A 4IFGA 3BHUA 3FQEA 3CY2A 4CEGA 5GZAA 1CKJA 3CKWA 4G1WA 4XJ0A 5HO8A 1K9AA 4ZK5A 3FV8A 4BCGA 2PUUA 2IZUA 4NM0A 5CF5A 4DEAA 4U0IA 4O7SA 4LGHA 4IAZA 3PE2A 2ONLC 5DFPA 5LMAA 2XIYA