2XBJA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
286
Chain Sequence
VYPKALRDEYIMSKTLGSGAGEVKLAFERKTCKKVAIKIISKALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Structure-Based Design of Potent and Selective 2-(Quinazolin-2-Yl)Phenol Inhibitors of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 286
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xbjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xbjA01
4ERWA 4D5HA 3PVBA 1AQ1A 4FKIA 4NJ3A 4NU1A 2Y4IB 2RL5A 2VTSA 3DKOA 4OTRA 1H1QA 4EH7A 2DWBA 4IB3A 5BYYA 4RFZA 3FQHA 4F6WA 4GKIA 3R8VA 3PJ3A 1KUTA 2J5FA 3UO6A 1UNLA 3P79A 4OTDA 4OTPA 5KMLA 4YR8A 1K9AA 3R8LA 3UO5A 3CJGA 3COHA 3MA3A 5C01A 4R7HA 5TE0A 4ZZMA 2JIIA 3ZDUA 1WVYA 4O1OA 4AT5A 5J7BA 2B0QA 2BIYA 5FUTA 4ZS0A 1V0BA 4IMYA 5CAVA 3QUPA 1O6LA 4C4GA 2JFLA 3UC3A 3RCDA 4BCPA 3PIYA 4E6DA 3HP2A 5ANKA 3DZOA 3V01A 4MXXA 5LCKA 4AN9A 2JBOA 4F7SA 4UZDA 3SXRA 3EMGA 1V0PA 1H27A 5C27A 3ZM9A 2PUPA 5FEDA 4G6OA 3FWQA 4I21A 3F88A 4KKHA 4V0GB 5C8MA 4D1ZA 2H96A 2QC6A 3IOPA 4I5CA 3QTRA 4RG0A 4XG6A 4IWDA 4BCIA 1NVQA 4FT0A 5EW3A 3IK3A 4PDYA 4N6YA 5DVRA 4WD5A 2JLDA 1R78A 5HCZA 3VQUA 2A4LA 5EKNA 2YM8A 3UTOA 1Q99A 3NEWA 2B55A 3LVPA 5HBHA 5JRSA 5CEOA 3M42A 5ICPA 4PV0A 3ZUTA 1WAKA 3TV6A 2ITVA 2WTKC 4GH2A 4QMXA 4OTHA 4KAOA 2XA4A 4TNDA 3SOCA 4U6RA 4J7BA 4QP8A 1W7HA 4EH2A 3LMIA 3F5XA 5DYJA 4D5KA 3JR1A 4XG8A 3ZO4A 4U43A 3QCYA 4UWYA 1JSUA 5ANOA 3W2CA 4AZTA 5AM6A 3QRJA 4L44A 5GJDA 3N4UA 2ZM3A 1H00A 3LIJA 3MY1A 4MD7E 5TR6A 3D14A 1OIQA 2WMBA 3NW5A 2PMIA 3QD3A 4AZVA 2J0IA 3L8SA 2OU7A 5CTPA 4EK4A 2B1PA 5EOLA 2PSQA 1F0QA 2GDOA 2PVYA 3KFAA 1HOWA 4BDEA 3NUAA 4TTHB 4EH4A 4QD6A 4FV5A 3MGYA 2Z7QA 3NNVA 4WO5A 4LM5A 3HL7A 2FA2A 2FSMX 2C6EA 3BU6A 3IECA 5E7RA 3MVMA 4KIKA 5L6WL 4ACGA 3SHEA 3LFDA 1TQMA 4GK4A 4Q9SA 4W9XA 5CNNA 2BTRA 5DGZA 1OL6A 3E7OA 4KD1A 3OXTA 2QQ7A 1FMKA 2OW3A 3CY3A 4W8EA 2YDJA 4MCVA 3H4JA 5M4FA 5IQEA 4J1RA 4EOKA 1WBNA 2WMSA 1YOMA 3DKGA 4E26A 2R5TA 3BGPA 5LCJA 4BFMA 3R04A 2QNJA 4DT8A 3EL7A 1H1PA 3VUMA 3BGZA 4EOOA 2P55A 3HV3A 3D4QA 4QOXA 4EBVA 1OIYA 4MXZA 5CEMA 3NS9A 4EOPA 1OL2A 2QOQA 2R0UA 3U9CA 1W0XC 2OICA 2XBJA 3PTGA 4G6LA 4RRVA 4UZHA 3F3VA 4AX8A 4BZNA 3FI2A 3OG7A 4CFUA 2ITXA 3LM5A 4JDHA 4XS2A 3RMFA 5D7VA 4DTKA 3CBLA 3ZMMA 2PTKA 3MIYA 4BBFA 2GHGA 3BV3A 4CFXA 3V5LA 2C0OA 3LFFA 3EKKA 5FM3A 1S9IA 3PRFA 4ANLA 2QHNA 4QMQA 3VS4A 3CE3A 3LE6A 3FQEA 3A7JA 1XBCA 5A46A 4W4VA 2HY0A 4LL5A 4XLIA 3LJ2A 4FK6A 4AW1A 4U3YA 5HICA 1YDSE 2IW9A 3QLGA 4X3FA 2EXEA 4AWIA 3RPRA 3TV4A 4DFXE 1RE8A 1XHAA 3W2OA 2PUUA 3DFAA 3KRJA 4AP7A 4APCA 3ENMA 3FKLA 1WMKA 1Q62A 4JT3A 3VS5A 3ZRLA 4YSMA 4BHNA 4BZDA 4CYJA 3WZUA 5FEQA 4Q5EA 4ZTMA 4RIWA 3THBA 3W10A 5JFWA 3BHVA 3NWWA 5L2SA 4ZJJA 3UZTA 2ZMDA 3QC4A 4CCBA 2RFSA 2CLQA 4YLLA 3LZBA 4ITJA 4AXAA 1JKSA 5I3OA 3QKMA 2ITUA 3LW0A 4DFBA 1J1CA 3E8NA 3JXWA 4NFNA 2OLCA 4BCNA 4FC0A 2JITA 2OZAA 3ZTXA 1KE8A 4JXFA 3EQHA 4ANNA 4DITA 4XV9A 2XYNA 3ULZA 5JMSA 4JVGA 5HO6A 5CEPA 3AQVA 3EQGA 1WBSA 3DDPA 4H3QA 4IAKA 3D5UA 3VF9A 2CKEA 4EKLA 4JAIA 4FG7A 5KX8A 2YM3A 2J7TA 4QTBA 4O2PA 4AA5A 4CG8A 3VUGA 1YDTE 5AIKA 4IZYA 4DFNA 2XKCA 5ETCA 4Z3VA 4DEBA 5KBRA 4CMUA 2ZB0A 1ZYJA 4NM7A 4TKSA 3L9NA 4D9UA 4C3RA 5CU2A 3DU8A 4RT7A 2C5VA 5CT7A 5H8BA 2BAQA 3UC4A 3F5UA 3H9OA 5LVNA 3U9NA 5CF5A 1K2PA 1CMKE 1OPLA 4E8AA 4IH8A 1YI4A 5FBOA 4Z9LA 1H1WA 4O6LA 1U54B 2YIYA 4IB0A 5AR5A 5G6VA 2RKUA 4OGRA 2IW8A 1PF8A 3ZEPA 4QTCA 4DEEA 1YKRA 4EOSA 3G51A 3Q9WA 2X1NA 4N6ZA 3R8ZA 2XM8A 2FSTX 2XCHA 3D2IA 3ZOSA 3F61A 3R1YA 2NO3A 2Y4PA 1UV5A 4IXPA 3UVQA 4BVUA 4C35A 3SKCA 4BDJA 4F6UA 2F57A 4J99A 3C4XA 1NA7A 3AC1A 4EH5A 3D15A 4EL9A 5HQ0A 2FGIA 4YBJA 3RAWA 2YN8A 2C0IA 2BRGA 5LMKC 5CVFA 5EH0A 5C1QB 3UZPA 3EOCA 4L68A 3HKOA 4HNFA 3F2NA 5L4QA 3A4OX 3ANQA 2QVSE 2FYSA 3LKMA 3FHIA 2ITPA 3QD0A 4OAUC 3RINA 2X8DA 1P2AA 4BDHA 3O71A 3U54A 4D2VA 3COKA 3R7GA 4RX5A 5J5SA 3OROA 4M0ZA 3F3ZA 2OI4X 3OHTA 5EK7A 5EYMA 3QBNA 5A4EA 3FUPA 4DEIA 4I93A 3DGKA 3BWJA 4UMRA 1KWPA 5HORA 5T68A 4QMZA 2H6DA 2HOGA 4FMQA 4MNEB 4FZAB 3OW3A 4D0XA 2I6LA 3KKVA 4IM3A 3C4ZA 1G8SA 1GIJA 3PRIA 4XLVA 4PDPA 5FM2A 2OIBA 2BRMA 2QLQA 4BCJA 4NFMA 5JK3A 4AAAA 1ZMUA 2JDSA 2W4KA 2WAJA 1L3RE 3MY0A 5D1JA 5D41A 4DGGA 5D9HA 3ZLYA 3SXFA 4MVFA 3FMLA 5CZHA 2YCFA 4Y46A 2JKMA 4KINA 4S30A 5H2UA 3TNWA 3FL4A 5DA3A 2VWIA 3QZIA 1LEZA 2HXLA 1O9UA 2XNEA 3PJ8A 3G0FA 1WBWA 2B54A 1B39A 3NYNA 2O65A 2CMWA 4BKJA 2C6TA 1J1BA 5E92A 4YJOA 3KULB 4QMVA 3FI4A 3P1AA 4FZDB 4I5MA 5CI7A 4CMOA 4IBMA 5BUIA 2IVUA 2C4GA 3DPKA 3I1AA 2VO6A 3AT2A 3B8RA 3HMPA 3HV7A 3P86A 4L7FA 4RC4A 2GCDA 5L6PA 1Q8YA 3C5UA 2JDVA 5CALA 4XJ0A 3KXGA 2GNJA 2J9MA 3UMXA 3VJOA 4IHPA 3RALA 2BZHB 1BL6A 4R5SA 2CPKE 3SRVA 4BDKA 4EJNA 4D2SA 3CSVA 1R39A 2OH4A 2XH5A 5IG1A 5AUZA 3H3CA 4YJQA 4O38A 4FL2A 3BRBA 2E9VA 2JDTA 4O96A 3ZRMA 4LGHA 5FTGA 1PMUA 4LRKA 1YWVA 2FUMA 4LUDA 3LLAA 4D28A 3RAKA 4FKTA 4TXCA 3TI1A 5BVDA 2VTRA 4K9YA 2WXVA 2W1FA 3VRYA 2ZJWA 5CXZA 4H39A 5FDPA 3WBLA 5L6OA 2PE1A 3C5IA 5J1WA 2H8HA 2HXQA 2R2PA 3KRLA 4MBIA 5IA5A 1G8AA 3FJQE 4AZEA 3EIDA 3FZOA 3QKLA 3P5KA 1H1SA 4PDSA 3QKKA 