2XBJA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
286
Chain Sequence
b'VYPKALRDEYIMSKTLGSGAGEVKLAFERKTCKKVAIKIISKALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Structure-Based Design of Potent and Selective 2-(Quinazolin-2-Yl)Phenol Inhibitors of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 286
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xbjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xbjA01
4HCTA 4OTHA 4Y73A 4PDOA 3Q9WA 3SXFA 3OY3A 5F4NA 1U46A 2NRUA 4U44A 3RM7A 5K5XA 2RFSA 4EOSA 3JR1A 2H8HA 3LLAA 4DINA 1B38A 4Q2AA 3OW3A 1A9UA 2R64A 3E87A 3P86A 5CEKA 5DI1A 2PZIA 5LQFA 2E9PA 4RJ6A 5CU2A 1M2PA 1K3AA 2FO0A 4HGLA 3RK7A 3WBLA 2PK9A 3H3CA 4OGRA 2O0UA 3OXIA 4O7WA 4EONA 4FL3A 5EOBA 4G3EA 4GW8A 4D1ZA 5CEMA 3O7LD 4B7TA 3G6GA 4A07A 4E6AA 3CTJA 3V5WA 5A9UA 4FV9A 2W1FA 3GQLA 4C4HA 5IDNA 1YXTA 2ZB0A 3EFJA 3R8ZA 2YLEA 2ZV7A 3DK7A 4PMMA 4Y5QA 3GU4A 4PL3A 5GJGA 4CXAA 4NYEA 4CCUA 1GZOA 1M2QA 4CRSA 3HA8A 4YNOA 5T6KA 3FZSA 4FKWA 3BV3A 4IWQA 3TZ9A 2JIUA 4AG8A 4IVDA 3EJ1A 2QI8A 4L42A 3FHIA 4JQ8A 3VS0A 2NO3A 2YWPA 1J7UA 2OIDA 5B2LA 4AA0A 3I5ZA 1S9JA 4BDKA 4V0GA 4MKCA 2G2FA 4ZTMA 4MQ2A 3NYXA 3ODYX 4BHNA 3GC9A 2NPQA 1A48A 4E7WA 2I7QA 3QXPA 1BKXA 4BWKA 4O0WA 3FLSA 5TKDA 3QX2A 3H9FA 2WQBA 4PTCA 4QP8A 4TRLA 4JG6A 2A27A 3RHKA 4AN2A 2C1AA 3KXZA 4KSQA 4RVLA 5DOSA 4R7IA 2GPHA 3PXZA 3F3WA 4BRXA 4F1MA 4NKSA 2YM4A 4QPSA 2A19B 2VWYA 1UNHA 3VWAA 4YHTA 3CBLA 2C5YA 3OWPA 4WNMA 2C69A 4QTCA 4I0TA 4CVAA 3VULA 3QZIA 4J7BA 3F82A 2WTDA 4JDKA 2WPAA 4XG7A 2JKKA 2UZEA 3ENHA 2VWBA 4ZJJA 5HBHA 5LMKA 1P5EA 4IJ9A 5GZ8A 3L9PA 2OBJA 4NJ3A 2XH5A 1IAHA 3HUCA 2FUMA 4FTRA 3UIMA 4QMSA 2FSLX 3KA0A 4K8AA 2P33A 4RSSA 4E5BA 4EUUA 5IUGA 5C27A 2R3IA 1ZYSA 4HVSA 4OLIA 5L2QA 5M53A 2C3JA 2O3PA 4YJTA 2QR8A 4HW7A 5KCVA 4IM3A 1G3NA 4XLIA 3P23A 4S33A 4JRVA 5E8VA 4IDVA 4DTAA 4GT3A 5CU6A 3COHA 3QKLA 3OBJA 4IX6A 5H8BA 3GCSA 1OL6A 2GTNA 5L4QA 3F6XA 2C3KA 3W8LA 4F1OA 4O22A 2QD9A 1VR2A 3E93A 3EQIA 4P4CA 1NT2A 4O7SA 2QG5A 3CJGA 4IACA 2WQOA 5HVYA 4ACCA 4AZFA 4YP8A 2B4SB 1SVHA 3R6XA 1JSVA 4WG4A 4FEVA 3ODZX 4R3CA 4ASEA 2VTPA 4JVGA 4KB8A 4CQEA 1OBGA 2GS2A 2EXCX 5IQAA 4IE9A 2BRNA 2OJGA 3QC4A 3BGQA 4IX5A 4O0UA 4NM3A 4BGQA 4CT1A 1VYWA 2ZDTA 4FV6A 4P5ZA 3D5WA 3V8WA 4JL9A 4ACGA 2EXEA 1GJOA 1YRPA 3VHKA 1NW1A 1IA9A 4W8EA 5DEWA 3ZFYA 1CMKE 3CQUA 3D4QA 3M42A 1FVTA 5DE2A 4FEXA 2ZOQA 5K5NA 2PE1A 4NTTA 3RZBA 4D2WA 3NEWA 2ESMA 2JLDA 4MXZA 4LRJA 3D9VA 3R9OA 2W9FB 2W1EA 4CFXA 3ZH8A 5HTBA 3AC2A 4G2FA 4AN3A 4FBXA 2Y6MA 4AW1A 4DH3A 1NA7A 4TYGA 2UZNA 5EM5A 4EL9A 4TNDA 4OTFA 4BBFA 3VF8A 5HLWA 4HVGA 3R8VA 2WMRA 2Q0NA 5E8SA 1H1RA 1WZYA 2Y6OA 3L8PA 4L52A 3MFSA 4DBXA 3FKOA 4KRCA 4E3CA 5AV1A 4E6QA 3OCTA 3EN4A 3PXRA 4BDDA 3CLYA 3DZQA 1LR4A 4J8NA 4FKTA 4ZTQA 3VBXA 1UKHA 2VTLA 2XM8A 3GFEA 3OTVA 3U54A 3FZPA 2YISA 3IGOA 1OL7A 3G6HA 2FA2A 1QPEA 1J7IA 4YJUA 4B8LA 2FGIA 3GGFA 5DN3A 2W96B 4G6LA 3ZHPC 3AXWA 3I79A 5BMMA 3AG9A 3FC2A 2CKOA 4S30A 3AT3A 3ZSGA 3O50A 4ID7A 2H6DA 2X2KA 3DAJA 4HVHA 2BROA 3BE2A 4XLVA 5L2TA 5D12A 3FPMA 1LEWA 3UYTA 5HG5A 2ZV8A 3WYYA 4YSMA 5BVDA 3QD0A 4D1SA 3BV2A 3DKCA 3VRZA 4L7FA 3PFQA 3EQFA 4ERKA 4BFMA 3ORXA 3U51A 3ORNA 2X8EA 2CGUA 2XNGA 5FGKA 2QOOA 4DT9A 1Q8ZA 3PSBA 3AMBA 5KX8A 3NIEA 5ITAA 3ATSA 2C0TA 2YEXA 3TNIA 2XNPA 5LWMA 2R3GA 3D15A 2QOLA 4C4JA 4PTGA 5CU0A 3SD0A 2ITUA 4C2VA 2R0UA 5HKMA 4FICA 2WQEA 3UOKA 3R22A 2RFDA 3MJ2A 4XG2A 3SGCA 5HNGA 1JPAA 4PDSA 2H96A 3R9HA 3JS2A 1PY5A 1JWHA 3BPRA 1JOWB 2GU8A 4QMWA 2WTCA 1I09A 1PXPA 5CAUA 1DI8A 4OBQA 2J0JA 2FH9A 4GH2A 2BZIB 4C61A 5CAPA 5HOAA 3TV6A 4U81A 4RJ7A 1SNUA 4U3ZA 2PWLA 3P1AA 4MBJA 4JAJA 5ANGA 3TI1A 4AP7A 5AV4A 4DFBA 5F20A 5HU9A 2QOFA 2ZB1A 4MQ1A 4D0WA 5HGIA 4UMUA 1JKSA 1RQQA 2X7FA 1W98A 3FDNA 5C8MA 4FK6A 2IJMA 3DT1A 4J98A 5LOHA 5C9CA 2OK1A 4JQ7A 2I0VA 2XNMA 5M57A 4CFMA 2ZDUA 5HNBA 4BCOA 1ZOHA 3ZFXA 3PY0A 1G8SA 2UZTA 3QXOA 4DEEA 2XK3A 3AC4A 3DOGA 4FT3A 4FSYA 5AJQA 1FINA 2VTHA 1QL6A 2QOKA 4CTBA 4G16A 4WBOA 2AC3A 4ZZNA 2IZUA 3KY2A 4FNZA 1IAJA 5FXQA 5TOZA 2XNBA 2QOBA 3MN3A 5FDPA 2P2HA 2VNYA 4M0YA 3QTRA 4IVAA 4BCNA 2SRCA 5ANEA 4RG0A 3MH1A 2PVFA 2VO6A 4D55A 2UW8A 4GT5A 5JK3A 4MVFA 2XJ0A 3ZUTA 5LWNA 2ITYA 3PE2A 2ZAZA 3RK5A 5L2IA 3POZA 4NK9A 1H27A 3OC1A 1Q61A 4RJ4A 5CT7A 3G5DA 3KKVA 1ZYDA 3BYSA 3R8UA 4E8AA 3BHTA 2RSVA 3AC3A 4FV1A 5I4NA 3MBLA 4DG0E 4L44A 3CD3A 5AP1A 3L1SA 4OAVB 3LFSA 3KEXA 3VS5A 3PVUA 5KMOA 1PYXA 2BILB 3CTHA 4KBCA 4U41A 5L3AA 4A4LA 5IZFA 4RRVA 4S34A 1YDSE 1R1WA 4YMJA 3S0OA 3SHEA 2YABA 5KKRC 4EOQA 5IQBA 5D41A 4YZ9A 4O7VA 3RWPA 3ORIA 3KXNA 