2XBJA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
286
Chain Sequence
VYPKALRDEYIMSKTLGSGAGEVKLAFERKTCKKVAIKIISKALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design of Potent and Selective 2-(Quinazolin-2-Yl)Phenol Inhibitors of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
total genus 90
structure length 286
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xbjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xbjA01
1QPJA 3ORPA 3EQHA 3SW7A 2PY3A 4FK6A 3KA0A 4I5HA 3VS4A 3VO3A 1JAMA 3HUBA 2Y9QA 2CGVA 3DNDA 4BTJA 4BYIA 2RF9A 5L6OA 3UZRA 3NYOA 1UWHA 3Q9YA 1PY5A 3FMKA 5DBXA 4NYEA 3PZHA 4KBAA 3MH0A 3QYZA 4O7RA 4ID7A 5CEMA 2QLQA 4AZSA 3ANRA 3CJGA 4RFYA 2JC6A 4FTIA 5HO7A 1O6YA 4RRVA 3ATSA 4Q2AA 2QOKA 3EN5A 4FG7A 4C38A 5IA3A 3R8UA 3NYVA 3LHJA 5AAGA 3W1FA 1FMKA 2GPHA 4LV8A 3BV2A 3FXWA 4QTBA 2GU8A 5T3QA 2ZM1A 4BN1A 2VNWA 2XYNA 3PTGA 3PP0A 3R2YA 4BCGA 4EKLA 1OMWA 2BZJA 1DM2A 4JLCA 4ZTMA 2QO2A 3NX8A 3QCQA 5IA4A 1REKA 2GNLA 4EH5A 3UOKA 4AW2A 4C7TA 3WYYA 1ZMVA 2B53A 3SD0A 4DTKA 3GUBA 1IASA 1OPLA 4MKCA 4IDVA 2GS6A 5HEZA 4O2ZA 4JG7A 4J71A 2YIQA 3R30A 2GFCA 2QOFA 3RAWA 4C3PA 4BZDA 4CG9A 4CMUA 5AUZA 4XOYA 3RHKA 3PA5A 4I0TA 2G15A 1Q41A 4IM2A 4PMMA 1H0WA 2XKDA 3BE9A 3KRRA 1MRVA 4FTOA 4QMOA 3VBTA 3VUHA 5KNJA 4LRMA 3ZLXA 4F1OA 1UU8A 5IQBA 2PZYA 5JT2A 4JR3A 2NO3A 5E8ZA 4ZSJA 3R83A 5I9WA 4E4MA 1WVWA 3D2IA 4OTRA 1H24A 3C0GA 2Y4IC 1TVOA 4OTHA 3FLYA 3VAPA 3SG9A 5IQCA 1UNGA 2EXMA 4UB7A 3DFAA 3QTRA 4K33A 3WF7A 4FR4A 5GZ9A 2C0IA 4TNDA 4R1VA 5AUYA 5ANDA 1FVVA 5M56A 2DQ7X 1LEWA 3CTJA 2IZRA 3DKFA 4G3FA 2FVDA 5FLFA 4A07A 4X2NA 5C8MA 4CKRA 4GKHA 4QTAA 4DBXA 2HAKA 4AT3A 4LI5A 4FKTA 2X7OA 2Z7SA 4YU2A 3UQGA 2Q0BA 3DS6A 3F82A 3NUPA 4B99A 4CQGA 5J5TA 1X8BA 2J0IA 4HCTA 4CMOA 3OXIA 4MF0A 2GHMA 3EL8A 3POZA 2BRHA 5K4IA 5AV2A 4EOPA 2RG6A 2WEIA 5J5SA 4IACA 5J9LA 2XM9A 3MB7A 3C5UA 3DDPA 3I6UA 3WZDA 4CFWA 5KMOA 2PMOX 2OG8A 3KQ7A 3Q52A 3ALOA 5IH4A 3CQEA 4FA2A 3OWLA 3IW7A 3DFCB 4KIOA 3FHIA 3SRVA 2RGPA 3IG7A 5HNIX 3I79A 2BILB 1U4DA 4EL9A 3DXPA 1UNLA 5HX6A 3IGOA 2XCHA 4E5AX 4L00A 3F3TA 3ZFYA 3R7IA 4FTQA 3VF9A 4FVPA 1OITA 1W84A 4BCHA 3IW4A 4RQKA 3M11A 3P4KA 4D4SA 3BZ3A 4AX8A 4EWQA 1JQHA 2PUUA 2XM8A 5F20A 2W9ZB 2YJSA 4O7NA 3FUPA 1Q8UA 4CZYB 3ZRMA 3ORIA 4GVAA 3EHAA 3HZTA 5J9YA 3SVVA 4AT5A 4CV9A 1J7LA 2R5TA 4U43A 3NUNA 4I3ZA 1XH7A 1YOLA 3PRFA 4I1ZA 3NMUF 3B2TA 4W9WA 2RFDA 3I7CA 4XS2A 4ANQA 3GCVA 3GFEA 2P4IA 1R3CA 2O64A 4YJTA 3WBLA 3T3VA 4BY9E 2ETRA 3H9RA 5KX8A 2W1HA 3DK3A 1E9HA 5AMNA 5JK3A 3HRFA 4ASDA 4C61A 3LOKA 2CGXA 3PE1A 2BRBA 2QOLA 4TXCA 2XNPA 5HO6A 3BYVA 4MBJA 5AAFA 3TZMA 3S00A 5M06A 4APPA 3MFRA 4TN6A 3SA0A 3GVUA 3TTJA 1R78A 3AMBA 1BKXA 3O7LB 3POOA 4NM5A 1PF8A 3OW4A 3JXWA 3MY0A 5HBEA 3QX4A 3NZ0A 3PFQA 3F61A 4JIKA 4D2TA 3PPJA 1TKIA 1XWSA 5IQIA 2F2CB 4QNYA 2Y4PA 3MPAA 1WZYA 3ZSGA 3A4PA 4DFZE 2WTIA 4ALUA 4O7SA 4QPMA 5KE0A 2HELA 4FF8A 2A4LA 4JOAA 4BICA 1KV1A 2BALA 4NH1A 2IVSA 4GS6A 4LL5A 5DHJA 4PY1A 3BGPA 3F2AA 2JDOA 5CAVA 1BL6A 1KE6A 4R7BA 1Z5MA 1FQ1B 4D55A 2UUEA 3KCFA 4M69A 3Q9XA 5JGBA 4U3ZA 4CG8A 2OI4X 4M97A 4U40A 4XNEA 3ZXTA 4ASXA 4BZOA 3Q04A 2PVNA 4DEEA 2BVAA 4FV5A 2E9PA 3OS3A 4EOQA 3K54A 3EYGA 4AZTA 5CSWA 3Q2MA 4O0VA 3GQLA 3FMEA 3QWKA 1GIIA 4WSQA 2KULA 5CVHA 1RJBA 5HG5A 1H01A 4KIQA 3SOCA 4BKYA 3PXKA 3BBTB 5KMLA 1B6CB 2W9FB 5FM3A 2X2KA 3VW8A 4GIIA 4JBQA 5LVOA 1Q3WA 5BUEA 5CANA 3OD6X 2XJ0A 3QF9A 1YWNA 4I21A 4M66A 1DI8A 3R7UA 2CCHA 1BI8A 3OUNB 1LR4A 3DA6A 2P0CA 4I24A 4EHGA 4XYFA 2OIQA 3AC2A 4C35A 1OIYA 5B2MA 3UQCA 2WOUA 4MXAA 3WF8A 2A2AA 2G2HA 3NCZA 3QKMA 4QP4A 3R1YA 3ZBXA 2UZLA 4FK3A 4PQNA 4AXAA 3PE2A 3MESA 5E1EA 1OPJA 2NPQA 2YJRA 4X2KA 4X6RA 3VUGA 4CFFA 4DT9A 2RG5A 5IUGA 4HVGA 3SX9A 2PMIA 3DZQA 3COKA 3D7TA 4XUFA 4MXOA 3SOAA 3G33A 4FIEA 3MFUA 5AP0A 4NW6A 2JAMA 2AYPA 1HOWA 2QHMA 2IN6A 3PA3A 5FDXA 3FQHA 3NYNA 5FBNC 4WG3A 4FZ6A 3A99A 2GCDA 5CU2A 4DG2E 3OFMA 2XP2A 3UODA 1NY3A 2BFYA 5EDQA 3KVWA 3TNIA 4YPDA 3F69A 3BX5A 2FO0A 1QPDA 4DC2A 2XA4A 1P4OA 5E90A 4X2FA 4QMVA 5FEQA 3CY3A 4UXLA 1WVXA 3N4UA 3I0QA 3IQ7A 1OL1A 3NWWA 4NM7A 5EDPA 4AFJA 3QQFA 4BCNA 5A4EA 4FKRA 4ZY5A 1H26A 4DEIA 4EHEA 2BZIB 4QYHA 2I40A 5JMSA 1WAKA 3I4BA 3V8WA 5CZHA 3RNIA 5CALA 5CAQA 2VX3A 3IO7A 3GC8A 3P78A 4BDAA 3D5WA 3AT3A 3G90X 2WMTA 5DVRA 1XBCA 2I6LA 4QMXA 4YMJA 2R3OA 2X7GA 2EXEA 4KKEA 5DWRA 2PE0A 5IA1A 3HDNA 2YISA 4XG8A 4X0MA 3HAMA 4JT3A 5F9EA 3RP9A 3QYWA 4D9UA 4FX3A 2VX0A 3EKKA 4R5SA 4F7LA 5GIPE 4TPTA 4AFEA 3P79A 4EHZA 3LMGA 2HIWA 4CVAA 5H8EA 2G9XA 2R7BA 4TWCA 5C03A 5KMIA 3MSSA 3T9TA 3ZC6A 2R3RA 3NS9A 4IB0A 1PMEA 3KXMA 4OTDA 4Y8DA 5DOSA 4X3FC 5AR5A 4CZTA 4YTCA 2JITA 2UVYA 4YJOA 2CJMA 2OJJA 4DGNA 4I5PA 4ZZOA 5LJJA 3TG1A 5B0XA 3U8WA 5JFVA 5B2KA 4HW7A 2Y6OA 3DT1A 4YTHA 4PUZA 4O0SA 3ZFXA 4DLJA 4F1TA 1H27A 3FMDA 2XK3A 4GCJA 3RPVA 5E9EA 2SRCA 2JKQA 5DI1A 3UP2A 5LARA 5IDNA 3GOKA 3ZLWA 4FYNA 3QGYA 4D9TA 2ITPA 3L9PA 1KSWA 3R8LA 3OTUA 2VN9A 4MEDA 2WNTA 4YSMA 3IW6A 3BQRA 3C4CA 3IOPA 3IPHA 1ZY4A 4AU8A 2GNIA 3EQDA 4FV3A 4Z16A 4LMNA 2VAGA 3E64A 1UV5A 3AD4A 3BBWA 3FEGA 4M14A 4P5ZA 