3E8CA 3R7UA 5KNJA 5KE0A 4RJ3A 3PE2A 3QUEA 5GZAA 2RFNA 4H1MA 2W99B 2ZDTA 3NUUA 3F2AA 4RBLA 3ROYA 4NM3A 3PXQA 4EHVA 3A7HA 4O0WA 4EH9A 4ZP5A 3JY9A 4TT7A 2XP2A 3CTJA 3R73A 5IQFA 4BI0A 5EM5A 2I0HA 2X81A 2YJRA 4LUEA 3S00A 2XK9A 3A62A 3HUBA 2BFXA 3R63A 3EQIA 3QA0A 3PLSA 3V8SA 3CY2A 3PJCA 2R3LA 1T46A 3P9JA 3NIEA 4EHEA 4PWNA 3KF7A 1JKTA 3C51A 4NZWB 4QPAA 5E90A 3C0GA 4QNYA 3RPOA 2C68A 4UEUA 2BKZA 3A7GA 4KA3A 3PVGA 1AGWA 1GIHA 3ZBFA 2EU9A 4APPA 3HGKA 4FT9A 2XK8A 4C4JA 4KUJA 3I81A 3VBXA 4MKCA 3GC9A 4I41A 2XCKA 4DEDA 2B9IA 4CT2A 3KXMA 4HYUA 4DAWA 4RFYA 3SQQA 3TZMA 3PG3A 1H1RA 4RX8A 4QTEA 3O7LB 4DLIA 3LFCA 4EEVA 2OK1A 2NPQA 4FV8A 4M14A 4JIAA 3MW1A 4F9BA 2C3LA 1BL7A 4AOTA 3KEXA 5IDPA 2YIRA 1U5QA 2B9FA 2PYWA 4FEWA 2VO0A 2IZRA 4XG9A 4GCJA 3CPCA 5HI2A 3U8WA 5LVMA 3NCGA 5KMMA 3UGCA 5LMKA 3HV5A 4AT3A 4EUTA 3FPMA 2EWAA 5CSHA 4M68A 3UOJA 2YAKA 2I1MA 3OVVA 2CNQA 1UU7A 3TNQB 3EH9A 3HAVA 4Z55A 4U81A 2OGVA 2QCSA 3CIKA 3BHUA 2P3GX 4AN3A 2XK3A 3AD4A 5DNRA 3TNIA 3VUKA 4CV9A 3IGGA 2H34A 3CR0A 3DFCB 4HJOA 3ALOA 3HMNA 1Y8GA 3FLQA 4K18A 5CYIA 3ORZA 1ZZ2A 1JQHA 5AR4A 3VJNA 5CF6A 3IDCA 1QL6A 1GOLA 4HVGA 4GIIA 4M12A 3E8EA 5HTBA 5IUIA 3DZQA 5JZJA 2OIQA 2QR8A 5E8YA 4D2TA 1U59A 2C3IB 5M57A 4BZOA 4FTIA 4EK6A 3DKFA 2Y7JA 4RC3A 4RWKA 3OY1A 5JZNA 3UP2A 3ZBXA 4A9SA 4DN5A 2BROA 4KBCA 4BYJA 3GB2A 4GG7A 2FSLX 4FGBA 3ZC6A 3JYAA 4UY9A 4KKGA 1TQIA 2VX1A 4FVRA 1FQ1B 4X2GA 2ZDUA 4LI5A 3DLZA 3BLHA 3MH3A 5KZ0A 4E4MA 1E1VA 5CI6A 3TDVA 4NTSA 2OF4A 4KIPA 4NJDA 1WBOA 2CJMA 4B8LA 4AACA 3BU3A 3GFEA 3V51A 5A54A 4Q2AA 5DR2A 4B99A 3R1SA 2W1EA 4MX9A 5HE2A 3ZFMA 3OY3A 4IZAA 4BTMA 3Q9ZA 4IB1A 2RG5A 3U6JA 4H05A 1SVEA 4IJ9A 2XK4A 4S33A 3ACKA 4PPBA 5ACBC 4O83A 4ZLYA 2UW6A 3QZFA 4RZWA 2FVDA 4EWQA 2R3MA 2OO8X 4YZDA 4TY1A 4AT4A 1U4DA 3I0OA 2XEZA 3MIAA 4HGSA 4TYIA 5IH5A 3D2KA 5CENA 2IVVA 3QCQA 2V62A 2VX0A 4GMYA 5HG8A 3W32A 4BKYA 2EUFB 3FLYA 5HD4A 4LMUA 3OCTA 3JUHA 4WHZA 2I7QA 3FLWA 3NLBA 4ZJVA 4U41A 1ZMWA 4JRVA 1PXOA 3RJCA 3N4TA 1UWHA 4RFMA 1XQZA 4IDTA 4UMTA 5F20A 3BEAA 4D4VA 2Z7RA 3F3TA 3OZ6A 5ANEA 5HESA 3SG8A 4ASXA 4JAJA 4XMOA 4EC9A 2BIKB 4WOVA 3T3UA 4PP7A 3II5A 5KMOA 3LMHA 3QRUA 2BAJA 2VD5A 3SX9A 4PNKA 4LGDA 3VS1A 2WIPA 4O0XA 2OWBA 2PE2A 2XJ1A 3HVCA 1STCE 5FG8A 4ANSA 1PMNA 2HZNA 2O63A 4N4SA 4QMTA 3W1FA 5DWRA 4HVSA 3VC4A 3G9LX 4M7IA 4ZTSA 3QTIA 3UBDA 2CN8A 4FG8A 4GT4A 1QPEA 4JG8A 2IZSA 3C50A 4FTRA 4PQNA 4HYHA 2YLFA 2IVTA 4IVAA 4GG5A 5KHXA 5CSXA 2QURA 2KTYA 3DJ7A 1LUFA 3S2PA 4C02A 4E20A 1FPUA 4UWBA 3VBYA 5IEVA 4DCEA 4E4LA 4K6ZA 4I4EA 5CSWA 4WG4A 4I6QA 3FSKA 3DCVA 3ZO1A 1BX6A 3QQLA 3I5ZA 3MJ1A 3FXZA 3PZHA 4DG2E 4IB5A 4RIOA 3ETAA 4I20A 3C7QA 2GNHA 3I4BA 4GYIA 4AZWA 5HX8A 4QMOA 2UW0A 2C69A 4TYHA 2WTDA 2BVAA 3A60A 2RIOA 4DGOA 3UP7A 4R6VA 5CQUA 4YU2A 5K9IA 4FKPA 3ZEWA 3HRBA 2BKKA 2Q83A 1QPCA 4BDGA 4TYEA 1H01A 4O1PA 4XYFA 4UX9A 1IAHA 4PL3A 2UZBA 4I0SA 4P4CA 1WZYA 4P2KA 2W1ZA 2CHLA 3BCEA 4TPTA 4XP0A 3HUCA 4R1YA 4ZSLA 3SOAA 4CTCA 4MQ2A 3CPBA 3AC3A 3L8XA 3WF5A 4GL9A 4IAZA 4G34A 3RHXA 3COMA 4BCHA 1MP8A 2GHLA 3RP9A 5LJJA 4AOJA 4O7VA 4E5WA 4GRBA 5E8VA 2WELA 1KE6A 4QNAA 4J98A 2XRUA 5HIBA 3NUXA 3QUDA 2GQRA 2VTAA 3SD0A 3E62A 1VJYA 4O7ZA 4CCUA 3ZLWA 1SNUA 4DINA 4OTFA 4R3PA 4FEVA 4TNBA 3GOPA 4BY9E 4FTNA 4I92A 3ZSHA 4L3PA 1ND4A 4C59A 2X2MA 4BIDA 2EB3A 4U9AA 5EYCA 3PDTA 3BHHA 5KMKA 3VUHA 1XR1A 4QYHA 5E8TA 3GCQA 5KBQA 1OI9A 4ZMEA 3D5XA 2UZLA 5IUHA 2O2UA 4U7ZA 3HA6A 2W5AA 4QQCA 3OTUA 3DBEA 1FBNA 2O64A 5ETFA 4TWOA 5CLPA 4RLLA 3ZYAA 4BYIA 1W84A 4CVAA 4R7BA 4O7RA 2W7XA 3LCTA 3ET7A 2YDIA 2HENA 1JSTA 3RAHA 4O0RA 5T6KA 4JNWA 4GJ2A 2HIWA 5AP6A 3GC8A 4XG2A 5J95A 2XRWA 3GQIA 4CKRA 2YCSA 4FICA 2OFVA 5CSVA 4BCMA 4R78A 4K11A 4I5PA 2W1CA 2CNVA 3DAKA 3NSZA 4L01A 1SVHA 5FXQA 2J0MB 3CLYA 4U8ZA 4GW8A 5IKWA 4FSRA 1Y6AA 1W83A 2QU5A 4L52A 4D2WA 4NIFA 1OVEA 3OEFX 2J5EA 3K2LA 1PRYA 3FY0A 5JGAA 5M53A 1GZ8A 2VTJA 2QO9A 3HZTA 3QQGA 4TZRA 5HD7A 1IAJA 3Q2JA 5JGBA 2RFDA 4USEA 5EM8A 5JEBA 3QRTA 3W8LA 2F7XE 3ODZX 4CEGA 3OTVA 3W2RA 5B2LA 2WTVA 3ZDIA 3DB6A 1GY3A 2NRUA 5K4JA 1YW2A 3HV6A 2F4JA 4RQVA 3C4WA 4G6NA 5J9YA 1OECA 5J9LA 5EFQA 2C1AA 5A4CA 4K8AA 4PX6A 5GZ8A 2GQGA 3DQXA 3KREA 3E8DA 4YURA 4ZXTA 3IOKA 2JKQA 3ZUUA 1VZOA 2C1BA 2GSFA 1W8CA 3LQ3A 5ANIA 3MPAA 3KRRA 3GCVA 2GTNA 3FLNC 1ATPE 3HRFA 3QF9A 4I4FA 4YJVA 3R7YA 3ZLXA 5K0XA 3SXSA 4QPMA 1OKZA 4M0YA 2HELA 1UKHA 2HZIA 3QQUA 4UN0C 2PVNA 4XH6A 4XNEA 5IU2A 4OR5A 2UZWE 5H8GA 5E4HA 2XIRA 2F2CB 4NKSA 4MTAA 4RIXB 4RSSA 4F7JA 5A14A 2RGPA 4MHAA 3GP0A 4UB7A 4U97A 3UODA 4GT3A 3LQ5A 3EZVA 3EFLA 4X2NA 5HE0A 1BUHA 1RW8A 2XIYA 4AZFA 4QP1A 5CU4A 5IEXA 2BHEA 5L2IA 3UNKA 4FKUA 3K5VA 5AA9A 2X7OA 2H9VA 4DGNA 4ZTLA 2CGWA 4Z7GA 3R9HA 4MK0A 5KKRB 1L8TA 2PVRA 3JVRA 1PKGA 2ERZE 4XUFA 4IX3A 1ZLTA 5DMZA 3T9IA 1ZOEA 4ITHA 4CKIA 5HO7A 3L8PA 4FV3A 4IQ6A 4NSTA 4O21A 4KB8A 4BRXA 3LJ0A 2IW6A 1WBVA 5HBEA 2EXCX 2YISA 1IRKA 2JIUA 3AC2A 1FOTA 1TQPA 3MH0A 4BIBA 1Q8WA 1F5QA 3BYMA 2QOHA 3HDNA 3W2PA 2HW7A 1PMEA 3PG1A 2JDOA 4NK9A 3EN9A 3WF6A 2BAKA 4BTJA 5EQEA 2VO7A 4BDBA 3FBVA 3GEQA 3JS2A 1XKKA 3TIYA 5CX9A 3V04A 3AC8A 4XV3A 