3V5QA

Discovery of a selective trk inhibitor with efficacy in rodent cancer tumor models
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
292
structure length
263
Chain Sequence
GIHVQHIKRRDIVLKRELKVFLAECYNLSPTKDKMLVAVKALPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMDVYSTDYYRTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords NT-3 growth factor receptor
publication title Discovery of GNF-5837, a Selective TRK Inhibitor with Efficacy in Rodent Cancer Tumor Models.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 263
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v5qA01
4HPTE 3R1NA 4PDPA 4ZLOA 1ZMWA 3DK3A 3NUXA 3QWKA 2VAGA 1CKPA 5E90A 4HVSA 3K3IA 5M56A 4Y85A 2BKKA 2QG5A 5FEDA 3SOCA 5J79A 2V22A 3FLSA 5FBNC 4RQKA 1UV5A 3CR0A 4IEBA 3ZUVA 3MYGA 4C4JA 5CALA 2UW6A 4AW1A 4IWDA 4R6VA 1PRYA 4D2TA 5A3XA 3RMFA 5AUYA 5IKWA 3WOWA 4GT5A 3QZGA 1DI8A 4HVDA 3WF6A 4S30A 2CKEA 1WBPA 3ZMMA 3S1HA 3FMLA 4NYEA 3A60A 3RKBA 4FT9A 5BVEA 3ZFMA 4AX8A 4FUXA 5DT0A 1TQMA 4QYFA 3V6RA 1WBOA 3KULB 5IA3A 3TL8A 5HE0A 5CEOA 4O84A 3ZSIA 3F66A 4J8NA 5JGBA 2JAVA 4IXPA 4BKYA 2BMCA 1Y6AA 2C1AA 3U6JA 3JR1A 4TYGA 1YOLA 3R9NA 3C0GA 4IC8A 3FMEA 4ZSAA 2XIYA 4FMQA 4PTGA 5HCXA 5C8NA 3CBLA 3C4FA 5GZ9A 1M52A 3I1AA 4LMNA 5EI8A 2ZYBA 2LGCA 3R1YA 2OXXA 2W17A 2OIBA 3C4WA 4FV9A 4MD8E 2UVYA 3QALE 5EOBA 4QMWA 4UBAA 3VS3A 3FHRA 2VWIA 3DLSA 4BWPA 1PYXA 4GT3A 4RIYA 2Q0BA 3BLHA 4BICA 2ITTA 4OR5A 1OI9A 4BCFA 4YTCA 3H9RA 4GFGA 2ITUA 3TWJA 4NTSA 2Z7QA 4NFMA 2WTKC 4TYIA 2JIVA 3DKOA 1P4FA 2UW3A 5DT4A 1FGKA 2QOLA 4UXQA 4UV0A 3MESA 3RZBA 4FOCA 4AG8A 3H4JA 4MNEA 4AN2A 2EU9A 3LFAA 3OTVA 3BYUA 3BEAA 4HPUE 4MBIA 2JC6A 2OJJA 3LFCA 3R02A 1VZOA 4YTFA 3V01A 5EM6A 4BCGA 5JFVA 3FL5A 3P7AA 5LWMA 3EN7A 2R3NA 3QF9A 3R7GA 4DH5A 5HE1A 2PMOX 3CTHA 4ZTHA 5DI1A 3TJCA 4R3RA 1H1SA 4BDEA 4CRLA 2IW6A 3LFSA 4LRJA 2YM3A 4AP7A 3UO4A 4FTQA 5D9HA 1YWRA 4FV6A 4BB4A 2I1MA 4GK3A 5HBEA 3TNWA 4R7IA 2W5HA 3R8LA 4A9UA 3DDQA 3UDBA 2G1TA 5EHOA 2VTTA 4KS7A 4V0GB 3M11A 4ACHA 4IANA 4CLIA 4CT1A 5JQ5A 4QMVA 4UWCA 5EDQA 4FBXA 4QQJA 4H58A 2F2UA 1OPLA 3LXKA 4KIKA 4RJ5A 4D5HA 2OJIA 3L1SA 2EXCX 3P9JA 5HCZA 4LOPA 2WXVA 3LCSA 3R8UA 4AN9A 2UW8A 2XM8A 3DA6A 3R21A 1OZ1A 3HV5A 4FZDB 2QR8A 5IMEA 3PVGA 4RC3A 1IRKA 4M3QA 4EUUA 4XV1A 5CI6A 2C1BA 1GIIA 2CGXA 3POOA 4IBMA 3COHA 1CM8A 4X2NA 3REPA 4AZTA 5HIEA 1PY5A 3TV7A 3UJGA 5HTCA 4FV4A 1JPAA 1QPJA 4H1MA 3QQKA 2Y0AA 3R9DA 2X8EA 1ZWSA 1OL2A 4YC8A 5LOHA 4AGDA 4M8TA 1F3MC 4XG9A 5BUIA 3AC1A 4ZS4A 2E9UA 2OH4A 4XOZA 4G6OA 1E1VA 3THBA 1LR4A 4OBQA 1BKXA 2O2UA 4KNBA 5CU4A 3K2LA 5KE0A 3VS1A 4FNXA 4I3ZA 4EOQA 2FH9A 2IZUA 3MDYA 4TYHB 3KFAA 4NW5A 3TZ9A 4FTRA 3Q53A 4FL2A 4J95A 4QP2A 1V0OA 4QD6A 3V04A 5BYZA 3A2CA 1H27A 2YLEA 4LGDA 3LFQA 4O91A 4X6QC 3ZLXA 2XBAA 5AP1A 5ETFA 4BZOA 4F0FA 4IAYA 3CY2A 4FKOA 3NNVA 4YHJA 4FOBA 3VHEA 3QUPA 4RJ6A 3QTXA 2BHHA 2XK9A 3AOXA 4LM5A 5TKDA 5M4CA 2PE0A 4QOXA 3NUPA 4AT3A 2CKOA 2W9FB 1IASA 1Q8TA 4L43A 4OBPA 3NWWA 3ZLSA 2PWLA 4UYAA 5HIBA 4FSRA 4QYGA 4JIKA 4N6ZA 3P79A 2XIKA 2B9FA 3BEGA 3OCTA 5ANEA 5M55A 4RT7A 5CENA 3WARA 5ITAA 5C4LA 2A19B 4IAKA 2W99B 5AP7A 1PXOA 3EN9A 4JNWA 5AP3A 3NX8A 2VTAA 3SAYA 3EWHA 4FKGA 3Q5ZA 3QUDA 1Q62A 3T9TA 3UQFA 1KWPA 4M15A 3ZXZA 1OGUA 4UMUA 2UZTA 2BROA 4TYJA 3MVHA 2G15A 1YDRE 5T3QA 1JWHA 1Q8YA 2JFLA 3K3JA 3NUSA 3O0GA 4YSJA 4DGGA 3EQHA 2WAJA 3GU4A 3RPRA 4YO4A 3Q5IA 4PMPA 4CV8A 5LVPA 3HGKA 4QRCA 2CNVA 3QD3A 1KSWA 2WMAA 5HNBA 3ZTXA 4CFFA 3A8XA 3FPMA 1IA9A 3OHTA 2WQMA 3EKNA 4X2KA 4EK8A 5EQPA 4AE6A 4GU6A 3UMWA 4DTBA 3C0HA 2VN9A 3DTCA 3MA3A 4J96A 1OBGA 1MRUA 3COKA 3DB6A 3WZKA 4GSBA 4LRMA 2E2BA 3PY1A 4AOTA 2OZAA 2WU7A 5CF4A 4CGAA 2ITNA 2PVHA 4EOPA 2YIRA 2V7OA 1YOJA 3GVUA 4GJ3A 5BMMA 4EJNA 1H00A 5HVJA 3DBQA 2VWWA 3OCGA 4JI9A 3SX9A 4Z16A 2PVYA 5AV2A 2XF0A 4M69B 3S2PA 5HBJA 1GAGA 3CY3A 3JUHA 2X2LA 4WHZA 1XBBA 4R78A 4OTGA 3N4UA 3UTOA 2HELA 3V6SA 4FTJA 2BRNA 3E8EA 4U8ZA 4DGLC 5CT0A 4O22A 2X4ZA 4KIPA 2Y7JA 5E92A 3ULZA 4FIEA 4PP7A 1KE9A 5F4NA 5FDXA 5B0XA 5E8VA 4C36A 3PP0A 2ZDTA 2GDOA 1A06A 3RCDA 3FMNA 3FYKX 1ZY4A 4UALA 4MQ2A 5LQFA 1UNHA 4YTHA 4YZCA 4F9AA 3VS0A 2WKMA 4UY9A 2PE1A 3ORKA 2R3HA 3PJ8A 3S0OA 1BL6A 4D2RA 3NZ0A 4QQCA 2C3IB 4GCJA 2PHKA 3OEFX 3VHKA 4LRKA 3BX5A 5EW3A 5TR6A 3VJNA 2GS7A 4A7CA 3GC7A 2J0LA 2W5AA 1H01A 3EZVA 4NEUA 3AT3A 4J97A 4GRBA 3ZSHA 2Q0NA 5IQGA 3Q9WA 4FT3A 4F6WA 3OWKA 4PL4A 2Z8CA 4ZY6A 2OXDA 4YR8A 3DTWA 3D14A 3LFEA 3QQLA 4IACA 4CMOA 2GHGA 5AUXA 4FSUA 4HCUA 5FQDC 5H8GA 2Z02A 3Q9ZA 4RGJA 3N4TA 3LXNA 2X7OA 3W8QA 4F7NA 2HY0A 4DC2A 2YISA 4KBKA 4I5MA 3QGYA 2I7QA 3QWJA 3DKGA 4K8AA 2CNQA 1GJOA 2UZBA 4GK2A 1WMKA 3FDNA 3AGLA 2IO6A 3HUCA 4GUEA 4BN1A 5IISA 3B2TA 3HMMA 5J7BA 3NVMB 4CZTA 3TIZA 3WF7A 4I22A 1OMWA 4K77A 4PDSA 4PMMA 4C35A 2QHMA 1H0WA 1CTPE 4XG8A 1GNGA 5FTQA 2G2HA 3R1SA 4O7SA 4Q9SA 5IQIA 3EN4A 3VBXA 2C6EA 2R0UA 5L8JA 3KXHA 1Q3WA 2XRWA 4YBJA 2ERKA 3JY9A 3QTUA 3ZO2A 4ANBA 3DKCA 1JSTA 5KHWA 3I5ZA 4XBRA 4F0GA 3HUBA 2W96B 3NCGA 2A1AB 5A9UA 3TACA 4YZBA 3OBJA 3VBTA 3PJ1A 3FBVA 3O23A 4BIBA 4BKZA 5BVNA 3R9RA 2A2AA 2XJ2A 1YI4A 3NUAA 2J9MA 4GEOA 3BBTB 