4GIHA 2X6EA 4FOCA 2O63A 5HVJA 1OZ1A 3PRIA 4ASZA 4HOKA 4LOQA 4F7NA 5EOLA 1M17A 4RMZA 2QI8A 4K2RA 5CU4A 1Q3DA 1Q8YA 2QODA 1YWVA 3ZONA 4O7YA 2IVUA 3F88A 4FEVA 5L4QA 3RAKA 4D1SA 5L8LA 2YIWA 1Y8GA 2NRYA 3CTHA 3DGKA 2GS2A 2ONLA 2X39A 4ZZMA 2Z7RA 5ANEA 1DS5A 4XV1A 3T3UA 3NW7A 3UDBA 3TUDA 4J53A 5C9CA 2W4KA 3E62A 4XHKB 3WARA 4I23A 3UTOA 3R63A 3OEZA 4IX5A 4JXFA 3R7YA 3B2WA 3TACA 5E1SA 5ACBC 4RVKA 2VTPA 3HECA 5HQ0A 5AUXA 4XG9A 4ALVA 2WXVA 4K9YA 3ACJA 1PXLA 3M42A 4XP0A 3QTZA 2J7TA 1G3NA 4B8LA 4JR7A 5DPVA 4C3RA 4HVHA 2WPAA 2KTYA 4DEHA 5I3RA 1FOTA 5DIAA 3QQJA 3W8QA 5KMMA 1PXJA 1YXUA 4IHPA 4DFYA 1AD5A 3QQLA 2ZV8A 3IKAA 5BVOA 1ZOEA 4YJUA 2NRUA 5GINE 3HYHA 2PVLA 5AP7A 4CV8A 4D0XA 4DGMA 2GQSA 4NW5A 5AUTA 5HVKA 4M68A 5CU3A 3NUUA 3TL8A 4I4FA 4GT4A 5BMMA 4JNWA 4TZRA 2PZPA 3BLHA 4IJ9A 3FYKX 5AIRA 1FBNA 1OBDA 2PVFA 2BDJA 3ZRKA 1F0QA 2IWIA 4ANBA 4BIBA 4IZ7A 4HPUE 2RKUA 2VWVA 3AD5A 4PV0A 3PVBA 2ZV7A 4S31A 3B8QA 3OXZA 2LAVA 4QTCA 3KMMA 2WFYA 2XB7A 3E8NA 3O17A 5GJFA 3MBLA 2FSLX 5HGIA 2A19B 4EQCA 4ZTQA 2OF2A 3C50A 4CLJA 4E6AA 3CKWA 2BHEA 3PSBA 5F95A 4P2KA 4QYYA 4ANMA 2YN8A 4WBBB 3IECA 4O84A 5M09A 2C6OA 3O7LD 1BUHA 4AA5A 1XO2B 1REJA 3BEGA 3DV3A 3QUEA 2IVTA 4YGAA 3RWQA 4UX9A 4KKHA 2QNJA 4IXPA 4JRNA 2W5HA 2F57A 4YO6A 3C4ZA 4GJ2A 3G0EA 4AZEA 5L8KA 4CMTA 4Y73A 3NIEA 4CTBA 4C4GA 5AUUA 4Z7HA 4ZLZA 4ZZNA 1H07A 1K9AA 3VVHA 5JFXA 4QQ5A 3LVPA 2UV2A 4AE9A 3LPBA 3RZBA 3ZEWA 4AGCA 4U6RA 1JSTA 3LAUA 4MVFA 2C3IB 4LFIA 1BX6A 5IA2A 4AOJA 3EQBA 4UYNA 4QMMA 1PKDA 1IAJA 1YDRE 2XK8A 3KK8A 4PMSA 3NVKI 5JSMA 4WUAA 1IRKA 2OSCA 4KIPA 1BI7A 5H9BA 4WHZA 4BDIA 5AR8A 1GIHA 1R0EA 1SVEA 3G51A 4HCUA 4E8AA 4JJRA 3TDWA 5AV1A 3ORLA 4IAIA 4IFGA 4J95A 4DLIA 2W1EA 4D4RA 4J96A 4EUUA 3WF9A 2YACA 1XBBA 4FTMA 3UBDA 3MIAA 1RDQE 3DY7A 4ACCA 5HIEA 1Q8TA 4OAUC 3KULA 2OXDA 4IVBA 4JG6A 4RLLA 1ZWSA 2OKRA 1M2PA 2QKRA 4XP2A 3ANQA 3CEKA 3MH2A 4FTLA 4F0IA 3F5PA 3W55A 2VWZA 3DBQA 3IOKA 4ZJIA 3VQUA 1G5SA 4QMLA 3FY2A 2R3HA 5AX9A 4RZWA 3KMWA 3CJFA 3FMMA 3VULA 4V0GA 5AA9A 3ZHPC 5EYMA 3VBQA 3QRKA 3W2QA 3QD3A 4II5A 4N6ZA 4F7SA 5KUPA 4QD6A 4RVMA 4BVUA 2OLCA 2UVXA 3FQEA 4IAAA 4K0YA 3UVQA 2PUPA 3GP0A 3O23A 4YP8A 1FVTA 4EOSA 4BI1A 3MPTA 4FT9A 3RK7A 5KHXA 1P2AA 1GZNA 3OY1A 5BVNA 3O8PA 4FODA 3VRZA 5JN2A 4FTNA 3NUXA 3KXHA 2CDZA 3WF5A 1Q62A 4ZEGA 4R8QA 2XNEA 3FLNC 4L7FA 4RIXA 4RJ8A 1H1RA 4R78A 4NK9A 1KWPA 5LVLA 4BCMA 4RJ4A 3H9FA 2GNFA 2V5QA 4F99A 4JRVA 3S3IA 3SQQA 5E92A 4E3CA 4IB1A 3PWDA 5C27A 2VZ6A 4D2WA 5A6OA 4RX9A 3Q4CA 5IH6A 2WQNA 2HWOA 2ERZE 3BEAA 3D94A 5FGKA 3ZBFA 3Q5ZA 5EHYA 3NAYA 5DE2A 2VO3A 5HVYA 3PXYA 3EFLA 3G6GA 3RK9A 3PA4A 4D0WA 3TIYA 2OK1A 3RJCA 3NUYA 2GMXA 2R3JA 3MVJA 4MTAA 2Z7LA 3D2KA 4QMTA 2WTVA 2R3IA 4O38A 4DGGA 5DLSA 5F94A 3TV6A 2ITZA 3C4WA 3G2FA 3QTSA 4YJVA 4MD8E 4QTEA 3LQ3A 5AM6A 5GJGA 3PY0A 3LM0A 3OOMA 4FUXA 5AP3A 2R2PA 3HP2A 5J95A 1I09A 3V5TA 2OJ9A 2OXXA 4BIEA 3BCEA 5FRIA 4FTUA 1K2PA 3CBLA 4MXZA 3NEWA 2YABA 5LVPA 4O1OA 4PRJA 3LFAA 3BV3A 4L3LA 4R3RA 2REIA 3G9LX 4KKGA 5EI6A 1NVRA 4EH2A 4E73A 2EUFB 4HZSA 3WZUA 3UIXA 4R7HA 1ND4A 1KE7A 2XK4A 3D9VA 5HE3A 3VUMA 3LFNA 3OF0A 3QALE 5AR7A 5DFPA 1PMVA 4E6CA 4R77A 3QTXA 3T9IA 2QG7A 4GV1A 3AC4A 2ONLC 3LXLA 4EKKA 2Y8OA 2WMSA 4ZTSA 5BUJA 4F6SA 2AC5A 4X3FA 3EQIA 2BKZA 3FZPA 3WYXA 3A4OX 5L2IA 2XVDA 4O96A 5CEKA 5JZJA 3MN3A 4C36A 2PZRA 3DQWA 3PJ8A 4W8DA 3TTIA 1OKYA 4ZTHA 1SVHA 5AP2A 5K5NA 4IZAA 2C5NA 4L46A 4BGGA 5IF1A 1YKRA 2C4GA 3ODYX 3R21A 4JAJA 4M7IA 4QMYA 5CS6A 3AT4A 4FV6A 5FEDA 4NEUA 4FZAB 1XH8A 4NCTC 3OBJA 2PMLX 4H1JA 4RFMA 4WRGA 3ZO3A 4DCEA 4O7LA 4CT1A 3IW5A 4GVJA 4GYIA 3KRJA 3FXXA 3P0MA 4HGTA 4RLKA 2CN5A 4YLJA 5BYYA 4HYUA 5ANJA 4G6LA 2V55A 4ERWA 4PDSA 3RPSA 4EK6A 3UO5A 2ERKA 3R73A 4CGAA 3FLSA 4QYEA 3QC4A 4X6QC 2GTMA 5EM8A 2VV9A 3L1SA 2QR7A 3E92A 3OT3A 4MXCA 3EN7A 5L8JA 5LVMA 5IQGA 2CN8A 4FT7A 3PYYA 3RCJA 4YHJA 2X0GA 1PXKA 2CSNA 2I0EA 3BGQA 3MA3A 4IWDA 3SLSA 4DEGA 3PPKA 4EJ7A 4YZDA 4XEYA 5D12A 1SM2A 2F7XE 5DT0A 3FHRA 3R1QA 5C4LA 4CRSA 3ZXZA 4WG5A 3GC9A 5LMKC 1UU3A 5LOHA 2CKPA 1IA8A 3A7GA 3KC3A 3BHHA 3E93A 3F5GA 3A7FA 3V5WA 5IQDA 3CD8A 1IAHA 3TI1A 4KUJA 4B4LA 2OGVA 3QQUA 1XJDA 4KAOA 3MJ2A 3BRBA 3ZM9A 3Q6WA 4Z3VA 3V5JA 3H10A 4G5PA 4F6WA 4O0YA 2UZBA 3R8ZA 4MD7E 3ITZA 2G2FA 5CNOA 5LMAA 3Q9ZA 2YCSA 4MAOA 4WBOA 2XJ1A 3UJGA 2PVYA 5E4HA 1PW2A 2PMNX 5M08A 2X8DA 3ZSIA 1PRYA 4QP8A 2JIIA 4IAYA 3LM5A 3QCYA 4NZWB 1TQPA 3ZSHA 3BU3A 4OBQA 4KSPA 4GUBA 3VN9A 2B7AA 4FSZA 4H1MA 4I6QA 4QP6A 3TJCA 2FUMA 3RAHA 5D7AA 3F66A 3EQPA 5J7BA 3H3CA 2ZDUA 1OL2A 4D5HA 2EWAA 1ZARA 2C1BA 2QD9A 3G6HA 5E8VA 3DQXA 3VUTA 3ZDUA 2IVVA 3ZH8A 4EJNA 4AP7A 4CXAA 3ZLSA 2C3JA 3M2WA 4A7CA 3F2RA 3R8PA 5C4KA 3E88A 2P33A 3REPA 2YAAA 4WOVA 3QA8A 4ANLA 5CEPA 2OW3A 2E9OA 1V0PA 2YHVA 2ZVAA 3FI4A 3ZU7A 4D4VA 2BRMA 1XH5A 5CVFA 3MDYA 4XH6A 4H05A 2J2IB 3WE8A 4BL1A 4ZTLA 4B6LA 3OZ6A 4RX5A 2OWBA 3U6HA 4GUEA 4YURA 5HG9A 2YLEA 2ACXA 2WMXA 4BTMA 4CZUA 4UEUA 2VWWA 3NVMB 1OL5A 3EFJA 3GU5A 3HV5A 4C59A 1YXSA 3MFSA 4TT7A 5BVKA 4ERKA 4BYJA 3ZLYA 3COIA 3DJ7A 1PXPA 4GG7A 4IE9A 4XG3A 3RNYA 3MVLA 4A06A 4CCBA 5JFSA 2UZEA 4ZLOA 