3KXGA 3PRFA 3HRFA 4F9YA 3BQRA 5I0BA 4ZMFA 2PE0A 2HZIA 2VTNA 2KULA 3MDYA 3L8VA 3EFLA 2B7AA 1OIRA 4M69B 3P7AA 2QG7A 1A06A 4IB5A 4ZTNA 2Q83A 1YHWA 2VV9A 5IH5A 3KL8A 3AOXA 3KQ7A 2ITQA 2QU5A 4OUCA 3UZPA 4M97A 4F65A 4TWCA 2JKOA 5DNRA 4O7TA 4RWJA 4Y5HA 2PMNX 1OL5A 3F3TA 4DBNA 5AFVA 2UW7A 4HGSA 5AUXA 1IASA 3C13A 3OXZA 5LARA 1PW2A 1Q41A 3D2KA 2GQRA 3LQ5A 4FKJA 1Y8YA 4C3PA 3FY0A 5KO1A 3DXQA 4PWNA 5HD4A 5AP3A 2XKDA 5EYCA 4CSVA 4NM5A 1UV5A 5EHOA 4EH2A 5E9EA 2F49A 2QONA 3ZO2A 1OM1A 4J8MA 3FV8A 4G9RA 5EK7A 2GTMA 2I0HA 1PRYA 2JFLA 3QRKA 2WZJA 3BHHA 3NPCA 4LOOA 3TV7A 3F88A 2ITTA 2YIWA 4C4GA 3PIYA 1Q8UA 3QYZA 4EORA 4NM0A 5AADA 1CDKA 2ETKA 4TN6A 4DC2A 2OJ9A 3UTOA 3VS7A 2Z2WA 4V04A 2UZDA 1YI4A 5BYLA 1M7QA 2YIXA 3PVBA 3MSSA 3PWDA 3ETAA 2X8DA 3FYKX 2XNNA 3EB0A 4XNEA 4UMRA 1STCE 4ACMA 2J90A 3T9TA 5CTPA 3CTQA 5E91A 4EZ5A 3Q4UA 4CGAA 4D2RA 4WRGA 3AGMA 4Z16A 5GHVA 4FTOA 4XRLA 3JY9A 2PYWA 5K9IA 5AAGA 3CY3A 4EH3A 4F6UA 5HU3A 3VBWA 1OMWA 3BEGA 3O0GA 3O8PA 3NIZA 3SLSA 1MQBA 3B2TA 3AGLA 2XP2A 3LIJA 3KXMA 3THBA 4EC8A 5HE0A 3UPZA 4FTAA 4BR3A 2BUJA 1XQZA 4NZWB 3I81A 5LVMA 3D7TB 4DH1A 4QQCA 1H25A 5D11A 2BFYA 2DUVA 3ORKA 4EQCA 3NWWA 3KXXA 3ROYA 4AZSA 2YJRA 4D2VA 5KBQA 4DGOA 2B9JA 4NWMA 2A2AA 4CZTA 4DGLC 4O7YA 2XBAA 2OSCA 2EVAA 2W9ZB 3DB6A 3TWJA 5E4HA 4I24A 4N0SA 4O83A 4JX7A 4QOXA 3TCPA 3UP7A 4CFFA 1KE7A 1KOAA 1YI3A 4LUEA 2B9FA 4L7SA 3PDTA 4J53A 3E88A 4FA2A 2F7XE 3PA5A 4FZ6A 4GK2A 4GK4A 4I0SA 4RWKA 2QQ7A 4PPAA 4TKSA 3H9RA 4EK4A 4KAOA 4QMYA 4IXPA 4O2ZA 5HO8A 4DEIA 1SYKA 4QMPA 3NUAA 2BR1A 5DT0A 1YWNA 2J0KA 4RJ3A 4LRKA 3RBWA 3K3IA 5IUHA 4IHPA 4FG7A 5AV3A 3IDCA 3VAPA 4RMZA 3N4VA 3LW0A 4AGDA 4YC3A 3DBDA 3ZTXA 4MBIA 4YJNA 2I1MA 4BZNA 5CF6A 3HZTA 3W2OA 3EQCA 5EQEA 4EHZA 4FT5A 5J5TA 4G31A 4BL1A 3COKA 2G01A 1H26A 4K1BA 4EYMA 3NW6A 5AUTA 3PSDA 5C8KA 4QMVA 3PA3A 4X2NA 2V7OA 4YC8A 4XV2A 3TT0A 3PJ1A 4DEHA 5BUIA 5DLSA 4BKZA 1QCFA 4ZTHA 1GOLA 2PVJA 4BIBA 5ANOA 3PPZA 4AT5A 4DFYA 3GBZA 1VEBA 3MJ1A 4JAIA 2ONLA 3R28A 4FUYA 1PYEA 4H1MA 4TY1A 3DK3A 5AX3A 2QO2A 2B1PA 3LFFA 3DFCB 4QMOA 3TL8A 4DGGA 4I6HA 5HD7A 3LFDA 3PRIA 4F9AA 4ZLZA 4JLCA 2CDZA 4IFCA 5CI6A 1PMNA 4OR5A 4BTKA 3B2WA 3GNIB 5JRQA 2R3NA 4ZAUA 5C03A 2UVXA 1BUHA 3QUDA 5ANIA 4BKJA 4DEGA 4C37A 4UYNA 4RX8A 5AAEA 5L8KA 1DM2A 4RC2A 3PXQA 4XG9A 3VQHA 5HTIA 4BCIA 2XM9A 3I0OA 4FF8A 3F5XA 3FXXA 4H36A 4R6VA 4XP3A 4J96A 2CN8A 4NFNA 3KREA 3FZOA 4U7ZA 2BDWA 5IKWA 2JC6A 2I0YA 4OTDA 3UC3A 5DMZA 3ZZEA 2ZYBA 4O1OA 3AMAA 4YZDA 3Q4CA 4OW8A 3DKFA 3WZUA 3RPOA 5K4JA 1QPDA 4MF1A 4O6EA 4ZY5A 2ZV2A 2UVZA 4L6QA 1SVGA 3MB7A 4GMYA 4QP1A 5CEQA 3FMEA 3CPBA 3DBEA 3ACKA 3QQHA 3ZM4A 2C1BA 4NM7A 5LVPA 5HO7A 4BBMA 3QCYA 1REKA 3LM5A 3Q5IA 2PUNA 1YXUA 4ASDA 3E5AA 3TACA 3UQGA 3R0TA 4GYIA 4FV7A 5FXSA 2C6LA 5J7BA 2ONLC 4C62A 4X6QC 4L53A 4LL5A 4C3FA 4NIFA 4AF3A 2VTJA 2YZAA 3FQSA 1MQ4A 5G6VA 2R3MA 3QTZA 5DHJA 2UW3A 1QMZA 4C38A 3GCPA 3FXWA 3V04A 3S3IA 3IW4A 4U0IA 4CYIA 2Z7QA 4NW5A 4GYGA 1Q8TA 3KC3A 4QMQA 1BLXA 5A6OA 4FI1A 4CLIA 2PVNA 3TNQB 5HCYA 3T8OA 4F4PA 1OVEA 5HE3A 4ZOGA 3V5LA 4EK6A 4OBPA 4RWIA 3D0EA 4WNOA 3HMMA 3VBYA 5A3XA 3QALE 4ZS4A 1PXJA 1IEPA 3DDPA 4QMXA 5CVHA 3I7CA 3F66A 5FXRA 3E3BX 5ACBC 1IRKA 3R01A 4RIXB 5CI7A 4IZAA 3Q5ZA 3GC0A 4I5CA 4EWQA 3R7EA 4EZ3A 4UMPA 1XH7A 2JDVA 1AQ1A 4RLKA 4ORKA 2W99B 1L3RE 2X39A 4BCPA 3NAXA 1PKGA 3A62A 1J91A 2Z7SA 2OWBA 1B6CB 5IQHA 1H0WA 2FB8A 5EM6A 4M0ZA 4ANQA 4JJRA 4TYIA 5I3RA 5KE0A 3RAKA 3GQIA 3FAAA 3R2YA 4IC7A 1WVWA 4EEVA 4FKVA 2OH0E 4Y8DA 3A99A 3H0YA 3COMA 4FIIA 1S9IA 3R7OA 3UE4A 3WF8A 2VX1A 4AGCA 1YOJA 4RX5A 3AMYA 5IQIA 1FQ1B 2PUUA 3NYVA 2OI4X 2PMLX 2XUUA 4J52A 5FG8A 3QGYA 3DQWA 3TUCA 4JRNA 5JEBA 4N4SA 4NT4A 2I6LA 2UZLA 5FEQA 3RNIA 1APME 4U8ZA 2Z7LA 2J5FA 3CD8A 3MFRA 5IQEA 4KD1A 4DFLA 1PXLA 1RJBA 4J71A 4HJOA 1OECA 1M17A 1FMOE 3WE8A 1G8AA 4AXAA 2RG6A 3BGZA 4DYMA 3MA6A 2DQ7X 2BDFA 3LXNA 5CXHA 3WIGA 3NNUA 4YC6A 3UO5A 2YZLA 4FX3A 4FT0A 3K2LA 3W2QA 4FL1A 3TUDA 3FMKA 5FEDA 5DR6A 3ET7A 1P2AA 4FV5A 3LHJA 1LUFA 2RGPA 2F7ZE 4MAOA 4IWPA 4QMZA 1E9HA 3ZRKA 3FI4A 3DY7A 3QRUA 4I5MA 4RA5A 3QCXA 4F99A 4DAWA 4QP3A 3E8EA 2VO3A 3KGAA 1XBAA 3CPCA 4BDAA 2O64A 2XYNA 4BWPA 5JGBA 1TVOA 5CF8A 3JPVA 3WI6A 2WTWA 3UG1A 5A4QA 5K0XA 3ULIA 4UB7A 5CEOA 4IM0A 4ZK5A 3EKNA 5EHLA 4O7ZA 3E3PA 2VWZA 4GUBA 4JG7A 5J8IA 4G3GA 2X2MA 2VGOA 3SA0A 5FTOA 4A4OA 2VNWA 4OBOA 2QC6A 4WBBB 4M69A 4QYGA 4UALA 3DAKA 3QU0A 1XH4A 3BRBA 5HZNA 5CNOA 3MPMA 2ITNA 2YDKA 3OUNB 4FKGA 4FZAB 4AOTA 2ITOA 3SW4A 4O6LA 1PXNA 5AEPA 5AUVA 1W0XC 2ERZE 5E1EA 3BYOA 1EH4A 5HE1A 3E7OA 3D5UA 4AZWA 3LFBA 4B4LA 3IW5A 