2RGPA 4LI5A 2GS6A 1WBTA 2GNGA 4TL0A 3ORLA 3PVBA 4HCTA 4YJQA 4E7WA 3PFQA 3G5DA 5T6KA 4WKQA 5HOAA 5EOLA 5IUIA 1J1BA 5AX9A 3VUKA 3EQGA 5LJJA 4IC7A 1FQ1B 5AFVA 3OTUA 1REJA 3EMGA 3V5PA 4TW9A 5C01A 3NVKI 5AAEA 1V0BA 3TZ8A 2HAKA 3KULA 3PVWA 1U59A 5E8UA 2YFXA 2PZRA 3MBLA 4X3JA 4F1TA 2R3LA 1YDTE 2WELA 2WMSA 4APPA 5JKGA 4KRCA 3H9FA 4KIQA 5DNRA 2QO9A 3BWFA 3LFBA 5DVRA 4FYNA 3W18A 2YDKA 3CS9A 2ZM3A 3ORZA 3CXWA 4PL5A 2VNWA 3QCYA 3R22A 4P90A 5AJQA 4BDKA 4HVHA 4O82A 1YHWA 1FVTA 3F9NA 3FI4A 4IIRA 3NW6A 3TM0A 2B54A 3ZONA 4CXAA 3FXWA 1PKGA 3FLWA 4E5WA 2YAKA 3H30A 5AM7A 5ANDA 5FXQA 4BIDA 1WVXA 4C37A 3Q52A 4O0UA 2PZIA 2OXYA 4RBLA 3DNDA 3PY0A 4C4GA 4U7ZA 3MB6A 4IE9A 4MX9A 3F61A 3QYWA 4FTAA 5EDPA 1WVYA 3A4PA 1JBPE 1B39A 3BYSA 3HRFA 2V5QA 1AD5A 2VTMA 2JIUA 4XV3A 5A14A 1H08A 4K2RA 1BL7A 1J7IA 2R7IA 3U9NA 3NYNA 2VX3A 4O0RA 4FODA 5L6PA 1YRPA 5HD7A 5M09A 3C13A 4N70A 4OTWA 3MW1A 4FKSA 5L3AA 3PXRA 3NSZA 4FSZA 1XR1A 2FGIA 4L53A 3RJCA 4AOJA 5I9VA 1H07A 4FK3A 4R77A 2WTDA 4IFCA 4IX3A 4U97A 2VWZA 5HX6A 3SHEA 4O2PA 3F2RA 4HGSA 4HYHA 3QRTA 3FSFA 3MH1A 3TUBA 2X2KA 2OLCA 3FLZA 4H1JA 4RWKA 4XG7A 4QMYA 4U3ZA 3UOKA 1J1CA 1U4DA 1V1KA 3PP1A 4RJ4A 5AR2A 2PZPA 2VTNA 4NM3A 1G8AA 4ARKA 3W10A 2XNBA 1YXTA 3E64A 5GJFA 2ZB0A 3E3BX 5FEEA 3B2WA 3M2WA 4PX6A 4RVKA 3AD6A 5FG8A 5KZ0A 4AZEA 1NVQA 4C34A 2P0CA 1XH9A 2IZSA 3FMJA 3QD0A 4FV1A 5IUGA 2YIXA 4WUNA 4WRSA 2VWUA 4EL9A 4Q9ZA 4E4MA 5CASA 2WMBA 3FY2A 2BRHA 4V0GA 5FTOA 3AC8A 5LVNA 3DU8A 4O7LA 2CLQA 2IPXA 3KMMA 5IQCA 2YCQA 2PE2A 5EH0A 4F08A 3P08A 3QD4A 2WMTA 3LLAA 3GCPA 3PA4A 4YLJA 4BTFA 3AD4A 3C5UA 3LW0A 3QC9A 4HGLA 3ODZX 3ZEPA 1OM1A 4KD1A 2NRUA 5ACBC 4WSQA 3BHHA 3ZUTA 3HLLA 5K5XA 4E5AX 4ZLZA 2F7EE 4UMQA 4BGGA 4HNIA 1TVOA 1YXUA 2Z60A 4YBKA 4ASEA 1Q4LA 1ZY5A 4QP3A 2I0YA 3QX4A 4DG2E 3HMNA 4ORKA 2GS2A 2QOQA 3D83A 4RFMA 2VV9A 4U44A 4HVIA 5M44A 5A4QA 3U55A 3AD5A 2UW7A 3C4CA 5BX0A 3CQUA 3MTLA 3ORIA 3DQWA 1RW8A 2UZLA 4QYYA 3NIZA 5EFQA 3SQQA 4IVDA 5E1SA 2W0JA 5G1XA 2C6IA 1J7LA 3QTWA 4AS0A 3FLYA 3DFCB 4IM2A 2C6KA 3MJ2A 3F82A 1RQQA 3TNQB 5IA0A 3PXKA 2YM6A 4U0IA 4L3LA 2IVSA 4ASXA 2HK5A 2HYYA 3Q32A 2Z2WA 2XK3A 3BQCA 4A9SA 3IG7A 3DCVA 1BYGA 4RC2A 5DT3A 3UC3A 3K54A 3K5UA 2WPAA 2CN5A 4M67A 4JDKA 2XP2A 3AC5A 2WEVA 5HBHA 4FV8A 4EOOA 2R3QA 3TTIA 4OTIA 3VULA 3UIBA 4ACCA 3PVUA 2FSOX 4I6HA 4F64A 2A27A 4X0MA 5ANOA 3VUHA 4AT5A 4B8MA 4BDBA 2O64A 3S3IA 4KSQA 2BFYA 5TT7A 3ZM9A 4WO5A 4GVJA 3ZH8A 5J8IA 2C6MA 1U54B 3DAKA 3P5KA 4M84A 4MVFA 2NNWB 4O0TA 4BI1A 3DBEA 4K6ZA 4Q5HA 4FZ6A 2P4IA 1OUYA 4KAOA 2C3KA 4RJ8A 4ANLA 4BL1A 5J9YA 3QD2B 4RFYA 5CZHA 2WO6A 5I3OA 1PMVA 4CFMA 1W0XC 4MWIA 3Q96A 4IWOA 5AR7A 5AP2A 4Y46A 2RIOA 5CANA 5HESA 5A6NA 4XLVA 3OF0A 3ZHPC 5B2KA 5CF8A 1ZOGA 3LXLA 3F2NA 3PJCA 2PUPA 3VS2A 1G5SA 3VBVA 4A9TA 3P23A 4C4HA 4GK4A 3CTQA 3EYGA 3VQHA 3SOAA 1OL7A 3CGFA 1B38A 3G6HA 3PA5A 4YJOA 4NU1A 4MHAA 3OCSA 5EI6A 4WBOA 4FGBA 3NNXA 3BHVA 3D5XA 4F65A 5ETIA 1VYZA 4BCQA 4E3CA 4X3FB 3SDJA 3OMVA 5I9YA 4KRDA 2YDIA 4YZNA 4RZWA 4UMTA 4EORA 1H1WA 3UOLA 4C58A 3W33A 2DUVA 5M4FA 4IWQA 4P7EA 4YJVA 3MN3A 4ZJJA 1DAWA 3KF4A 4FV3A 5HCYA 2OFVA 4DBNA 1O9UA 3DBCA 3R71A 4GIHA 3VUIA 2DS1A 1DM2A 3D9VA 4O7ZA 1SNXA 3BHTA 3COIA 4E93A 4FA2A 3CQEA 4RA4A 3ZDIA 4RWLA 4B4LA 5HU3A 3LCTA 4L7SA 5DEWA 1CKJA 3TN8A 4AN3A 4ERWA 4XUFA 4AFJA 3GT8A 2PU8A 3D7ZA 4HVGA 2QLQA 4BBEA 4EOLA 4S33A 1WBWA 3QXOA 2ZV2A 2W4KA 3DT1A 4J99A 5DE2A 2XYUA 3BGPA 3GU5A 2VNYA 4D55A 3IONA 3HKOA 2X7GA 4D1XA 3DJ5A 4UX9A 2WTJA 2WTWA 2ITOA 3GXLA 2FVDA 3TNPC 3G0EA 3JS2A 3FLNC 3VUTA 2XIZA 4EH5A 3DS6A 4ZY4A 1Z9XA 4IJPA 2ESMA 5FUTA 3QKLA 3EL8A 4GT4A 3HA8A 3PXQA 4EOJA 1VYWA 2Q83A 2YJRA 3HP5A 3ANQA 2B1PA 4I21A 1OIYA 4YPDA 5AEPA 4IWPA 3WBLA 5J9LA 2W9ZB 4A4LA 4TT7A 3SG8A 3MVLA 2GFCA 3ZM4A 2XH5A 4PPBA 2B0QA 3VS4A 1PJKA 3WF5A 2OZOA 2W1HA 4IDTA 2UW5A 4PRJA 4C57A 4Y5HA 2VTRA 2Y4IB 1OIQA 3GUBA 3O50A 4OBOA 3EL7A 3OUKA 5JH6A 2R7BA 4AZWA 5AR3A 1I09A 4R8QA 5DH3A 5IA5A 2BVAA 1XH8A 5DN3A 3R28A 3V8TA 3WF8A 5BUJA 5E9EA 2X9FA 1U46A 1YXXA 4L52A 1Z5MA 3KXZA 1YDSE 2EXEA 1H1RA 5A46A 3A7FA 4FEWA 3O71A 4H3QA 4KB8A 5GIOE 5KCVA 3EQPA 4DA5A 2R3IA 1PXLA 3BU5A 5E8TA 4OAUC 2VZ6A 1WCCA 1ZOHA 5CVHA 2IZRA 1P2AA 2JKKA 4D9UA 1GY3A 2OIDA 1DI9A 3JXWA 4ZSGA 1XH7A 2VO0A 1FMKA 1W7HA 3KMWA 5EQEA 3OW4A 4O96A 2GNLA 3R9OA 1Q8ZA 5HD4A 3UNKA 2PVNA 3EN6A 5AV0A 3ZS5A 4EQMA 5AA9A 3W2PA 1E1XA 2OF4A 4GYGA 3C4XA 4FSYA 5AR4A 5GIPE 4ZMEA 4AFEA 2HZ0A 2JEDA 3HMPA 2R3JA 2YA9A 3ORPA 4GL9A 3AMBA 3GU8A 1H26A 5HTIA 3UOHA 4OAVB 1XBAA 2C68A 3PE1A 4JG6A 4ZTMA 2V55A 3UP7A 4G9CA 4K1BA 5J1VA 1OKZA 1T46A 2J2IB 3FAAA 3NAYA 4FNZA 5D41A 3U9CA 5C1QB 3SW7A 5CXHA 4LL5A 5H3QA 4R7HA 1XO2B 2OH0E 4QP4A 4QYEA 4UWYA 1W84A 3OUNB 3QTZA 4AGCA 1SVGA 4RX9A 5L8KA 3TCPA 3KB7A 1KE8A 2ITYA 3Q6UA 4PTEA 3U54A 4FTLA 4FEVA 3RINA 1Y8YA 3ZBFA 2JGZA 5FGKA 3H9OA 3RP9A 2BAQA 3B8QA 5AP6A 3FMDA 2Y4PA 5AUWA 2J6MA 5D12A 4FEXA 4NZWB 5AAFA 3DJ6A 1H4LA 4PY1A 3PIZA 2BAJA 3V5TA 2WGJA 4HW7A 5I3RA 1R78A 4CYIA 3W2OA 3LJ1A 3WZEA 1GIHA 2ZMDA 3KU2A 3ELJA 4O0XA 3HDNA 2BUJA 3BV2A 1UWHA 3R8ZA 4P4CA 4A4OA 3OY3A 3D5WA 4D2PA 1YKRA 2XB7A 2XKCA 5JGDA 4EBWA 5DWRA 