4MQ2A 3GB2A 1H1QA 2ZM3A 2Z60A 3H0YA 4HVDA 2QU5A 2VGOA 1SNUA 4YJPA 3FZTA 5A4QA 2I0HA 4BBEA 3QQHA 3R28A 4DFUA 2PVHA 3QHRA 4NL0A 4FI1A 1LP4A 3IDCA 3KXZA 3FWQA 1YOJA 3SXFA 3PXQA 4JBPA 4BC6A 4Q5EA 4BFMA 2OIBA 5EW9A 2HW6A 3FQSA 3R00A 4FNYA 4GK2A 4IZ5A 4G3DA 4NFMA 2VTLA 2OZAB 4TYHB 4IADA 3PUPA 4OTIA 3K2LA 5CXHA 5EW8A 2QOQA 4LM5A 5TR6A 4BI2A 2XEYA 3L9MA 2VTNA 3FZ1A 4KS7A 2Y4IB 4GRBA 2XJ2A 4OUCA 5CNNA 3GI3A 2O65A 4YHTA 5DYJA 1PMNA 4JIAA 3QZIA 4DT8A 4V01A 2OICA 1V0BA 3OOGA 1LPUA 2VWIA 5TOZA 4DH3A 5AFVA 4GK3A 4B8MA 4DITA 2B9HA 5CSVA 3TZ7A 5HOAA 2XK6A 2VTAA 5C8NA 4HPTE 1APME 3ODZX 5KBQA 2BRGA 2OJIA 2YDJA 2OFVA 3DAEA 4Q9ZA 4I6HA 5CF8A 1K3AA 3KRXA 1MQBA 3QX2A 5FXSA 2BDFA 3O50A 3ALNA 3BYMA 3UZTA 4ITIA 3DJ6A 5BMSA 3H30A 3GCPA 1XH4A 3RI1A 2X6DA 2C1AA 2DUVA 2OZOA 4YPSA 5AR3A 2V0DA 2ESMA 5AR4A 4HYIA 3F3UA 4XMOA 5ETIA 1YRPA 1YWRA 3PY1A 4XOZA 4NJ3A 5I9YA 3AGLA 2QR8A 3DK6A 4RIWA 4RBLA 3L8PA 5J87A 5DG5A 4IVDA 1YW2A 3LLAA 2V7OA 1CM8A 2UW0A 5JZNA 3C0IA 1W83A 4C3FA 4L3JA 4RWLA 2O5KA 2BIYA 3MTLA 3LCKA 4FC0A 2PU8A 2BZHB 1Q61A 4EOKA 4AZVA 4AGWA 3UO4A 2VTOA 2VTQA 1KOAA 4O6LA 4EWHA 4I0RA 3R7GA 2DYLA 3RWPA 4CEGA 3FKLA 5GIOE 4QP2A 1URCA 2P3GX 4R6VA 3FY0A 4BCOA 3DBEA 2HCKA 3QTQA 4XBUA 3ZM4A 3TEIA 5FQDC 4V05A 4AG8A 5EKOA 1Y91A 2OZAA 3KXGA 4KRDA 2W1ZA 5CSXA 1PXMA 3UOHA 4GMYA 3PVGA 2CNVA 3C4XA 2BAQA 2BIKB 4NIFA 3GBZA 1WBWA 3UIMA 2B4SB 4R3PA 4Q9SA 4YJRA 1CKJA 4C34A 5IQFA 2JDVA 4QQJA 2R0IA 2BMCA 3OCTA 3OC1A 4GSBA 5EQEA 2WTJA 5CZIA 3AC8A 4HNIA 4JS8A 4F08A 4O2PA 3CCNA 1H1PA 3AOXA 2YIRA 2F2UA 4OTFA 4FSTA 4PL3A 4WRSA 2J50A 3VJOA 5DT3A 5IG1A 3LZBA 3FI3A 3U4UA 4K77A 5GNKA 3F6XA 3FC1X 5M4IA 3KGAA 3Q96A 1YOMA 1ZYJA 4QMWA 4QYFA 4DFXE 2X7FA 4RSSA 4PNIA 3R02A 2BAKA 2WMRA 5D10A 4E1ZA 4OW8A 4EOJA 3I60A 1KE5A 3QRJA 4YZBA 5EW3A 4RIYA 3D7ZA 3SXSA 3DAKA 4BTKA 2CKQA 1CDKA 5JGAA 4ANSA 5IMXA 5CSPA 3NNWA 3MY1A 4QMSA 2B55A 4LRKA 2X4ZA 2PVRA 3PZEA 3NUAA 2P2IA 4UY9A 3LCOA 5HE2A 3MPMA 5KMNA 4FNXA 4KBKA 5IQHA 1PXIA 3P7CA 5BVFA 1JVPP 2JGZA 5HLPA 3FJQE 4QQTA 3L9LA 2B54A 2Z8CA 3EZVA 3P7AA 4JX7A 4UWBA 4IH8A 2UZDA 3PXFA 5EI2A 4NWMA 3UNKA 1AQ1A 2WB8A 1XH6A 2C5YA 3GC0A 3GQIA 3EYHA 3JUHA 5DRBA 5H3QA 3CS9A 2VWXA 5HESA 3R9OA 4ZMFA 1SMHA 3ACKA 2CKOA 4GT3A 4EBWA 5EFQA 2W4JA 1JLUE 3FKNA 4W8EA 5CYIA 4ZP5A 2FB8A 3ZUVA 3BYOA 4E4LA 4FMQA 5CAOA 3FMHA 4TYGA 5L2SA 2JKOA 5IH5A 4QO9A 3G0FA 4EOMA 2GDOA 3VNTA 5E8XA 1G8SA 2VWYA 3GGFA 4ACDA 4AUAA 4EK4A 5CEOA 1J7UA 1MRUA 3AXWA 2ITNA 4RJ7A 5JQ5A 4D2RA 5D7VA 3CC6A 3R04A 3RGFA 3ZFMA 2QURA 3UNJA 5EKNA 1YHSA 3HMPA 5DT4A 5JRSA 5DA3A 1Q97A 3UMWA 4W4VA 2HZ4A 4C33A 3OY3A 3HA8A 3HEGA 4I41A 4PP9A 4UALA 5H2UA 1GZKA 3ENMA 1RE8A 4YC8A 3OEFX 3T8OA 2WTKB 3D0EA 4RJ5A 3VIDA 3DKGA 3KXXA 4FSMA 2F9GA 4G17A 1YXVA 3OWJA 4RC2A 5EM5A 4FTTA 4FSRA 4LMUA 4MQ1A 3DDQA 1OM1A 5BVEA 3SAYA 5HIBA 1ZXEA 3LQ5A 4U8ZA 5AP1A 5JGDA 2BPMA 3SW4A 1OPKA 2EVAA 2PZ5A 3A8XA 3KL8A 2Y0AA 5LCJA 3WOWA 1H00A 3HRCA 4UYAA 3AMAA 2WMVA 4TYEA 2C6KA 4H36A 3KFAA 4RWJA 4IWPA 4EH8A 2OF4A 3E8EA 2VTSA 3A7JA 3FSKA 4MXXA 4OTWA 4G34A 2OU7A 4HGSA 1P5EA 3Q4ZA 1YDSE 2VRXA 2XUUA 2EB2A 3MV5A 4LV5A 4O7WA 1JSVA 3FL5A 4ZTNA 4L6QA 4HVSA 2IO6A 4GK4A 5AJQA 2ZB0A 1P4FA 1I44A 3DKOA 2R9SA 5E8UA 3AGMA 1B39A 4X3FB 2WMWA 4OBOA 5AV3A 4BCJA 4C4HA 1OUKA 3U54A 4QP3A 4J7BA 1GAGA 2BZKB 2B1PA 3V04A 2I1MA 2OH4A 3QU0A 3DLZA 4BDEA 3TM0A 3QTWA 3I81A 4O1PA 4IMYA 3M1SA 1ZZLA 5EH0A 4KS8A 3DCVA 1Y6AA 2C6LA 3C1XA 3FE3A 4FL3A 4FVRA 4G31A 2C5OA 2UW9A 2V62A 4RWKA 4APCA 3ZRLA 3MGYA 4JBVA 3KREA 3KEXA 3PG1A 4GW8A 1OIUA 4LGGA 4AOIA 1YXTA 4ZIMA 3KMUA 2CCIA 4IWOA 4M84A 3RZFA 3F3VA 5TKDA 4DEDA 2VUWA 4I6FA 3KY2A 4IIRA 4G2FA 1F5QA 3QAME 2EB3A 3TNHA 2HZNA 4BGQA 4HGLA 3HGKA 5B7VA 5L2TA 4FL1A 4NTTA 5HZNA 3CP9A 2PVKA 5EDRA 4FYOA 5EHLA 3VF8A 3DBCA 2CGWA 3NGAA 2WMQA 1WFCA 4GG5A 1JSUA 3NYXA 3ZDIA 4E26A 4NKAA 2YCFA 3FI2A 4RIXB 4QT1A 2W06A 3ORKA 4ZJVA 5IQEA 2WGJA 5FWKK 1WMKA 3GC7A 4RFZA 3HV6A 3UIBA 1OBGA 2C0OA 2I0VA 4O22A 4U45A 2WQMA 3GCQA 4IB3A 4LYNA 4CRLA 2IW6A 4J99A 4EH6A 5M51A 1FVRA 3ETAA 4EQMA 3V01A 2B9FA 5JKGA 5AX3A 4EZ5A 2CNQA 1BMKA 3DJ5A 3HLLA 3PVWA 1M2RA 3SDJA 3VS5A 5DNRA 4EH3A 2YIXA 3MVHA 4K18A 4XCUA 2Q83A 4FUYA 5TE0A 4L3PA 4QP7A 4B7TA 4DFBA 3AD6A 3DXNA 3FAAA 3ORMA 3V6SA 3R8VA 3NLBA 3RMFA 3ZZEA 5CI7A 3H0ZA 4LUDA 3TUCA 1M14A 1UA2A 5T68A 4U80A 3IW8A 3LMIA 3R1NA 4TYIA 4DINA 5E8TA 3HNGA 3L9NA 2E9NA 5CU6A 3V8SA 5IEVA 1H1SA 2R3GA 4TYJA 1PHKA 4BBFA 4BCIA 4USEA 3F7WA 3LXPA 4EORA 5HU3A 4MNFA 3FPQA 4FGRA 4G6NA 3N9XA 4O6EA 3FMLA 4OR5A 5BVWA 2X2MA 2XBJA 4L8MA 4PMTA 2ITXA 3BPRA 4U44A 3N51A 4MH7A 3KVXA 4EH4A 3GEQA 3F5XA 3Q60A 1Q4LA 3BU5A 4O91A 4FEUA 3P86A 3I1AA 2H9VA 3WIKA 5ICPA 1ZYCA 3IONA 2ZM4A 4EC8A 2GFSA 3TNQB 4CYJA 4UBAA 4RC4A 2PL0A 1J1BA 4X21A 3QQGA 4CKJA 4E4XA 4F9AA 5A4TA 3E87A 3HA6A 3Q2JA 4U5JA 4FEXA 4YNOA 4LQMA 3Q3BA 3FI8A 5FD2A 3NAXA 2C3KA 4AE6A 3QUDA 4C37A 5AA8A 4CD0A 3PPZA 4AN2A 4CSVA 3VS0A 4H39A 3WZJA 1YHWA 5H8GA 4CT2A 5A46A 5FEEA 2VWBA 2GNHA 3QTUA 2IJMA 3LFCA 4IX3A 3OWKA 4P7EA 3AC1A 3RHXA 4I5MA 5K5XA 3EN9A 2CKEA 3W2SA 2VO7A 4ARKA 2ZJWA 2C0TA 2FSOX 4AA0A 4PPCA 1QPEA 