2PVFA 3RNIA 3RM6A 1CSNA 3PZEA 3RCJA 2R3KA 2WTWA 4FTMA 4I6BA 4IFGA 4ZEGA 3TT0A 2ETRA 4D0WA 5BMMA 4DBNA 5M08A 3OWKA 1PJKA 3OT8A 3WZEA 4F09A 3GU6A 3HRCA 3ULIA 4FUYA 5C8NA 2Q0BA 4JOAA 3UQGA 3UQFA 4IM0A 3O96A 4O7TA 3FZRA 3LHJA 3R9DA 4YTCA 2DS1A 3HMMA 3QWJA 4L67A 4MWIA 4YNEA 5JRQA 4QMYA 2ZV9A 3H9FA 2VGOA 5AV4A 4I1ZA 2UV2A 2PY3A 1SVGA 4IWOA 4RJ8A 3ZO3A 3I6WA 4YC6A 1I09A 3PPZA 4G9CA 2P2HA 3RKBA 4ACMA 1A06A 1Q97A 2X9EA 3GFWA 3NNXA 3KN5A 3CS9A 4EONA 3PA5A 1YVJA 3SGCA 4PTEA 3CJFA 2WQBA 4DYMA 3MFUA 1T45A 3E93A 4KWPA 4ACHA 5DFPA 1CKIA 5FXSA 3WARA 5B0XA 3KY2A 3SV0A 3MI9A 5HE1A 3R22A 2ZM4A 2ITQA 2PE0A 3DJ6A 2WHBA 1TKIA 4C61A 2ZV7A 4TWPA 3HV4A 3KXXA 3FQSA 4S31A 3Q04A 2JC6A 2LAVA 2PU8A 4L6QA 1CM8A 3NGAA 3KCFA 2O5KA 4UWCA 3VW8A 3CEKA 4PMMA 3HP5A 2PL0A 5AIRA 3T8OA 5I9ZA 1KE5A 5ETIA 1JKLA 3NMUF 3FMEA 2GFSA 4KIKB 4FUXA 2OKRA 4G3CA 4MYGA 4RZVA 4F70A 4DE4A 3QAME 4BWPA 3TG1A 3LCSA 3VVHA 4R8QA 5IMXA 4BDDA 3UYTA 5CEKA 3UQCA 3FYKX 1M52A 4A9YA 5CAQA 3LLTA 1WVWA 4IFCA 3FPQA 5FGKA 5DH3A 2XJ0A 2CNUA 2C30A 4M84A 4N57A 3NUSA 4Y72A 4FYOA 3QCXA 4XBUA 3UOKA 4D55A 2QD9A 4XHKB 3T9TA 2QG5A 3QALE 4DA5A 3BU5A 3NYOA 5M44A 1R3CA 5GINE 4D2RA 1JOWB 2W06A 4C2WA 1EH4A 3PLAE 1I44A 1JBPE 3E63A 5A9UA 4QMLA 5L8KA 2J0LA 5LOHA 1M7NA 3QC9A 3SW4A 3TWJA 5HNBA 4F65A 2PK9A 2BZIB 3FEGA 2HWPA 2XNPA 2JIVA 3C1XA 4ANMA 4A06A 5CVHA 4CFWA 2NNWB 3IW4A 2OIDA 3NVKI 3C4CA 2B53A 2F7ZE 3IW6A 3ANRA 1OPKA 2XNNA 4ERKA 4G16A 4ZMFA 2OH0E 1TVOA 3SG9A 4YO4A 5M09A 5AJQA 2XIKA 5HLPA 3WILA 3SLSA 2WIHA 4BGGA 4EHZA 4YHFA 5CF8A 4PPAA 5AAFA 1URWA 4LQMA 3G15A 4I6FA 3EHAA 4FSMA 4FEQA 4ACDA 3K54A 1KSWA 3O50A 3VO3A 3NAXA 3A4PA 3PP1A 2OJIA 4FTUA 2EXMA 1Y8YA 4JI9A 1WBTA 3OWPA 3B2TA 4FSWA 4JG7A 5E8ZA 3VHKA 3OT3A 2F7EE 2Y6MA 1Q8ZA 4RJ5A 2IJMA 4X3FB 4FL3A 4EZ5A 2XIXA 1REKA 4MF1A 3V5PA 5AV3A 3NVMB 4WSYA 4FX3A 4XOYA 2FH9A 4CGAA 5CU6A 4EOJA 2J4ZA 4FKOA 4NL0A 4EK3A 2BHHA 5E1EA 2RG6A 2O0UA 2UVYA 3IONA 1BKXA 5J5TA 4K77A 4RIWB 3D7ZA 2E9NA 3WZKA 2CCIA 4YTFA 3P0MA 2YIXA 3Q60A 4HCVA 4DHFA 4DCAA 4U42A 3QTXA 5BVKA 3ITZA 4Y5QA 4ZS4A 4DBXA 4D2PA 4DH8A 4F9WA 2ITYA 4EOMA 3ODYX 4PF4A 2YERA 5EW8A 3ZFYA 1NY3A 2IO6A 4C62A 4EOLA 3EJ1A 3BLRA 2I0YA 4C3FA 4FF8A 1J91A 4FV6A 4NM0A 4P5ZA 1XBBA 5TF9A 3LXPA 5DPVA 2OZAB 4IM2A 3I60A 3IPHA 4FR4A 4KS7A 3MPTA 2KULA 2YCQA 4FKRA 2J51A 2RFEA 4FV1A 4MNFA 4XV1A 4UXLA 3BGQA 1GAGA 4FKLA 2CKQA 5K3YA 4FTQA 5I5ZA 3WE8A 4ZY5A 1ZOHA 5BVEA 4WUNA 4JQEA 4QMMA 3FMMA 5IZFA 1BLXA 4XCUA 4E1ZA 1XH4A 4UMQA 3FMNA 5B2KA 3PY3A 3R8MA 1NXKA 1OB3A 4BWXA 5ITAA 2VTPA 3R1NA 2QOIA 1H28A 2OF2A 2VTOA 3R8UA 5J8IA 3TACA 3HECA 2Z2WA 3PVUA 4DH5A 3V8WA 1XH6A 4C4EA 3E3PA 4FG9A 4BN1A 2F9GA 2VTNA 3LFEA 5IA1A 1JWHA 2XKEA 3Q4ZA 4GFMA 3ELJA 3U4UA 5CAUA 1SZMA 2X6EA 2YA9A 3MBLA 5BMSA 4G2FA 4Q9ZA 3CP9A 2A2AA 1UKIA 3D9VA 2WTKB 3GXLA 4K33A 4QQJA 5M55A 5BNJA 1BYGA 2QODA 1PXLA 4FV2A 4KNBA 4EWHA 3FAAA 1GZKA 1M14A 3QX2A 5M4UA 4DF3A 4E6CA 3AOXA 3MFTA 4KRCA 3TJCA 4DG3E 3S3IA 5HLNA 1ZWSA 3A8XA 4IVDA 5IQBA 3Q32A 1REJA 3DBQA 1CTPE 4EOIA 4EJ7A 4O7LA 4J8NA 3V6SA 4ALVA 2IPXA 4JJRA 4RA5A 1UU8A 1JPAA 2X9FA 3MVJA 5CEIA 3RK5A 3FL5A 3OXZA 2C3JA 4DTAA 3UOLA 5M06A 2OXXA 4YZCA 3TUDA 1IA9A 2WNTA 4FKJA 3TKIA 5EQYA 4M66A 3PY0A 4ZSJA 3RK9A 4O27B 4E4NA 3ATTA 3ZXTA 4KBKA 1OL5A 4CRLA 4LRJA 4C34A 2QI8A 4FK3A 4IDVA 2G2HA 5DR6A 3I5NA 3RPYA 4Z16A 2WMQA 4A9TA 4M69A 3TKHA 5AR2A 2HYYA 3UPZA 5HO8A 2OZOA 5FD2A 3HA8A 2JEDA 3QX4A 4H58A 1G3NA 3TNHA 3WF9A 3R2BA 3FXXA 3ZZEA 3BBWA 3R8PA 2VTQA 5EHLA 1YXSA 4G5PA 4QMPA 2ITTA 3OUNB 2R0IA 1RQQA 3TTJA 3LJ1A 1ZZLA 4PMTA 4QMNA 1JLUE 1KV2A 1XH7A 4E6QA 5AADA 2UVZA 2Z7LA 3KB7A 3Q2MA 5CQWA 2GNFA 3FLSA 4PRJA 5LVOA 4LOQA 1A48A 4O2ZA 3V5WA 4ZAUA 4MXOA 1OZ1A 1ZRZA 4YJUA 5HHWA 4QP7A 4C4HA 4ZJIA 3TUCA 3KRWA 4XP2A 4IEBA 3F3UA 5DIAA 1U46A 1YRPA 2JAVA 3OXIA 3WF7A 3D7TA 4BBEA 4CQGA 3LFBA 3C9WA 3RGFA 3MPMA 4U44A 4AS0A 3GT8A 5LARA 3HLLA 3RM7A 4AW2A 5BUJA 4B0GA 2BILB 2WD1A 3ERKA 4JBQA 4WT6A 4YC8A 2CKPA 4DFZE 3VS0A 5J7HA 4TRLA 1PXIA 4YHJA 5ANJA 1YHSA 2SRCA 3KQ7A 2WTJA 5JQ8A 2ONLC 2X4FA 4FNXA 4A4XA 3Q53A 5D11A 3SW7A 2X7FA 3FMHA 2VWYA 4FSTA 2JDRA 3NAYA 4W4WA 5EYDA 5ANGA 3ORTA 2HY81 3CGFA 4FNYA 2FO0A 4ITIA 1UU9A 4RWJA 3E7VA 2E9UA 3HMIA 3MN3A 4WG3A 3SRVB 4P7EA 5IMEA 3ZS5A 4EHGA 3ZFXA 2QR7A 2C47A 3A99A 4ZLOA 2PVLA 3GGFA 5C9CA 4RLKA 4XRLA 3CTQA 4BDAA 2FSOX 3MB7A 3R7EA 2Z8CA 3LFQA 4HGTA 4X0MA 3OD6X 4ALWA 4KKEA 4BBMA 4DLJA 5K4IA 4IWPA 4S34A 3BI6A 4J53A 4DH3A 2F2UA 2DQ7X 4ZLZA 5HU3A 4O86A 2JKOA 3N9XA 4QQTA 5GNKA 4RWLA 4HVHA 4E5AX 1OIUA 5CEQA 3LCKA 4X21A 1Z5MA 5CS6A 5EI6A 1R0EA 1Q8TA 1FVVA 5CZIA 4KIOA 3VS7A 3MB6A 3VBTA 4MBLA 4O91A 5DT4A 2QOFA 4QO9A 3DBDA 2JBPA 2QG7A 4M67A 1SNXA 1XH9A 3LFSA 2IZUA 3EZRA 3OWLA 3IKAA 3QCSA 3BQCA 3VF8A 4BDFA 2VNYA 2XKFA 4LG4A 4D1XA 5AV2A 4I24A 2YABA 3W16A 5AR8A 4LYNA 4RJ7A 5I9XA 4DEGA 5L2QA 3QQJA 4UALA 4ZK5A 1UU3A 5TKDA 4X3JA 4Y85A 1VR2A 2F49A 4YZBA 2PPQA 4LL0A 2QO2A 2CGXA 4K2RA 5KHWA 5HIDA 4EKKA 1GIIA 4IC8A 4I3ZA 4XG3A 3OUKA 3GC7A 4ZSGA 1LR4A 2YHVA 3PXFA 3VBWA 1MQ4A 5DRDA 5DBXA 4USFA 4U5JA 3CD8A 3LQ8A 4WNPA 2Y4IC 1Y91A 3P23A 1OMWA 