2CPKE 4NSTA 2UVXA 4NTTA 3TNHA 3TZ7A 2FSLX 3V5LA 5JK3A 1KE6A 3Q4UA 1KOBA 3QQGA 1PYEA 3BU3A 4O81A 2C0IA 3PWYA 4DCAA 4TRLA 1H28A 4MTAA 3EQBA 4LGGA 1Y91A 3A7GA 3KEXA 1OIUA 3ORNA 4BCOA 2GNHA 3EFWA 3NUYA 4X3FC 3PYYA 2VWXA 2YAAA 1CSNA 1PW2A 3QCXA 4ITJA 4JQ8A 2XK7A 4ITIA 1SVEA 1ZYLA 3NLBA 2NRYA 3VQUA 2ETKA 2VTLA 3W2QA 1SYKA 4TTHB 4EOMA 2XNOA 3RVGA 3G33A 3UIXA 4O7NA 3IW4A 4CYJA 3ZXTA 5BVDA 4I5CA 4USFA 3P0MA 3TDVA 1AGWA 2VTOA 2RFEA 5A4TA 5AUUA 3BV3A 4E4LA 2PUIA 5LMAA 4R7BA 3TI1A 1SVHA 2Z7LA 1QPCA 3W2CA 4FL1A 4GW8A 4W4VA 5CEMA 4PPAA 3QRKA 3DXNA 3LJ2A 4FSQA 2W1FA 5HNIX 4BTMA 2DWBA 2VU3A 3RNYA 1Q97A 2J5FA 3F5PA 1J91A 3HZTA 1MQBA 4YU2A 5L2SA 2R5TA 2OSCA 2J0JA 3V5QA 4U43A 4FNWA 1YXSA 5H9BA 4FKPA 2XK8A 2VGOA 4RJ7A 4E8AA 2OK1A 1DS5A 3UYSA 2G2IA 3OWPA 1WBSA 2YM4A 3ZO1A 4FTTA 5AAGA 2YWPA 2PZ5A 4DEIA 5B2MA 3LPBA 4PF4A 4CVAA 3I0OA 2RFNA 3BYVA 3CD3A 2FSMX 3PXYA 3CQWA 1FMOE 4U40A 5H8BA 4KKEA 3VWAA 1LEZA 4EH7A 5BVFA 4JDIA 1GZNA 2BFXA 2ZB1A 2B7AA 4F70A 3KRJA 4MD9E 4R3PA 3TKHA 4ZSJA 2VTHA 4CTBA 3RPSA 4IZAA 4K9YA 2C5YA 2R3PA 2HZNA 4ZOGA 4FTIA 4E73A 1UNLA 2WQNA 2W05A 4RVTA 2BKZA 1PXPA 2VD5A 2JBPA 3B8RA 3SW4A 4DLJA 5KMNA 5DG5A 5EHYA 2H6DA 3HVCA 4IAZA 4QMSA 2O63A 3ZO4A 5HICA 4EH6A 4AZSA 5HG9A 1R0PA 4FK6A 5K5NA 3P4KA 4RRVA 2CGUA 4NK9A 4DGNA 4M0YA 2Y4IC 3MFSA 4KUJA 2RF9A 5KZIA 5L8LA 2PVKA 3OEZA 4J53A 5JRQA 4O0SA 2PK9A 3E8CA 5LMKA 1YVJA 3ERKA 3G9LX 4IZ5A 1ZXEA 4EJ7A 4LYNA 3UZRA 2C5NA 2PUUA 3KY2A 5L6OA 4O21A 5J7HA 5K0XA 2YABA 2XUUA 3DJ7A 3DPKA 3WZUA 4D0WA 2V7AA 3KN6A 3SXFA 4EK3A 2XIRA 2Y8OA 4GVAA 4TXCA 1ZARA 3GU7A 5D11A 1OL5A 5EYCA 5C8MA 3TIYA 5JMSA 5LXMA 4GKIA 1PF8A 4I0RA 5HG5A 3PSDA 3ID6C 5CSWA 4BDDA 2GNJA 2HWOA 2R3GA 4YSMA 5BVKA 2YERA 2AYPA 2QOFA 4DH1A 2UZDA 4GG7A 4D0XA 1BX6A 3GQLA 5AUTA 5LWNA 2RFDA 3Q60A 5JRSA 2YZLA 1NT2A 3GC0A 2E9VA 3MVMA 3VW8A 4EYJA 3F5GA 3FSKA 5CSHA 4FTUA 4H39A 5KO1A 2OO8X 3W16A 2VWVA 2VTPA 1OB3A 1BUHA 2BILB 4YNEA 4CSVA 3F88A 4BCIA 1R0EA 4AUAA 3RK7A 3BGQA 2RSVA 4GJ2A 3JY0A 4CKIA 1ND4A 4G9RA 4A06A 4BGHA 5AV3A 2WMRA 5C9CA 4AQCA 4D2WA 5HQ0A 2EWAA 3BIZA 4IQ6A 4OTRA 1PMEA 3UIUA 4Y8DA 2KTYA 2W4JA 2C6LA 3QCSA 2ITXA 5AR5A 4J52A 3F3WA 4AGWA 4ZTRA 5G6VA 4EC8A 4F7JA 4WNKA 5E7RA 2VWBA 1U5QA 4F4PA 4RIXA 4DH7A 1M2PA 2PVJA 3FQHA 3RM7A 3GC9A 4PMSA 3L8VA 2JKQA 2C3LA 5HLPA 3RK5A 3W2SA 2R0IA 2QOBA 4ENYA 5JSMA 4XHKB 3NRMA 5JT2A 3TDWA 3W55A 2YCFA 3AC4A 4FGRA 5CNNA 2XK4A 1JNKA 2YHVA 3HP2A 4I1ZA 4MXAA 1Q61A 5CEKA 3LCOA 4QPSA 3HNGA 5BNJA 2QOKA 2GU8A 3LOKA 3HV6A 3HV7A 4V05A 3P86A 5IEYA 3SA0A 2XM9A 5J9ZA 3VUMA 4GH2A 3POZA 4DITA 4XMOA 2PULA 2I0VA 4AU8A 3BBWA 3NPCA 3V8SA 1G3NA 4ZY5A 2J50A 3KN5A 4ANNA 1BLXA 3QHWA 4ANOA 1A9UA 1P5EA 4G34A 3ATTA 3PWDA 4AF3A 2RKUA 4G5PA 5AP4A 5AR8A 5M08A 5J95A 4XG6A 4QP1A 4YJTA 4DH3A 1HCLA 5DMZA 5CEPA 2IJMA 4QMTA 3NGAA 3PJ3A 5DEYA 2GMXA 3FC2A 4FSWA 4MXYA 2IVUA 4RA5A 4XX9A 3S95A 2UW0A 5AV4A 4DEHA 1PHKA 2JDVA 3FMHA 4HYUA 2F9GA 3BHYA 4AZFA 5CWZA 3C51A 3UOJA 4KA3A 2YITA 3GC8A 4RG0A 4A07A 4EI4A 2PSQA 4W4YA 4FT0A 4EONA 1Y8GA 2GQGA 4PNKA 4UMRA 2XJ1A 3II5A 3IW7A 1KV2A 4FSTA 4XYFA 3FPQA 3TV4A 2B9HA 4EZ7A 2FO0A 1VEBA 3KF7A 4DFNA 1UWJA 4YLLA 3FY0A 5FBOA 1K9AA 1KE7A 1MQ4A 2O3PA 4NKAA 3R7EA 4FTCA 4MXXA 1TQIA 4Z3VA 4ZAUA 5EM7A 2VUWA 1JQHA 4BWKA 4EEVA 4OGRA 3TKUA 1OPKA 4YHFA 1BMKA 3MIAA 3ATSA 4QQTA 3IKAA 3QU0A 4QNYA 5KBQA 1IR3A 4FKRA 5HLWA 3EN5A 5AUZA 3SG9A 1OKVA 1WFCA 2C5OA 4NH1A 2I0HA 2ZM4A 4BGQA 4C3RA 2QHNA 3BCEA 5DBXA 3FZPA 4L8MA 2R2PA 3KRXA 4FV0A 5K4IA 4ID7A 3IK3A 5TOZA 3S00A 1ZLTA 2F2CB 4AE9A 5IQDA 1Y6BA 1JKKA 2GPHA 1UVRA 4C0TA 5LCJA 2AC5A 2CGWA 3MPMA 2JITA 4BFMA 4JAIA 4FL3A 3KQ7A 4E6CA 5IG1A 3MH3A 4RIWB 5GNKA 4NKSA 4N0SA 3DXQA 4KS8A 2JDTA 3PPKA 4X21A 5HHWA 2YM5A 4L3JA 3FI3A 5HE3A 3UGCA 5C03A 3AT4A 3BGZA 4DEBA 5B7VA 4H3BA 3NEWA 4U81A 4EHGA 3I4BA 2DYLA 3PY3A 1MUOA 4L67A 5JFSA 3RALA 4IAFA 4F99A 5AP0A 1KE5A 1OIRA 2W06A 3GB2A 2WU6A 2IW9A 3DFAA 2ETMA 5M4IA 4XG4A 5GZ8A 4QNAA 3MIYA 4MCVA 3KCFA 3M42A 4JXFA 1WBVA 4MBLA 2PL0A 5BUEA 1YWNA 2KULA 4C33A 4S34A 4HZSA 3BQRA 2BTRA 5F1ZA 2WIHA 4X2JA 4M13A 4PMTA 4FEUA 4FI1A 3SRVB 3UPXA 1QL6A 1ZZLA 1GOLA 3BU6A 4D58A 4JBOA 4KBCA 1CDKA 3I79A 1ZZ2A 4G3DA 4D5KA 3IDBA 4N6YA 4GKHA 4GFMA 2BCJA 1L8TA 4IB0A 2XYNA 2HXLA 4USDA 5CTPA 4LG4A 3NR9A 4RVLA 1F5QA 2QCSA 2HENA 2QI8A 5BMSA 2W7XA 3OOMA 4O7VA 3MWUA 3U8WA 3ALOA 4JJRA 4F0IA 4YJSA 2X2MA 4Z7GA 2ITWA 4AXAA 2EVAA 3M1SA 2J90A 3QZIA 4C4EA 4BCNA 1W98A 3JPVA 3F5XA 5AMNA 4BI2A 2OGVA 3DLZA 5HIDA 4KABA 2JBOA 1W83A 4ZZOA 2FYSA 2ERZE 1L3RE 5IMXA 2PUNA 3DV3A 4FKUA 4FIJA 4RIYB 5LCKA 5KKRB 5EM5A 3RGFA 5AWMA 3G51A 3COMA 5CI7A 3QRUA 3H0YA 4L6QA 4DFLA 5M57A 4BZNA 4C02A 3E93A 3PJ2A 4XG3A 5L2WA 1TKIA 2XK6A 2QU6A 3F5UA 4FT5A 3HL7A 4KSPA 3QC4A 4HGTA 4Y73A 4GV1A 2ITVA 2NP8A 2BPMA 4MNEB 2IVVA 4G3FA 3PPJA 2X81A 4JL9A 4QMUA 3KK9A 3QLFA 3KREA 3FI2A 3OXZA 3SV0A 4XP3A 3L8PA 1YW2A 2JD5A 3O7LB 4E4NA 4BY9E 1OL6A 3E87A 3EQDA 4CFVA 4OW8A 5D10A 3VS6A 4G5JA 3ETAA 3R8MA 4C4FA 2F57A 1IAHA 4ZTNA 4PWNA 5CVFA 4ZJVA 1XJDA 3SXSA 4OTFA 1XH6A 4W9XA 2XKFA 5HORA 1XKKA 3GEQA 4R5SA 3HECA 5KUPA 4J71A 4TKSA 4BCMA 2CNUA 3MH0A 4AACA 3QTSA 