2UZNA 2BTSA 5J1WA 3W18A 4MX9A 4LGHA 2WO6A 3S95A 1R1WA 4PTEA 2JFLA 4EC9A 5LMBA 1MUOA 2Y6MA 4FKWA 3FC2A 3KRLA 3C7QA 3V5QA 1XBAA 4GYGA 1WCCA 2ZMCA 3D7TB 3PG3A 5E91A 3S0OA 4L67A 3D15A 5M4CA 2PPQA 5FP5A 3WE4A 4FV8A 4QMUA 4RJ6A 3BWFA 4E4NA 3PSCA 4UMRA 1HCKA 4AGUA 3PIYA 2UZUE 4QMPA 3EJ1A 5AM7A 5A3XA 5EQPA 4EZ3A 3UYSA 4MWIA 3OCBA 2WTDA 4YO4A 2W1DA 3ORTA 2W17A 4EYMA 3FZSA 4Z7GA 4GEOA 4L44A 1HCLA 4M13A 4U3YA 3ZCLA 3ET7A 3GCUA 4FSNA 4DH7A 5AP5A 1J1CA 3ZMMA 3CSVA 1ZYLA 4F4PA 2JDSA 4NM3A 3I0OA 2HYYA 2ZOQA 5DH3A 2C6EA 2B9IA 2O0UA 4JL9A 3TDVA 3Q4UA 2XKEA 4DA5A 3D14A 4RQVA 4QMZA 3IK3A 4D28A 1XQZA 3LW0A 2EU9A 2R3LA 1CKPA 4BDFA 2FYSA 1ZRZA 4C57A 2WD1A 5E8YA 3RTPA 2J0JA 2QOHA 5CI6A 3D83A 4AN3A 4E20A 4JQ8A 3FMNA 4MD9E 2RFNA 3VUDA 4ENYA 2GHGA 5D1JA 3VBWA 3I5NA 4L01A 4ZAUA 3F3ZA 1OECA 2E9VA 4AW0A 5ETCA 4MBIA 2IW9A 3PY3A 3II5A 5KO1A 4FV7A 4IFCA 5IU2A 3EQRA 4YBKA 4HJOA 3R9DA 2E2BA 4OAVB 2R0UA 5AV4A 4BBMA 4XG7A 3OMVA 4GFOA 3VBYA 3VQHA 4TWNA 2RL5A 4J98A 4S2ZA 3BQCA 4I20A 1R0PA 4O27B 3UPXA 2W99B 2PHKA 2R64A 4M69B 4U9AA 4D58A 3W10A 4FKQA 3CE3A 2VTIA 4PPAA 4U81A 4FEQA 4GL9A 3E7VA 3WILA 4L45A 4NTSA 3TN8A 4PL5A 3A7HA 2XNMA 4F0GA 1IG1A 2ETKA 4I0SA 4Z55A 3CIKA 3HMNA 3CR0A 4V04A 5CLPA 5CASA 3RPYA 5AR2A 4L68A 3EKNA 3PXRA 1XKKA 2BRNA 3F7ZA 3AT2A 5K4JA 2XH5A 4UWYA 3FZRA 5TT7A 4E6DA 3A60A 5AAEA 3QZHA 4CQEA 1CKIA 2UZWE 1L3RE 5HCZA 3VJNA 3NRMA 1H28A 2OH0E 4FKGA 2BTRA 3CGFA 4WIHA 5J79A 1U5RA 4F6UA 1CSNA 3ZYAA 1PYXA 1LEZA 1URWA 1VYZA 3P9JA 4JG8A 5HE1A 3CTQA 2XEZA 3V6RA 3QZGA 3UE4A 3NW6A 1PJKA 2G01A 3LQ8A 3QLFA 2RFSA 3TKUA 2R4BA 3MVMA 2BHHA 3RALA 4JQEA 3A62A 1YI3A 4KNBA 4TWOA 4RZVA 1OL6A 2Y7JA 2UW6A 3FLWA 3OHTA 4KIKB 4FGBA 4JBOA 2WOTA 2QOIA 2AUHA 3O8TA 3MA6A 2YA9A 1AGWA 3KN5A 3QLGA 3P23A 2PUNA 3EL7A 3TKIA 3L8VA 2C30A 4G3CA 3WIGA 3JVSA 4ITJA 2VO0A 3KF7A 3E5AA 4Y5QA 2BAJA 3PJ1A 3BI6A 1FGIA 4L52A 3R0TA 5CAPA 4BDBA 5M55A 4ENXA 4F09A 3VRYA 4OGRA 4BR3A 2XNOA 5HORA 4G3EA 3ZS5A 3AC5A 3MY5A 4ANNA 4PNKA 4BIDA 2PYWA 1U46A 1W0XC 2ZMDA 3OG7A 4ZXTA 3BGZA 3AC3A 1E1XA 2WELA 1ZYSA 4FIGA 4L7SA 4DYMA 3NNUA 2P2HA 4YR8A 4OTQA 1ATPE 2XIRA 2XS0A 4WT6A 5AP6A 3L8XA 1WBNA 4BDHA 4CFMA 2VNYA 4QRCA 1VZOA 2BKKA 3ERKA 1UU7A 3QKKA 4MXYA 4R7IA 4MK0A 2C6IA 3OXTA 4FTAA 1H0VA 3TUBA 3BYSA 5CTPA 3E3PA 3U87A 3E7OA 1LUFA 5KMKA 4O0WA 3V5LA 3DK7A 4K6ZA 4A9TA 2HZIA 3P08A 3R6XA 1DI9A 4IM3A 1ZOHA 1B38A 2WQEA 4XV3A 2ITUA 3QRIA 1WBTA 4AOTA 3HUCA 2UZOA 4F9WA 3LCTA 2BR1A 3EQFA 2O8YA 3NNXA 1U5QA 3OBGA 4P5QA 5FTGA 5IDPA 2WZJA 1QCFA 3RINA 1QMZA 3F9NA 2XBAA 3ULIA 5I9UA 3MIYA 4CCUA 3CXWA 4ZSEA 5DEYA 4EHVA 5I9VA 4K1BA 4ZSGA 1W8CA 3GENA 3E63A 4FT5A 3FSFA 4HCVA 4LUEA 4RWIA 4ZOGA 4C58A 5HO8A 3NCGA 2A1AB 5DN3A 4F9CA 4I92A 4W9XA 4DH5A 2QU6A 3G15A 4YTFA 3W32A 3QCSA 3MTFA 3FBVA 5CEIA 4A9YA 2ITWA 4N0SA 4UMPA 2JAVA 1FGKA 2X4FA 4RA4A 4YSJA 2UVZA 5I9ZA 4XG4A 4O83A 4IEBA 5HNBA 4FE2A 3HV3A 1IA9A 3VUKA 5EYKA 4C4EA 5FBOA 4J52A 3V5PA 3K5UA 5IISA 1OB3A 3HVCA 2QO7A 2YWPA 5L3AA 5ETAA 5AP4A 5I3OA 5IQAA 2QCSA 3EB0A 3FLQA 2C68A 3ZO2A 4DH1A 3UPZA 3K5VA 4FIFA 1KOBA 3ZO4A 4K8AA 5BYZA 1ZYDA 3NUSA 4DBNA 3UG1A 4Q5HA 4C4JA 5A9UA 2VD5A 3BKBA 3D4QA 1GJOA 3N4TA 3WZEA 2WTKC 4ONAA 4FIHA 4U42A 5FXRA 4KIKA 3E3BX 4GU9A 5ANGA 4FSQA 4J97A 4YNEA 3W16A 1PKGA 3HV4A 4LG4A 4YLLA 2J0KA 1SZMA 4NKSA 5C1QB 3OROA 2WAJA 3C0HA 1CTPE 3DBFA 2R7IA 3U6IA 4I22A 5C01A 2X8IA 4Y72A 4IX6A 2I7QA 3LMHA 3QD4A 4DCAA 3TZ8A 4IB5A 3BWJA 5EM6A 3S1HA 4IANA 4YC6A 3RKBA 4BHZA 5EI8A 4QP1A 5J1VA 5LXMA 4N6YA 5G6VA 1GIJA 3IDBA 1OIQA 2VO6A 4FZDB 4AS0A 1VJYA 2PUIA 4IM0A 4WNOA 1DAYA 3TKHA 2A0CX 4C4IA 3UQFA 4MBLA 4LL0A 3VBVA 3OP5A 4AGDA 3GT8A 4QYGA 5AIKA 3VW6A 4EI4A 3C5IA 5D9HA 3ORZA 3MI9A 1J91A 4XP3A 3COHA 4GH2A 1YDTE 4W4YA 4A4OA 3O96A 1KE9A 1NXKA 2E9UA 1YXXA 2Q0NA 4I5CA 2Z2WA 2XNNA 3P1AA 4OTPA 2UW7A 4QMQA 4WKQA 3KULB 2PULA 5KZ0A 1O6KA 2UZVA 4XRLA 4GFGA 2JEDA 3SV0A 4FKIA 4YZNA 4ACHA 4EUTA 4M15A 5E8SA 2W7XA 4S32A 2DWBA 2YEXA 3QL8A 3Q6UA 4ALWA 4FV1A 3HMIA 4BCFA 2R3NA 4FKJA 4N70A 5HX8A 3VHKA 3EQGA 5GZ8A 4XX9A 3ZZWA 4FSYA 4OT5A 3UC4A 1T46A 4BDJA 4D4YA 5JFWA 1KV2A 2H6DA 1XH9A 3FXZA 5LWMA 1NW1A 3PJ2A 4XLVA 4AQCA 4RGJA 1UKHA 1W98A 4WSYA 1A9UA 3C4EA 3HL7A 4CTCA 2HENA 3FMJA 3DTCA 3DLSA 3D5UA 4ASEA 1EH4A 1OI9A 4BCPA 4FTRA 4IC8A 3QQKA 2GNGA 3I6WA 5IZFA 5TO8A 1W7HA 2UW8A 1T45A 3R2BA 5HTCA 3G5DA 1Y6BA 2IZSA 5TF9A 3PXZA 4XBRA 2FSTX 3QZFA 4RX8A 2PTKA 5M53A 2JD5A 2C3LA 2O2UA 2QKWB 4L43A 5K0KA 4HNFA 4BWXA 3VS1A 4QPSA 4JDHA 3ORXA 3RPOA 3ZUTA 5L6WL 1OKZA 4P4CA 2ZB1A 4EEVA 5E8WA 2C5VA 2QG5A 3QKLA 5I0BA 4PDOA 2HXLA 2YWVA 1JPAA 5ANIA 3DBDA 2C6MA 4B0GA 2XCKA 4JDJA 4ZMEA 2B0QA 3JYAA 5CY3A 1U54A 3TV7A 3OCGA 4RIYB 2B9JA 3DXQA 3HRBA 3R8MA 2W1FA 2XRWA 3UGCA 3SXRA 2FA2A 5DGZA 4RC3A 4PP7A 2J5FA 4ZS0A 1SYKA 5AUWA 5AUVA 4AF3A 2CLXA 1XHAA 2YIYA 5IEYA 2F49A 2JKMA 1PMUA 4WG4A 4HZRA 4PPBA 5A54A 3VS6A 2H8HA 3CQUA 2GHLA 5HCXA 4YJNA 4EBVA 1PXOA 2IPXA 2XYUA 4F1MA 3LLTA 3OVVA 4C2WA 4V0GB 2VTMA 5CQWA 2ZV9A 4YZ9A 3R9RA 1VEBA 3E8CA 5EHOA 4O81A 3UIUA 5F4NA 4D1ZA 2ITQA 3LFFA 2QOBA 2YM6A 4D2VA 3LJ1A 3THBA 4DG0E 2X1NA 4FTJA 5HKMA 