3BYSA 3F69A 4L53A 3U51A 3ZZWA 4N0SA 3G2FA 1FVRA 2UZOA 2WMTA 4J95A 4A4OA 2VWWA 4OLIA 4FKWA 4Y95A 1S9JA 2BCJA 2G01A 4TYJA 2BPMA 3CD3A 4UYNA 1BMKA 3ZRKA 4AA4A 5IQCA 3RI1A 2QKRA 3RWQA 4GK2A 4ANQA 5L8LA 4I23A 4YGAA 4DEAA 3ZHPC 2EVAA 3ORNA 3ORIA 4JRNA 4G5JA 4U0IA 1ERKA 5I0BA 1DI9A 4RGJA 3QTWA 4NYEA 1XH5A 4PP9A 4NCTC 4FSZA 3POZA 5HTIA 5KMIA 4BDIA 3FC2A 4UBAA 4W8DA 1UVRA 4QYYA 3RK7A 4DTBA 4WNMA 3BE2A 5HCYA 4IW0A 4JBVA 4X2JA 2R3OA 4YPDA 3GUBA 5I4NA 3FKOA 3TZ9A 3OCGA 4AW0A 4OTGA 2XYUA 3F3WA 4AOIA 5C4LA 1KV1A 4BCKA 1YWNA 3DTWA 2Z7SA 3PJ1A 2GS7A 2JAMA 1X8BA 1Y57A 3FMJA 3ID6C 4PMSA 1FGKA 4WUAA 1OGUA 3UZRA 1NVSA 1RDQE 3NRMA 4OT6A 2XM9A 3OCBA 4FV0A 5JQ5A 1GNGA 2WU7A 3ORLA 2C5YA 4FNWA 4ID7A 4UV0A 2WQEA 3UJGA 4HW7A 3L9PA 1J7IA 2OSCA 4C33A 2X7GA 4O84A 4X6QC 3QHRA 4C2VA 2P4IA 2YWVA 4QP2A 4MAOA 2HCKA 2CGVA 4O6EA 3MTLA 2QOCA 5B2MA 3ZONA 3EQBA 3KVXA 3VW6A 5LXMA 5AP7A 4RIYA 4J97A 5HGIA 2PWLA 3EL8A 2UUEA 2CCHA 4CQEA 4HYSA 1J7LA 4GVAA 3TXOA 4YLJA 4GKHA 3TZ8A 2YJSA 3GQLA 4EZ7A 1KOAA 1PXJA 2J6MA 4AUAA 1GZNA 3SA0A 2A27A 1XWSA 4EZ3A 4QT1A 4XP3A 3R9RA 5IQDA 2X2KA 4P5QA 3E5AA 4ZIMA 4H36A 5HEZA 4E3CA 3NR9A 1E9HA 3QRKA 3P7AA 3Q9YA 1DI8A 4HGEA 2ONLA 4DGMA 4EH8A 3KF4A 3ACJA 4O0SA 4QYFA 4ZZNA 5LQFA 2X6DA 3ORPA 3PWDA 4HNIA 4FTTA 2G1TA 3VS2A 1ZY5A 3MSSA 3MYGA 4IAIA 4JDIA 3RAIA 2BDFA 2W1DA 2BR1A 3RPVA 3UO4A 1ZAOA 4QMUA 3M2WA 3FZ1A 5IQHA 4XBRA 2VNWA 1H26A 4EH3A 3KA0A 4WNOA 5DI1A 4CFFA 5IUGA 4QRCA 4BTKA 4FEUA 1W82A 3JY0A 2ZMCA 4FNZA 1ZYLA 4HZRA 2UW7A 4KSQA 5D10A 2X8IA 4C7TA 4GVJA 4R3CA 4IX5A 4L3JA 2A0CX 2RF9A 4F4PA 5CWZA 2PULA 1JNKA 5DN3A 3SC1A 1QPJA 5IQIA 2J0KA 1HCKA 2OG8A 3QFVA 1YOJA 3CKXA 4QYEA 3QYZA 4E7WA 3DA6A 1Q3DA 4X2KA 4J96A 4E6AA 4A9RA 3BQRA 4KRDA 5HLWA 4BR3A 3GENA 4N70A 5HOAA 1CDKA 1LP4A 3FI3A 3DTCA 1OBDA 2Y9QA 2CN5A 5FTOA 5GHVA 3CC6A 2VTLA 3OEZA 3I7CA 3VBQA 3ORXA 1JSVA 2YM6A 2YEXA 4ZTQA 2E9OA 3FZTA 1R1WA 1BI7A 4FV9A 3UIXA 3FKNA 3QGWA 4GS6A 3PSDA 2G2FA 5LWMA 3EYGA 2UZEA 2W9FB 1XJDA 2GNGA 3EYHA 3OWJA 3QRIA 2YZLA 1Q4LA 4G3GA 4FVQA 1O6YA 4ZTRA 3WYYA 3VUDA 2X39A 1PXMA 3GC0A 3BELA 2VUWA 1ZOGA 2VTHA 4F08A 4JQ7A 1IG1A 4YZ9A 1WVXA 2Q0NA 2Z60A 1KE9A 1PYEA 4LGGA 2BMCA 4HYIA 2VTMA 3L1SA 2CDZA 4TYHB 4XRJA 2ZB1A 5HVYA 1YXUA 2JGZA 2VZ6A 2WOUA 4FOCA 3PA4A 4LRMA 4DFLA 4ZSAA 5HVKA 5E1SA 1RJBA 3EWHA 1M17A 3TTIA 3P4KA 4F1OA 2G2IA 4IWQA 1MQBA 1MRYA 5AV1A 5AUWA 3PPKA 3D5VA 3JPVA 5A6OA 3GU8A 3HAMA 3FE3A 3Q52A 3CGOA 4YC3A 2ZYBA 4HPTE 2OJ9A 4F63A 3MVHA 5FBNC 5HG9A 4BCQA 4PUZA 5M56A 2ZVAA 1ZYDA 4HOKA 4AGDA 3MWUA 4XEYA 1Z9XA 2GMXA 3N4VA 3I7BA 1JKKA 3LXKA 4XX9A 2PMLX 3R30A 3TCPA 4CXAA 4NCTA 1OM1A 2VX3A 3DOGA 2PZPA 4HVIA 4M3QA 3EFWA 4ORKA 3Q3BA 3VAPA 4RQKA 3UVPA 5FDXA 1Q24A 4CYIA 4C38A 4NT4A 4C4FA 1PXKA 4G3DA 3S95A 4V0GA 3SDJA 4A9UA 2GS6A 1AD5A 3DJ5A 1IR3A 1OKVA 4BL1A 4YMJA 2PUNA 3UYSA 5TT7A 4ASZA 4YZMA 4YSJA 3KRXA 3NUNA 2R3JA 3KK8A 4I6HA 1SMHA 3QQFA 3CQUA 4YTHA 3BHYA 3BHTA 3D0EA 2HAKA 4L3LA 4F7LA 2W96B 3EN6A 1OITA 2Y8OA 3MS9A 3O8UA 4TN6A 5IA2A 4FOBA 3Q6WA 3WZJA 4YP8A 2HWOA 3KGAA 3FMDA 4FSQA 3G0EA 3NCZA 3QU0A 1MRVA 3F66A 4MD8E 5HG5A 4JX7A 2V55A 4WRSA 1LEWA 5EYKA 4HCTA 3QXOA 2UW4A 3GU7A 1H08A 3PA3A 5EQPA 4CD0A 1HCLA 4AGCA 4AGWA 4F9CA 2QLUA 3F2RA 3DXPA 4O81A 2DUVA 3QTSA 4NTTA 3RZFA 4Q5HA 2XJ2A 1E1XA 2ITWA 1FGIA 2XNBA 3KK9A 4RVMA 5HG7A 4BDCA 3AT3A 3OFMA 5LMBA 4JDJA 5EG3A 4NIFB 2ITOA 4YJTA 4YHTA 1YHVA 3TIZA 4E93A 5E9EA 3EQDA 3PP0A 3IGOA 4IJPA 3UNJA 3UPXA 2YACA 2QOOA 4CZTA 2R3GA 3QL8A 5BVFA 4QP4A 5IEYA 2YCRA 3Q9XA 3KMUA 2VTTA 5E8UA 3TN8A 5CT0A 5AUVA 3QLFA 3CTHA 3OS3A 4X7QA 5J87A 4G3EA 3BV2A 4F7NA 5AUXA 4RC2A 5F1ZA 2W4OA 1O6KA 4EK5A 3UOHA 2CSNA 3G6HA 3E87A 3MJ2A 5A6NA 1YI6A 3Q6UA 3IDPA 2E9PA 5BX0A 4AU8A 4EQMA 3PIXA 3GI3A 5IH6A 4FVPA 4L42A 3TV7A 5T3QA 4OUCA 1PW2A 4W9WA 4D4RA 3HYHA 5DT0A 5ACKA 4FIGA 4C0TA 1ZARA 3VRZA 3O17A 2GS2A 5GIOE 5EM6A 5AM7A 1B38A 4F99A 2REIA 3PIZA 4BICA 3Q4UA 4U40A 3PXYA 2NRYA 3DXQA 3LCDA 2V22A 1YDRE 2QOBA 2XK6A 4B6LA 4YJPA 5IDNA 4RJ4A 5DEYA 3FXWA 3QTUA 5K5XA 2BTSA 3Q96A 5I3RA 5HVJA 1KOBA 2EB2A 4KBAA 4IANA 2XNMA 2C6IA 4XG4A 4AW5A 2X2LA 3R0TA 5AAGA 1ZYSA 1QCFA 3GOKA 3WIGA 3ORKA 2AUHA 3PSCA 4FIFA 1Q41A 3E88A 4YJNA 2W05A 1IASA 1ZMVA 2C5NA 5C4KA 3DK6A 3EB0A 2ITZA 2WQOA 3GU4A 4IX4A 4ONAA 4JIKA 3CQEA 2XUUA 3V3VA 3ORMA 5EDPA 2PMNX 5HNGA 3MDYA 4AN2A 2B7AA 5EDRA 5CAOA 1B6CB 3D5WA 2OJGA 3AXWA 4CV8A 4FE2A 3A7IA 3AC5A 2IZTA 2W5BA 3FLZA 4U80A 3KL8A 4LFIA 5DE2A 4ZSEA 1Z57A 4AG8A 2C6KA 3QTZA 5L8JA 4C4IA 5IQAA 1XO2B 4QP6A 4JDKA 3BIZA 3H10A 4JX3A 4YPSA 4EQCA 4AFEA 5BYLA 3OBGA 4D4SA 1H07A 3GNIB 3C13A 5E91A 5AX9A 4WRGA 3Q5ZA 1P4OA 5L3AA 3VIDA 4OBQA 5G1XA 3EN5A 1GJOA 3HMOA 5DR9A 4FTLA 4EYMA 4RX7A 4F0IA 2LGCA 2WZJA 2YWPA 3OMVA 2R7IA 3FZPA 4M97A 3GVUA 4I5HA 5IA0A 4ASDA 4J52A 3K5UA 5DT3A 5EI2A 4RX9A 3RZBA 4O0YA 2V0DA 4UXQA 4FKSA 3TDWA 4QPSA 2ZOQA 1G5SA 2R3PA 2R3QA 3MTFA 4FKVA 4OW8A 4C57A 5CY3A 4DG0E 3DV3A 2VU3A 3V5JA 4D1SA 4RVTA 2HZ4A 3O7LD 3DY7A 3IQ7A 3ZU7A 3OCSA 2WOTA 5FEEA 4ACCA 5FLFA 3AMYA 5F4NA 1M2QA 4LOOA 1OL7A 1YOLA 2X8EA 3F9NA 4R5YA 4TL0A 5KUPA 4TW9A 2VN9A 3CXWA 2R64A 4QTAA 