4U80A 4O0WA 5KX8A 5IDPA 2PYWA 3A7IA 3L9LA 3KC3A 2JAMA 3VIDA 3C7QA 4NIFB 2QU5A 3A7HA 3GCVA 4HYSA 4RVMA 4U3YA 4U9AA 2E9OA 2H8HA 4JX3A 5FLFA 4DTKA 4F9BA 2B55A 4L46A 3CIKA 5D7VA 4BTJA 4V01A 3IGGA 1URCA 4ASZA 1M2RA 3FKNA 4USEA 1A48A 3PRIA 5HVKA 3PG1A 4OTQA 5A4EA 4I41A 2WMXA 4DG0E 4I4FA 3R1QA 4J1RA 3O8UA 1YWVA 3QGWA 3OD6X 4Y83A 4AT4A 3K5VA 3EYHA 4CCBA 4JR7A 4BCJA 1M2QA 5FD2A 1GZKA 2UZVA 2XNNA 4FIGA 3ZOSA 4WG4A 4EWQA 3GNIB 4E5BA 2HW7A 3OY1A 3OFMA 4YJPA 5DHJA 3NYVA 3VS7A 3QYZA 2RG6A 4DYMA 4FT7A 4GYIA 4L00A 4TYHA 3QQFA 2BHEA 3QFVA 3OCBA 4M7IA 3VVHA 4NFNA 4AW5A 3QHRA 4G6LA 4EOKA 1BI7A 3NUNA 4O38A 2YEXA 2E9NA 2HOGA 3DKFA 5EW8A 4A9YA 4B0GA 1K2PA 4OT5A 5IEXA 4IDVA 4ZEGA 5A4CA 4XNEA 3O2MA 4EOIA 2QOIA 3NMUF 4IADA 4YJUA 2F7XE 4D28A 4MK0A 3DZOA 5IA4A 4AW0A 4JBVA 1XH4A 5FEQA 5GJGA 3DXPA 2ZDUA 4O1OA 3RM6A 1F0QA 4U42A 4DHFA 3NDMA 2YJSA 3EJ1A 4S32A 3UODA 3G0FA 3FZRA 3R8VA 2WOUA 4BC6A 5M07A 5HO6A 2JKOA 3ZFYA 3AC2A 4BBFA 1LP4A 3GCQA 3AMYA 2YIYA 3UYTA 3ORTA 3E88A 5AIRA 1JVPP 2QOCA 1IG1A 1M7NA 2H96A 5J1WA 1ZYJA 2QR7A 4YMJA 2WTCA 5IH6A 4FV7A 4GMYA 4FTNA 4F7LA 5TF9A 1M14A 2VTQA 2E9PA 4I94A 3PE2A 3PG3A 3A7JA 5AIKA 2CCHA 2BZIB 3WE4A 4RSSA 1PMUA 5EG3A 3A61A 3DZQA 4JDHA 2W1GA 3GENA 2WIPA 4ACMA 5CF6A 4XCUA 4F9CA 4ZP5A 5A4LA 5KMLA 3PIXA 4MYGA 5HG8A 4Z7HA 4G3GA 3E5AA 3GCSA 2C6TA 2WMQA 3PSCA 4BDJA 1AQ1A 5ETAA 4B7TA 1PXJA 3HMOA 5EI2A 4K0YA 4CFNA 2WEIA 3I5NA 2X8DA 5I9ZA 2FA2A 1OPJA 5D1JA 3IQ7A 4J8MA 4RQVA 5CS6A 3R7IA 4RIOA 4UYNA 5LMBA 2IVTA 3CKXA 4IAAA 2XRUA 4FSNA 4FUYA 2HXQA 4I0TA 4Y72A 4BVUA 3FJQE 5AP5A 3BELA 4I6QA 1B6CB 3ROYA 3CD8A 4JDJA 2IW8A 4AA0A 4EYMA 3RK9A 4WG5A 2FUMA 2B9JA 4CFUA 3FI8A 1PXNA 4ACDA 3N4VA 1YOMA 5CY3A 1OBDA 2ZJWA 3FMKA 5GHVA 3T9IA 1H1QA 1YI6A 5IQEA 2QVSE 5CAVA 3NW7A 4X6RA 3FYJX 4TNBA 4XJ0A 4M69A 5KKRC 2R4BA 3RI1A 2OZAB 3PLAE 2IWIA 3VUGA 3EZRA 4JVGA 2C5XA 3ZO3A 3TXOA 3O17A 2BALA 4FC0A 3H10A 1JKLA 2PVFA 1GZOA 3D94A 4N4SA 4WA9A 4QTCA 4IX5A 1UKIA 3IPHA 2GFSA 4TYEA 1FVRA 2GNFA 3GQIA 1JLUE 4C4IA 4EKKA 2PMLX 1GIJA 3EOCA 3D2KA 4CEGA 3GOKA 4GS6A 4JRVA 4BRXA 2A4LA 4ZZNA 5EKOA 1PKDA 4DT8A 2DQ7X 2ETRA 3I7CA 3FZOA 4L42A 2GCDA 2XNGA 4O27B 4LOQA 2BAKA 4ANMA 3ACJA 1Z57A 3MFUA 4IVBA 1QMZA 4F6SA 4H36A 3QXPA 4ZZMA 1ERKA 4QP9A 3FHIA 3FZ1A 3HAMA 5C4KA 3E7VA 3WE8A 5DYJA 1R3CA 2VO7A 3SC1A 4MXCA 3W8LA 4BF2A 3E62A 3NYOA 1FOTA 1FPUA 2WQOA 4I23A 4O7TA 3FZTA 4U6RA 3RZFA 4DLIA 5ETCA 1FBNA 2OIQA 4AZVA 4EH2A 2WMVA 3MB7A 3TJDA 1PMNA 2X0GA 4IB5A 4M14A 4C59A 3QA8A 3UQCA 2I40A 3T8OA 3P1AA 5KBRA 3TEIA 2QONA 5IQBA 3I7BA 3EKKA 4XP2A 4GIIA 1OKWA 4IVAA 2BDFA 3ZLYA 4JT3A 4RZVA 5ICPA 3E63A 4FKIA 3CSVA 1WAKA 5CVGA 3DOGA 1Y57A 5H2UA 4O7WA 1M17A 2PMNX 4D2SA 4HGEA 5JGAA 5AM6A 4BYJA 4YURA 2UZEA 3AMAA 2X4FA 3F69A 4FIHA 4JS8A 3TUCA 2BZKB 5EYKA 5L2IA 4M97A 1UU7A 2CDZA 1UU9A 4DFBA 3IOPA 1YHSA 3PA3A 2P2IA 4XBUA 5EHLA 3R7UA 4F6UA 5IUHA 3MVJA 1H8FA 3RAIA 3ACKA 2WHBA 2J0KA 3FMMA 4NM0A 3JVRA 4QTEA 3EFJA 3FQSA 3S4QA 5F20A 2VX1A 2YCSA 4FKQA 4BHZA 2XJ0A 1J7UA 1XBCA 4ALWA 4JLCA 4I6FA 4DBXA 2X1NA 1PXKA 3OS3A 4IM3A 4YC6A 4LFIA 3L9PA 5CF5A 2AUHA 3OVVA 4A9RA 5JEBA 4O6LA 4XLIA 3NNWA 4J7BA 2OI4X 1VR2A 4V04A 3L8XA 4FVPA 4EQUA 3EQIA 3MI9A 4ANQA 2JDSA 3LFNA 1UKHA 3C4EA 2J4ZA 3OXTA 2RL5A 3EFLA 3HDMA 4FKJA 4RWJA 4TWNA 2OF2A 3WYXA 5IQHA 1FGIA 3N9XA 4G2FA 2F7ZE 3DNEA 2HWPA 3RAKA 5AX3A 2C3JA 2EB2A 3OWJA 2UUEA 3IOKA 3LCDA 1KUTA 4XEYA 4JG8A 1YHVA 3VO3A 2X6EA 2BIKB 4KBAA 3QZHA 3TZMA 4E26A 4B9DA 4CQEA 3R01A 5D7AA 5HVYA 4YHTA 4ALVA 5E8XA 2EUFB 4LQMA 2ZV8A 2B53A 4JR3A 3ZBXA 5FTGA 4FNYA 1APME 4X2FA 3SRVA 3JVSA 4QMLA 4U5JA 4C62A 5IU2A 4H05A 4MEDA 3I81A 5IEVA 5HU9A 2BDWA 2ONLC 5IQFA 4IX4A 4LMUA 5CSVA 2ZOQA 2EB3A 3LXPA 3PLSA 4AGUA 4WUAA 1STCE 4IX6A 3DBDA 4UEUA 3KCKA 5BVOA 3UO5A 2HY81 5HEZA 3HMIA 2C6OA 4BDCA 3SGCA 3DQXA 3R73A 2YM7A 2PVRA 5KMKA 3D7TB 4PDOA 5HGIA 2XKDA 4DCEA 4F1MA 4FTMA 4EBVA 1O6LA 1EH4A 3BYOA 2QURA 2C0OA 3NIEA 4LV8A 3HRBA 4QTAA 5E1EA 3VN9A 3OW3A 1FVVA 3FXZA 5M51A 3GGFA 4WNMA 4YGAA 3C0IA 3MPTA 4FZFB 3R7OA 3LMHA 3IW5A 2UZWE 5KMJA 4WIHA 3CKWA 1ZMVA 5M4UA 3OWLA 3GCUA 3KRWA 2O0UA 3G90X 2C6DA 4PQNA 3V3VA 4DN5A 1QPDA 3KVWA 4BTKA 4I5HA 2Y9QA 4QTBA 1UA2A 2O65A 4GUBA 5B2LA 2JDRA 3HYHA 5I5ZA 4BZDA 2ZM1A 3UQGA 4C2VA 5DR6A 4D4YA 4W8EA 3TTJA 4TNDA 5DFPA 4D4VA 4UZHA 5E91A 2YACA 4JBQA 3WF9A 2YM8A 2WQEA 5BYYA 3R00A 5HTBA 3Q04A 4CG9A 3KGAA 4ZIMA 3MGYA 4M12A 2FSTX 2V0DA 4H3PA 4EK4A 3CPBA 4U45A 2XCHA 1O6YA 2Y6MA 2WQBA 3Q4TA 5EW9A 2JKMA 4DAWA 3OT3A 3WIKA 4BDHA 4NIFA 3RPVA 3L9NA 3QKMA 2OU7A 3W1FA 4XH6A 4C3PA 4IJ9A 5CNOA 2QOOA 3D4QA 3R7VA 2JLDA 3DDPA 1NA7A 4O1PA 2B4SB 5F94A 5FM3A 4NCTC 3R6XA 4W8DA 4QTDA 3GI3A 3MPAA 4K33A 5GINE 1U5RA 2F49A 3DY7A 4CKJA 3V8WA 3DBFA 4FVQA 4G31A 4EZ3A 4UMPA 4QP8A 2XS0A 1S9JA 2XCKA 3A62A 4E6DA 1QCFA 2C30A 1SMHA 3KRRA 1UU3A 3EQRA 3R8PA 3G6GA 3C4ZA 3P78A 1QPEA 4KWPA 5E8ZA 2C47A 3BWJA 2GHLA 2W1ZA 3LQ8A 3QAME 5CYIA 3V5JA 4BBMA 4RFZA 2PZYA 1V0PA 4IZ7A 2QG7A 4TWCA 2BRGA 3BYMA 3A99A 3DK7A 3F3TA 4HZRA 3PIYA 4QMPA 5DPVA 3SKCA 1Q99A 1UNGA 4FKTA 1H1PA 3MA6A 4FVRA 3RAHA 2P55A 3F2AA 4QO9A 3VBYA 4P5ZA 5FM2A 3VRZA 5DRBA 2QQ7A 3BPRA 3ZU7A 