2XIXA 2C6TA 3C13A 3ORNA 3LIJA 3SRVB 1ZY5A 4R1YA 1S9JA 4Y5HA 4IVAA 3R7EA 3ELJA 4H58A 4CFVA 1GZ8A 2W1IA 5CVGA 5JQ8A 2YAKA 2G2IA 4TRLA 5HE0A 2J6MA 4UZHA 2BROA 5IA5A 4BKZA 4F7JA 5J7HA 3PLSA 3R9HA 3O51A 4D2SA 4EK3A 2O3PA 1Q5KA 4FVQA 5HD7A 3GU6A 4G16A 4F63A 3HP5A 4FIIA 2X8EA 5KKRC 3NDMA 3BLQA 3NR9A 2WHBA 2GTNA 3QC9A 4FV4A 3K3IA 5EYDA 5HICA 3EZRA 4GFMA 3A2CA 4D1XA 4JI9A 4P90A 3RPRA 4F65A 4S34A 4YUQA 2JIVA 2FH9A 3I7BA 5FDPA 2J0LA 3GFWA 3PVUA 3NPCA 4EK8A 2RIOA 4CFNA 4M8TA 4DTBA 3SC1A 4FEWA 3KB7A 3OW3A 3JPVA 5M4FA 2VX1A 1GZOA 4PDPA 3V3VA 4EH9A 4BGHA 2WQBA 4GJ3A 3CPBA 2VTRA 5IKWA 3UNZA 4BCQA 3BYUA 3MJ1A 4BZNA 1Q8ZA 4PX6A 3UMXA 3B8RA 3PJ3A 1V0OA 3FZOA 1OKWA 3FL4A 3QUPA 4F64A 2R3KA 4XG2A 1YI6A 3DNEA 2VGPA 4FOBA 5HBJA 2PE1A 1H25A 1YQJA 3OT8A 4C8BA 2W1GA 4IVCA 4EOOA 4F9BA 1WBVA 2UW3A 5A6NA 5EQYA 3CKXA 2W0JA 5KHWA 3H9OA 1W82A 3NW5A 3COMA 3D5VA 5KZIA 3LCSA 3HDMA 2QONA 2HY81 3JY0A 1IR3A 4MF1A 3ZO1A 4X2GA 2P55A 2J5EA 2XKFA 4UV0A 2UZTA 1H08A 5A4LA 4H3BA 4Z9LA 2PSQA 2R3FA 1JKLA 3P7BA 3SHEA 4DN5A 5HTIA 1L8TA 3BHUA 3ZOSA 3CQWA 3PSDA 4FNWA 4N4SA 4FG8A 2VWUA 3JVRA 1KUTA 2JBPA 3O0GA 4YZMA 4OTGA 4HVIA 3KKVA 2WIPA 4C02A 3GXLA 4RIWB 1Q8WA 5CAUA 4AWIA 4J1RA 2Z7QA 3LXNA 1BLXA 4FG9A 3R7VA 5EG3A 4M12A 4USFA 2W5BA 4FKUA 2WEVA 3LXKA 2CHLA 3V51A 5HBHA 1SVGA 4KINA 3BHVA 3GOPA 1CMKE 2C47A 3UOLA 2JLDA 3AQVA 4G6OA 4WNPA 3RCDA 4C62A 2C5XA 2X9EA 3W2RA 3W8LA 4BDKA 4O0XA 2V22A 5DRDA 3QD0A 3DKCA 4FV9A 2OJFE 4WA9A 3ZUUA 4UN0C 5I5ZA 5JRQA 2IW8A 4PWNA 5AWMA 4AW1A 4Y95A 3HMOA 3R7OA 3VUIA 4RT7A 4KRCA 1NT2A 1NVSA 2HK5A 3U9CA 1PYEA 4OT6A 2QOCA 4ZTRA 3GU8A 2VTJA 4E6QA 5BYLA 2YM8A 3TWJA 5B2LA 2ITYA 4NIFB 5FTOA 3QXOA 1WBOA 4FKVA 4ZJJA 5JH6A 3PJCA 4O7ZA 1Z9XA 3DU8A 5HU9A 4M67A 5FG8A 2XNGA 1FPUA 4TL0A 3NIZA 2GS7A 4L42A 2YFXA 2X81A 5DEWA 3W2OA 3QFVA 4BCKA 4BWPA 2BFXA 1A06A 4NT4A 4AA4A 2LGCA 4BF2A 2VU3A 4TKSA 3NSZA 5CSHA 3R9NA 5IMEA 4DGOA 1A48A 2J4ZA 4O0TA 4PTCA 4DAWA 5CU0A 2VTTA 4I94A 4RX7A 4UMUA 5LQFA 5KCVA 4U7ZA 4U0IA 3GU7A 5BNJA 3NNVA 3VC4A 2R3MA 3LFBA 5BQ0A 4NJDA 3U9NA 2JFMA 1GOLA 4Y46A 4JX3A 3VS2A 4DTAA 2WQOA 4JDIA 4M0YA 1DAWA 2V7AA 3FYJX 2GQRA 3EFKA 2YZLA 3QTIA 4I6BA 4U41A 4WUNA 3Q9WA 5EM7A 4BB4A 5L6PA 4K11A 3BHTA 4PL4A 4WNKA 3A61A 2BDWA 4IAFA 2OIDA 2WTCA 2JDTA 3QBNA 1MRYA 4RIOA 4E5BA 4J8NA 4ACMA 3HAVA 2ITVA 5CT0A 2R3PA 5IUHA 4UXQA 2F4JA 2PVJA 5I9XA 5IPJA 2OFUA 3C9WA 3G9NA 3AMYA 1YVJA 4YBJA 5A4CA 4DFLA 4XG6A 3CPCA 5IEXA 4FSWA 4KB8A 4O86A 3VS3A 2HOGA 4D2PA 3LFDA 5HD4A 5A14A 4FKOA 4JDKA 4FV0A 4AAAA 3Q4TA 3U4WA 3PWYA 5F1ZA 4NFNA 3QXPA 2FSMX 4JQ7A 3RVGA 2WMAA 4ACGA 2OJGA 2IZTA 2J9MA 3SKCA 3QGWA 4TY1A 5HG7A 2F7EE 4F70A 2WMBA 2J90A 2JBOA 1JKSA 4XRJA 3BELA 2JKKA 3LFEA 4FKSA 3UOJA 4X7QA 1JOWB 1H1WA 3TCPA 3TT0A 1WVYA 3DB6A 3LFQA 4FTKA 4AZWA 4FKLA 4TTHB 3TJDA 1M7QA 2ZYBA 4X2JA 3EMGA 4S30A 2IG7A 5LMKA 3EWHA 4MCVA 3WI6A 2ETMA 2VTHA 2ZDTA 4IBMA 3PP1A 5H8BA 4DFNA 4I4EA 3N4VA 3MH3A 3FPMA 5EOBA 2IZUA 5ITAA 4NU1A 3Q5IA 2W1CA 2H34A 4OBPA 5HHWA 2XZSA 2W05A 3EFWA 3FKOA 1WBPA 4QQCA 4YJQA 4CNHA 2J0MB 2W96B 3AG9A 5HI2A 2C6DA 1UKIA 4IX4A 2YM7A 4FZ7A 4QOXA 4CKIA 5HLNA 4KSQA 3EN4A 1MQ4A 3BIZA 3MB6A 4G1WA 2XIZA 2WIHA 4FT3A 4QTDA 2HWPA 3KF4A 3R22A 4TYHA 4NM0A 3LJ2A 2XIYA 5ANKA 2JIUA 4F0FA 3SG8A 2YCQA 3OCSA 1S9IA 5CEQA 2ZAZA 5LWNA 4RJ3A 4ANOA 2YDIA 3BE2A 3CGOA 5BVDA 2QVSE 2UW5A 5HIDA 2OXYA 3TNWA 3GU4A 5K0XA 4XJ0A 3MS9A 2YITA 1YHVA 4RVLA 4A9SA 3UO6A 3OWPA 3UVPA 4BDCA 4O0UA 2XIKA 2I0YA 4QNAA 3DPKA 4UMTA 4TW9A 5J9ZA 1Q24A 2QQ7A 4M0ZA 4LGDA 2CGUA 4DGLC 5GZAA 3UZPA 2GSFA 5BUIA 4PF4A 5HG8A 3QWJA 3VWAA 3WF6A 4IDTA 3MWUA 1R39A 4QP9A 4ZSAA 5IA0A 2C69A 3RM6A 4C4FA 1RW8A 4KBCA 3TNPC 5C8KA 5T6KA 3RM7A 4AACA 4RVTA 4ORKA 1OGUA 2F7ZE 2GQGA 3LE6A 1JNKA 4BWKA 5CF4A 4FBXA 5FP6A 1P14A 4RA5A 2HY0A 5E7RA 5GJDA 5IUIA 4PMPA 1J7IA 4AW5A 3MW1A 4MYGA 3TXOA 4LOOA 4E5WA 2WMUA 2YLFA 5DMZA 4FL2A 2PK9A 1O6LA 3DZOA 3KU2A 4C0TA 3SGCA 3H4JA 5HNGA 2BCJA 4FZFB 2FGIA 5GHVA 2QHNA 5CENA 3K3JA 4CLIA 2H96A 5HLWA 2NNWB 3HX4A 4DF3A 5KBRA 3DTWA 5G1XA 1ZZ2A 3VS7A 3LFSA 1FINA 4AN9A 3LJ0A 3RK5A 2QC6A 4XV2A 4YZCA 2B52A 5CT7A 3IGGA 4PDYA 2QOOA 1Q99A 2HXQA 4ZK5A 2X9FA 3CD3A 5CX9A 3WZKA 4ZSLA 4DEAA 2WU7A 3EIDA 1JWHA 5HCYA 1MP8A 2HW7A 3LCDA 5LVNA 1O9UA 2XNBA 4RPVA 3R01A 4YLKA 4EYJA 3QRTA 2CMWA 4ITHA 4IZYA 1ZLTA 1STCE 4FSUA 1Y8YA 4CFXA 4ZS4A 4IC7A 4G9RA 2PZIA 3F5UA 2YM3A 3OTVA 3MYGA 4EZ7A 1UU9A 4HGEA 4WD5A 4F9YA 3KXNA 5M44A 3KRWA 3MH1A 4E7WA 2ZV2A 4FT0A 5L2QA 4EK5A 3BLRA 3F3WA 4EOIA 1TQMA 3JS2A 5DR9A 4H3PA 2YZAA 1V1KA 5DR6A 4ZY6A 4KD1A 4U79A 2J51A 4KA3A 4JAIA 2WU6A 4D5KA 4YTIA 3D5XA 1NVQA 2CPKE 2WKMA 3O71A 3ATTA 1Z57A 3BU6A 2RFEA 3KN6A 5EK7A 5JEBA 3FDNA 3UC3A 5KMJA 4DG3E 3PIZA 4EQUA 2W4OA 4Y85A 3BHYA 5BPYA 3QD2B 1OKVA 2OBJA 4X3JA 3W2CA 1OIRA 3CLYA 3FV8A 2A27A 4KABA 3R1SA 4IJPA 4WNMA 5M07A 4EH7A 2GNJA 4DE4A 1E1VA 5BX0A 2XK9A 3ULZA 3CY2A 1F3MC 2W5AA 4MWHA 4B9DA 4IAKA 3PLAE 3A7IA 3Q53A 5EYCA 3DB8A 3JY9A 4H3QA 5FXQA 4EONA 4E93A 1VR2A 2G1TA 4A4XA 2R3QA 3C51A 4IW0A 1BL7A 4USDA 3ZC5A 4YJSA 4PTGA 4O21A 3QCXA 2XF0A 2YDKA 3L8SA 4O7TA 2HZ0A 2YERA 2PWLA 3W33A 