4R7IA 4BHZA 3MY5A 5KCVA 2VWXA 3OW4A 4PL5A 5D12A 4DC2A 3NX8A 3PE1A 1U54A 4MBJA 4PTCA 4EUUA 2WTIA 1SM2A 4HVDA 4ENXA 4PMPA 1Y6BA 3Q5IA 4HPUE 2BZKB 4IADA 2JD5A 4FGRA 2UZDA 1U5RA 3G9NA 3O8TA 5AP0A 3NYVA 5TO8A 2B4SB 3A2CA 2O3PA 3ZM4A 1APME 1UA2A 1URCA 2WEIA 4PL4A 5LWNA 3F5GA 4IC7A 2HZ0A 2VV9A 3KXHA 3TL8A 2WMXA 3TJDA 4MXYA 4BF2A 3E3BX 2XKDA 4QQ5A 4BI2A 1F3MC 2ZAZA 1JAMA 3QD2B 4MXAA 2PVMA 5E8SA 5GJGA 4F1MA 3W8QA 4JR7A 4V04A 4CFVA 3W18A 5IH4A 5HNIX 3G90X 2IVSA 2J90A 3H9RA 5JH6A 3FMKA 4ALUA 4ANOA 2R4BA 4RA4A 3WZDA 3O0GA 5AUTA 4K0YA 2PUIA 2HK5A 4FYNA 2PZYA 2Z02A 4LOPA 2GNLA 1OL1A 1K3AA 4FT5A 2X4ZA 4NW6A 3A8WA 3I6UA 4MNEA 2W1GA 5HCXA 3U87A 2A19B 5BVOA 3F5PA 4YTIA 2W17A 1VYZA 2J2IB 2YITA 3BPRA 3QTQA 1OKWA 3VHEA 2VO3A 2ERKA 3BX5A 3DQWA 2G15A 5AWMA 4JBOA 5LVLA 4CLJA 2V7AA 5CSPA 3GCUA 3NW6A 3QZGA 4AE6A 4MH7A 2XIZA 3DBFA 5EDQA 4BI1A 3ENHA 4M13A 4NUSA 3UVRA 4C36A 1JVPP 2W5HA 2UZNA 3EFJA 4L46A 4KIQA 3R9OA 3ZO2A 1J3HA 4UMUA 4Y83A 3EN7A 3T3VA 3OF0A 3V5QA 1YXTA 3C0HA 3ATSA 4KSPA 5I9UA 4NEUA 1OPJA 3EQPA 3MH2A 4J71A 4C37A 3KXZA 3KULA 3I79A 3A61A 5L2WA 1Q61A 5CVGA 5FQDC 1VYWA 4B9DA 3CKWA 4S2ZA 3SVVA 1FMOE 4GUEA 3K3JA 1R0PA 3JVSA 4FTCA 3UMWA 4BTFA 3EN4A 3HEGA 5CAPA 4GT5A 3F7WA 3L9MA 3I0QA 1WBPA 3W33A 3PYYA 5IISA 2B9HA 3LXNA 5DG5A 5EOBA 1P5EA 5JFVA 3R01A 4H3BA 2J50A 3RHKA 1J7UA 3P7BA 3PXZA 1M2PA 2ZV2A 2WQNA 3QXPA 1H8FA 4FIHA 4JQ8A 4M15A 3FDNA 3RNYA 2IN6A 4F0FA 2IWIA 2YZAA 2FB8A 2WKMA 4WKQA 4AZSA 1YI3A 2R3IA 3DNEA 2GNIA 2X0GA 5DLSA 4A7CA 5JFSA 3O23A 4ENYA 5M07A 3D94A 4ZTNA 5IA3A 5HKMA 1ZY4A 5ETAA 2YM5A 1PKDA 2ESMA 2ITNA 3AD5A 4GFGA 3O8PA 5H8EA 3N51A 5BUEA 2V5QA 2UW8A 5M4CA 3NYXA 4GSBA 3IG7A 4YUQA 5LVPA 4CFMA 2C6LA 2I0EA 4A07A 4L9IA 2PMOX 4EI4A 4AQCA 3S1HA 2J0JA 1WFCA 2PHKA 3B8QA 2BDWA 4WBBB 3TM0A 3AD6A 3VNTA 2R3HA 5CASA 3TKUA 1LPUA 3QYWA 3WOWA 5HE3A 5AR3A 5F94A 1H25A 3V6RA 2BRNA 5AA8A 5JFXA 1M2RA 4II5A 2UZVA 5DOSA 1PYXA 4B8MA 3DT1A 3DLSA 3TZ7A 4FIEA 5BVWA 2VWZA 2P0CA 1Q5KA 2C6DA 4IX6A 5F9EA 2W1HA 5CU3A 4I0RA 3W2QA 3R02A 3ZSIA 4CT1A 3U55A 2WQMA 4FT3A 1UWJA 2C6OA 3NPCA 1KE7A 3BKBA 3DKCA 4K1BA 1H4LA 4FT7A 3R7IA 5F95A 4XV2A 3R2YA 4LV8A 5KO1A 1MRUA 1Q8UA 2AYPA 2WFYA 3O51A 2OXDA 3Q4CA 5AX3A 2P33A 3IDBA 3NDMA 2UW5A 4YLKA 5E8XA 5A3XA 4J8MA 4YBKA 4FTOA 4XG7A 4BCGA 4CZUA 3DS6A 1XBAA 3VUIA 4MQ1A 3R7VA 3SAYA 3VUTA 4AFJA 3OOMA 2YIQA 1PHKA 3Q4TA 3IW5A 4EC8A 5GIPE 2WMAA 4JL9A 2OBJA 2WU6A 3P7CA 3BWFA 3POOA 3MVLA 4CLIA 3NNWA 4Y73A 4BCOA 5C26A 4O0VA 3M1SA 4BC6A 2WMRA 3ZC5A 3GBZA 1DAYA 3R7OA 3RPSA 1YWRA 1YXVA 4QP3A 3GCSA 3WYXA 4FBXA 5JGDA 1PMVA 4LV5A 3LXLA 4FSYA 4OTIA 1SYKA 3OC1A 3VBVA 4ANBA 2BZJA 3NNUA 4BIEA 4QMWA 3U6HA 4GJ3A 1OUKA 5FTQA 4G31A 4L43A 3AGMA 5C8KA 5AV0A 2UZUE 5AR7A 3KMMA 4M69B 1FVTA 2XB7A 2XEYA 4FZ7A 2QHMA 4EQUA 3KN6A 3UIMA 4GK3A 3EQRA 3UG1A 4TWCA 4D58A 5IQGA 4IAYA 5A4LA 4GFOA 4FSNA 1CKPA 4XOZA 3BLQA 4Y5HA 4IACA 5BQ0A 4X2FA 3ZXZA 4FIJA 3PWYA 3VN9A 3ZUVA 5AP3A 3UG2A 3AG9A 2O8YA 2W9ZB 4FTKA 5EI8A 4BKZA 2BFYA 3WF8A 2VRXA 3EFKA 1DM2A 4GYGA 4CZYB 3BYUA 2UVXA 5EHYA 5IA4A 2WGJA 3FSFA 4GEOA 4FTAA 4IAFA 3QQHA 3K3IA 5A4QA 2R3RA 3DK3A 4H1JA 4AF3A 3OP5A 2QOKA 4O7YA 3EQFA 3D7TB 1DAWA 3FY2A 3PY1A 4MD9E 5M51A 3DB8A 5M4IA 1VEBA 4OAVB 3LFAA 4R1VA 3TNPC 2WB8A 3G6GA 5HIEA 3A7FA 5HTCA 1Q3WA 4ZOGA 2BUJA 3MA6A 2OFUA 3R9NA 5I9YA 4DFUA 3U4WA 4FKGA 5AP1A 2JKKA 4F0GA 4ZTHA 3TEIA 5J1VA 4CMTA 3UIBA 4W4YA 2UZTA 1A9UA 4JR3A 3NW7A 2PVHA 3OOGA 5H3QA 2OXYA 3PVWA 1MUOA 1QPDA 2CKOA 4IVCA 4RPVA 2P2IA 4BCFA 5KMNA 4FA2A 3VULA 4OTQA 2BRHA 2XNOA 3FC1X 4WBOA 4WSQA 2XBAA 5HU9A 2PVKA 4FV4A 4MF0A 1ZYCA 3QGYA 1QMZA 3DK7A 4PDOA 3UNZA 3WIKA 3REPA 4CFNA 3FV8A 3E64A 3QHWA 5CXHA 3AMBA 4FIIA 4NWMA 3RBWA 4RJ6A 3BBTB 3DBCA 2GPHA 3FHRA 1WCCA 3NUPA 2WMUA 1YQJA 2B52A 2QO7A 4U3ZA 5AP4A 5HX6A 2QOLA 2WMVA 1FINA 3PFQA 4I22A 3R21A 5DRBA 5I9WA 2I40A 2PZRA 5D7AA 2C5OA 1DS5A 2XZSA 3AMAA 2XVDA 1ZXEA 3MFSA 4IZ5A 4WG5A 4FODA 2YAAA 3S0OA 5HBJA 3QWKA 5EW9A 4FKQA 4RWIA 2YIWA 5EKOA 4EORA 3VQHA 1P4FA 3HDMA 3LMGA 4F64A 2QKWB 4HGLA 4I0TA 2OJJA 4GU9A 4E4XA 3NIZA 2A1AB 4D4YA 3AGLA 3MV5A 4GV1A 3R00A 5J9ZA 2DYLA 3KC3A 4R3RA 3PXRA 4JG6A 3KVWA 2IG7A 3FYJX 1CKJA 4LMNA 4OBPA 5K0KA 1YHWA 4BB4A 4IVBA 3S4QA 5AFVA 4CSVA 3UIUA 3R28A 2I0VA 5BYZA 5IPJA 5KKRC 4CG9A 1GZOA 2XF0A 3R71A 2YLEA 2WMWA 3O2MA 2ETMA 5EHOA 4CNHA 5CANA 3OBJA 3LAUA 5FXRA 2CLXA 2C6MA 3IW7A 3EQCA 4NKAA 4PPCA 5IF1A 3DXNA 1NW1A 4YZNA 2UW3A 2R9SA 4MEDA 4ZZOA 3RWPA 2C5XA 4U79A 3CCNA 3LFNA 3RTPA 3KU2A 4O0UA 2WO6A 2QU6A 4HCUA 1OKYA 3ZH8A 3WE4A 2ETKA 1PXNA 2GTMA 4JBPA 4YJSA 4YJRA 5AMNA 4QYGA 4KS8A 4P90A 4B7TA 4C58A 4U45A 4V01A 4USDA 5GJFA 1OUYA 4D9TA 3LM0A 3MFRA 4V05A 5BPYA 5L2TA 2BDJA 2WPAA 4R77A 5BVNA 2YM7A 1UNHA 5K5NA 3COIA 3IS5A 1XH8A 3M11A 4AGUA 3ALNA 3H0ZA 3MH1A 3VWAA 3BYOA 2PVJA 2WTCA 5FP6A 4FI1A 2C0TA 3V5TA 3DDQA 4ZY4A 3RVGA 3KMWA 3W2SA 3CQWA 3AC4A 3IO7A 5AEPA 1NVRA 2CGUA 3ZLSA 4DFYA 4YO6A 4E73A 2R3NA 4E5BA 3MESA 3V8TA 2OJFE 3LPBA 5GZ9A 5CNOA 1V0OA 3B2WA 1M7QA 3QQKA 4BGHA 2AC3A 4BWKA 4DT9A 3C4EA 5C03A 3AT4A 4PY1A 3FZSA 3QD4A 3LOKA 4QTDA 2VGPA 2ACXA 1P14A 3H30A 