4ZLYA 3QL8A 4IB3A 4XV9A 3LM0A 4O83A 5J5TA 4ZS0A 3FQEA 3MH2A 4FV2A 1YXVA 3LZBA 3EB0A 3P7BA 4C3FA 3LMIA 5CQUA 2PVMA 4CT2A 4P2KA 5KNJA 4FKLA 3FC1X 4TWOA 4FV5A 1U54A 5LVLA 4YJNA 4JOAA 2OJFE 2PVLA 4OUCA 3PRFA 3OXIA 2JFMA 3QCQA 4F09A 2UZNA 1UU8A 3UBDA 3RHXA 3OOGA 3VUDA 5HO8A 4EK5A 5CZIA 4NW6A 4FSMA 4UZDA 3DAEA 4HYIA 2J0MB 2R3RA 4MNFA 4NL0A 5CU6A 2JDOA 4DFYA 4CMTA 2XMYA 3BZ3A 2YIWA 4L01A 3CPCA 5HX8A 4W4WA 4PDYA 2BZJA 3A4OX 3EQFA 3IW8A 4FG7A 3D0EA 3LAUA 5CEIA 3E8NA 2ONLA 3AQVA 5JFWA 3UO6A 3I6WA 2W1EA 1PXMA 5HG7A 4O0VA 4G3EA 4XG2A 5DA3A 3R2YA 1ATPE 4HNFA 4AOIA 4EHZA 4E1ZA 3MTFA 5CU3A 4F9YA 4JBPA 3U6HA 5IPJA 2NPQA 3U6IA 3WZDA 4RMZA 1FINA 2P33A 5I9WA 4I93A 4X3FA 4NJDA 4XP0A 4ASDA 4YO6A 4C8BA 3HA6A 3U87A 2IG7A 4HCVA 4QMOA 4WNPA 3ANRA 4E20A 5IH4A 4ZSEA 4WOVA 3LHJA 1R39A 3I0QA 2VRXA 4II5A 3VRYA 1XQZA 2WMWA 4QYHA 2HZ4A 4G6NA 4CKRA 4KIOA 3BE9A 4CQGA 3FWQA 5HI2A 4MKCA 4L44A 5E8SA 2B52A 4DGMA 4ZTLA 3FXXA 5DGZA 1E9HA 4O86A 3IO7A 2OBJA 3LJ0A 5E8WA 3VS5A 4BDIA 2R3FA 5L4QA 4UXLA 4YTIA 4ZK5A 2R64A 4CZYB 4EZ5A 3L8SA 3UP2A 2ZV7A 2ACXA 3EIDA 1Q8UA 4MD7E 5AUVA 1XHAA 4BDAA 2BZHB 4DFZE 1MP8A 5CQWA 4HJOA 3C5IA 3QQUA 3BE2A 5TO8A 2CN8A 4CFWA 4CV9A 4D9TA 4RWIA 3QQHA 1ZYDA 3ZZEA 3BHUA 1URWA 3ALNA 4F1OA 2YCRA 2FB8A 3KK8A 3DK6A 4L9IA 3ET7A 5EK7A 5F95A 5M06A 2ITQA 3QRIA 2J5EA 4JRNA 2BRBA 4TWPA 1BI8A 3Q2MA 3NAXA 4YZMA 4QMXA 5CAPA 5BPYA 3QTQA 4P5QA 4B99A 2PY3A 3BRBA 4MH7A 3UE4A 3JYAA 3ODYX 3RBWA 5DR9A 3Q3BA 1KOAA 3CJGA 3MV5A 2RFSA 4PV0A 5E8YA 3UNJA 5CX9A 3G9NA 5GJDA 2BDJA 3KL8A 5CU2A 4NCTA 3E7OA 2Y6OA 3E92A 3OG7A 4I92A 4KKHA 4MWHA 3QBNA 5KHXA 2CGVA 4IW0A 4Z9LA 3R30A 1OUKA 4IZYA 3MJ1A 3MY5A 1Q5KA 4ZJIA 4BI0A 2CJMA 3D15A 4HOKA 4J98A 3LQ5A 2REIA 1R1WA 3TG1A 2QKWB 3RNIA 3LMGA 2GQSA 4IAIA 2CLXA 4FR4A 4RLLA 4A4XA 2WFYA 4DEEA 3DB8A 3D2IA 3MY1A 2CHLA 4X7QA 2H9VA 3LFFA 3PUPA 5ANKA 4FX3A 5JQ8A 1ZAOA 3QTRA 5IA2A 4ANSA 2QKRA 4IFGA 1WZYA 4AA4A 1Q3DA 2H34A 4MF1A 5E4HA 1VJYA 2OWBA 5ANIA 4F7SA 3UZTA 3UPZA 3Q4CA 3N51A 4O6EA 2QOHA 2G9XA 3CE3A 3ZFXA 4CTCA 1CKIA 4DTAA 1RJBA 1DAYA 2W1CA 2ZAZA 3BLRA 4MXZA 4C38A 4FICA 4D1ZA 5J5SA 1GZ8A 3ITZA 3PDTA 3KMUA 4O7YA 4PPCA 4G16A 1WBNA 5FXSA 3HAVA 1Q24A 3LCKA 2YLFA 4FIIA 4LV5A 3EQCA 3ZYAA 4DEDA 3ZZWA 2P3GX 2G01A 3ZSGA 3I6UA 5ANJA 5DOSA 2PMIA 4S31A 3WZJA 2ZMCA 2AC3A 1W8CA 2VO6A 5C27A 3VBQA 1JSUA 4QMZA 2UZOA 4B8LA 5HO7A 2XZSA 4RLKA 4NJ3A 1X8BA 4TZRA 3NS9A 1H24A 4MF0A 3VF9A 3I60A 4LUDA 3FV8A 4IM0A 4EH8A 5BVWA 5FWKK 3RTPA 4EK6A 4BKJA 3RWPA 3EHAA 5IH5A 2R3MA 3OZ6A 4CFXA 1ZYSA 5AADA 1JKTA 2EXMA 4RC4A 5CLPA 5EDRA 3IDPA 3PTGA 3UVPA 4FTKA 5K0KA 3GFEA 2Z7RA 4JAJA 4EH9A 4I24A 4E6QA 5CT7A 5M53A 3ULIA 2R9SA 2C4GA 3MFTA 3O96A 5DR2A 2W5BA 2VTJA 4W9WA 2ZVAA 4U79A 3TV6A 2OW3A 4XRJA 5JN2A 4AW2A 1IEPA 3NYXA 4EQCA 1K3AA 3AC3A 2PPQA 5I4NA 3UNZA 2XEYA 4Q2AA 5IQAA 3CTJA 4MXOA 5FRIA 4DEGA 4IH8A 1H25A 2GNIA 3O51A 1NW1A 2OICA 1JSVA 2HZIA 4NWMA 4D4RA 4BWXA 4KKGA 2CMWA 4BDGA 3ORXA 4ZXTA 2B9IA 3ENHA 3D7TA 5DRDA 3U51A 4ENXA 4FEQA 2OJGA 2BIYA 4BHNA 5AV1A 2QNJA 4ZSLA 3F7WA 3A8WA 5LVOA 3VF8A 1LEWA 4IVCA 1NVSA 4XV2A 5H8EA 4I5PA 4BR3A 2XIXA 3OROA 5CSXA 3UIMA 4ZMFA 4CCUA 2XNEA 4IB1A 2X7FA 3IDCA 2C69A 4ERKA 2GQRA 5A54A 5JFXA 4I0SA 3O8TA 3LLTA 2CKQA 3GOPA 4Y95A 3F3VA 4E6AA 4M66A 5KMMA 3W32A 4G17A 5IA1A 1RE8A 1CMKE 3PXZA 2VTIA 3LIJA 5ANGA 4BCKA 1Q8WA 1ZOEA 4EHEA 5C8KA 2W4OA 3T3VA 3KXMA 3FKOA 2WNTA 3VAPA 3E8DA 5HNGA 4K18A 2YN8A 3R2BA 3RWQA 1OL1A 5F9EA 4FG8A 4FIFA 4WT6A 4PNIA 3SVVA 2VGPA 3CEKA 2XBJA 3ENMA 1JAMA 1NY3A 4CNHA 3FKLA 1MRVA 5L2TA 3H3CA 2BR1A 5DIAA 4CG8A 1YI3A 3V51A 2QODA 5CAUA 2OKRA 3MSSA 4ALUA 4KIKB 4D1SA 4XS2A 1HOWA 4UB7A 5TE0A 2P2HA 4NUSA 4C2WA 3QX2A 1XH5A 3QLGA 4EKLA 3L9MA 4YC3A 1Q41A 5CAQA 3HV3A 4FF8A 1S9IA 4LGHA 4YP8A 4BIEA 5CAOA 4GU9A 5ACKA 3PPZA 2GTNA 4WNOA 3ZUUA 4RX7A 3ZCLA 4I4EA 2XNPA 4DINA 4EWHA 2CKPA 4YJRA 4S2ZA 1HCKA 3GFWA 5I9UA 4L45A 2IZTA 4EHVA 2J0IA 3BLQA 2CSNA 4E4XA 3DGKA 5BQ0A 4R1VA 4DT9A 2I0EA 3ZRLA 4G3CA 4YUQA 3ZEWA 4YPSA 5A6OA 5KMIA 4IHPA 4GFOA 4U41A 3VBWA 2QC6A 3E3PA 3QTIA 4YZDA 3PXFA 4WSYA 2QLUA 1IA8A 3PSBA 2V62A 4BDFA 2O8YA 3NUUA 5CEQA 5EKNA 5FDPA 3QZFA 5I0BA 5BYLA 4L7FA 2YDJA 5FP6A 3RCJA 3OBGA 2XEZA 2X8IA 4FZAB 2R3KA 2W1DA 3QQJA 4JX7A 3VW6A 4DFXE 3KXXA 1WVWA 3BKBA 3KA0A 4AA5A 4EC9A 3ZC5A 2WD1A 3LQ3A 4FE2A 3R0TA 3R63A 3VNTA 5K3YA 3CJFA 3SLSA 1IAJA 1YQJA 4JQ7A 1XWSA 3SXRA 4OTHA 4QMMA 4APCA 3VC4A 3EH9A 2HW6A 5EYDA 2X39A 4N57A 3WYYA 5IF1A 5FP5A 4PP9A 4QP7A 2BTSA 3PZEA 2VX0A 3Q9YA 4AAAA 4ONAA 2VWYA 3OP5A 4I20A 4PUZA 4C7TA 3VJOA 2I6LA 4JQEA 3CCNA 3RPOA 4CD0A 3PZHA 4QPMA 2GSFA 2RG5A 5DLSA 1J3HA 3QRJA 4ZTSA 4DFUA 2A0CX 2J51A 3WIGA 3F6XA 2UV2A 4AWIA 4QMQA 3ORMA 2WZJA 1W82A 1ZRZA 3ZC6A 4I6BA 4Y5QA 1I44A 2W1IA 3FLQA 3IS5A 4QT1A 4X2GA 3KXGA 4D2VA 2G2FA 3Q2JA 2VO3A 4YZ9A 3R7YA 2BRMA 3GU6A 2WMUA 3LVPA 4K11A 4TY1A 4UN0C 2YZAA 4IMYA 1G8SA 2Z7SA 4UWBA 2GTMA 2IN6A 3RPYA 3F3UA 4BCPA 1LPUA 4OTPA 4NM5A 4RIXB 3TT0A 2ITZA 4ITHA 4WG3A 5J87A 3AG9A 3ZRMA 3EFKA 3QA0A 4QQ5A 2WTKB 3OC1A 3QKKA 3UVQA 2QO7A 4L3PA 4FTOA 3C1XA 4B6LA 4RX5A 4Z55A 3H0ZA 4CLJA 3C9WA 4QP6A 2C5VA 3CGOA 1ZYCA 2UZUE 3RHKA 