2O65A 3D5VA 1OUKA 3ZBXA 3UJGA 3K54A 4FV8A 4ACHA 2QO7A 2HWPA 1GIHA 3GU8A 5G1XA 1Y8GA 3ZM9A 1OPJA 4AW2A 1T46A 2QKWB 4PMSA 2DWBA 4O1PA 3GP0A 2EUFB 2J9MA 4EH4A 3BEAA 1M2RA 4BZOA 3QUEA 1U5QA 4FIGA 4R7BA 5ETCA 5M55A 2XIKA 3H10A 3PIXA 4UV0A 3GT8A 5AV0A 4D4VA 3RCDA 1OIYA 2EB3A 4EHEA 1H07A 4F9WA 4P7EA 5EKNA 3QWJA 3QL8A 2WFYA 4EH9A 2XK9A 5AP2A 2XIZA 5AR2A 3F3ZA 3FQEA 4D4SA 4EJ7A 3OVVA 4I0RA 5E8YA 4O0VA 5HG8A 4QYFA 3D94A 5K4IA 1CKJA 5EQYA 3ZSIA 1RDQE 4MTAA 4NU1A 4F64A 2HY81 1F5QA 1JKKA 4RIYA 5AM7A 3T3VA 3TUBA 4ANOA 3LMIA 3OCGA 4QD6A 5LCKA 1URWA 2QOHA 4TWPA 3A7IA 3UMXA 4GFGA 2IWIA 1XHAA 3D7TA 3ZU7A 2PULA 1YXXA 1YQJA 2F57A 3FBVA 2HW7A 3RM6A 2RKUA 4NH1A 2QOCA 2HENA 3KMUA 5BPYA 3V8SA 3KRLA 4FSRA 4IW0A 3TNWA 4GFMA 1JSUA 4IZYA 2WIHA 2XBJA 2E9VA 1WBPA 3Q32A 1KV2A 3G90X 2C6TA 1KE8A 4TZRA 3G15A 4QTAA 2CCHA 4C36A 2QR7A 4O0TA 4BCKA 3FLQA 3WARA 3ZDIA 4GS6A 1FMKA 1ZYLA 3WILA 4BIEA 4FTNA 1OL2A 5ETAA 5FWKK 4BCMA 1XR1A 3DTWA 3TTIA 4FC0A 3NUSA 4FVPA 5LVOA 3DNDA 3QKKA 3FC1X 3BGPA 3LJ2A 4FKQA 3KU2A 4MD9E 3QF9A 4J97A 3SG8A 3RINA 4DH5A 3HP5A 4LGHA 4Z3VA 2IZSA 4IAAA 3U8WA 3R00A 3KMMA 4D1XA 1PF8A 4YJQA 5AWMA 3FXZA 2GQSA 3LXLA 3MA3A 2BIKB 3SXRA 1ZYCA 3ZLSA 2R3KA 2CKEA 5H8GA 1OBDA 4BTJA 1WMKA 3CQWA 2EWAA 3EQBA 4U45A 4L00A 3KB7A 4F7SA 3ORTA 4L9IA 1VZOA 3OWKA 1R3CA 4FSTA 2PPQA 3UNZA 5A4CA 3HMNA 3V6RA 5DEYA 3TNHA 3ROCA 3RWQA 3UQCA 3C4ZA 4Q9ZA 3E92A 4M66A 4JXFA 4JI9A 3UYSA 3UBDA 2CNQA 1YXVA 4QNAA 5IA1A 5DBXA 4MH7A 1OB3A 2P3GX 1B39A 5AR5A 2NP8A 5HESA 3RP9A 4QMMA 4J99A 4JDHA 3VVHA 4QP2A 4XRJA 5B2MA 3TM0A 4QMUA 4OTRA 1OPKA 3HGKA 3ZO4A 3BLHA 3IS5A 3ZYAA 4E5AX 1QPJA 3R7UA 4AN9A 5CAOA 3ITZA 4EH8A 1O6YA 5JFWA 2B52A 4GT4A 2A1AB 3KVXA 1Y6BA 3C0IA 3CGOA 4B0GA 3PTGA 5DPVA 3VUTA 2R3HA 2Y4IB 4MWIA 3AC1A 1M7NA 3R7IA 3Q2MA 1UVRA 1XH5A 2XIXA 3BX5A 3QRTA 4UWCA 3R9RA 4O27B 3R71A 1JSTA 2PUIA 5CENA 4K2RA 3C7QA 3FL4A 4YNEA 5D7AA 3UIBA 4TYHB 5KBRA 5IDPA 2J50A 4IIRA 4GRBA 3KCKA 4IBMA 4G17A 2QHNA 5IH4A 2BHHA 4O91A 2GNHA 3DPKA 5EW9A 5LMKC 4LGDA 3LVPA 3PJ2A 5KMNA 5J9ZA 5EW8A 1MRVA 3FYJX 3KN5A 1J7LA 2P55A 2ITZA 5TF9A 1H1QA 1JKLA 2Y7JA 2WO6A 3VS3A 2JKQA 5HX8A 3QX4A 3BELA 3HV4A 3U87A 4NL0A 2J7TA 3C51A 2C6IA 1ZZ2A 3BHVA 3C0HA 3D83A 3PSCA 4FIEA 5GNKA 3PLAE 3HDNA 3A8WA 2VAGA 3LFNA 2GS7A 1W82A 4QYHA 4WHZA 4BDIA 3QC9A 3LCKA 4CFWA 5M51A 2BKKA 3QZHA 4KBKA 4FTQA 4EOOA 4EZ7A 3SW7A 1JNKA 5IPJA 4UZHA 3UOLA 5IQFA 4BDFA 5AUZA 1FPUA 2PMOX 1KWPA 2R5TA 2W17A 4O7LA 2FVDA 2VWVA 3FMHA 3I7BA 4IFGA 5IEYA 4IAIA 5EFQA 3U4UA 4C35A 4RIXA 5IA4A 3MVLA 4ANBA 2VTIA 5FM2A 2RL5A 3DCVA 1PXIA 3EYGA 1CKPA 2C5NA 2YM8A 4EOPA 5LVNA 4MD8E 1Q24A 4KNBA 2J51A 3P0MA 3DK6A 2WOTA 4G6NA 3BHUA 5CQWA 4RVMA 4BGHA 1YOLA 2X8IA 3DXNA 4X2FA 5E1SA 2YLFA 3ORMA 3DBFA 5EI2A 5CXZA 1W7HA 2UV2A 1TQMA 5EW3A 4NIFB 4C57A 4X2KA 1YWVA 1R78A 4XUFA 4XX9A 5CAVA 4OAUC 2X1NA 3SQQA 5I9YA 5CSPA 5I9VA 2V62A 4F09A 4FT7A 5AX9A 3ZMMA 1DAWA 3IGGA 1E1VA 4YJOA 4EK8A 1XH9A 4FODA 3O8UA 3O71A 5HLPA 1XWSA 2FSMX 3F69A 5AA9A 4IB3A 1LEZA 2R3RA 5BNJA 1R0EA 2C6DA 3VS6A 1U59A 3MI9A 1KE5A 5E8UA 2YN8A 4AW0A 3AC5A 3BKBA 1Q8YA 1Z57A 4CMOA 5EDPA 2BIYA 5CVFA 4YURA 3LXKA 3KK8A 5AP0A 2XEYA 1VJYA 4M84A 5CQUA 3W1FA 4LOPA 5HLNA 4EQMA 4GFOA 4AW5A 2GQGA 1P4FA 5D9HA 2AC5A 5I5ZA 5CSXA 4E20A 2ZM3A 3EQHA 4TYEA 4YJSA 1WBWA 4ZTSA 4B9DA 2XMYA 4XOZA 5IA2A 3H0ZA 4BDCA 3G33A 3HMOA 1R0PA 3DZOA 2WTKB 2NRYA 4UWYA 4N6YA 3FLNC 2WEIA 4A06A 4MXCA 3BYUA 5L6WL 3U9NA 4L3PA 2GFSA 2E9OA 4CFUA 1YOMA 5HTCA 2JDTA 1OL1A 2R9SA 4G6OA 4CKJA 2EU9A 4Y85A 4LMNA 1Z9XA 3GVUA 3A7HA 4QP6A 5HG7A 5L8JA 3W32A 3FKNA 4AOIA 1PXMA 4XYFA 2Y8OA 3PE1A 4JNWA 4Y72A 3WOWA 4QMNA 3EFKA 4WO5A 3H30A 3R8PA 3ZBFA 2OFUA 4BTFA 4WKQA 3CGFA 4UN0C 3ID6C 2WXVA 4FZFB 4JBVA 3BZ3A 3GC8A 4UXQA 5J5SA 3E8DA 5KMIA 1CTPE 3QQUA 4Q5HA 5ANKA 5HICA 2DYLA 2ITWA 1AD5A 3KRRA 3QQJA 3C4EA 4C02A 4H1JA 3WYXA 2XB7A 4GIIA 4J1RA 3K3JA 3NZ0A 1Q4LA 4AT3A 2JIVA 3LQ8A 4L46A 4NJDA 4JOAA 4UXLA 3O7LB 4IAYA 4FTLA 1T45A 4PPBA 3IPHA 3C4WA 4FKSA 4P90A 4DFZE 4UZDA 4W9XA 4WG5A 3OOGA 3G51A 3PA4A 3MV5A 1UNLA 3HUBA 2XJ2A 3DAEA 4I5PA 4CEGA 2YWVA 4JBQA 4YTCA 4HZSA 4EJNA 4EK5A 2G15A 2QCSA 4XBRA 5D10A 2YITA 1WVXA 1Z5MA 2FYSA 3P4KA 5HE2A 4NW6A 4QQTA 5ETFA 2CSNA 2JD5A 1V0OA 2QOQA 3F61A 3MIYA 4XG4A 4DTKA 3TIYA 2CLXA 5EYKA 3N4TA 4AX8A 5B0XA 4LOQA 3FUPA 1BI7A 4FV3A 3PVGA 4RFYA 5DFPA 3RPVA 3KN6A 5GZAA 3PG3A 4X2GA 4FSWA 3QHRA 2VD5A 2CGWA 5DRDA 5JQ5A 5GIPE 2W06A 4HGEA 2VWXA 4KINA 5M56A 4J95A 4EWHA 5L2SA 3KFAA 3CE3A 4DGNA 4K0YA 4QPMA 3VQUA 4ITJA 4BBEA 5JMSA 1PJKA 2CGXA 4XG6A 4PMTA 2Y4PA 3RGFA 3FLYA 4RBLA 4IANA 3Q2JA 3QRJA 