5AP5A 4OTWA 4L7SA 5ANDA 3BEGA 4Y8DA 2YDKA 2XNGA 4O22A 5CF4A 4O0TA 4L45A 4FL1A 5E8WA 2YM4A 5EM7A 1OBGA 4IAAA 3TUBA 4O7NA 2NP8A 4FZFB 3IW8A 3W55A 4RIYB 2PZIA 4W4XA 3PSBA 3F7ZA 4JLCA 4L8MA 2W4JA 4G1WA 4UMPA 2G9XA 3KXNA 2GHMA 3P08A 2QONA 2Y6OA 2AC5A 1V1KA 3L8VA 4KABA 5JT2A 3GCPA 2RSVA 3C0IA 5JN2A 5KMJA 1W98A 3U6IA 1IEPA 4Z7HA 4RMZA 3HNGA 3E92A 4MWHA 4B4LA 3PJ2A 4EBWA 5CU0A 3UE4A 1OIRA 4GUBA 4L00A 2WEVA 5J79A 4O7WA 4O82A 3DAEA 4NH1A 4EYJA 2VWBA 3P78A 3BE9A 2V7OA 4YNOA 5DHJA 2GFCA 5HZNA 4IE9A 2C3KA 5AP2A 3LCOA 4ARKA 4F9AA 5LMAA 2VTIA 2ZM1A 4ASEA 4QP9A 1PXPA 4AE9A 4C8BA 5JKGA 3FI8A 4HZSA 4FZ6A 3F82A 2Y0AA 2B9JA 3DAJA 2GQSA 3R83A 3R1QA 4WIHA 5FRIA 1H0VA 2W1IA 4DEHA 5JSMA 4A4LA 3NZ0A 2ZV8A 1H24A 2YFXA 4QMSA 3BYVA 4GU6A 5DEWA 4OT5A 1H0WA 4FTJA 1YXXA 4GIHA 5FP5A 4F9YA 2BRBA 3G5DA 4F6SA 2VAGA 1BI8A 2VWVA 4PTGA 2W0JA 4NW5A 2XK7A 4JS8A 4IIRA 4ZY6A 5TOZA 2VWUA 4EK8A 3H0YA 5AUYA 4IZ7A 5A4TA 3QA8A 3ZCLA 4F1TA 3PUPA 3ZSGA 4FEXA 2UW9A 4G3FA 4M8TA 4EH6A 3GU5A 4DH7A 1NT2A 4PNIA 3NUYA 1UNGA 4FV7A 2GU8A 4OBOA 4NM5A 2BALA 4TYGA 3KCKA 4WNKA 4CKJA 5FWKK 1PY5A 5H9BA 4DGLC 4O7SA 4RIXA 3ROCA 2XMYA 3QZHA 4C3PA 4WA9A 4UYAA 4X3FC 3UDBA 3R6XA 4S32A 4DH1A 2PZ5A 3D83A 2HW6A 4X6RA 4G17A 3EKNA 3F6XA 3DNDA 4RVKA 3C4FA 3VS3A 3L9LA 2E2BA 4AA0A 1IA8A 3BZ3A 3VS6A 4BGQA 4TWNA 3HX4A 4MXCA 4CRSA 5I9VA 5AUUA 5B7VA 2XS0A 4I94A 4FSUA 4RVLA 2R7BA 4G9RA 5KZIA 3PPJA 4H3PA 5AAEA 4EOQA 3PXKA 3G33A 2R3FA 4CTBA 2JFMA 3WI6A
chains in the Genus database with same CATH superfamily
4ERWA 4D5HA 3PVBA 1AQ1A 4FKIA 4NJ3A 4NU1A 2Y4IB 2RL5A 2VTSA 3DKOA 4OTRA 1H1QA 4EH7A 2DWBA 4IB3A 5BYYA 4RFZA 3FQHA 4F6WA 4GKIA 3R8VA 3PJ3A 1KUTA 2J5FA 3UO6A 1UNLA 3P79A 4OTDA 4OTPA 5KMLA 4YR8A 1K9AA 3R8LA 3UO5A 3CJGA 3COHA 3MA3A 5C01A 4R7HA 5TE0A 4ZZMA 2JIIA 3ZDUA 1WVYA 4O1OA 4AT5A 5J7BA 2B0QA 2BIYA 5FUTA 4ZS0A 1V0BA 4IMYA 5CAVA 3QUPA 1O6LA 4C4GA 2JFLA 3UC3A 3RCDA 4BCPA 3PIYA 4E6DA 3HP2A 5ANKA 3DZOA 3V01A 4MXXA 5LCKA 4AN9A 2JBOA 4F7SA 4UZDA 3SXRA 3EMGA 1V0PA 1H27A 5C27A 3ZM9A 2PUPA 5FEDA 4G6OA 3FWQA 4I21A 3F88A 4KKHA 4V0GB 5C8MA 4D1ZA 2H96A 2QC6A 3IOPA 4I5CA 3QTRA 4RG0A 4XG6A 4IWDA 4BCIA 1NVQA 4FT0A 5EW3A 3IK3A 4PDYA 4N6YA 5DVRA 4WD5A 2JLDA 1R78A 5HCZA 3VQUA 2A4LA 5EKNA 2YM8A 3UTOA 1Q99A 3NEWA 2B55A 3LVPA 5HBHA 5JRSA 5CEOA 3M42A 5ICPA 4PV0A 3ZUTA 1WAKA 3TV6A 2ITVA 2WTKC 4GH2A 4QMXA 4OTHA 4KAOA 2XA4A 4TNDA 3SOCA 4U6RA 4J7BA 4QP8A 1W7HA 4EH2A 3LMIA 3F5XA 5DYJA 4D5KA 3JR1A 4XG8A 3ZO4A 4U43A 3QCYA 4UWYA 1JSUA 5ANOA 3W2CA 4AZTA 5AM6A 3QRJA 4L44A 5GJDA 3N4UA 2ZM3A 1H00A 3LIJA 3MY1A 4MD7E 5TR6A 3D14A 1OIQA 2WMBA 3NW5A 2PMIA 3QD3A 4AZVA 2J0IA 3L8SA 2OU7A 5CTPA 4EK4A 3W0PA 2B1PA 5EOLA 2PSQA 1F0QA 2GDOA 2PVYA 3KFAA 1HOWA 4BDEA 3NUAA 4TTHB 4EH4A 4QD6A 4FV5A 3MGYA 2Z7QA 3NNVA 4WO5A 4LM5A 3HL7A 2FA2A 2FSMX 2C6EA 3BU6A 3IECA 5E7RA 3MVMA 4KIKA 5L6WL 4ACGA 3SHEA 3LFDA 1TQMA 4GK4A 4Q9SA 4W9XA 5CNNA 2BTRA 5DGZA 1OL6A 3E7OA 4KD1A 3OXTA 2QQ7A 1FMKA 2OW3A 3CY3A 4W8EA 2YDJA 4MCVA 3H4JA 5M4FA 5IQEA 4J1RA 4EOKA 1WBNA 2WMSA 1YOMA 3DKGA 4E26A 2R5TA 4DDIA 1ST4A 3BGPA 5LCJA 4BFMA 3R04A 2QNJA 4DT8A 3EL7A 1H1PA 3VUMA 3BGZA 4EOOA 2P55A 3HV3A 3D4QA 4QOXA 4EBVA 1OIYA 4MXZA 3UDZA 5CEMA 3NS9A 2XAMA 4EOPA 1OL2A 2QOQA 2R0UA 3U9CA 1W0XC 2OICA 2XBJA 3PTGA 4G6LA 4RRVA 4UZHA 3F3VA 4AX8A 4BZNA 3FI2A 3OG7A 4CFUA 2ITXA 3LM5A 4JDHA 4XS2A 3RMFA 5D7VA 4DTKA 3CBLA 3ZMMA 2PTKA 3MIYA 4BBFA 2GHGA 3BV3A 4CFXA 3V5LA 2C0OA 3BL9A 3LFFA 3EKKA 5FM3A 1S9IA 3PRFA 4ANLA 2QHNA 4QMQA 3VS4A 3CE3A 3LE6A 3FQEA 3A7JA 1XBCA 5A46A 4W4VA 2HY0A 4LL5A 4XLIA 3LJ2A 4FK6A 4AW1A 4U3YA 5HICA 1YDSE 2IW9A 3QLGA 4X3FA 2EXEA 4AWIA 3RPRA 3TV4A 4DFXE 1RE8A 1XHAA 3W2OA 2PUUA 3DFAA 3KRJA 4AP7A 4APCA 3ENMA 3FKLA 1WMKA 1Q62A 4JT3A 3VS5A 3ZRLA 4YSMA 4BHNA 4BZDA 4CYJA 3WZUA 5FEQA 4Q5EA 4ZTMA 4RIWA 3THBA 3W10A 5JFWA 3BHVA 3NWWA 5L2SA 4ZJJA 3UZTA 2ZMDA 3QC4A 4CCBA 2RFSA 2CLQA 4YLLA 3LZBA 4ITJA 4AXAA 1JKSA 5I3OA 3QKMA 2ITUA 3LW0A 4DFBA 1J1CA 3E8NA 3JXWA 4NFNA 2OLCA 4BCNA 4FC0A 2JITA 2OZAA 3ZTXA 1KE8A 4JXFA 3EQHA 4ANNA 4DITA 4XV9A 2XYNA 3ULZA 5JMSA 4JVGA 5HO6A 5CEPA 3AQVA 3EQGA 1WBSA 3DDPA 4H3QA 4IAKA 4AAYA 3D5UA 3VF9A 2CKEA 4EKLA 4JAIA 4FG7A 5KX8A 2YM3A 2J7TA 4QTBA 4O2PA 4AA5A 4CG8A 3VUGA 1YDTE 5AIKA 4IZYA 4DFNA 2XKCA 5ETCA 4Z3VA 4DEBA 5KBRA 4CMUA 2ZB0A 1ZYJA 4NM7A 4TKSA 3L9NA 4D9UA 4C3RA 5CU2A 3DU8A 4RT7A 2C5VA 5CT7A 5H8BA 2BAQA 3UC4A 3F5UA 3H9OA 5LVNA 3U9NA 5CF5A 1K2PA 1CMKE 1OPLA 4E8AA 4IH8A 1YI4A 5FBOA 4Z9LA 1H1WA 4O6LA 1U54B 2YIYA 4IB0A 5AR5A 5G6VA 2RKUA 4OGRA 2IW8A 1PF8A 3ZEPA 4QTCA 4DEEA 1YKRA 4EOSA 3G51A 3Q9WA 2X1NA 4N6ZA 3R8ZA 2XM8A 2FSTX 2XCHA 3D2IA 3ZOSA 3F61A 4LV7A 3R1YA 2NO3A 2Y4PA 1UV5A 4IXPA 3UVQA 4BVUA 4C35A 3SKCA 4BDJA 4F6UA 2F57A 4J99A 3C4XA 1NA7A 3AC1A 4EH5A 3D15A 4EL9A 5HQ0A 2FGIA 4YBJA 3RAWA 2YN8A 2C0IA 2BRGA 5LMKC 5CVFA 5EH0A 5C1QB 3UZPA 3EOCA 4L68A 3HKOA 4HNFA 3F2NA 5L4QA 3A4OX 3ANQA 2QVSE 2FYSA 3LKMA 3FHIA 2ITPA 3QD0A 4OAUC 3RINA 2X8DA 1P2AA 4BDHA 3O71A 3U54A 4D2VA 3COKA 3R7GA 4RX5A 5J5SA 3OROA 4M0ZA 3F3ZA 2OI4X 3OHTA 5EK7A 5EYMA 3QBNA 5A4EA 3FUPA 4DEIA 4I93A 