4FYOA 4EUTA 2XNMA 5L6WL 3ZLWA 1NXKA 1RDQE 4M0ZA 4F9WA 3R04A 4BYIA 1OKYA 3FUPA 3WI6A 5HLNA 4RX8A 5EM8A 2XVDA 5C26A 3MFRA 3CP9A 4LUEA 5EYMA 5GZAA 3MS9A 4WBBB 5IDNA 4WD5A 1LUFA 3NCZA 3P7CA 3NNUA 4JG7A 4LL0A 3LFDA 1O6KA 4M68A 4C61A 4F63A 2QO2A 3Q6WA 1P14A 2WTVA 5K4JA 1M7QA 3UVRA 5I9XA 1JOWB 4O7RA 3IGOA 4OLIA 2YWVA 3UG2A 2GHMA 3CLYA 1SNUA 2C0TA 3DAJA 3LE6A 5HKMA 3TKIA 2JIIA 3KVXA 4R1YA 4DH8A 2XKEA 4DF3A 2OFUA 3AGMA 3T3UA 5AA8A 5HE2A 3TNIA 3LKMA 1SM2A 3IECA 3KXNA 4CRSA 2VTSA 4CZUA 4QMNA 3AT2A 3KRLA 4O0YA 4PL3A 3ZDUA 3FE3A 3Q9XA 1NVRA 3QUEA 2UW4A 3Q4ZA 3GP0A 2PTKA 1MRYA 5JZNA 4FKWA 1SZMA 2CCIA 2OJ9A 3OT8A 2YIQA 3FL4A 4EOSA 4G1WA 3D5UA 2X9EA 3HX4A 3KKVA 4DG3E 3IW6A 4O2ZA 2J7TA 3CC6A 5LVMA 3C50A 3HEGA 4NM7A 3RAWA 4DE4A 4KINA 5FXRA 3D5VA 4TPTA 2OG8A 4ZTQA 1JKSA 3W2RA 2NO3A 4MQ1A 5IZFA 5KMOA 4OTDA 4BCHA 3TUDA 2WOTA 1P4OA 4OT6A 4QPAA 4WRGA 3UZPA 2F4JA 4RJ3A 4EH3A 5CU0A 3U4WA 4XRLA 3UC4A 2QD9A 3FZSA 4FKVA 5CXZA 1T45A 2R3OA 3BI6A 3F7ZA 3LM5A 5L2QA 4R3CA 4YNOA 2SRCA 3GBZA 2XA4A 2ZV9A 2UW9A 2O5KA 2X6DA 4Q5EA 1TQPA 2WB8A 4XOYA 4DEAA 4RPVA 3R83A 5LARA 4TN6A 2LAVA 3HRCA 3O7LD 1OVEA 3AXWA 2HIWA 4RIWA 4GG5A 4W4XA 3UMXA 1PXIA 4DGOA 4L68A 5CSPA 5JZJA 4LOOA 5T68A 1OITA 4MAOA 5EQYA 3SD0A 4YLKA 2WTIA 4FZ7A 5K9IA 3MY0A 4MBJA 3HV4A 4EH4A 3ZRKA 4R5YA 3ROCA 3O8PA 1H0VA 1REKA 3NW5A 4D4SA 4CMUA 4JIAA 3U4UA 2HCKA 3WILA 4FG9A 2UVZA 4ACGA 5HZNA 3F3ZA 3G2FA 1OECA 3R9HA 5LMKC 3FEGA 4NT4A 4PTCA 2ITPA 1ZMUA 3V5WA 1KV1A 3UG1A 3G15A
chains in the Genus database with same CATH superfamily
4HPTE 3R1NA 4PDPA 4ZLOA 1ZMWA 3DK3A 3NUXA 3QWKA 2VAGA 1CKPA 5E90A 4HVSA 1OGYA 3K3IA 5M56A 4Y85A 2BKKA 2XALA 2QG5A 5FEDA 3SOCA 5J79A 2V22A 3FLSA 5FBNC 4RQKA 1UV5A 3CR0A 4IEBA 3ZUVA 3MYGA 4C4JA 5CALA 2UW6A 4AW1A 4IWDA 4R6VA 1PRYA 3TMOA 4D2TA 5A3XA 3RMFA 5AUYA 5IKWA 3WOWA 4GT5A 3QZGA 1DI8A 4HVDA 3WF6A 4S30A 2CKEA 1WBPA 3ZMMA 3NFGB 3S1HA 3FMLA 4NYEA 3A60A 3RKBA 4FT9A 5BVEA 3ZFMA 4AX8A 4FUXA 5DT0A 1TQMA 4QYFA 3V6RA 1WBOA 3KULB 5IA3A 3TL8A 5HE0A 4O4CA 5CEOA 4O84A 3ZSIA 3F66A 4J8NA 5JGBA 2JAVA 4IXPA 4BKYA 2BMCA 1Y6AA 2C1AA 3U6JA 1VLRA 4TYGA 1YOLA 3R9NA 3C0GA 4IC8A 3JR1A 3FMEA 4ZSAA 2XIYA 4FMQA 4PTGA 5HCXA 5C8NA 3CBLA 3W0MA 3C4FA 5GZ9A 1M52A 3I1AA 4LMNA 5EI8A 2ZYBA 2LGCA 3R1YA 2OXXA 2W17A 2OIBA 3C4WA 4FV9A 4MD8E 2UVYA 3QALE 5EOBA 4QMWA 4UBAA 3VS3A 3FHRA 2VWIA 3DLSA 4BWPA 1PYXA 4GT3A 4RIYA 2Q0BA 3BLHA 4BICA 2ITTA 4OR5A 1OI9A 4BCFA 4YTCA 3H9RA 4O4EA 4GFGA 2ITUA 3TWJA 4NTSA 2Z7QA 4NFMA 2WTKC 4TYIA 2JIVA 3DKOA 1P4FA 2UW3A 5DT4A 1FGKA 2QOLA 4UXQA 4UV0A 3MESA 3RZBA 4FOCA 4AG8A 3H4JA 4MNEA 4AN2A 2EU9A 3LFAA 3OTVA 3BYUA 3BEAA 4HPUE 4MBIA 2JC6A 2OJJA 3LFCA 3R02A 1VZOA 4YTFA 3V01A 5EM6A 4BCGA 5JFVA 3ML1A 3FL5A 3P7AA 5LWMA 3EN7A 2R3NA 3QF9A 3R7GA 4DH5A 5HE1A 2PMOX 3CTHA 4ZTHA 5DI1A 3TJCA 4R3RA 1H1SA 4BDEA 4CRLA 2IW6A 3LFSA 4LRJA 2YM3A 4AP7A 3UO4A 4FTQA 5D9HA 1YWRA 4FV6A 4BB4A 2I1MA 4GK3A 5HBEA 3TNWA 4R7IA 2W5HA 3R8LA 4A9UA 3DDQA 3UDBA 2G1TA 5EHOA 2VTTA 4KS7A 4V0GB 3M11A 4ACHA 4IANA 4CLIA 4CT1A 5JQ5A 4QMVA 4UWCA 5EDQA 4FBXA 4QQJA 4H58A 2F2UA 1OPLA 3LXKA 4KIKA 4RJ5A 4D5HA 2OJIA 3L1SA 2EXCX 3P9JA 5HCZA 4LOPA 2WXVA 3LCSA 3R8UA 4AN9A 2UW8A 2XM8A 3DA6A 3R21A 1OZ1A 3HV5A 4FZDB 2QR8A 5IMEA 3PVGA 4RC3A 1IRKA 4M3QA 4EUUA 4XV1A 5CI6A 2C1BA 1GIIA 2CGXA 3POOA 4IBMA 3COHA 1CM8A 4X2NA 3REPA 4AZTA 5HIEA 1PY5A 3TV7A 3UJGA 5HTCA 4FV4A 1JPAA 1QPJA 4H1MA 3QQKA 2Y0AA 3R9DA 2X8EA 1ZWSA 1OL2A 4YC8A 5LOHA 4AGDA 4M8TA 1F3MC 4XG9A 5BUIA 3AC1A 4ZS4A 2E9UA 2OH4A 4XOZA 4FJVA 4G6OA 3KIOC 1E1VA 3THBA 1LR4A 4OBQA 1BKXA 2O2UA 4KNBA 5CU4A 3K2LA 5KE0A 3VS1A 4FNXA 4I3ZA 4EOQA 2FH9A 2IZUA 3MDYA 4TYHB 3KFAA 4NW5A 3TZ9A 4FTRA 3Q53A 4FL2A 4J95A 4QP2A 1V0OA 4QD6A 3V04A 5BYZA 3A2CA 1H27A 2YLEA 4LGDA 3LFQA 4O91A 4X6QC 3ZLXA 2XBAA 5AP1A 5ETFA 4BZOA 4F0FA 4IAYA 3CY2A 4FKOA 3NNVA 4YHJA 4FOBA 3VHEA 3QUPA 4RJ6A 3QTXA 2BHHA 2XK9A 3AOXA 4LM5A 5TKDA 5M4CA 2PE0A 4QOXA 3NUPA 4AT3A 2CKOA 2W9FB 1IASA 1Q8TA 4L43A 4OBPA 3NWWA 3ZLSA 3BL7A 2PWLA 4UYAA 5HIBA 4FSRA 4QYGA 4JIKA 4N6ZA 3PUFC 3P79A 2XIKA 2B9FA 3BEGA 3OCTA 5ANEA 5M55A 4RT7A 5CENA 3WARA 5ITAA 5C4LA 2A19B 2IEWA 4IAKA 2W99B 5AP7A 1PXOA 3EN9A 4JNWA 5AP3A 3NX8A 2VTAA 3SAYA 3EWHA 4FKGA 3Q5ZA 3QUDA 1Q62A 3T9TA 3UQFA 1KWPA 4M15A 3ZXZA 1OGUA 4UMUA 2UZTA 2BROA 4TYJA 3MVHA 2G15A 1YDRE 5T3QA 1JWHA 1Q8YA 2JFLA 3K3JA 3NUSA 3O0GA 4YSJA 4DGGA 3EQHA 2WAJA 3GU4A 3RPRA 4YO4A 3Q5IA 4PMPA 4CV8A 5LVPA 3HGKA 4QRCA 2CNVA 3QD3A 1KSWA 2WMAA 5HNBA 3ZTXA 4CFFA 3A8XA 3FPMA 1IA9A 3OHTA 2WQMA 3EKNA 4X2KA 4EK8A 5EQPA 4AE6A 3BLAA 4GU6A 3UMWA 4DTBA 3C0HA 2VN9A 3DTCA 3MA3A 4J96A 1OBGA 1MRUA 3COKA 3DB6A 3WZKA 4GSBA 4LRMA 2E2BA 3PY1A 4AOTA 2OZAA 2WU7A 5CF4A 4CGAA 2ITNA 2PVHA 4EOPA 2YIRA 2V7OA 1YOJA 3GVUA 4GJ3A 5BMMA 4EJNA 1H00A 5HVJA 3DBQA 2VWWA 3OCGA 4JI9A 3SX9A 4Z16A 2PVYA 5AV2A 2XF0A 4M69B 3S2PA 5HBJA 1GAGA 3CY3A 3JUHA 2X2LA 4WHZA 1XBBA 4R78A 4OTGA 3N4UA 3UTOA 2HELA 3V6SA 4FTJA 2BRNA 3E8EA 4U8ZA 4DGLC 5CT0A 4O22A 2X4ZA 4KIPA 2Y7JA 5E92A 3ULZA 4FIEA 4PP7A 1KE9A 5F4NA 5FDXA 5B0XA 5E8VA 4C36A 3PP0A 2ZDTA 2GDOA 1A06A 3RCDA 3FMNA 3FYKX 1ZY4A 4UALA 4MQ2A 