1SNXA 4YHFA 3A8WA 4MNEA 5AV0A 4O7VA 4MNEB 4ZLYA 4G3GA 2X2LA 2RSVA 3UP7A 4UZDA 4W4XA 2XMYA 4ZY4A 3TIZA 4GT5A 2DS1A 3VBXA 1ZMUA 4S33A 4L53A 3EH9A 5CF6A 3TZ9A 2NP8A 3UVRA 4O0RA 2ITTA 2XKCA 2JDRA 3RBWA 4TNBA 3ZEPA 5AEPA 5L2WA 1FMOE 3TV4A 1TQIA 4AT4A 3ID6C 1JBPE 4DH8A 1M2QA 3KK9A 3LKMA 4WO5A 1Y57A 4KWPA 3KCKA 1UVRA 5ANOA 4TWPA 2ITOA 1QPCA 3ENHA 3HV7A 2UW4A 4NCTA 4QPAA 5AADA 3O8UA 4XLIA 5CWZA 5FTQA 4IAZA 5K3YA 5M4UA 5FM2A 4CFUA 4G9CA 4BTFA 3O2MA 1OL7A 2EXCX 4A9RA 4UWCA 4IWQA 4BI0A 3DOGA 3EN6A 1ZAOA 2YM4A 4GKIA 5CQUA 1UNHA 4G5JA 5CXZA 4IQ6A 1OVEA 3PIXA 4GU6A 4O82A 1ERKA 4FICA 4W4WA 4M3QA 1M7NA 2AC3A 1NA7A 1XR1A 1ZMWA 4BHNA 4FNZA 4BRXA 4CYIA 4BDDA 3GCSA 2YM5A 4BDGA 1UWJA 3E8DA 3HMMA 5D11A 2Z02A 4DEBA 4EOLA 3R71A 3QHWA 4NSTA 5CF5A 3GNIB 1GY3A 1M52A 4J8MA 4LOPA 4R3CA 4C2VA 4XV9A 1H4LA 2PE2A 1BYGA 4R5YA 3U51A 4OLIA 4NUSA 4U97A 5ACKA 1IEPA 3EOCA 2QLUA 4AZFA 3JR1A 5KKRB 3Q32A 2OO8X 3U6JA 2CLQA 3IS5A 1RQQA 3PDTA 3FLZA 4MHAA 2WTWA 3ZTXA 3F2NA 4JVGA 3EQCA 1PXNA 1J3HA 3C4FA 1U59A 3RAIA 3VHEA 1YI4A 3MFTA 3U55A 1GNGA 4HYSA 3QA0A 1JKKA 2PVMA 5LCKA 5DR2A 3I5ZA 4QMNA 2CNUA 1U54B 1VYWA 1WBSA 4FTCA 4LRJA 5J8IA 2QO9A 4I93A 3OUKA 3S2PA 3S4QA 3DAJA 5C26A 1KE8A 4FIJA 2XRUA 3IDPA 4L9IA 1ZOGA 4YC3A 5K9IA 5HTBA 3ROYA 3UG2A 1QL6A 4DHFA 2BUJA 4HYHA 5M57A 4RG0A 2XK7A 4UMQA 4FKPA 4BKJA 1H8FA 1G8AA 4A4LA 3ROCA 3P5KA 5D41A 3W2PA 4Y83A 3V8TA 3UYTA 4N57A 1OUYA 1JKTA 2YCRA 4FV2A 3QRUA 5FUTA 5I4NA 4A9UA 5ETFA 3HKOA
chains in the Genus database with same CATH superfamily
1QPJA 3ORPA 3EQHA 3SW7A 2PY3A 4FK6A 3KA0A 4I5HA 3VS4A 3VO3A 1JAMA 3HUBA 2Y9QA 2CGVA 3DNDA 4BTJA 4BYIA 2RF9A 5L6OA 3UZRA 3NYOA 1UWHA 3Q9YA 1PY5A 3FMKA 5DBXA 4NYEA 3PZHA 4KBAA 3MH0A 3QYZA 2XAOA 4O7RA 4ID7A 5CEMA 2QLQA 4AZSA 3ANRA 3CJGA 4RFYA 2JC6A 4FTIA 5HO7A 1O6YA 4RRVA 3ATSA 4Q2AA 2QOKA 3EN5A 4FG7A 4C38A 5IA3A 3R8UA 3NYVA 3LHJA 5AAGA 3W1FA 1FMKA 2GPHA 4LV8A 3BV2A 3FXWA 4QTBA 2GU8A 5T3QA 2ZM1A 4BN1A 2VNWA 2XYNA 3PTGA 3PP0A 3R2YA 4BCGA 4EKLA 1OMWA 2BZJA 1DM2A 4JLCA 4ZTMA 2QO2A 3NX8A 3QCQA 5IA4A 1REKA 4JMQA 2GNLA 4EH5A 3W0OA 3UOKA 4AW2A 4C7TA 3WYYA 1ZMVA 2B53A 3SD0A 4DTKA 3GUBA 1IASA 1OPLA 4MKCA 4IDVA 2GS6A 5HEZA 4O2ZA 4BJJA 4JG7A 4J71A 2YIQA 3R30A 2GFCA 2QOFA 3RAWA 4C3PA 4BZDA 4CG9A 4CMUA 5AUZA 4XOYA 3RHKA 3PA5A 4I0TA 2G15A 1Q41A 4IM2A 4PMMA 1H0WA 2XKDA 3BE9A 3KRRA 1MRVA 4FTOA 4QMOA 3VBTA 3VUHA 5KNJA 4LRMA 3ZLXA 4F1OA 1UU8A 5IQBA 2PZYA 5JT2A 4JR3A 2NO3A 5E8ZA 4ZSJA 3R83A 5I9WA 4E4MA 1WVWA 3D2IA 4OTRA 1H24A 3C0GA 2Y4IC 1TVOA 4OTHA 3FLYA 3VAPA 3SG9A 5IQCA 1UNGA 2EXMA 4UB7A 3DFAA 3QTRA 4K33A 3WF7A 4FR4A 5GZ9A 2C0IA 4TNDA 4R1VA 5AUYA 5ANDA 1FVVA 5M56A 2DQ7X 1LEWA 3CTJA 2IZRA 3DKFA 4G3FA 2FVDA 5FLFA 4A07A 4X2NA 5C8MA 4CKRA 4GKHA 4QTAA 4DBXA 2HAKA 4AT3A 4LI5A 4FKTA 2X7OA 2Z7SA 4YU2A 3UQGA 2Q0BA 3DS6A 3F82A 3NUPA 4B99A 4CQGA 5J5TA 1X8BA 2J0IA 4HCTA 4CMOA 3OXIA 4MF0A 2GHMA 3EL8A 2X0PA 3POZA 2BRHA 5K4IA 5AV2A 4EOPA 2RG6A 2WEIA 5J5SA 4IACA 5J9LA 2XM9A 3MB7A 3C5UA 3DDPA 3I6UA 3WZDA 4CFWA 5KMOA 2PMOX 2OG8A 3KQ7A 3Q52A 3ALOA 5IH4A 3CQEA 4FA2A 3OWLA 3IW7A 3DFCB 4KIOA 3FHIA 3SRVA 2RGPA 3IG7A 5HNIX 3I79A 2BILB 1U4DA 4EL9A 3DXPA 1UNLA 5HX6A 3IGOA 2XCHA 4E5AX 4L00A 3F3TA 3ZFYA 3R7IA 3ML1A 4O4FA 4FTQA 3VF9A 4FVPA 1OITA 1W84A 4BCHA 3IW4A 4RQKA 3M11A 3P4KA 4D4SA 3BZ3A 4AX8A 4EWQA 1JQHA 2PUUA 2XM8A 5F20A 2W9ZB 2YJSA 4O7NA 3FUPA 1Q8UA 4CZYB 3ZRMA 3ORIA 4GVAA 3EHAA 3HZTA 5J9YA 3SVVA 4AT5A 4CV9A 1J7LA 2R5TA 4U43A 3NUNA 4I3ZA 1XH7A 1YOLA 3PRFA 4I1ZA 3NMUF 3B2TA 4W9WA 2RFDA 3I7CA 4XS2A 4ANQA 3GCVA 3GFEA 2P4IA 1R3CA 2O64A 4YJTA 3WBLA 3T3VA 4BY9E 2ETRA 3H9RA 5KX8A 2W1HA 3DK3A 1E9HA 5AMNA 5JK3A 3HRFA 4ASDA 4C61A 3W0PA 3LOKA 2CGXA 3PE1A 2BRBA 2QOLA 4TXCA 2XNPA 5HO6A 3BYVA 4MBJA 5AAFA 3TZMA 3S00A 5M06A 4APPA 3MFRA 4TN6A 3SA0A 3GVUA 1XMMA 3TTJA 1R78A 3AMBA 1BKXA 3O7LB 3POOA 4NM5A 1PF8A 3OW4A 3JXWA 3MY0A 5HBEA 3QX4A 3P5JC 3NZ0A 3PFQA 3F61A 4JIKA 4D2TA 3PPJA 1TKIA 1XWSA 5IQIA 2F2CB 4QNYA 2Y4PA 3MPAA 1WZYA 3ZSGA 3A4PA 4DFZE 2WTIA 4ALUA 4O7SA 4QPMA 5KE0A 2HELA 4FF8A 2A4LA 4JOAA 4BICA 1KV1A 2BALA 4NH1A 2IVSA 4GS6A 4LL5A 5DHJA 4PY1A 3BGPA 3F2AA 2JDOA 5CAVA 1BL6A 1KE6A 4R7BA 1Z5MA 1FQ1B 4D55A 2UUEA 3KCFA 4M69A 3Q9XA 5JGBA 4U3ZA 4CG8A 2OI4X 4M97A 4U40A 4XNEA 3ZXTA 4ASXA 4BZOA 1ST4A 3Q04A 2PVNA 4DEEA 2BVAA 4FV5A 2E9PA 3OS3A 4EOQA 3K54A 3EYGA 4AZTA 5CSWA 3Q2MA 4O0VA 3GQLA 3FMEA 3QWKA 1GIIA 4WSQA 2KULA 5CVHA 1RJBA 5HG5A 1H01A 4KIQA 3SOCA 4BKYA 4AXEA 3PXKA 3BBTB 5KMLA 1B6CB 2W9FB 5FM3A 2X2KA 3VW8A 4GIIA 4JBQA 5LVOA 1Q3WA 5BUEA 5CANA 3OD6X 2XJ0A 3QF9A 1YWNA 4I21A 4M66A 1DI8A 3R7UA 2CCHA 1BI8A 3OUNB 1LR4A 3DA6A 2P0CA 4I24A 4EHGA 4I6LA 3VONA 4XYFA 2OIQA 3AC2A 4C35A 1OIYA 5B2MA 3UQCA 2WOUA 4MXAA 3WF8A 2A2AA 2G2HA 3NCZA 3QKMA 4QP4A 3R1YA 3ZBXA 2UZLA 4FK3A 4PQNA 4AXAA 3PE2A 3MESA 5E1EA 1OPJA 2NPQA 2YJRA 4X2KA 4X6RA 3VUGA 4CFFA 4DT9A 2RG5A 5IUGA 4HVGA 3SX9A 2PMIA 3DZQA 3COKA 3D7TA 4XUFA 4MXOA 3SOAA 3G33A 4FIEA 3MFUA 5AP0A 4NW6A 2JAMA 2AYPA 1HOWA 2QHMA 2IN6A 3PA3A 5FDXA 4BJJB 3FQHA 3NYNA 5FBNC 4WG3A 4FZ6A 3A99A 4LV7A 2GCDA 5CU2A 4DG2E 3OFMA 