3DGKA 3BWJA 4UMRA 1KWPA 5HORA 5T68A 4QMZA 2H6DA 2HOGA 4FMQA 4MNEB 4FZAB 3OW3A 4D0XA 2I6LA 3KKVA 4IM3A 3C4ZA 1G8SA 1GIJA 3PRIA 4XLVA 4PDPA 5FM2A 2OIBA 2BRMA 2QLQA 4BCJA 4NFMA 5JK3A 4AAAA 1ZMUA 2JDSA 2W4KA 2WAJA 1L3RE 3MY0A 5D1JA 5D41A 4DGGA 5D9HA 3ZLYA 3SXFA 4MVFA 3FMLA 5CZHA 2YCFA 4Y46A 2JKMA 4KINA 4S30A 5H2UA 3TNWA 3FL4A 5DA3A 2VWIA 3QZIA 1LEZA 2HXLA 1O9UA 2XNEA 3PJ8A 3G0FA 1WBWA 2B54A 1B39A 3NYNA 2O65A 2CMWA 4BKJA 2C6TA 1J1BA 5E92A 4YJOA 3KULB 4QMVA 3FI4A 3P1AA 4FZDB 4I5MA 5CI7A 4CMOA 4IBMA 5BUIA 2IVUA 2C4GA 3DPKA 3I1AA 2VO6A 3AT2A 3B8RA 3HMPA 3HV7A 3P86A 4L7FA 4RC4A 2GCDA 5L6PA 1Q8YA 3C5UA 2JDVA 5CALA 4XJ0A 3KXGA 2GNJA 2J9MA 3UMXA 3VJOA 3P5JC 4IHPA 3RALA 2BZHB 1BL6A 4R5SA 2CPKE 3SRVA 4JMQA 4BDKA 4EJNA 4D2SA 3CSVA 1R39A 2OH4A 2XH5A 5IG1A 5AUZA 3H3CA 4YJQA 4O38A 4FL2A 3BRBA 2E9VA 2JDTA 4O96A 3ZRMA 4LGHA 4I6LA 5FTGA 1PMUA 4LRKA 1YWVA 2FUMA 4LUDA 3LLAA 4D28A 3RAKA 4FKTA 4TXCA 3TI1A 5BVDA 2VTRA 4K9YA 2WXVA 2W1FA 3VRYA 2ZJWA 5CXZA 4H39A 5FDPA 3WBLA 5L6OA 2PE1A 3C5IA 5J1WA 2H8HA 2HXQA 2R2PA 3KRLA 4MBIA 5IA5A 1G8AA 3FJQE 4AZEA 3EIDA 3FZOA 3QKLA 3P5KA 1H1SA 4PDSA 3QKKA 3E8CA 3R7UA 5KNJA 5KE0A 4RJ3A 3PE2A 3QUEA 5GZAA 2RFNA 4H1MA 2W99B 2ZDTA 3NUUA 3F2AA 4RBLA 3ROYA 4NM3A 3PXQA 4EHVA 3A7HA 4O0WA 4EH9A 4ZP5A 3JY9A 4TT7A 2XP2A 3CTJA 3R73A 5IQFA 4BI0A 5EM5A 2I0HA 2X81A 2YJRA 4LUEA 3S00A 2XK9A 3A62A 3HUBA 2BFXA 3R63A 3EQIA 3QA0A 3PLSA 3V8SA 3CY2A 3PJCA 2R3LA 1T46A 3P9JA 3NIEA 4EHEA 4PWNA 3KF7A 1JKTA 3C51A 4NZWB 4QPAA 5E90A 3C0GA 4QNYA 3RPOA 2C68A 4UEUA 2BKZA 3A7GA 4KA3A 3PVGA 1AGWA 1GIHA 3ZBFA 2EU9A 4APPA 3HGKA 4FT9A 2XK8A 4O4CA 4C4JA 4KUJA 4BJJB 3I81A 3VBXA 4MKCA 3GC9A 4I41A 2XCKA 4DEDA 2B9IA 4CT2A 3KXMA 4HYUA 4DAWA 4RFYA 3SQQA 3TZMA 3PG3A 1H1RA 4RX8A 4QTEA 3O7LB 4DLIA 3LFCA 4EEVA 2OK1A 2NPQA 4FV8A 4M14A 4JIAA 3MW1A 4F9BA 2C3LA 1BL7A 4AOTA 3KEXA 5IDPA 2YIRA 1U5QA 2B9FA 2PYWA 4FEWA 2VO0A 2IZRA 4XG9A 4GCJA 3CPCA 5HI2A 3U8WA 5LVMA 3NCGA 5KMMA 3UGCA 5LMKA 3HV5A 4AT3A 4QDEA 4EUTA 3FPMA 2EWAA 5CSHA 4M68A 3UOJA 2YAKA 2I1MA 3OVVA 2CNQA 1UU7A 3TNQB 3EH9A 3HAVA 4Z55A 4U81A 2OGVA 2QCSA 3CIKA 3BHUA 2P3GX 4AN3A 2XK3A 3AD4A 5DNRA 3TNIA 3VUKA 4CV9A 3IGGA 2H34A 3CR0A 3DFCB 4HJOA 3ALOA 3HMNA 1Y8GA 3FLQA 4K18A 5CYIA 3W0OA 3ORZA 1ZZ2A 1JQHA 5AR4A 3VJNA 5CF6A 3IDCA 1QL6A 1GOLA 4HVGA 4GIIA 4M12A 3E8EA 5HTBA 5IUIA 3DZQA 5JZJA 2OIQA 2QR8A 5E8YA 4D2TA 1U59A 2C3IB 5M57A 4BZOA 4FTIA 4EK6A 3DKFA 2Y7JA 4RC3A 4RWKA 3OY1A 5JZNA 3UP2A 3ZBXA 4A9SA 4DN5A 2BROA 4KBCA 4BYJA 3GB2A 4GG7A 2FSLX 4FGBA 3ZC6A 3JYAA 4UY9A 4KKGA 1TQIA 2VX1A 4FVRA 1FQ1B 4X2GA 2ZDUA 4LI5A 3DLZA 3BLHA 3MH3A 5KZ0A 4E4MA 1E1VA 5CI6A 3TDVA 4NTSA 2OF4A 4KIPA 4NJDA 4FJVA 1WBOA 2CJMA 4B8LA 4AACA 3BU3A 3GFEA 3V51A 5A54A 4Q2AA 5DR2A 4B99A 3R1SA 2W1EA 4MX9A 5HE2A 3ZFMA 3OY3A 4IZAA 4BTMA 3Q9ZA 4IB1A 2RG5A 3U6JA 4H05A 1SVEA 4IJ9A 2XK4A 4S33A 3ACKA 4PPBA 5ACBC 4O83A 4ZLYA 2UW6A 3QZFA 4RZWA 2FVDA 4EWQA 2R3MA 2OO8X 4YZDA 4TY1A 4AT4A 1U4DA 3I0OA 2XEZA 3MIAA 4HGSA 4TYIA 5IH5A 3D2KA 5CENA 2IVVA 3QCQA 2V62A 2VX0A 4GMYA 5HG8A 3W32A 2ZFYA 4BKYA 2EUFB 3FLYA 5HD4A 4LMUA 3OCTA 3JUHA 4WHZA 2I7QA 3FLWA 3NLBA 4ZJVA 4U41A 1ZMWA 4JRVA 1PXOA 3RJCA 3N4TA 3W0NA 1UWHA 3UDTA 4RFMA 1XQZA 4IDTA 4UMTA 5F20A 3BEAA 4D4VA 2Z7RA 3F3TA 2XANA 3OZ6A 5ANEA 5HESA 3SG8A 4ASXA 4JAJA 4XMOA 4EC9A 2BIKB 4WOVA 3T3UA 4PP7A 3II5A 5KMOA 3LMHA 3QRUA 2BAJA 2VD5A 3SX9A 4PNKA 4LGDA 3VS1A 2WIPA 4O0XA 2OWBA 2PE2A 2XJ1A 3HVCA 1STCE 5FG8A 4ANSA 1PMNA 2HZNA 2O63A 4N4SA 4QMTA 3W1FA 5DWRA 4HVSA 3VC4A 3G9LX 4M7IA 4ZTSA 3QTIA 3UBDA 2CN8A 4FG8A 4GT4A 1QPEA 4JG8A 2IZSA 3C50A 4FTRA 4PQNA 4HYHA 2YLFA 2IVTA 4IVAA 4GG5A 5KHXA 5CSXA 2QURA 2KTYA 3DJ7A 1LUFA 3S2PA 4C02A 4E20A 1FPUA 4UWBA 3VBYA 5IEVA 4DCEA 4E4LA 4K6ZA 4I4EA 5CSWA 4WG4A 4I6QA 3FSKA 3DCVA 3ZO1A 1BX6A 3QQLA 3KIOC 3I5ZA 3MJ1A 3FXZA 3PZHA 4DG2E 4IB5A 4O4BB 4RIOA 3TYKA 3ETAA 4I20A 3C7QA 2GNHA 3I4BA 4GYIA 4AZWA 5HX8A 4QMOA 2UW0A 2C69A 4TYHA 2WTDA 2BVAA 3A60A 2RIOA 4DGOA 3UP7A 4R6VA 5CQUA 4YU2A 5K9IA 4FKPA 3ZEWA 3HRBA 2BKKA 2Q83A 1QPCA 4BDGA 1TFFA 4TYEA 1H01A 4O1PA 4XYFA 4UX9A 1IAHA 4PL3A 2UZBA 4I0SA 4P4CA 1WZYA 4P2KA 2W1ZA 2CHLA 3BCEA 4TPTA 4XP0A 3HUCA 4R1YA 4ZSLA 3SOAA 4CTCA 4MQ2A 3CPBA 3AC3A 3L8XA 3WF5A 4GL9A 4IAZA 4G34A 3RHXA 3COMA 4BCHA 1MP8A 2GHLA 3RP9A 5LJJA 4AOJA 4O7VA 4E5WA 4GRBA 5E8VA 2WELA 1KE6A 4QNAA 4J98A 2XRUA 5HIBA 3NUXA 3QUDA 2GQRA 2VTAA 3SD0A 3E62A 1VJYA 4O7ZA 4CCUA 3ZLWA 1SNUA 4DINA 4OTFA 4R3PA 4FEVA 4TNBA 3GOPA 4BY9E 4FTNA 4I92A 3ZSHA 4L3PA 1ND4A 4C59A 2X2MA 4BIDA 2EB3A 4U9AA 5EYCA 3PDTA 3BHHA 5KMKA 3VUHA 1XR1A 4QYHA 5E8TA 3GCQA 5KBQA 1OI9A 4ZMEA 3D5XA 2UZLA 5IUHA 2O2UA 4U7ZA 3HA6A 2W5AA 4QQCA 3OTUA 3DBEA 1FBNA 2O64A 5ETFA 4TWOA 5CLPA 4RLLA 3ZYAA 4BYIA 1W84A 4CVAA 4R7BA 4O7RA 2W7XA 3LCTA 3ET7A 2YDIA 2HENA 1JSTA 3RAHA 4O0RA 5T6KA 4JNWA 4GJ2A 2HIWA 5AP6A 3GC8A 4XG2A 5J95A 2XRWA 3GQIA 4CKRA 2YCSA 4FICA 1TZDA 2OFVA 5CSVA 4BCMA 1XMLA 4R78A 4K11A 4I5PA 2W1CA 2CNVA 3DAKA 3NSZA 4L01A 1SVHA 5FXQA 2J0MB 3CLYA 4U8ZA 4GW8A 5IKWA 4FSRA 1Y6AA 1W83A 2QU5A 4L52A 4D2WA 4NIFA 1OVEA 3OEFX 2J5EA 3K2LA 