2WAJA 4L3LA 2XS0A 1XO2B 3FY2A 4I1ZA 1DAYA 1JQHA 4FL2A 4JX3A 4I21A 3C1XA 3QD3A 4KIPA 3RCJA 5FP5A 4HYSA 4UY9A 3ZXZA 5A14A 3V5JA 4MHAA 5EI6A 4AFEA 3MFTA 2P4IA 3FHRA 3W2RA 5ANJA 4DEBA 5KMKA 5HHWA 2HZNA 4XV1A 5BVOA 4C8BA 5BUEA 1J1BA 4O81A 3LXPA 1ZOEA 4F08A 2BZJA 2W1HA 2C3IB 3M1SA 4I6FA 1ZMWA 3IONA 2R3LA 3IOPA 2YM3A 2JDOA 4GU6A 4I94A 3CKXA 4KIKB 3V6SA 2IVVA 3R8MA 3VF9A 4C58A 5M4FA 3LAUA 4DN5A 5C4KA 4AQCA 4BKYA 2HYYA 4NTSA 2EXMA 3QTQA 4F0FA 3C5IA 1G5SA 2XK8A 2O5KA 1ERKA 2PZRA 3TNPC 3Q60A 1X8BA 3NX8A 5E8TA 5BUJA 3FSFA 4JG8A 4RIYB 3U9CA 1Q62A 4BCQA 3LCSA 3FLWA 5CWZA 4PDPA 3FE3A 5T3QA 3W18A 1WBNA 2WKMA 3EQDA 1OIUA 3QTWA 3FZRA 1FVRA 1O6LA 3Q4ZA 1KSWA 3AD6A 3DV3A 1UU8A 4X6RA 1Q97A 4XEYA 3ZC5A 3O96A 5J9YA 3LFAA 3ENMA 3PPJA 4Z7GA 1H01A 4KKGA 5A54A 3UVPA 3U6JA 3L9MA 1QPCA 3VUIA 3BWFA 1ZY4A 2HXQA 3SRVB 2C3LA 1H28A 3DJ5A 3GU7A 3N51A 4AGUA 5LMAA 2VTQA 5L8LA 3W16A 3EMGA 4YJPA 1WFCA 4G5JA 2WMAA 3SXSA 4EOIA 2XCKA 4GKIA 5FDXA 2XEZA 2C6MA 3HVCA 5IA5A 3DLSA 4XG3A 4E4NA 5EQPA 4FG9A 1Y91A 3DB8A 2ITXA 1YHSA 2UW6A 4R78A 3VJOA 4QRCA 3S00A 2XF0A 3QA8A 4ZTLA 1Q99A 2WU7A 4RT7A 3GU6A 4BB4A 4F7LA 5HIDA 4MD7E 2IVSA 4Z7HA 5J1VA 2CKPA 4XH6A 3TN8A 4I22A 3WIKA 4N57A 2GNLA 2PVMA 4NCTA 3RALA 4IAZA 1UWJA 2QHMA 4XG8A 5H8EA 2HAKA 4AOJA 4O82A 2VRXA 2ZMCA 5C26A 3SG9A 3DDQA 3A60A 4Q9SA 2YM6A 2OIBA 5EG3A 2X7OA 2V5QA 4RWLA 5AM6A 4EOMA 4E73A 3WF6A 4TYHA 3R2BA 4FV4A 3M11A 2C4GA 2OICA 1R39A 4XP2A 4CFNA 2BRMA 2JEDA 2Q0BA 2QVSE 3IECA 2GNGA 3CIKA 2AYPA 4LYNA 4U3YA 4A9SA 3R30A 4JQEA 2WEVA 4Y46A 4M15A 3F2RA 3R73A 4MEDA 2YAKA 4D4RA 4WD5A 3PWYA 3W33A 5JGDA 4ZSEA 2JKMA 3PP1A 3QYWA 1TKIA 1BL6A 4LM5A 4MYGA 4MF0A 5J95A 3TZMA 2W1DA 1H24A 5DG5A 3WE4A 2YIRA 1PMUA 2OJIA 5KMMA 2Y0AA 4O96A 1U4DA 2PE2A 1ZY5A 4DFXE 3CC6A 3Q6UA 5JFXA 4PL4A 1W83A 3UO4A 1BYGA 2C30A 2O63A 2HIWA 4BDJA 2XJ1A 3R1SA 5CVGA 3EKKA 2HZ0A 4PNIA 5BVEA 5AR8A 4BY9E 3QD4A 2W5BA 2YAAA 4FEQA 3NUUA 4NCTC 4WA9A 5CANA 4IVCA 4CKRA 3A61A 4PX6A 5JKGA 2IPXA 4FTCA 2Y4IC 1WBTA 4EH5A 2XVDA 4CG8A 3Q96A 3HECA 4YPSA 2VN9A 5FUTA 1P4OA 2YDIA 5M44A 2WHBA 3SAYA 4HNIA 2OIQA 3F7ZA 3KRWA 3TTJA 3IW8A 4USFA 3QCQA 4HVIA 5EH0A 3TV4A 5EM7A 4ASXA 3MTLA 4R1VA 5TE0A 4BICA 4ZEGA 5LVLA 3ATTA 4L3JA 3TDVA 2C0IA 3M2WA 1U54B 1V1KA 2J6MA 4GG7A 4RIWB 3GCUA 5DRBA 3RAWA 4F63A 4G5PA 2VWIA 1MRUA 4HYHA 2F2UA 4PY1A 3RPRA 4ALVA 2KTYA 2WMVA 5EYMA 3EQGA 1XJDA 3KRXA 4ZIMA 1W8CA 4I92A 3FI2A 5I9XA 4JT3A 4LL0A 3U6HA 4YBJA 4TWNA 4FK3A 1ND4A 2PVHA 5KUPA 3C4FA 5CEIA 4U79A 4Y95A 2PZPA 3B8RA 1GIIA 2WB8A 3OWJA 2PVKA 3IQ7A 2CHLA 3VUDA 3KF7A 5KZIA 4ACDA 2YM7A 3AQVA 3WF7A 2HXLA 4XS2A 3UNKA 1TQIA 3GXLA 3AD5A 4LV5A 3SX9A 4BZDA 5CT0A 4EYJA 3EQPA 3C0GA 3O51A 1PXKA 4ZLOA 3A8XA 4BYIA 4KS8A 3LPBA 1PXOA 4R77A 3I5NA 1YXSA 3TKIA 3P78A 5A46A 2XNEA 4IAFA 4IDTA 5M4UA 2VTTA 3ANRA 3QTUA 4ZY4A 2V0DA 3MPTA 2UW4A 4WOVA 3UIXA 3VS4A 3VW6A 1DS5A 3ZS5A 3R7YA 3R7GA 2FSTX 3U55A 4CZYB 2RFEA 2GDOA 4X3FB 3RPSA 5IU2A 3R1QA 5C8NA 2CNUA 3PP0A 3V01A 3LOKA 4IM2A 3ACJA 3Q9XA 1ZMVA 1OITA 4M12A 3EHAA 2PVLA 3P08A 4LV8A 2WELA 3MPAA 4GVJA 2BRHA 4FSQA 2HZ4A 3VUGA 4AU8A 4KIOA 4F9BA 4CKIA 4R1YA 4RVKA 5AP5A 3MWUA 5T68A 4YBKA 4L01A 3UZTA 3OCBA 4F0IA 2BRGA 4PTEA 3FLZA 2BPMA 5CEPA 3PXFA 2VWUA 4R5SA 3V5TA 3LMHA 4I5HA 3TXOA 4RX7A 4B6LA 5CSVA 4CV9A 5CY3A 2HY0A 5KMLA 4E26A 3MY1A 2GS6A 4GCJA 2YERA 3QTXA 1ZARA 1H4LA 1YKRA 3W55A 2PZ5A 1MP8A 4CMUA 3TKHA 2OF4A 4QPAA 4I3ZA 5CF5A 4N70A 5DGZA 3UMWA 3QA0A 2R3FA 3OMVA 4FSUA 2P2IA 3UQFA 4RQVA 2J0LA 2WTKC 3Q52A 2OZAB 3LKMA 3BCEA 2WMUA 3DNEA 4JR7A 5IA3A 2VU3A 3SOCA 4OT5A 3R83A 4LMUA 2VTMA 3EIDA 3PXKA 5H2UA 1FOTA 5JH6A 3FQHA 4E6CA 3DFAA 2VO7A 4M68A 5FTQA 2JIIA 3UNJA 5IQCA 3QUPA 3P79A 2BAKA 4FGBA 3RI1A 4B99A 2ITVA 2YCRA 3GENA 4FV2A 4L67A 3PVWA 4G34A 3F5UA 4GUEA 3MH0A 5KKRB 4BCHA 3MESA 2WMXA 4BIDA 4X2JA 3NS9A 2W05A 1UU7A 3NUPA 4GVAA 3GOPA 4UMTA 4GU9A 4FNYA 3Q3BA 4IEBA 2WOUA 4O0RA 5HORA 5HBJA 4BI0A 4TL0A 3NYNA 2J4ZA 1H1SA 2XK6A 3BU3A 2HK5A 3L8XA 4TW9A 4U80A 4A4XA 4E6DA 4CG9A 1FGKA 1K9AA 4CV8A 3LJ0A 1FBNA 3GB2A 3RVGA 3U4WA 2V22A 3P5KA 4AZEA 4W4YA 1CM8A 3NDMA 1BMKA 4OTGA 5HEZA 4FYOA 4IX4A 4MNEA 4DCAA 4CTCA 2JITA 2ZVAA 5AA8A 5KHXA 3R9DA 5AAFA 3WF5A 3FI3A 1MRYA 2ACXA 4NKAA 2OFVA 4DA5A 2O2UA 3LMGA 3PXYA 3E8NA 2F2CB 1WBSA 3F5PA 2IO6A 3NRMA 4YHFA 5CF4A 4KIKA 4S2ZA 4Z9LA 3VC4A 2WQMA 2GCDA 3DTCA 4R7HA 3KMWA 5F1ZA 3FZTA 4ZJIA 5ACKA 3REPA 5BVWA 1GY3A 2UZVA 4KUJA 4QP9A 4ANMA 3WZDA 2BMCA 4FIHA 4YPDA 3CJFA 1UU9A 3NR9A 2WTJA 4ZSJA 3ZLWA 4BDBA 5BVNA 5C1QB 3JYAA 3BYVA 3QQLA 5EYDA 3V5PA 4EOJA 3G0EA 5CX9A 4JR3A 2VTAA 3F2NA 5IQDA 4FTKA 