5LQFA 1UNHA 4YTHA 4YZCA 4F9AA 3VS0A 2WKMA 4UY9A 2PE1A 3ORKA 2R3HA 3PJ8A 3S0OA 1BL6A 4D2RA 3NZ0A 4QQCA 2C3IB 4GCJA 2PHKA 3OEFX 3VHKA 4LRKA 3BX5A 5EW3A 5TR6A 3VJNA 2GS7A 4A7CA 3GC7A 2J0LA 2W5AA 1H01A 3EZVA 4NEUA 3AT3A 4J97A 4GRBA 3ZSHA 2Q0NA 5IQGA 3Q9WA 4FT3A 4F6WA 3OWKA 4PL4A 2Z8CA 4ZY6A 2OXDA 4YR8A 3DTWA 3D14A 3LFEA 3QQLA 4IACA 4CMOA 2GHGA 5AUXA 4FSUA 4HCUA 5FQDC 5H8GA 2Z02A 3Q9ZA 4RGJA 3N4TA 3LXNA 2X7OA 3W8QA 4F7NA 2HY0A 4DC2A 2YISA 4KBKA 4I5MA 3QGYA 2I7QA 3QWJA 3DKGA 4K8AA 2CNQA 1GJOA 2UZBA 4GK2A 1WMKA 3FDNA 3AGLA 2IO6A 3HUCA 4GUEA 4BN1A 5IISA 3B2TA 3HMMA 5J7BA 3NVMB 4CZTA 3TIZA 3WF7A 4I22A 1OMWA 4K77A 4PDSA 4PMMA 4C35A 2QHMA 1H0WA 1CTPE 4XG8A 1GNGA 5FTQA 2G2HA 3R1SA 4O7SA 4Q9SA 5IQIA 3EN4A 4QEBA 3VBXA 2C6EA 2R0UA 5L8JA 3KXHA 1Q3WA 2XRWA 4YBJA 2ERKA 3JY9A 3QTUA 3ZO2A 4ANBA 2X0PA 3DKCA 1JSTA 5KHWA 3I5ZA 4XBRA 4F0GA 3HUBA 2W96B 3NCGA 2A1AB 5A9UA 3TACA 4YZBA 3OBJA 3VBTA 3PJ1A 3FBVA 3O23A 4BIBA 4BKZA 5BVNA 3R9RA 2A2AA 2XJ2A 1YI4A 3NUAA 2J9MA 4GEOA 3BBTB 2RGPA 4LI5A 2GS6A 1WBTA 2GNGA 4TL0A 3ORLA 3PVBA 4HCTA 4YJQA 4E7WA 4AXCA 3PFQA 3G5DA 5T6KA 4WKQA 5HOAA 5EOLA 5IUIA 1J1BA 5AX9A 3VUKA 3EQGA 5LJJA 4IC7A 1FQ1B 5AFVA 3OTUA 1REJA 3EMGA 3V5PA 4TW9A 5C01A 3NVKI 5AAEA 1V0BA 3TZ8A 2HAKA 3KULA 3PVWA 1U59A 5E8UA 2YFXA 2PZRA 3MBLA 4X3JA 4F1TA 2R3LA 1YDTE 2WELA 2WMSA 4APPA 5JKGA 4KRCA 3H9FA 4KIQA 5DNRA 2QO9A 3BWFA 3LFBA 5DVRA 4FYNA 3W18A 2YDKA 3CS9A 2ZM3A 3ORZA 3CXWA 4PL5A 2VNWA 3QCYA 3R22A 4P90A 5AJQA 4BDKA 4HVHA 4O82A 1YHWA 1FVTA 3F9NA 3FI4A 4IIRA 3NW6A 3TM0A 2B54A 3ZONA 4CXAA 3FXWA 1PKGA 3FLWA 4E5WA 2YAKA 3H30A 5AM7A 5ANDA 5FXQA 4BIDA 1WVXA 4C37A 3Q52A 4O0UA 2PZIA 2OXYA 4RBLA 3DNDA 3PY0A 4C4GA 4U7ZA 3MB6A 4AXDA 4IE9A 4MX9A 3F61A 3QYWA 4FTAA 5EDPA 1WVYA 3A4PA 1JBPE 1B39A 3BYSA 3HRFA 2V5QA 1AD5A 2VTMA 2JIUA 4XV3A 5A14A 1H08A 4K2RA 1BL7A 1J7IA 2R7IA 3U9NA 3NYNA 2VX3A 4O0RA 3W0PA 4FODA 5L6PA 1YRPA 5HD7A 5M09A 3C13A 4N70A 4OTWA 3MW1A 4FKSA 5L3AA 3PXRA 3NSZA 4FSZA 1XR1A 2FGIA 4L53A 3RJCA 4AOJA 5I9VA 1H07A 4FK3A 4R77A 2WTDA 4IFCA 4IX3A 4U97A 2VWZA 5HX6A 3SHEA 4O2PA 3F2RA 4HGSA 4HYHA 3QRTA 3FSFA 3MH1A 3TUBA 2X2KA 2OLCA 3FLZA 4H1JA 4RWKA 2XARA 4XG7A 4QMYA 4U3ZA 3UOKA 1J1CA 1U4DA 1V1KA 3PP1A 4RJ4A 5AR2A 2PZPA 2VTNA 4NM3A 1G8AA 4ARKA 3W10A 2XNBA 1YXTA 3E64A 5GJFA 2ZB0A 3E3BX 5FEEA 3B2WA 3M2WA 4PX6A 4RVKA 3AD6A 5FG8A 5KZ0A 4AZEA 1NVQA 4C34A 2P0CA 1XH9A 2IZSA 3FMJA 3QD0A 4FV1A 5IUGA 2YIXA 4WUNA 4WRSA 2VWUA 4EL9A 4Q9ZA 4E4MA 5CASA 2WMBA 3FY2A 2BRHA 4V0GA 5FTOA 3AC8A 5LVNA 3DU8A 4O7LA 2CLQA 2IPXA 3KMMA 5IQCA 2YCQA 2PE2A 5EH0A 4F08A 3P08A 3QD4A 2WMTA 3LLAA 3GCPA 3PA4A 4YLJA 4BTFA 3AD4A 3C5UA 3LW0A 3QC9A 4HGLA 3ODZX 3ZEPA 1OM1A 4KD1A 2NRUA 5ACBC 4WSQA 3BHHA 3ZUTA 3HLLA 5K5XA 4E5AX 4ZLZA 2F7EE 4UMQA 4BGGA 4HNIA 1TVOA 1YXUA 2Z60A 4YBKA 4ASEA 1Q4LA 1ZY5A 4QP3A 2I0YA 3QX4A 4DG2E 3HMNA 4ORKA 2GS2A 2QOQA 3D83A 4RFMA 2VV9A 4U44A 4HVIA 5M44A 5A4QA 3U55A 3AD5A 2UW7A 3C4CA 5BX0A 3CQUA 3MTLA 3ORIA 3DQWA 1RW8A 2UZLA 4QYYA 3NIZA 5EFQA 3SQQA 4IVDA 5E1SA 2W0JA 5G1XA 2C6IA 1J7LA 3QTWA 4AS0A 3FLYA 3DFCB 4IM2A 2C6KA 3MJ2A 3F82A 1RQQA 3TNQB 5IA0A 3PXKA 2YM6A 4U0IA 4L3LA 2IVSA 4ASXA 2HK5A 2HYYA 3Q32A 2Z2WA 2XK3A 3BQCA 4A9SA 3IG7A 3DCVA 1BYGA 4RC2A 5DT3A 3UC3A 3K54A 3K5UA 2WPAA 2CN5A 4M67A 3AKJA 4JDKA 2XP2A 3AC5A 2WEVA 5HBHA 4FV8A 4EOOA 2R3QA 3TTIA 4OTIA 3VULA 3UIBA 4ACCA 3PVUA 2FSOX 4I6HA 4F64A 2A27A 4X0MA 5ANOA 3VUHA 4AT5A 4B8MA 4BDBA 2O64A 3S3IA 4KSQA 2BFYA 5TT7A 3ZM9A 4WO5A 4GVJA 3ZH8A 5J8IA 2C6MA 1U54B 3DAKA 3P5KA 4M84A 4MVFA 2NNWB 4O0TA 4BI1A 3DBEA 4K6ZA 4Q5HA 4FZ6A 2P4IA 1OUYA 4KAOA 2C3KA 4RJ8A 4ANLA 4BL1A 5J9YA 4O4BB 3QD2B 4RFYA 5CZHA 2WO6A 5I3OA 1PMVA 4CFMA 1W0XC 4MWIA 3Q96A 4IWOA 5AR7A 5AP2A 4Y46A 2RIOA 5CANA 5HESA 5A6NA 4XLVA 3OF0A 3ZHPC 5B2KA 5CF8A 1ZOGA 3LXLA 3F2NA 3PJCA 2PUPA 3VS2A 1G5SA 4FRFA 3VBVA 4A9TA 3P23A 4C4HA 4GK4A 3CTQA 3EYGA 3VQHA 3SOAA 1OL7A 3CGFA 1B38A 3G6HA 3PA5A 4YJOA 4NU1A 4MHAA 3OCSA 5EI6A 4WBOA 4FGBA 3NNXA 3BHVA 3D5XA 4F65A 5ETIA 1VYZA 4BCQA 4E3CA 4X3FB 3SDJA 3OMVA 5I9YA 4KRDA 2YDIA 4YZNA 4RZWA 4UMTA 4EORA 1H1WA 3UOLA 4C58A 3W33A 2DUVA 5M4FA 4IWQA 4P7EA 4YJVA 3MN3A 4ZJJA 1DAWA 3KF4A 4FV3A 5HCYA 2OFVA 4DBNA 1O9UA 3DBCA 3R71A 4GIHA 3VUIA 2DS1A 1DM2A 3D9VA 4O7ZA 1SNXA 3BHTA 3COIA 4E93A 4FA2A 3CQEA 4RA4A 3ZDIA 4RWLA 4B4LA 5HU3A 3LCTA 4L7SA 5DEWA 1CKJA 3TN8A 4AN3A 4ERWA 4XUFA 4AFJA 3GT8A 2PU8A 3D7ZA 4HVGA 2QLQA 4BBEA 4EOLA 2XAOA 4S33A 1WBWA 3QXOA 2ZV2A 2W4KA 3DT1A 4J99A 5DE2A 2XYUA 3BGPA 3GU5A 2VNYA 4D55A 3IONA 3HKOA 2X7GA 4D1XA 4DHJA 3DJ5A 4UX9A 2WTJA 2WTWA 2ITOA 3GXLA 2FVDA 3TNPC 3G0EA 3JS2A 3FLNC 3VUTA 2XIZA 4EH5A 3DS6A 4ZY4A 1Z9XA 4IJPA 2ESMA 5FUTA 3QKLA 3EL8A 4GT4A 3HA8A 3PXQA 4EOJA 1VYWA 2Q83A 2YJRA 3HP5A 3ANQA 2B1PA 4I21A 3TYKA 1OIYA 4YPDA 5AEPA 4IWPA 3WBLA 5J9LA 2W9ZB 4A4LA 4TT7A 3SG8A 3MVLA 2GFCA 3ZM4A 2XH5A 4PPBA 2B0QA 3VS4A 1PJKA 3WF5A 2OZOA 2W1HA 4IDTA 2UW5A 4PRJA 4C57A 4Y5HA 2VTRA 2Y4IB 1OIQA 3GUBA 3O50A 4OBOA 3EL7A 3OUKA 5JH6A 2R7BA 4AZWA 5AR3A 1I09A 4R8QA 5DH3A 5IA5A 2BVAA 1XH8A 5DN3A 3R28A 3V8TA 3WF8A 5BUJA 5E9EA 2X9FA 1U46A 1YXXA 4L52A 1Z5MA 3KXZA 