2XP2A 3UODA 1NY3A 2BFYA 5EDQA 3KVWA 3TNIA 4YPDA 3F69A 3BX5A 2FO0A 1QPDA 4DC2A 2XA4A 1P4OA 5E90A 4X2FA 4QMVA 5FEQA 3CY3A 4UXLA 1WVXA 3N4UA 3I0QA 3IQ7A 1OL1A 3NWWA 4NM7A 5EDPA 4AFJA 3QQFA 4BCNA 5A4EA 4DHZA 4FKRA 4ZY5A 1H26A 4DEIA 4EHEA 2BZIB 4QYHA 2I40A 5JMSA 1WAKA 3I4BA 3V8WA 5CZHA 3RNIA 5CALA 5CAQA 2VX3A 3IO7A 3GC8A 3P78A 4BDAA 3D5WA 3AT3A 3G90X 2WMTA 5DVRA 1XBCA 2I6LA 4QMXA 4YMJA 2R3OA 2X7GA 2EXEA 4KKEA 5DWRA 2PE0A 5IA1A 3HDNA 2YISA 4XG8A 4X0MA 3HAMA 4JT3A 5F9EA 3RP9A 3QYWA 4D9UA 4FX3A 2VX0A 3EKKA 4R5SA 4F7LA 5GIPE 4TPTA 4AFEA 3P79A 4EHZA 3LMGA 2HIWA 4CVAA 5H8EA 2G9XA 2R7BA 4TWCA 5C03A 5KMIA 3MSSA 3T9TA 3ZC6A 2R3RA 3NS9A 4IB0A 1PMEA 3KXMA 4OTDA 4Y8DA 5DOSA 4X3FC 5AR5A 4CZTA 4YTCA 2JITA 2UVYA 4YJOA 2CJMA 2OJJA 4DGNA 4I5PA 4ZZOA 5LJJA 3TG1A 5B0XA 3U8WA 5JFVA 5B2KA 4HW7A 2Y6OA 3DT1A 4YTHA 4PUZA 4O0SA 3ZFXA 4DLJA 4F1TA 1H27A 3FMDA 2XK3A 4GCJA 3RPVA 5E9EA 2SRCA 2JKQA 5DI1A 3UP2A 5LARA 5IDNA 3GOKA 3ZLWA 4FYNA 3QGYA 3PUFC 4D9TA 2ITPA 3L9PA 1KSWA 3R8LA 3OTUA 2VN9A 4MEDA 2WNTA 4YSMA 3IW6A 3BQRA 3C4CA 3IOPA 3IPHA 1ZY4A 4AU8A 2GNIA 3EQDA 4FV3A 4Z16A 4LMNA 2VAGA 3E64A 1UV5A 3AD4A 3BBWA 3FEGA 4M14A 4P5ZA 4GIHA 2X6EA 4FOCA 2O63A 5HVJA 1OZ1A 3PRIA 4ASZA 4HOKA 4LOQA 4F7NA 5EOLA 1M17A 4RMZA 2QI8A 4K2RA 5CU4A 1Q3DA 1Q8YA 2QODA 1YWVA 3ZONA 4O7YA 2IVUA 3F88A 4FEVA 5L4QA 3RAKA 4D1SA 5L8LA 2YIWA 1Y8GA 2NRYA 3CTHA 3DGKA 2GS2A 2ONLA 2X39A 4ZZMA 2Z7RA 5ANEA 1DS5A 4XV1A 3T3UA 3NW7A 3UDBA 3TUDA 4J53A 5C9CA 2W4KA 3E62A 4XHKB 3WARA 4I23A 3UTOA 3R63A 3OEZA 4IX5A 4JXFA 3R7YA 3B2WA 3TACA 5E1SA 5ACBC 4RVKA 2VTPA 3HECA 5HQ0A 5AUXA 4XG9A 4ALVA 2WXVA 4K9YA 3ACJA 1PXLA 3M42A 4XP0A 3QTZA 2J7TA 3W0MA 1G3NA 4B8LA 4JR7A 5DPVA 4C3RA 4HVHA 2WPAA 2KTYA 1ST0A 4DEHA 5I3RA 1FOTA 5DIAA 3QQJA 3W8QA 5KMMA 1PXJA 1YXUA 4IHPA 4DFYA 1AD5A 3QQLA 2ZV8A 3IKAA 5BVOA 1ZOEA 4YJUA 2NRUA 5GINE 3HYHA 2PVLA 5AP7A 4CV8A 4D0XA 4DGMA 2GQSA 4NW5A 5AUTA 5HVKA 4M68A 5CU3A 3NUUA 3TL8A 4I4FA 4GT4A 5BMMA 4JNWA 4TZRA 2PZPA 3BLHA 4IJ9A 3FYKX 5AIRA 1FBNA 1OBDA 2PVFA 2BDJA 3ZRKA 1F0QA 2IWIA 4ANBA 4BIBA 4IZ7A 4HPUE 2RKUA 2VWVA 3AD5A 4PV0A 3PVBA 2ZV7A 4S31A 3B8QA 3OXZA 2LAVA 4QTCA 3KMMA 2WFYA 2XB7A 3E8NA 3O17A 4O4CA 5GJFA 3MBLA 2FSLX 5HGIA 2A19B 4EQCA 4ZTQA 2OF2A 3C50A 4CLJA 4E6AA 3CKWA 2BHEA 3PSBA 5F95A 4P2KA 4QYYA 4ANMA 2YN8A 4WBBB 3IECA 4O84A 5M09A 2C6OA 3O7LD 1BUHA 4AA5A 1XO2B 1REJA 3BEGA 3DV3A 3QUEA 2IVTA 4YGAA 3RWQA 4UX9A 4KKHA 2QNJA 4IXPA 4JRNA 2W5HA 2F57A 4YO6A 3C4ZA 4GJ2A 3G0EA 4AZEA 5L8KA 4CMTA 4Y73A 3NIEA 4CTBA 4C4GA 5AUUA 4Z7HA 4ZLZA 4ZZNA 1H07A 1K9AA 3VVHA 5JFXA 4QQ5A 3LVPA 2UV2A 4AE9A 3LPBA 3RZBA 3ZEWA 4AGCA 4U6RA 1JSTA 3LAUA 4MVFA 2C3IB 4LFIA 1BX6A 5IA2A 4AOJA 3EQBA 4UYNA 4QMMA 1PKDA 1IAJA 1YDRE 2XK8A 3KK8A 4PMSA 3NVKI 5JSMA 4WUAA 1IRKA 2OSCA 4KIPA 1BI7A 5H9BA 4WHZA 4BDIA 5AR8A 1GIHA 1R0EA 1SVEA 3G51A 4HCUA 4O4EA 4E8AA 4JJRA 3TDWA 5AV1A 3ORLA 4IAIA 4IFGA 4J95A 4DLIA 2W1EA 4D4RA 4J96A 4EUUA 3WF9A 2YACA 1XBBA 4FTMA 3UBDA 3MIAA 1RDQE 3DY7A 4ACCA 5HIEA 1Q8TA 4OAUC 3KULA 2OXDA 4IVBA 4JG6A 4RLLA 1ZWSA 2OKRA 1M2PA 2QKRA 4XP2A 3ANQA 3CEKA 3MH2A 4FTLA 4F0IA 3F5PA 3W55A 2VWZA 3DBQA 3IOKA 4ZJIA 3VQUA 1G5SA 4QMLA 3FY2A 2R3HA 5AX9A 4RZWA 3KMWA 3CJFA 3FMMA 3VULA 4V0GA 5AA9A 3ZHPC 5EYMA 3VBQA 3QRKA 3W2QA 3QD3A 4II5A 4N6ZA 4F7SA 5KUPA 4QD6A 4RVMA 4BVUA 2OLCA 2UVXA 3FQEA 4IAAA 4K0YA 3UVQA 2PUPA 3GP0A 3O23A 4YP8A 1FVTA 4EOSA 4BI1A 3MPTA 4FT9A 3RK7A 5KHXA 1P2AA 1GZNA 3OY1A 5BVNA 3O8PA 4FODA 3VRZA 5JN2A 4FTNA 3NUXA 3KXHA 2CDZA 3WF5A 1Q62A 4ZEGA 4R8QA 2XNEA 3FLNC 4L7FA 4RIXA 4RJ8A 1H1RA 4R78A 4NK9A 1KWPA 5LVLA 4BCMA 4RJ4A 3H9FA 2GNFA 2V5QA 4F99A 4JRVA 3S3IA 3SQQA 5E92A 4E3CA 4IB1A 3PWDA 5C27A 2VZ6A 4D2WA 5A6OA 4RX9A 3Q4CA 5IH6A 2WQNA 2HWOA 2ERZE 3BEAA 3D94A 5FGKA 3ZBFA 3Q5ZA 5EHYA 4AXFA 3NAYA 5DE2A 2VO3A 5HVYA 3PXYA 3EFLA 3G6GA 3RK9A 3PA4A 4D0WA 3TIYA 2OK1A 3RJCA 3NUYA 2GMXA 2R3JA 3MVJA 4MTAA 2Z7LA 3D2KA 4QMTA 2WTVA 2R3IA 4O38A 4DGGA 5DLSA 5F94A 3TV6A 2ITZA 3C4WA 3G2FA 3QTSA 4YJVA 4MD8E 4QTEA 3LQ3A 5AM6A 5GJGA 3PY0A 3LM0A 3OOMA 4FUXA 5AP3A 2R2PA 3HP2A 5J95A 1I09A 3V5TA 2OJ9A 2OXXA 4BIEA 3BCEA 5FRIA 4FTUA 1K2PA 3CBLA 4MXZA 3NEWA 2YABA 5LVPA 4O1OA 4PRJA 3LFAA 3BV3A 4L3LA 4R3RA 2REIA 3G9LX 4KKGA 5EI6A 1NVRA 4EH2A 4E73A 2EUFB 4HZSA 3WZUA 3UIXA 4R7HA 1ND4A 1KE7A 2XK4A 3D9VA 5HE3A 3VUMA 3LFNA 3OF0A 3QALE 5AR7A 5DFPA 1PMVA 4E6CA 4R77A 3QTXA 3T9IA 2QG7A 4GV1A 3AC4A 2ONLC 3LXLA 4EKKA 2Y8OA 2WMSA 4ZTSA 5BUJA 4F6SA 2AC5A 4X3FA 3EQIA 2BKZA 3FZPA 3WYXA 3A4OX 5L2IA 2XVDA 4O96A 5CEKA 5JZJA 3MN3A 4C36A 2PZRA 3DQWA 3PJ8A 4W8DA 3TTIA 1OKYA 4ZTHA 1SVHA 5AP2A 5K5NA 4IZAA 2C5NA 4L46A 4BGGA 5IF1A 1YKRA 2C4GA 3ODYX 3R21A 4JAJA 4M7IA 4QMYA 5CS6A 3AT4A 4FV6A 5FEDA 4NEUA 4FZAB 1XH8A 4NCTC 3OBJA 2PMLX 4H1JA 4RFMA 4WRGA 3ZO3A 4DCEA 4O7LA 4CT1A 3IW5A 4GVJA 4GYIA 3KRJA 3FXXA 3P0MA 4HGTA 4RLKA 2CN5A 4YLJA 5BYYA 4HYUA 5ANJA 4G6LA 2V55A 4AXDA 4ERWA 4PDSA 3RPSA 4EK6A 3UO5A 2ERKA 3R73A 4CGAA 3FLSA 4QYEA 3QC4A 4X6QC 2GTMA 5EM8A 2VV9A 3L1SA 2QR7A 3E92A 3OT3A 4MXCA 3EN7A 5L8JA 5LVMA 3PFYA 5IQGA 2CN8A 4FT7A 4DDIA 3PYYA 3RCJA 4YHJA 2X0GA 