2R7BA 1OPLA 5TR6A 3PUPA 3VBTA 4YZMA 5D1JA 4AT4A 2GMXA 2PSQA 4RZWA 4BI2A 1OIQA 4HCUA 3E8CA 4M7IA 3I6UA 3PJ3A 5JT2A 4I4EA 4D9TA 1YDRE 3NLBA 4C4FA 2B9IA 5ICPA 1JKTA 4BI1A 2CPKE 2GHGA 3EZVA 3MFUA 3NAYA 2UZWE 1E1XA 3SRVA 5JZJA 3FMLA 4IX3A 3Q6WA 2RG5A 4Q5EA 4BWXA 3SVVA 4AE6A 5C4LA 2PMIA 5CLPA 4B8MA 4C4IA 1P14A 1HCKA 3FJQE 3ZXTA 2ITPA 3UVRA 4EBWA 5GIOE 3OUKA 3W2PA 2X9FA 4FKPA 2OG8A 4HYUA 5BVKA 4F6WA 2RF9A 3Q9ZA 4O86A 4IB1A 3B8QA 4XJ0A 4GIHA 3MH2A 2XIYA 3QHWA 4EK3A 4RA4A 3IO7A 3NVKI 4MXYA 1KUTA 4D0XA 2X4FA 4HPUE 3UZRA 2ZM4A 3IKAA 3ANQA 5CZHA 4O0XA 4FIFA 4ITIA 4QT1A 2C47A 3MB6A 5BMSA 1Q5KA 2BAQA 4RQKA 3RNYA 2J0MB 3MIAA 3ALNA 2IW6A 3Q4TA 3LFEA 4U42A 1FVVA 3ZO1A 1GZKA 1PMVA 5FP6A 1Y6AA 2YCQA 2J5EA 1NVSA 4IAKA 3I0QA 4G1WA 5M4CA 4S32A 5AIKA 4IB0A 4W9WA 2IG7A 3GCVA 4K6ZA 4DH7A 4GG5A 4R5YA 4QP7A 2R0IA 3OCSA 3PY3A 1NVQA 4FR4A 4PF4A 1KOBA 5AV2A 5CASA 5CZIA 3TDWA 2YA9A 1XH6A 3GEQA 3QQKA 4OTWA 3BI6A 3KK9A 5M08A 1LPUA 4L43A 5AMNA 5IUIA 5HO6A 4YLLA 2UZUE 2OXYA 2XKCA 4F0GA 5HX6A 2JBOA 3UOJA 2XCHA 1O9UA 2ETMA 3OXTA 4S31A 5DYJA 3HA6A 3IOKA 4F7NA 2O8YA 2B53A 4BTMA 1ZRZA 2PZYA 4RPVA 3UC4A 4YTFA 3EYHA 3VJNA 1KE9A 5J87A 4KS7A 3QRIA 4I6QA 5LJJA 5HVKA 3HKOA 3C4CA 1GNGA 4XMOA 3H4JA 4O0SA 4U40A 1HCLA 2WD1A 3K5UA 3AT2A 4BDGA 4II5A 4ZTRA 1GZNA 1Q3WA 3A7FA 4FEWA 5DT4A 3FWQA 1YWRA 2BALA 3PJ8A 4FKRA 3VNTA 5GJDA 4QNYA 3KF4A 4ZLYA 3UO6A 4C59A 3KVWA 3HV5A 3QBNA 5HCZA 2YCSA 2WQNA 1V0PA 4FOCA 2QURA 4CMTA 3VS2A 4KABA 4ALUA 4GJ2A 4WNKA 4CRLA 2OH4A 1ZMUA 4HVDA 5J1WA 3EFWA 3TZ7A 1U54A 4ZS0A 4RIWA 5CALA 4R3PA 3EH9A 2X4ZA 4LG4A 1NVRA 4EBVA 4FKIA 3OY1A 4YZNA 3UVQA 1XH8A 3CKWA 3ZUUA 2W5HA 2WU6A 4EQUA 5AUYA 4FTIA 2RFNA 4IC8A 4N6ZA 3N9XA 2LGCA 1WCCA 4ENXA 4A9UA 4R8QA 4U6RA 4DHFA 2ZMDA 4WUAA 4FYNA 1GAGA 3R63A 4UX9A 2YCFA 1FGIA 2DS1A 4XOYA 4NSTA 4QTEA 2XIRA 3QZGA 3ERKA 5FM3A 2WTIA 4V01A 3JY0A 4BYJA 5IISA 2A4LA 3BHYA 2G9XA 2PUPA 2Z60A 4UWBA 4YUQA 4YLKA 5TT7A 5A4TA 3I60A 4E4MA 2UZBA 3TKUA 3ORZA 5FQDC 2OLCA 2I40A 4UYAA 3PG1A 5I9UA 2ZV9A 1WVYA 4D9UA 2XKEA 3NYOA 3TJCA 3GFWA 3GC7A 4QYYA 2VZ6A 4AA4A 3U6IA 2OJJA 3HL7A 5DR9A 3NUXA 2QLUA 4W8DA 1Q3DA 4QTBA 3FZ1A 4RZVA 3JUHA 4ZP5A 4KWPA 2UVYA 3OEZA 2PVYA 4YGAA 1ZLTA 3NNWA 4LRMA 5AIRA 3MW1A 5TO8A 4XBUA 4O2PA 3MVMA 4G3CA 4X3FA 4C2WA 2QOIA 4TXCA 4FTTA 3BBTB 2XKFA 4EI4A 3RJCA 4M14A 2VTRA 2W1CA 4BHZA 2OKRA 3T9IA 2IW8A 1NY3A 3HRCA 4FTMA 3V5QA 2UW0A 3OG7A 4F6SA 4DG3E 5BQ0A 3OF0A 5I9WA 1OUYA 5DT3A 3KXHA 3GUBA 4IVBA 4PUZA 2PTKA 3QZFA 4RJ8A 4ZZMA 4ANSA 2XRWA 2AUHA 4X21A 2H9VA 4FOBA 4LFIA 4HYIA 4BC6A 3AT4A 3NGAA 3WZJA 3IDBA 4DT8A 4ARKA 4V05A 4F7JA 4FVQA 1H0VA 4KA3A 4ZSGA 3QTSA 4FKUA 4E5WA 4YR8A 3OT3A 5JFVA 2CGVA 3QQFA 3GCQA 2W5AA 1PMEA 3NW5A 4MCVA 5EHYA 1XBBA 3RZFA 1BL7A 2CMWA 4O7RA 5AUWA 4FG8A 1YHVA 3A7GA 4FEUA 3IW7A 1MUOA 3R1YA 1RW8A 4HOKA 3EL8A 4DITA 4M8TA 2OZAA 5F9EA 4KRDA 5IEVA 4XV3A 4D2PA 4K77A 4IMYA 5E8ZA 3F5GA 1IG1A 1SVEA 3ZFMA 4PNKA 4GL9A 4H58A 3BU6A 5E7RA 2BAJA 5EOLA 1O6KA 4C34A 4FGRA 2F7EE 3HP2A 4JBPA 1L8TA 3KCFA 4X3FC 3D2IA 5E8XA 4KSPA 4AE9A 2E9NA 4OT6A 5K3YA 2OXXA 5EKOA 4HZRA 2GHMA 3HV6A 4H3BA 4RJ5A 2CLQA 3ZC6A 3P7CA 2X81A 4I93A 4BF2A 3QFVA 5A4LA 3HDMA 3CSVA 2R7IA 4PPCA 3SV0A 3LCOA 2BZHB 3ZRLA 3COIA 1BX6A 3EN9A 4RIOA 5IH6A 5FD2A 2J2IB 2QO9A 3DA6A 3S95A 4O7NA 2GNIA 3IDPA 3V51A 4QQJA 4M67A 4U9AA 5DIAA 4YSJA 2BZKB 3E64A 4G3FA 4O21A 3OT8A 5F94A 2R3OA 3F3UA 2A0CX 3PPKA 4U43A 5ETIA 4AUAA 4MXXA 2XK4A 4KBAA 3A4PA 1OKWA 3AC8A 5M07A 3NCGA 5KHWA 2BTRA 2RIOA 1H00A 3JVRA 5BX0A 3RMFA 4WRSA 4FT9A 2QU6A 2WMWA 3OTUA 4DEDA 4AACA 3QAME 5J9LA 4ZMEA 3O2MA 3VRYA 3UG2A 5JQ8A 3RPYA 3C5UA 2R3PA 3ZONA 4YZCA 4PMPA 2IZRA 3K5VA 4MWHA 4W4VA 3T3UA 4CCBA 1YW2A 5ANDA 3ZRMA 4E93A 4USEA 1AGWA 2REIA 2VX3A 3POOA 2IVTA 2Z8CA 3TZ8A 4DE4A 4PQNA 3BE9A 3LE6A 3HNGA 3I6WA 3OP5A 4CLJA 2R3JA 4AA5A 2G2HA 3E7VA 4WNPA 4WG3A 2QNJA 2IVUA 3I1AA 4IQ6A 2WIPA 2WMSA 2B55A 5AP7A 2UW5A 2VUWA 3DJ7A 1UA2A 2C5XA 3EWHA 1ZXEA 3WZKA 1OKYA 4KKHA 4FSNA 3HV7A 4MK0A 2ZM1A 4D5KA 4TWOA 1NXKA 4AWIA 2VX0A 4MNEB 3FI8A 4HPTE 4UBAA 2JAVA 3DKOA 3PLSA 3OOMA 3GU5A 3ORLA 4RLLA 4BCJA 3EQRA 4WIHA 5CNNA 1M14A 3CP9A 5AP6A 2F9GA 3KULB 4AFJA 4JBOA 3ZZWA 1ZYJA 4F1TA 3SOAA 1OKZA 2PL0A 3VIDA 4GSBA 3E63A 2J0IA 2OF2A 3OROA 4G3DA 4L45A 4PP9A 5GZ9A 5H9BA 4CNHA 1YI6A 2UZOA 3OD6X 3HAVA 5AP4A 4CD0A 4DFUA 3VBVA 2BHEA 2V55A 4F9CA 5I9ZA 3OBGA 4E4XA 3ZSHA 4IJPA 5BVFA 4OTIA 3LFCA 4ALWA 1CSNA 3HMPA 5CSWA 5HIEA 5M06A 5DVRA 3UPXA 3ZEPA 4H3QA 2B54A 3S2PA 3NSZA 1J3HA 5HCXA 3R9NA 2PY3A 3JXWA 4OTQA 2HOGA 4H3PA 4M13A 3FMDA 1JVPP 4APPA 2BRBA 4YU2A 2OJFE 4DTBA 2G2IA 