1PRYA 3FY0A 5JGAA 5M53A 1GZ8A 2VTJA 2QO9A 3HZTA 3QQGA 4TZRA 5HD7A 1IAJA 3Q2JA 5JGBA 2RFDA 4USEA 5EM8A 5JEBA 3QRTA 3W8LA 2F7XE 3ODZX 4CEGA 3OTVA 3W2RA 5B2LA 2WTVA 3ZDIA 3DB6A 1GY3A 2NRUA 5K4JA 1YW2A 3HV6A 2F4JA 4RQVA 3C4WA 4G6NA 5J9YA 1OECA 5J9LA 5EFQA 2C1AA 5A4CA 4K8AA 4PX6A 5GZ8A 2GQGA 3DQXA 3KREA 3E8DA 4YURA 4ZXTA 3IOKA 2JKQA 3ZUUA 1VZOA 2C1BA 2GSFA 1W8CA 3LQ3A 5ANIA 3MPAA 3KRRA 3GCVA 2GTNA 3FLNC 1ATPE 3HRFA 3QF9A 4I4FA 4YJVA 3R7YA 3ZLXA 5K0XA 4AXFA 3SXSA 4QPMA 1OKZA 4M0YA 2HELA 1UKHA 2HZIA 3QQUA 4UN0C 2PVNA 4XH6A 4XNEA 5IU2A 4OR5A 2UZWE 5H8GA 5E4HA 2XIRA 2F2CB 4NKSA 4MTAA 4RIXB 4RSSA 4F7JA 5A14A 2RGPA 4MHAA 3GP0A 4UB7A 4U97A 3UODA 4GT3A 3LQ5A 3EZVA 3EFLA 4X2NA 5HE0A 1BUHA 1RW8A 2XIYA 4AZFA 4QP1A 5CU4A 5IEXA 2BHEA 5L2IA 3UNKA 4FKUA 3K5VA 5AA9A 2X7OA 2H9VA 4DGNA 4ZTLA 2CGWA 4Z7GA 3R9HA 4MK0A 5KKRB 1L8TA 2PVRA 3JVRA 1PKGA 2ERZE 4XUFA 4IX3A 1ZLTA 5DMZA 3T9IA 1ZOEA 4ITHA 4CKIA 5HO7A 3L8PA 4FV3A 4IQ6A 4NSTA 4O21A 4KB8A 4BRXA 3LJ0A 2IW6A 4F78A 1WBVA 5HBEA 2EXCX 2YISA 1IRKA 2JIUA 3AC2A 1FOTA 1TQPA 3MH0A 4BIBA 1Q8WA 1F5QA 3BYMA 2QOHA 3HDNA 4DDGA 3W0MA 2AEGA 3W2PA 2HW7A 1PMEA 3PG1A 2JDOA 4NK9A 3EN9A 3WF6A 2BAKA 4BTJA 5EQEA 2VO7A 4BDBA 3FBVA 3GEQA 3JS2A 1XKKA 3AKLA 3TIYA 5CX9A 3V04A 3AC8A 4XV3A 2PVFA 3RNIA 3RM6A 1CSNA 3PZEA 3RCJA 2R3KA 2WTWA 4FTMA 4I6BA 4IFGA 4ZEGA 3TT0A 2ETRA 4D0WA 5BMMA 4DBNA 5M08A 3OWKA 1PJKA 3OT8A 3WZEA 4F09A 3GU6A 3HRCA 3ULIA 4FUYA 5C8NA 2Q0BA 4JOAA 3UQGA 3UQFA 4IM0A 3O96A 4O7TA 3FZRA 3LHJA 3R9DA 4YTCA 2DS1A 3HMMA 3QWJA 4L67A 4MWIA 4YNEA 5JRQA 4QMYA 2ZV9A 3H9FA 2VGOA 5AV4A 4I1ZA 2UV2A 2PY3A 1SVGA 4IWOA 4RJ8A 3ZO3A 3I6WA 4YC6A 1I09A 3PPZA 4G9CA 2P2HA 3RKBA 4ACMA 1A06A 1Q97A 2X9EA 3GFWA 3NNXA 3KN5A 3CS9A 4EONA 3PA5A 1YVJA 3SGCA 4PTEA 3CJFA 3W0SA 2WQBA 4DYMA 3MFUA 1T45A 3E93A 4KWPA 4ACHA 5DFPA 1CKIA 5FXSA 3WARA 5B0XA 3KY2A 3SV0A 3MI9A 5HE1A 3R22A 2ZM4A 2ITQA 2PE0A 3DJ6A 2WHBA 1TKIA 4C61A 2ZV7A 4TWPA 3HV4A 3KXXA 3FQSA 4S31A 3Q04A 2JC6A 2LAVA 2PU8A 4L6QA 1CM8A 3NGAA 3KCFA 2O5KA 4UWCA 3VW8A 3CEKA 4PMMA 3HP5A 2PL0A 5AIRA 3T8OA 5I9ZA 1KE5A 5ETIA 1JKLA 3PFYA 3NMUF 3FMEA 2GFSA 4KIKB 4FUXA 2OKRA 4G3CA 4MYGA 4RZVA 4F70A 4DE4A 3QAME 4BWPA 3TG1A 3LCSA 3VVHA 4R8QA 5IMXA 4BDDA 3UYTA 5CEKA 3UQCA 3FYKX 1M52A 4A9YA 5CAQA 3LLTA 2XARA 1WVWA 4IFCA 3FPQA 5FGKA 5DH3A 2XJ0A 2CNUA 2A98A 2C30A 4M84A 4N57A 3NUSA 4Y72A 4FYOA 3QCXA 4XBUA 3UOKA 4D55A 2QD9A 4XHKB 3T9TA 2QG5A 3QALE 4AXDA 3BU5A 3NYOA 5M44A 4DA5A 1R3CA 5GINE 4D2RA 1JOWB 2W06A 4C2WA 1EH4A 3PLAE 1I44A 1JBPE 3E63A 5A9UA 4QMLA 5L8KA 2J0LA 5LOHA 1M7NA 3QC9A 3SW4A 3TWJA 5HNBA 4F65A 2PK9A 2BZIB 3FEGA 2HWPA 2XNPA 2JIVA 3C1XA 4ANMA 4A06A 5CVHA 4CFWA 2NNWB 3IW4A 2OIDA 3NVKI 3C4CA 2B53A 2F7ZE 3IW6A 3ANRA 1OPKA 2XNNA 4ERKA 4G16A 4ZMFA 2OH0E 1TVOA 3SG9A 4YO4A 5M09A 5AJQA 2XIKA 5HLPA 3WILA 3SLSA 2WIHA 4BGGA 2IEWA 4EHZA 4YHFA 5CF8A 4PPAA 5AAFA 1URWA 4LQMA 3G15A 4I6FA 3EHAA 4FSMA 4FEQA 4ACDA 3K54A 1KSWA 3O50A 3VO3A 3NAXA 3A4PA 3PP1A 2OJIA 4FTUA 2EXMA 1Y8YA 4JI9A 1WBTA 3OWPA 3B2TA 4FSWA 4JG7A 5E8ZA 3VHKA 3OT3A 2F7EE 2Y6MA 1Q8ZA 4RJ5A 2IJMA 4X3FB 4FL3A 4EZ5A 2XIXA 1REKA 4MF1A 3V5PA 5AV3A 3NVMB 4WSYA 4FX3A 4XOYA 2FH9A 4CGAA 5CU6A 4EOJA 2J4ZA 4FKOA 4NL0A 4EK3A 2BHHA 5E1EA 2RG6A 2O0UA 2UVYA 3IONA 1BKXA 5J5TA 4K77A 4RIWB 3D7ZA 2E9NA 3WZKA 2CCIA 4YTFA 3P0MA 2YIXA 3Q60A 4HCVA 4DHFA 4DCAA 4U42A 3QTXA 5BVKA 3ITZA 4Y5QA 4ZS4A 4DBXA 4D2PA 4DH8A 4F9WA 2ITYA 4EOMA 3ODYX 4PF4A 2YERA 5EW8A 3ZFYA 1NY3A 2IO6A 4C62A 4EOLA 3EJ1A 3BLRA 2I0YA 4C3FA 4FF8A 1J91A 4FV6A 4NM0A 4P5ZA 1XBBA 5TF9A 4AXEA 3LXPA 5DPVA 2OZAB 4IM2A 3I60A 3IPHA 4FR4A 4KS7A 3MPTA 2KULA 2YCQA 4FKRA 2J51A 2RFEA 4FV1A 4MNFA 4XV1A 4UXLA 3BGQA 1GAGA 4FKLA 2CKQA 5K3YA 4FTQA 5I5ZA 3WE8A 4ZY5A 1ZOHA 5BVEA 4WUNA 4JQEA 4QMMA 3FMMA 5IZFA 1BLXA 4XCUA 4E1ZA 1XH4A 4UMQA 3FMNA 5B2KA 3PY3A 3R8MA 1NXKA 1OB3A 4BWXA 5ITAA 2VTPA 3R1NA 2QOIA 1H28A 2OF2A 2VTOA 3R8UA 5J8IA 3TACA 3HECA 2Z2WA 3PVUA 4DH5A 3V8WA 1XH6A 4C4EA 3E3PA 4FG9A 4BN1A 2F9GA 2VTNA 3LFEA 5IA1A 1JWHA 2XKEA 3Q4ZA 4GFMA 3ELJA 3U4UA 5CAUA 1XMMA 1SZMA 2X6EA 2YA9A 3MBLA 5BMSA 4G2FA 4Q9ZA 3CP9A 2A2AA 1UKIA 3D9VA 2WTKB 3GXLA 4K33A 4QQJA 5M55A 5BNJA 1G8KA 1BYGA 2QODA 1PXLA 4FV2A 4KNBA 4EWHA 3FAAA 1GZKA 1M14A 3QX2A 5M4UA 4DF3A 4E6CA 3AOXA 3MFTA 4KRCA 3TJCA 4DG3E 3S3IA 5HLNA 1ZWSA 3A8XA 4IVDA 5IQBA 3Q32A 1REJA 3DBQA 1CTPE 4EOIA 4EJ7A 4O7LA 4J8NA 3V6SA 4ALVA 2IPXA 4JJRA 4RA5A 1UU8A 1JPAA 2X9FA 3MVJA 5CEIA 3RK5A 3FL5A 3OXZA 2C3JA 4DTAA 3UOLA 5M06A 2OXXA 4YZCA 3TUDA 1IA9A 2WNTA 4FKJA 3TKIA 5EQYA 4M66A 3PY0A 4ZSJA 3RK9A 4O27B 4E4NA 3ATTA 3ZXTA 4KBKA 1OL5A 4CRLA 4LRJA 4C34A 2QI8A 4FK3A 4IDVA 2G2HA 5DR6A 3I5NA 3RPYA 4Z16A 2WMQA 4A9TA 4M69A 3TKHA 5AR2A 2HYYA 3UPZA 5HO8A 2OZOA 5FD2A 3HA8A 5BV3A 2JEDA 3QX4A 4H58A 1G3NA 3TNHA 3WF9A 3R2BA 3FXXA 3ZZEA 3BBWA 3R8PA 2VTQA 5EHLA 1YXSA 4G5PA 4QMPA 2ITTA 3OUNB 2R0IA 1RQQA 3TTJA 3LJ1A 1ZZLA 4PMTA 4QMNA 1JLUE 1KV2A 1XH7A 4E6QA 5AADA 1G8JA 2UVZA 2Z7LA 3KB7A 3Q2MA 5CQWA 2GNFA 3FLSA 4PRJA 5LVOA 4LOQA 1A48A 4O2ZA 3V5WA 4ZAUA 4MXOA 1OZ1A 1ZRZA 4YJUA 5HHWA 4QP7A 4C4HA 4ZJIA 3TUCA