1PXKA 2CSNA 2I0EA 3BGQA 3MA3A 4IWDA 3SLSA 4DEGA 3PPKA 4EJ7A 4YZDA 4XEYA 5D12A 1SM2A 2F7XE 5DT0A 3FHRA 3W0NA 3R1QA 5C4LA 4CRSA 3ZXZA 4WG5A 3GC9A 5LMKC 1UU3A 5LOHA 2CKPA 1IA8A 3A7GA 3KC3A 3BHHA 3E93A 3F5GA 3A7FA 3V5WA 5IQDA 3CD8A 1IAHA 3TI1A 4KUJA 3UDZA 4B4LA 2OGVA 3QQUA 1XJDA 4KAOA 3MJ2A 3BRBA 3W0RA 3ZM9A 3Q6WA 4Z3VA 3V5JA 3H10A 4G5PA 4F6WA 4O0YA 2UZBA 3R8ZA 4MD7E 3ITZA 2G2FA 5CNOA 5LMAA 3Q9ZA 2YCSA 4MAOA 4WBOA 2XJ1A 3UJGA 2PVYA 5E4HA 1PW2A 2PMNX 5M08A 2X8DA 3ZSIA 1PRYA 4QP8A 2JIIA 2A98A 3LM5A 3QCYA 4IAYA 1TQPA 4NZWB 3BU3A 4OBQA 3ZSHA 3AKLA 4KSPA 4GUBA 3VN9A 2B7AA 4FSZA 4H1MA 4I6QA 4QP6A 3TJCA 2FUMA 3RAHA 5D7AA 3F66A 3EQPA 5J7BA 3H3CA 2ZDUA 1OL2A 4D5HA 2EWAA 1ZARA 2C1BA 2QD9A 3G6HA 5E8VA 3DQXA 3VUTA 3ZDUA 2IVVA 3ZH8A 4EJNA 2AQXA 4AP7A 4CXAA 3ZLSA 2C3JA 3M2WA 4A7CA 3F2RA 3R8PA 5C4KA 3E88A 2P33A 3REPA 2YAAA 4WOVA 3QA8A 4ANLA 5CEPA 2OW3A 2E9OA 1V0PA 2YHVA 2ZVAA 3FI4A 3ZU7A 4D4VA 2BRMA 1XH5A 5CVFA 3MDYA 4XH6A 4H05A 2J2IB 3WE8A 4BL1A 4ZTLA 4B6LA 3OZ6A 4RX5A 2OWBA 3U6HA 4GUEA 4YURA 5HG9A 2YLEA 2ACXA 2WMXA 4BTMA 4CZUA 4UEUA 2VWWA 3NVMB 1OL5A 3EFJA 3GU5A 3HV5A 4C59A 1YXSA 3MFSA 4TT7A 5BVKA 4ERKA 4BYJA 3ZLYA 3COIA 3DJ7A 1PXPA 4GG7A 4IE9A 4XG3A 3RNYA 3MVLA 4A06A 4CCBA 5JFSA 2UZEA 4ZLOA 4MQ2A 3GB2A 1H1QA 2ZM3A 2Z60A 3H0YA 4HVDA 2QU5A 2VGOA 1SNUA 4YJPA 3FZTA 5A4QA 2I0HA 4BBEA 3QQHA 3R28A 4DFUA 2PVHA 3QHRA 4NL0A 4FI1A 1LP4A 3IDCA 3KXZA 3FWQA 1YOJA 3SXFA 3PXQA 4JBPA 4BC6A 4Q5EA 4BFMA 2OIBA 5EW9A 2HW6A 3FQSA 3R00A 4FNYA 4GK2A 4IZ5A 4G3DA 4NFMA 2VTLA 2OZAB 4TYHB 4IADA 3PUPA 4OTIA 3K2LA 5CXHA 5EW8A 2QOQA 4LM5A 5TR6A 4BI2A 2XEYA 3L9MA 2VTNA 3FZ1A 4KS7A 2Y4IB 4AAYA 4GRBA 2XJ2A 4OUCA 5CNNA 3GI3A 2O65A 4YHTA 5DYJA 1PMNA 4JIAA 3QZIA 4DT8A 4V01A 2OICA 1V0BA 3OOGA 1LPUA 2VWIA 5TOZA 4DH3A 5AFVA 4GK3A 4B8MA 4DITA 2B9HA 5CSVA 3TZ7A 5HOAA 2XK6A 2VTAA 5C8NA 4HPTE 1APME 3ODZX 5KBQA 2BRGA 2OJIA 2YDJA 2OFVA 3DAEA 4Q9ZA 4I6HA 5CF8A 1K3AA 3KRXA 1MQBA 3QX2A 5FXSA 2BDFA 3O50A 3ALNA 1XMLA 3BYMA 3UZTA 4ITIA 3DJ6A 5BMSA 3H30A 3GCPA 1XH4A 3RI1A 2X6DA 2C1AA 2DUVA 2OZOA 4YPSA 5AR3A 2V0DA 2ESMA 5AR4A 4HYIA 3F3UA 4XMOA 5ETIA 1YRPA 1YWRA 3PY1A 4XOZA 4NJ3A 5I9YA 3AGLA 2QR8A 3DK6A 4RIWA 4RBLA 3L8PA 5J87A 5DG5A 4IVDA 1YW2A 3LLAA 2V7OA 1CM8A 2UW0A 5JZNA 3C0IA 1W83A 4C3FA 4L3JA 4RWLA 2O5KA 2BIYA 3MTLA 3LCKA 4FC0A 2PU8A 2BZHB 1Q61A 4EOKA 4AZVA 4AGWA 3UO4A 2VTOA 2VTQA 1KOAA 4O6LA 4EWHA 4I0RA 3R7GA 2DYLA 3RWPA 4CEGA 3FKLA 5GIOE 4QP2A 1URCA 2P3GX 4R6VA 3FY0A 4BCOA 3DBEA 2HCKA 3QTQA 4XBUA 3ZM4A 3TEIA 5FQDC 4V05A 4AG8A 5EKOA 1Y91A 2OZAA 3KXGA 4KRDA 2W1ZA 5CSXA 1PXMA 3UOHA 4GMYA 3PVGA 2CNVA 3C4XA 2BAQA 2BIKB 3W0SA 4NIFA 3GBZA 1WBWA 3UIMA 2B4SB 4R3PA 4Q9SA 4YJRA 1CKJA 4C34A 5IQFA 2JDVA 4QQJA 2R0IA 2BMCA 3OCTA 3OC1A 4GSBA 5EQEA 2WTJA 5CZIA 3AC8A 4HNIA 4JS8A 4F08A 4O2PA 3CCNA 1H1PA 3AOXA 2YIRA 2F2UA 4OTFA 4FSTA 4PL3A 4WRSA 2J50A 3VJOA 5DT3A 5IG1A 3LZBA 1TZDA 3FI3A 3U4UA 4K77A 5GNKA 3F6XA 3FC1X 5M4IA 3KGAA 3Q96A 1YOMA 1ZYJA 4QMWA 4QYFA 4DFXE 2X7FA 4RSSA 4PNIA 3R02A 2BAKA 2WMRA 5D10A 4E1ZA 4OW8A 4EOJA 3I60A 1KE5A 3QRJA 4YZBA 5EW3A 4RIYA 3D7ZA 3SXSA 3DAKA 4BTKA 2CKQA 1CDKA 5JGAA 4ANSA 5IMXA 5CSPA 3NNWA 3MY1A 4QMSA 2B55A 4LRKA 2X4ZA 2PVRA 3PZEA 3NUAA 2P2IA 4UY9A 3LCOA 5HE2A 3MPMA 4O4BB 5KMNA 4FNXA 4KBKA 5IQHA 1PXIA 3P7CA 5BVFA 1JVPP 2JGZA 5HLPA 3FJQE 4QQTA 3L9LA 2B54A 2Z8CA 3EZVA 3P7AA 4JX7A 4UWBA 4IH8A 2UZDA 3PXFA 5EI2A 4NWMA 3UNKA 1AQ1A 2WB8A 3NFFB 1XH6A 2C5YA 3GC0A 3GQIA 3EYHA 3JUHA 5DRBA 5H3QA 3CS9A 2VWXA 5HESA 3R9OA 4ZMFA 1SMHA 3ACKA 2CKOA 4GT3A 4EBWA 5EFQA 2W4JA 1JLUE 3FKNA 4W8EA 5CYIA 4ZP5A 2FB8A 3ZUVA 3BYOA 4E4LA 1W2FA 4FMQA 5CAOA 3FMHA 4TYGA 5L2SA 2JKOA 5IH5A 4QO9A 3G0FA 4EOMA 2GDOA 3VNTA 5E8XA 1G8SA 2VWYA 3GGFA 4ACDA 4AUAA 4EK4A 5CEOA 1J7UA 1MRUA 3AXWA 2ITNA 4RJ7A 5JQ5A 4D2RA 5D7VA 3CC6A 3R04A 3RGFA 3ZFMA 2QURA 3UNJA 5EKNA 1YHSA 3HMPA 5DT4A 5JRSA 5DA3A 1Q97A 3UMWA 4W4VA 2HZ4A 4C33A 3OY3A 3HA8A 3HEGA 4I41A 4PP9A 4UALA 5H2UA 1GZKA 3ENMA 1RE8A 4YC8A 3BL9A 3OEFX 3T8OA 2WTKB 3D0EA 4RJ5A 3VIDA 3DKGA 3KXXA 4FSMA 2F9GA 4G17A 1YXVA 3OWJA 4RC2A 5EM5A 4FTTA 4FSRA 4LMUA 4MQ1A 3DDQA 1OM1A 5BVEA 3SAYA 5HIBA 1ZXEA 3LQ5A 4U8ZA 5AP1A 5JGDA 2BPMA 3SW4A 1OPKA 2EVAA 2PZ5A 3A8XA 3KL8A 2Y0AA 4DHIB 5LCJA 3WOWA 1H00A 3HRCA 4UYAA 3AMAA 2WMVA 4TYEA 2C6KA 4H36A 3KFAA 3AKJA 4RWJA 4IWPA 4EH8A 3UDSA 2OF4A 3E8EA 2VTSA 3A7JA 3FSKA 4MXXA 4OTWA 4G34A 2OU7A 1OGYA 4HGSA 1P5EA 3Q4ZA 1YDSE 2VRXA 2XUUA 2EB2A 3MV5A 4LV5A 4O7WA 1JSVA 3FL5A 4ZTNA 4L6QA 4HVSA 2IO6A 4GK4A 5AJQA 2ZB0A 1P4FA 1I44A 3DKOA 2R9SA 5E8UA 3AGMA 1B39A 4X3FB 2WMWA 4OBOA 5AV3A 4BCJA 4C4HA 1OUKA 3U54A 4QP3A 4J7BA 1GAGA 2BZKB 2B1PA 3V04A 2I1MA 2OH4A 3QU0A 3DLZA 4BDEA 3TM0A 3QTWA 3I81A 4O1PA 4IMYA 3M1SA 1ZZLA 5EH0A 4KS8A 3DCVA 1Y6AA 2C6LA 3C1XA 3FE3A 4FL3A 4FVRA 4G31A 2C5OA 2UW9A 2V62A 4RWKA 4APCA 3ZRLA 3MGYA 4JBVA 3KREA 3KEXA 3PG1A 4GW8A 1OIUA 4LGGA 4AOIA 1YXTA 4ZIMA 3KMUA 2CCIA 4IWOA 4M84A 3RZFA 3F3VA 5TKDA 4DEDA 2VUWA 4I6FA 3KY2A 4IIRA 4G2FA 1F5QA 3QAME 2EB3A 3TNHA 2HZNA 4BGQA 4HGLA 3HGKA 5B7VA 5L2TA 4FL1A 4NTTA 5HZNA 3CP9A 2PVKA 5EDRA 4FYOA