3D14A 5BYZA 4ZSLA 2CN5A 4LUDA 3VO3A 3PIZA 4CFVA 3QD2B 1YVJA 2ETRA 2YIQA 3QLFA 4K18A 1JBPE 4AS0A 4QO9A 3HEGA 1M52A 2GNFA 4JIAA 4PL5A 2W1ZA 3DGKA 4YTIA 4X3JA 4PV0A 3LLTA 3NUNA 4QMLA 3G9LX 5C01A 1SNXA 4FNWA 5IQGA 3UDBA 5EM8A 3VUKA 1I44A 4GK3A 1GIJA 5E8WA 4X0MA 3BQCA 5FBOA 4C3RA 5J79A 3OEFX 2HCKA 4U97A 4FKOA 4W4XA 5M4IA 2W0JA 3GI3A 3Q9YA 1WBOA 1UKIA 5CU4A 3D7ZA 3Q53A 4RFMA 2YFXA 2OZOA 3TJDA 3MY0A 4HCVA 3NW7A 4WUNA 5JGAA 5FBNC 1SM2A 4TPTA 3RKBA 2X2LA 3UIUA 3DXPA 2FSOX 5E90A 3BIZA 4QQ5A 4TT7A 4QYEA 3RHXA 3W10A 3W2CA 5LCJA 3F2AA 5DH3A 4EOLA 3OS3A 2ERKA 3HLLA 2IZTA 3RTPA 1REJA 3L9NA 4KIQA 4BGGA 3A2CA 2W4JA 3NNXA 2XK7A 4JIKA 3BLRA 2XA4A 5DA3A 5IF1A 2CNVA 3L9LA 4V0GB 5LMBA 3BU5A 4TTHB 4MX9A 3DQXA 3MVHA 1Y57A 2OXDA 3EZRA 4FIJA 5L6PA 2B0QA 2R2PA 4WSYA 3V8TA 3QQGA 4C4EA 4FNXA 4ZY6A 5FEEA 4DLJA 3N4UA 1VYZA 3EN6A 4D2SA 1W84A 2IW9A 3OZ6A 2GNJA 3CQEA 4IH8A 3OFMA 4IZ7A 1ZAOA 4BCGA 2ZJWA 5HBEA 3NNVA 4PDYA 4RGJA 3R04A 2C0OA 1URCA 4I20A 3FPQA 4EUTA 1HOWA 2BCJA 2YACA 2CJMA 2E9UA 3FKLA 3VN9A 3DLZA 4I23A 3EL7A 4DFNA 1Q8WA 4E4LA 4FUXA 1XKKA 5IA0A 4MXOA 1H08A 2XRUA 3CEKA 3R02A 4JDJA 3ZEWA 4IWDA 2OW3A 2GFCA 1OKVA 3O8TA 2X0GA 4O0YA 4CYJA 2BDJA 4DEAA 5AUUA 5B7VA 4YZBA 3FMNA 4LI5A 4EHGA 4RC3A 3RAHA 3UODA 2G1TA 3LCTA 4JDIA 3DJ6A 3DBCA 4D5HA 3FEGA 4O84A 1UU3A 2I0EA 4DG2E 1JLUE 2VTOA 4USDA 2W1IA 3FSKA 5M09A 4BDHA 3D5XA 4K33A 4QMTA 4F70A 1OGUA 2C5VA 2JAMA 3PJCA 3VUMA 4I4FA 4AZVA 4FZ7A 4XHKB 2WMQA 4BDEA 3HRBA 4M3QA 5H3QA 4DLIA 4JS8A 1UWHA 4RFZA 3PYYA 4ITHA 4TNBA 4A7CA 1H1WA 3ZOSA 4OTPA 2C5OA 3MYGA 3Q04A 2PU8A 3EN5A 3UP2A 4C7TA 3LQ3A 1U5RA 3R7VA 2BKZA 1CKIA 2C6OA 2VWWA 4HGTA 5CS6A 5CSHA 4NFMA 5FLFA 2E2BA 4YJRA 3P9JA 4ZJVA 3QCSA 3QLGA 1J1CA 3AD4A 3VHEA 4IADA 1IA8A 4LQMA 5KZ0A 4QP4A 4CT2A 3LCDA 5IMXA 5JSMA 3O23A 5IMEA 3MGYA 3VUHA 4DGMA 3ULZA 3VBQA 4ZSAA 3R8LA 4D4YA 3C50A 4ZZOA 1RE8A 3MY5A 4EC9A 3CS9A 2GHLA 3CR0A 3H9OA 3HV3A 3HYHA 2QKRA 4GEOA 2F4JA 3QTIA 5F95A 4EH6A 1ZOGA 3LJ1A 4I41A 4YLJA 1IR3A 3IG7A 4ERWA 3PZHA 5HIBA 5A6NA 4C0TA 3TG1A 1ZZLA 3CXWA 2YDJA 4PRJA 3S1HA 4G9CA 1TQPA 2JFMA 1BI8A 2JBPA 3G2FA 3F7WA 2IN6A 4I6BA 4IWOA 4GJ3A 3WF9A 2CKQA 3F9NA 1KE6A 2W7XA 4FKLA 2H34A 3MH3A 4HNFA 1K2PA 4FV0A 1ZWSA 3SDJA 4RC4A 4ZXTA 5AR7A 1WAKA 2C6KA 3HMIA 2LAVA 3IW6A 5I3OA 4NEUA 4EHVA 4C33A 3ELJA 2YJSA 1YDTE 4XCUA 5EDRA 4YO4A 1ATPE 3O17A 5HQ0A 4FVRA 3EN7A 3G9NA 3IK3A 4H39A 3DS6A 3F3VA 4AZTA 4U5JA 4BCFA 4BVUA 2Z02A 4ANNA 3UGCA 4A9RA 2C6EA 3RAIA 3BLQA 2VGPA 4L68A 4AAAA 2VTSA 4MNFA 4RX9A 3A7JA 3MS9A 4O38A 5HNIX 3OW4A 2XYUA 4L8MA 4EH7A 2PVRA 2HWOA 2XNOA 4QTDA 3A4OX 4GV1A 2YIYA 3BBWA 2QLQA 3NVMB 5JZNA 1PHKA 3NUYA 3VW8A 1GZ8A 1LP4A 3LFQA 2GSFA 4W4WA 5CAQA 4ONAA 2R4BA 5J7HA 3CY2A 4P5QA 4FTUA 4WT6A 3NMUF 5HI2A 4K9YA 4X7QA 2X6DA 3EOCA 2QODA 5KNJA 3W8QA 2VO0A 2Y9QA 4ASZA 5IG1A 4D28A 4FZDB 3V3VA 4E1ZA 3SKCA 5A4EA 5CYIA 5BYYA 5EDQA 4ENYA 2JDRA 5EI8A 2X7GA 2XZSA 5AR4A 3MVJA 1DI9A 3W2SA 3L8SA 5KMJA 2JDSA 4A9TA 4YJVA 4APCA 1V0BA 3HAMA 2X6EA 5HVJA 1XBCA 1SMHA 3TEIA 3BYMA 5LXMA 1H8FA 4XP0A 3JVSA 5B2KA 3QWKA 5FTGA 4H05A 4KKEA 1UNGA 2W4OA 1JAMA 5E92A 1SZMA 4FSZA 3MTFA 4LGGA 1OZ1A 4D2TA 2R3QA 4NUSA 4DF3A 5D7VA 5HG9A 4YTHA 2OU7A 4WSQA 4K11A 2OGVA 3LM0A 4RVTA 5AR3A 2HW6A 3G0FA 3R21A 1F3MC 2CCIA 3C4XA 4XV9A 2X9EA 4YHJA 4Z55A 1OI9A 5GINE 4IZ5A 2WNTA 3OWLA 3R1NA 2YHVA 2PHKA 2C68A 4PP7A 2WMBA 5JN2A 2Z7RA 2WGJA 2JGZA 4GKHA 2HELA 3OHTA 2BVAA 3BWJA 2W4KA 3NCZA 3QGWA 3ORPA 5GJFA 3WZEA 3ZLXA 4FTJA 4UEUA 3KRJA 5L6OA 2P0CA 2BFXA 3DKGA 3II5A 3CCNA 4MXAA 5K0KA 2NNWB 3FMMA 3LZBA 3P7BA 3S4QA 4FMQA 3SC1A 3TIZA 4EKLA 3FL5A 2WTVA 3GOKA 3KULA 2UW9A 1WBVA 4R3RA 5FRIA 4TYJA 3ZUVA 3VS1A 4FE2A 3RK9A 4EOKA 5JFSA 2YM5A 4AGWA 4A9YA 3UOHA 3DBQA 4UMQA 3DU8A 3I4BA 2W1GA 4MBLA 4CQGA 5IEXA 2WMTA 5JRSA 3FMJA 3ZCLA 3ZLYA 4DCEA 4DH8A 3PY1A 5DR2A 2BTSA 4YO6A 5L2WA 5CU3A 4FSMA 4BN1A 4P2KA 3ZO3A 4EKKA 2B9HA 3HX4A 2EB2A 4D58A 3C9WA 4CZUA 3ZDUA 4ANLA 2OO8X 2UUEA 1F0QA 5DWRA 4Y83A 1PKDA 3PZEA 1H1PA 2V7AA 3QKMA 1KV1A 3E62A 3ALOA
chains in the Genus database with same CATH superfamily