1XMLA 1YDSE 2EXEA 1H1RA 5A46A 3A7FA 4FEWA 3O71A 4H3QA 4KB8A 5GIOE 5KCVA 3EQPA 4DA5A 2R3IA 1PXLA 3BU5A 5E8TA 4OAUC 3P5JC 4I6LA 2VZ6A 1WCCA 1ZOHA 3AKLA 5CVHA 2IZRA 1P2AA 2JKKA 4D9UA 1GY3A 2OIDA 1DI9A 3JXWA 4ZSGA 1XH7A 2VO0A 1FMKA 1W7HA 3KMWA 5EQEA 3OW4A 4O96A 3UDTA 2GNLA 3R9OA 1Q8ZA 5HD4A 3UNKA 2PVNA 3EN6A 5AV0A 3ZS5A 4EQMA 5AA9A 3W2PA 1E1XA 2OF4A 4GYGA 3C4XA 4FSYA 5AR4A 5GIPE 4ZMEA 4AFEA 2HZ0A 2JEDA 3HMPA 2R3JA 2YA9A 3ORPA 4GL9A 3AMBA 3GU8A 1H26A 5HTIA 3UOHA 4OAVB 1XBAA 2C68A 3PE1A 4JG6A 4ZTMA 2V55A 3UP7A 4G9CA 4K1BA 5J1VA 1OKZA 1T46A 2J2IB 3FAAA 3NAYA 4FNZA 5D41A 3U9CA 5C1QB 3SW7A 4QDVA 5CXHA 4LL5A 5H3QA 4R7HA 1XO2B 2OH0E 4QP4A 4QYEA 4UWYA 1W84A 3OUNB 3QTZA 4AGCA 1SVGA 4RX9A 5L8KA 3TCPA 3KB7A 1KE8A 2ITYA 3Q6UA 4PTEA 3U54A 4FTLA 4FEVA 3RINA 1Y8YA 3ZBFA 2JGZA 5FGKA 3H9OA 3RP9A 2BAQA 3VONA 3B8QA 5AP6A 3FMDA 2Y4PA 5AUWA 2J6MA 5D12A 4FEXA 4NZWB 5AAFA 3DJ6A 1H4LA 4PY1A 3PIZA 2BAJA 3V5TA 2WGJA 4HW7A 5I3RA 1R78A 4CYIA 3W2OA 3LJ1A 3WZEA 1GIHA 2ZMDA 3KU2A 3ELJA 4O0XA 3HDNA 2BUJA 3BV2A 1UWHA 3R8ZA 4P4CA 4A4OA 3OY3A 3D5WA 4D2PA 1YKRA 2XB7A 2XKCA 5JGDA 4EBWA 5DWRA 2CPKE 4NSTA 2UVXA 4NTTA 3TNHA 3TZ7A 2FSLX 3V5LA 5JK3A 1KE6A 3Q4UA 1KOBA 3QQGA 1PYEA 3BU3A 4O81A 2C0IA 3PWYA 4DCAA 4TRLA 1H28A 4MTAA 3EQBA 4LGGA 1Y91A 3A7GA 3KEXA 1OIUA 3ORNA 4BCOA 2GNHA 3EFWA 3NUYA 4X3FC 3PYYA 2VWXA 2YAAA 1CSNA 1PW2A 3QCXA 4ITJA 4JQ8A 2XK7A 4ITIA 1SVEA 1ZYLA 3NLBA 2NRYA 3VQUA 2ETKA 2VTLA 3W2QA 1SYKA 4TTHB 4EOMA 2XNOA 3RVGA 3G33A 3UIXA 4O7NA 3IW4A 4CYJA 3ZXTA 5BVDA 4I5CA 4USFA 3P0MA 3TDVA 1AGWA 2VTOA 2RFEA 5A4TA 5AUUA 3UDSA 3BV3A 4E4LA 2PUIA 5LMAA 4R7BA 3TI1A 1SVHA 2Z7LA 1QPCA 3W2CA 4FL1A 4GW8A 4W4VA 5CEMA 4PPAA 3QRKA 3DXNA 3LJ2A 4FSQA 2W1FA 5HNIX 4BTMA 2DWBA 2VU3A 3RNYA 1Q97A 2J5FA 3F5PA 1J91A 3HZTA 1MQBA 4YU2A 5L2SA 2R5TA 3BL9A 2OSCA 2J0JA 3V5QA 4U43A 4FNWA 1YXSA 5H9BA 4FKPA 2XK8A 2VGOA 4RJ7A 4E8AA 2OK1A 1DS5A 3UYSA 2G2IA 3OWPA 1WBSA 2YM4A 3ZO1A 4FTTA 5AAGA 4DDIA 2YWPA 2PZ5A 4DEIA 5B2MA 3LPBA 4PF4A 4CVAA 3I0OA 2RFNA 3BYVA 3CD3A 2FSMX 3PXYA 3CQWA 1FMOE 4U40A 5H8BA 4KKEA 3VWAA 1LEZA 4EH7A 5BVFA 4JDIA 1GZNA 2BFXA 2ZB1A 2B7AA 4F70A 3KRJA 4MD9E 4R3PA 3TKHA 4ZSJA 2VTHA 4CTBA 3RPSA 4IZAA 4K9YA 2C5YA 2R3PA 2HZNA 4ZOGA 4FTIA 4E73A 1UNLA 2WQNA 2W05A 4RVTA 2BKZA 1PXPA 2VD5A 2JBPA 3B8RA 3SW4A 4DLJA 5KMNA 5DG5A 5EHYA 2H6DA 3HVCA 4IAZA 4QMSA 2O63A 3ZO4A 5HICA 4EH6A 4AZSA 5HG9A 1R0PA 4FK6A 5K5NA 3P4KA 4RRVA 2CGUA 4NK9A 4DGNA 4M0YA 2Y4IC 3MFSA 4KUJA 2RF9A 5KZIA 5L8LA 2PVKA 3OEZA 4J53A 5JRQA 4O0SA 2PK9A 3E8CA 5LMKA 1YVJA 3ERKA 3G9LX 4IZ5A 1ZXEA 4EJ7A 2X0QA 4LYNA 3UZRA 2C5NA 2PUUA 3KY2A 5L6OA 4O21A 5J7HA 1TZDA 5K0XA 2YABA 2XUUA 3DJ7A 3DPKA 3WZUA 4D0WA 2V7AA 3KN6A 3SXFA 4EK3A 2XIRA 2Y8OA 4GVAA 4TXCA 1ZARA 3GU7A 5D11A 1OL5A 5EYCA 5C8MA 3TIYA 5JMSA 5LXMA 4GKIA 1PF8A 4I0RA 5HG5A 3PSDA 3ID6C 5CSWA 4BDDA 2GNJA 2HWOA 2R3GA 4YSMA 5BVKA 2YERA 2AYPA 2QOFA 4DH1A 2UZDA 4GG7A 4D0XA 1BX6A 3GQLA 5AUTA 5LWNA 2RFDA 3Q60A 5JRSA 2YZLA 1NT2A 3GC0A 2E9VA 3MVMA 3VW8A 4EYJA 3F5GA 3FSKA 5CSHA 4FTUA 4H39A 5KO1A 2OO8X 3W16A 2VWVA 2VTPA 1OB3A 1BUHA 2BILB 4YNEA 4CSVA 3F88A 1W2DA 4BCIA 1R0EA 4AUAA 3RK7A 3NFFB 3BGQA 2RSVA 4GJ2A 3JY0A 4CKIA 1ND4A 4G9RA 4A06A 4BGHA 5AV3A 2WMRA 5C9CA 4AQCA 4D2WA 5HQ0A 1XMMA 2EWAA 3BIZA 4IQ6A 4OTRA 1PMEA 3UIUA 4Y8DA 2KTYA 2W4JA 2C6LA 3QCSA 2ITXA 5AR5A 4J52A 3F3WA 4AGWA 4ZTRA 5G6VA 4EC8A 4F7JA 4WNKA 5E7RA 3O5AA 2VWBA 1U5QA 4F4PA 4RIXA 4DH7A 1M2PA 2PVJA 3FQHA 3RM7A 3GC9A 4PMSA 3L8VA 2JKQA 2C3LA 5HLPA 3RK5A 3W2SA 2R0IA 2XAMA 2QOBA 4ENYA 5JSMA 4XHKB 3NRMA 5JT2A 3TDWA 3W55A 2YCFA 3AC4A 4FGRA 5CNNA 2XK4A 1JNKA 2YHVA 3HP2A 4I1ZA 4MXAA 1Q61A 5CEKA 3LCOA 4QPSA 3HNGA 5BNJA 2QOKA 2GU8A 3LOKA 3HV6A 3HV7A 4V05A 3P86A 5IEYA 3SA0A 2XM9A 5J9ZA 3VUMA 4GH2A 3POZA 4DITA 4XMOA 2PULA 2I0VA 4AU8A 3BBWA 3NPCA 3V8SA 1G3NA 4ZY5A 2J50A 3KN5A 4ANNA 1BLXA 3QHWA 4ANOA 1A9UA 1P5EA 4G34A 3ATTA 3PWDA 4AF3A 2RKUA 4G5PA 5AP4A 5AR8A 5M08A 5J95A 1ST4A 4XG6A 4QP1A 4YJTA 4DH3A 1HCLA 5DMZA 5CEPA 2IJMA 4QMTA 3NGAA 3PJ3A 5DEYA 2GMXA 3FC2A 4FSWA 4MXYA 2IVUA 4RA5A 4XX9A 3S95A 2UW0A 5AV4A 4DEHA 1PHKA 2JDVA 4BJJB 3FMHA 4HYUA 2F9GA 3BHYA 4AZFA 5CWZA 3C51A 3UOJA 4KA3A 2YITA 3GC8A 4RG0A 4A07A 4EI4A 2PSQA 4W4YA 4FT0A 4EONA 1Y8GA 2GQGA 4PNKA 4UMRA 2XJ1A 3II5A 3IW7A 1KV2A 4FSTA 4XYFA 3FPQA 3TV4A 2B9HA 4EZ7A 2FO0A 1VEBA 3KF7A 4DFNA 1UWJA 4YLLA 3FY0A 5FBOA 1K9AA 1KE7A 1MQ4A 2O3PA 4NKAA 3R7EA 4FTCA 4MXXA 1TQIA 4Z3VA 4ZAUA 5EM7A 2VUWA 1JQHA 4BWKA 4EEVA 4OGRA 3TKUA 1OPKA 4YHFA 1BMKA 3MIAA 3ATSA 4QQTA 3IKAA 3QU0A 4QNYA 5KBQA 1IR3A 4FKRA 5HLWA 3EN5A 5AUZA 3SG9A 1OKVA 1WFCA 2C5OA 4NH1A 2I0HA 2ZM4A 4BGQA 4C3RA 2QHNA 3BCEA 5DBXA 3FZPA 4L8MA 2R2PA 3KRXA 4FV0A 5K4IA 4ID7A 3IK3A 5TOZA 3S00A 1ZLTA 2F2CB 4AE9A 5IQDA 1Y6BA 1JKKA 2GPHA 1UVRA 4C0TA 5LCJA 2AC5A 2CGWA 3MPMA 2JITA 4BFMA 4JAIA 4FL3A 3KQ7A 4E6CA 5IG1A 3MH3A 4RIWB 5GNKA 4NKSA 2IF8A 4N0SA 3DXQA 4KS8A 2JDTA 3PPKA 4X21A 5HHWA 2YM5A 4L3JA 3FI3A 5HE3A 3UGCA 5C03A 3AT4A 3BGZA 4DEBA 5B7VA 4H3BA 3NEWA 4U81A 4EHGA 3I4BA 2DYLA 3PY3A 1MUOA 4L67A 5JFSA 3RALA 4IAFA 4F99A 5AP0A 1KE5A 1OIRA 2W06A 3GB2A 2WU6A 2IW9A