4HCTA 4OTHA 4Y73A 4PDOA 3Q9WA 3SXFA 3OY3A 5F4NA 1U46A 2NRUA 4U44A 3RM7A 5K5XA 2RFSA 4EOSA 3JR1A 2H8HA 3LLAA 4DINA 1B38A 4Q2AA 3OW3A 1A9UA 2R64A 3E87A 3P86A 5CEKA 5DI1A 2PZIA 5LQFA 2E9PA 4RJ6A 5CU2A 1M2PA 1K3AA 2FO0A 4HGLA 3RK7A 3WBLA 2PK9A 3H3CA 4OGRA 2O0UA 3OXIA 4O7WA 4EONA 4FL3A 5EOBA 4G3EA 4GW8A 4D1ZA 5CEMA 3O7LD 4B7TA 3G6GA 3W0RA 4A07A 4E6AA 3CTJA 3V5WA 5A9UA 4FV9A 2W1FA 3GQLA 4AQKA 4C4HA 5IDNA 1YXTA 2ZB0A 3EFJA 3R8ZA 2YLEA 2ZV7A 3DK7A 4PMMA 4Y5QA 3GU4A 4PL3A 5GJGA 4CXAA 4NYEA 4CCUA 1GZOA 1M2QA 4CRSA 3HA8A 4YNOA 5T6KA 3FZSA 4FJVA 4FKWA 3BV3A 4IWQA 3TZ9A 4BJJB 2JIUA 4AG8A 4IVDA 3EJ1A 2QI8A 4L42A 3FHIA 4JQ8A 3VS0A 2NO3A 2YWPA 1J7UA 2OIDA 5B2LA 4AA0A 3I5ZA 1S9JA 4BDKA 4V0GA 4MKCA 3UDSA 2G2FA 4ZTMA 4MQ2A 3NYXA 3ODYX 4BHNA 3GC9A 2NPQA 1A48A 4E7WA 2I7QA 3QXPA 1BKXA 4BWKA 4O0WA 3FLSA 5TKDA 3QX2A 3H9FA 2WQBA 4PTCA 4QP8A 4TRLA 4JG6A 2A27A 3RHKA 4AN2A 2C1AA 3KXZA 4KSQA 4RVLA 5DOSA 4R7IA 2GPHA 3PXZA 3F3WA 4BRXA 4F1MA 4NKSA 2YM4A 4QPSA 2A19B 2VWYA 1UNHA 3VWAA 4YHTA 3CBLA 2C5YA 3OWPA 4WNMA 2C69A 4QTCA 4I0TA 4CVAA 3VULA 2XALA 3QZIA 4J7BA 3F82A 2WTDA 4JDKA 2WPAA 4XG7A 2JKKA 2UZEA 3ENHA 2VWBA 4ZJJA 5HBHA 5LMKA 1P5EA 4IJ9A 5GZ8A 3L9PA 2OBJA 4NJ3A 2XH5A 1IAHA 3HUCA 2FUMA 4FTRA 3UIMA 4QMSA 2FSLX 3KA0A 4K8AA 2P33A 4RSSA 4E5BA 4EUUA 5IUGA 5C27A 2R3IA 1ZYSA 4HVSA 4OLIA 5L2QA 5M53A 2C3JA 2O3PA 4YJTA 2QR8A 4HW7A 5KCVA 4IM3A 1G3NA 4XLIA 3P23A 4S33A 4JRVA 5E8VA 4IDVA 4DTAA 4GT3A 5CU6A 3COHA 3QKLA 3OBJA 4IX6A 5H8BA 3GCSA 1OL6A 2GTNA 5L4QA 3F6XA 2C3KA 3W8LA 3PFYA 4F1OA 4O22A 2QD9A 1VR2A 3E93A 3EQIA 4P4CA 1NT2A 4O7SA 2QG5A 3CJGA 4IACA 2WQOA 5HVYA 4ACCA 4AZFA 4YP8A 2B4SB 1SVHA 3R6XA 1JSVA 4WG4A 4FEVA 3ODZX 4R3CA 4ASEA 2VTPA 4JVGA 4KB8A 4CQEA 1OBGA 2GS2A 2EXCX 5IQAA 4IE9A 2BRNA 2OJGA 3QC4A 3BGQA 4IX5A 3TMOA 4O0UA 4NM3A 4BGQA 4CT1A 1VYWA 2ZDTA 4FV6A 4P5ZA 3D5WA 3V8WA 4JL9A 4ACGA 2EXEA 1GJOA 1YRPA 3VHKA 1NW1A 1IA9A 4W8EA 5DEWA 3ZFYA 1CMKE 3CQUA 3D4QA 3M42A 1FVTA 5DE2A 4FEXA 2ZOQA 5K5NA 2PE1A 4NTTA 3RZBA 4D2WA 3NEWA 2ESMA 2JLDA 4MXZA 4LRJA 3D9VA 3R9OA 2W9FB 2W1EA 4CFXA 3ZH8A 5HTBA 3AC2A 4G2FA 4AN3A 4FBXA 2Y6MA 4AW1A 4DH3A 1NA7A 4TYGA 2UZNA 5EM5A 4EL9A 4TNDA 4OTFA 4BBFA 3VF8A 5HLWA 4HVGA 3R8VA 2WMRA 2Q0NA 5E8SA 4LV7A 1H1RA 1WZYA 2Y6OA 3L8PA 4L52A 3MFSA 4DBXA 3FKOA 4KRCA 4E3CA 5AV1A 4E6QA 3OCTA 3EN4A 3PXRA 4BDDA 3CLYA 3DZQA 1LR4A 4J8NA 4FKTA 4ZTQA 3VBXA 1UKHA 2VTLA 2XM8A 3GFEA 3OTVA 3U54A 3FZPA 2YISA 3IGOA 1OL7A 3G6HA 3BL9A 2FA2A 1QPEA 1J7IA 4YJUA 3AKJA 4B8LA 2FGIA 3GGFA 5DN3A 2W96B 4G6LA 3ZHPC 3AXWA 3I79A 5BMMA 3AG9A 3FC2A 2CKOA 4S30A 3AT3A 3ZSGA 3O50A 4ID7A 2H6DA 2X2KA 3DAJA 4HVHA 2BROA 3BE2A 4XLVA 5L2TA 5D12A 3FPMA 1LEWA 3UYTA 5HG5A 2ZV8A 3WYYA 4YSMA 5BVDA 3QD0A 4D1SA 3BV2A 3DKCA 3VRZA 4L7FA 3PFQA 3EQFA 4ERKA 4BFMA 3ORXA 3U51A 3ORNA 2X8EA 2CGUA 2XNGA 5FGKA 1XMLA 2QOOA 4DT9A 1Q8ZA 3PSBA 3AMBA 5KX8A 3NIEA 5ITAA 3ATSA 2C0TA 2YEXA 3TNIA 2XNPA 5LWMA 2R3GA 3D15A 2QOLA 4C4JA 4PTGA 5CU0A 3SD0A 2ITUA 4C2VA 2R0UA 5HKMA 4FICA 2WQEA 3UOKA 3R22A 2RFDA 3MJ2A 4XG2A 3SGCA 5HNGA 1JPAA 4PDSA 2H96A 3R9HA 2NYAA 3PUFC 3JS2A 1PY5A 1JWHA 3BPRA 1JOWB 2GU8A 4QMWA 2WTCA 1I09A 1PXPA 5CAUA 1DI8A 4OBQA 2J0JA 2FH9A 4GH2A 2BZIB 4C61A 5CAPA 5HOAA 3TV6A 4U81A 4RJ7A 1SNUA 4U3ZA 2PWLA 3P1AA 4MBJA 4JAJA 5ANGA 3TI1A 4AP7A 5AV4A 3VONA 4DFBA 5F20A 5HU9A 2QOFA 2ZB1A 4MQ1A 4D0WA 5HGIA 4UMUA 1JKSA 1RQQA 2X7FA 1W98A 3FDNA 5C8MA 4FK6A 2IJMA 3DT1A 4J98A 5LOHA 5C9CA 2OK1A 4JQ7A 2I0VA 2XNMA 5M57A 4CFMA 2ZDUA 5HNBA 4BCOA 1ZOHA 3ZFXA 3PY0A 1G8SA 2UZTA 3QXOA 4DEEA 2XK3A 2AEGA 3AC4A 3DOGA 4FT3A 4FSYA 5AJQA 1FINA 2VTHA 1QL6A 2QOKA 4CTBA 4G16A 4WBOA 2AC3A 4ZZNA 2IZUA 3KY2A 4FNZA 1IAJA 5FXQA 5TOZA 2XNBA 2QOBA 3MN3A 5FDPA 2P2HA 2VNYA 4M0YA 3QTRA 4IVAA 4BCNA 2SRCA 5ANEA 4RG0A 3MH1A 2PVFA 2VO6A 4D55A 2UW8A 4GT5A 5JK3A 4MVFA 2XJ0A 3ZUTA 5LWNA 2ITYA 4DDGA 3PE2A 2ZAZA 3RK5A 5L2IA 3POZA 4NK9A 1H27A 3OC1A 1Q61A 4RJ4A 5CT7A 4QDEA 3G5DA 3KKVA 1ZYDA 3BYSA 3R8UA 4E8AA 3BHTA 2RSVA 3AC3A 4FV1A 5I4NA 3MBLA 4DG0E 4L44A 3CD3A 5AP1A 3L1SA 4OAVB 3LFSA 3KEXA 3VS5A 3PVUA 5KMOA 1PYXA 2BILB 3CTHA 4KBCA 4U41A 5L3AA 3AKKA 4A4LA 5IZFA 4RRVA 4S34A 1YDSE 1R1WA 4YMJA 3S0OA 3SHEA 2YABA 5KKRC 4EOQA 5IQBA 5D41A 4YZ9A 4O7VA 3RWPA 3ORIA 3KXNA 3KXGA 3PRFA 3HRFA 4F9YA 3BQRA 5I0BA 4ZMFA 2PE0A 2HZIA 2VTNA 2KULA 3MDYA 3L8VA 3EFLA 2B7AA 1OIRA 4M69B 3P7AA 2QG7A 1A06A 4IB5A 4ZTNA 2Q83A 1YHWA 2VV9A 5IH5A 3KL8A 3AOXA 3KQ7A 2ITQA 2QU5A 4OUCA 3UZPA 4M97A 4F65A 4TWCA 2JKOA 5DNRA 4O7TA 4RWJA 4Y5HA 2PMNX 1OL5A 3F3TA 4DBNA 5AFVA 2UW7A 4HGSA 5AUXA 1IASA 3C13A 3OXZA 5LARA 1PW2A 1Q41A 3D2KA 2GQRA 3LQ5A 4FKJA 1Y8YA 4C3PA 3FY0A 5KO1A 3DXQA 4PWNA 5HD4A 5AP3A 2XKDA 5EYCA 4CSVA 4NM5A 1UV5A 5EHOA 4EH2A 5E9EA 4DHIB 2F49A 2QONA 3ZO2A 1OM1A 4J8MA 3FV8A 4G9RA 5EK7A 2GTMA 2I0HA 1PRYA 2JFLA 3QRKA 2WZJA 3BHHA 3NPCA 4LOOA 3TV7A 3F88A 2ITTA 2YIWA 4C4GA 3PIYA 1Q8UA 3QYZA 4EORA 3TYKA 4BJJA 4NM0A 5AADA 1CDKA 2ETKA 4TN6A 4DC2A 2OJ9A 3UTOA 3VS7A 2Z2WA 4V04A 2UZDA 1YI4A 5BYLA 1M7QA 2YIXA 3PVBA 3MSSA 3PWDA 3ETAA 2X8DA 3FYKX 2XNNA 3EB0A 4XNEA 4UMRA 1STCE 4ACMA 2J90A 3T9TA 5CTPA 3CTQA 5E91A 4EZ5A 3Q4UA 4CGAA 4D2RA 4WRGA 3AGMA 4Z16A 5GHVA 4FTOA 4XRLA 3JY9A 2PYWA 5K9IA 5AAGA 3CY3A 4EH3A 4F6UA 5HU3A 3VBWA 1OMWA 3BEGA 3O0GA 3O8PA 3NIZA 3SLSA 1MQBA 3B2TA 3AGLA 2XP2A 3LIJA 3KXMA 3THBA 4EC8A 5HE0A 3UPZA 4FTAA 4BR3A 2BUJA 1XQZA 4NZWB 3I81A 5LVMA 3D7TB 4DH1A 4QQCA 1H25A 5D11A 2BFYA 2DUVA 3ORKA 4EQCA 3NWWA 3KXXA 3ROYA 4AZSA 2YJRA 4D2VA 5KBQA 4DGOA 2B9JA 4NWMA 2A2AA 4CZTA 4DGLC 4O7YA 2XBAA 2OSCA 2EVAA 2W9ZB 3DB6A 3TWJA 5E4HA 4I24A 4N0SA 4O83A 4JX7A 4QOXA 3TCPA 3UP7A 4CFFA 1KE7A 1KOAA 1YI3A 4LUEA 2B9FA 4L7SA 3PDTA 4J53A 3E88A 4FA2A 2F7XE 3PA5A 4FZ6A 4GK2A 4GK4A 4I0SA 4RWKA 2QQ7A 4PPAA 4TKSA 3H9RA 4EK4A 4KAOA 4QMYA 4IXPA 4O2ZA 5HO8A 4DHJA 4DEIA 1SYKA 4QMPA 3NUAA 2BR1A 5DT0A 1YWNA 2J0KA 4RJ3A 4LRKA 3RBWA 3K3IA 5IUHA 4IHPA 4FG7A 5AV3A 3IDCA 3VAPA 4RMZA 3N4VA 3LW0A 4AGDA 4YC3A 3DBDA 3ZTXA 4MBIA 4YJNA 2I1MA 4BZNA 5CF6A 3HZTA 3W2OA 3EQCA 5EQEA 4EHZA 4FT5A 5J5TA 4G31A 4BL1A 3COKA 2G01A 1H26A 4K1BA 4EYMA 3NW6A 5AUTA 3PSDA 5C8KA 4QMVA 3PA3A 4X2NA 2V7OA 4YC8A 4XV2A 3TT0A 3PJ1A 4DEHA 5BUIA 5DLSA 4BKZA 1QCFA 4ZTHA 1GOLA 2PVJA 4BIBA 5ANOA 3PPZA 4AT5A 4DFYA 3GBZA 1VEBA 3MJ1A 4JAIA 2ONLA 3R28A 4FUYA 1PYEA 4H1MA 4TY1A 3DK3A 5AX3A 2QO2A 2B1PA 3LFFA 3DFCB 4QMOA 3TL8A 4DGGA 4I6HA 5HD7A 3LFDA 3PRIA 4F9AA 4ZLZA 4JLCA 2CDZA 4IFCA 3NFFB 5CI6A 1PMNA 4OR5A 4BTKA 3B2WA 3GNIB 5JRQA 2R3NA 4ZAUA 5C03A 2UVXA 1BUHA 3QUDA 5ANIA 4BKJA 4DEGA 4C37A 4UYNA 4RX8A 5AAEA 5L8KA 1DM2A 4RC2A 3PXQA 4XG9A 3VQHA 5HTIA 4BCIA 2XM9A 3I0OA 4FF8A 3F5XA 3FXXA 4H36A 4R6VA 1G8KA 4XP3A 4J96A 2CN8A 4NFNA 3KREA 3FZOA 4U7ZA 2BDWA 5IKWA 2JC6A 2I0YA 4OTDA 3UC3A 5DMZA 3ZZEA 2ZYBA 4O1OA 3AMAA 4YZDA 3Q4CA 4OW8A 3DKFA 3WZUA 3RPOA 5K4JA 1QPDA 4MF1A 4O6EA 4ZY5A 2ZV2A 2UVZA 4L6QA 1SVGA 3MB7A 4GMYA 4QP1A 5CEQA 3FMEA 3CPBA 3DBEA 3ACKA 3QQHA 3ZM4A 2C1BA 4NM7A 5LVPA 5HO7A 4BBMA 3QCYA 1REKA 3LM5A 3Q5IA 2PUNA 1YXUA 4ASDA 3E5AA 3TACA 3UQGA 3R0TA 4GYIA 4FV7A 5FXSA 2C6LA 5J7BA 2ONLC 4C62A 4X6QC 4L53A 4LL5A 4C3FA 4NIFA 4AF3A 2VTJA 2YZAA 3FQSA 1MQ4A 5G6VA 2R3MA 3QTZA 5DHJA 2UW3A 1QMZA 4C38A 3GCPA 3FXWA 3V04A 3S3IA 3IW4A 4U0IA 4CYIA 2Z7QA 4NW5A 4GYGA 1Q8TA 3KC3A 4QMQA 1BLXA 5A6OA 4FI1A 4CLIA 2PVNA 3TNQB 5HCYA 3T8OA 4F4PA 1OVEA 5HE3A 4ZOGA 3V5LA 4EK6A 4OBPA 4RWIA 3D0EA 4WNOA 3HMMA 3VBYA 5A3XA 3QALE 4ZS4A 1PXJA 1IEPA 3DDPA 4QMXA 5CVHA 3I7CA 3F66A 5FXRA 3E3BX 5ACBC 1IRKA 3R01A 4RIXB 5CI7A 4IZAA 2X0PA 3Q5ZA 3GC0A 4I5CA 4EWQA 3R7EA 4EZ3A 4UMPA 1XH7A 2JDVA 1AQ1A 4RLKA 4ORKA 2W99B 1L3RE 2X39A 4BCPA 3NAXA 1PKGA 3A62A 1J91A 2Z7SA 2OWBA 1B6CB 5IQHA 1H0WA 2FB8A 5EM6A 4M0ZA 4ANQA 4JJRA 4TYIA 5I3RA 5KE0A 3RAKA 3GQIA 3FAAA 3R2YA 4IC7A 1WVWA 4EEVA 4FKVA 2OH0E 4Y8DA 3A99A 4LDTA 3H0YA 3COMA 4FIIA 1S9IA 3R7OA 3UE4A 3WF8A 2VX1A 4AGCA 1YOJA 4RX5A 3AMYA 5IQIA 1FQ1B 2PUUA 3NYVA 2OI4X 2PMLX 2XUUA 4J52A 5FG8A 3QGYA 3DQWA 3TUCA 4JRNA 5JEBA 4N4SA 4NT4A 2I6LA 2UZLA 5FEQA 3RNIA 1APME 4U8ZA 2Z7LA 2J5FA 3CD8A 3MFRA 5IQEA 4KD1A 4DFLA 1PXLA 1RJBA 4J71A 4HJOA 1OECA 1M17A 1FMOE 3WE8A 1G8AA 4AXAA 2RG6A 3BGZA 4DYMA 3MA6A 2DQ7X 2BDFA 3LXNA 5CXHA 1W2DA 3WIGA 3NNUA 4YC6A 3UO5A 2YZLA 4FX3A 4FT0A 3K2LA 3W2QA 4FL1A 3TUDA 3FMKA 5FEDA 5DR6A 3ET7A 1P2AA 4FV5A 3LHJA 1LUFA 2RGPA 2F7ZE 4MAOA 4IWPA 4QMZA 1E9HA 3ZRKA 3FI4A 3DY7A 3QRUA 4I5MA 4O4FA 3QCXA 4RA5A 4F99A 4DAWA 4QP3A 3E8EA 2VO3A 3KGAA 1XBAA 3CPCA 4BDAA 2O64A 2XYNA 4BWPA 5JGBA 1TVOA 5CF8A 3JPVA 3WI6A 2WTWA 3UG1A 5A4QA 5K0XA 3ULIA 4UB7A 5CEOA 4IM0A 4ZK5A 3EKNA 5EHLA 4O7ZA 3E3PA 2VWZA 4GUBA 4JG7A 5J8IA 4G3GA 2X2MA 2VGOA 3SA0A 5FTOA 4A4OA 2VNWA 4OBOA 2QC6A 4WBBB 4M69A 4QYGA 4UALA 3DAKA 3QU0A 1XH4A 3BRBA 5HZNA 5CNOA 3MPMA 2ITNA 2YDKA 3OUNB 4FKGA 4FZAB 4AOTA 2ITOA 3SW4A 4O6LA 1PXNA 5AEPA 5AUVA 1W0XC 2ERZE 5E1EA 3BYOA 1EH4A 5HE1A 3E7OA 3D5UA 4AZWA 3LFBA 4B4LA 3IW5A 2O65A 3D5VA 1OUKA 3ZBXA 3UJGA 3K54A 4FV8A 4ACHA 2QO7A 2HWPA 1GIHA 3GU8A 5G1XA 1Y8GA 3ZM9A 1OPJA 1TZDA 4AW2A 1T46A 2QKWB 4PMSA 2DWBA 4O1PA 3GP0A 2EUFB 2J9MA 4EH4A 3BEAA 1M2RA 4BZOA 3QUEA 1U5QA 4FIGA 4R7BA 5ETCA 5M55A 2XIKA 3H10A 3PIXA 4UV0A 3GT8A 5AV0A 4D4VA 3RCDA 1OIYA 2EB3A 4EHEA 1H07A 4F9WA 4P7EA 5EKNA 3QWJA 3QL8A 2ZFYA 2WFYA 4EH9A 2XK9A 5AP2A 2IEWA 2XIZA 5AR2A 3F3ZA 3FQEA 4D4SA 4EJ7A 3OVVA 4I0RA 5E8YA 4O0VA 5HG8A 4QYFA 3D94A 5K4IA 1CKJA 5EQYA 3ZSIA 1RDQE 4MTAA 4NU1A 4F64A 2HY81 1F5QA 1JKKA 4RIYA 5AM7A 3T3VA 3TUBA 4ANOA 3LMIA 3OCGA 4QD6A 5LCKA 1URWA 2QOHA 4TWPA 3A7IA 3UMXA 4GFGA 2IWIA 1XHAA 3D7TA 3ZU7A 2PULA 1YXXA 1YQJA 2F57A 3FBVA 2HW7A 3RM6A 2RKUA 4NH1A 2QOCA 2HENA 3KMUA 5BPYA 3V8SA 3KRLA 4FSRA 4IW0A 3TNWA 4GFMA 1JSUA 4IZYA 2WIHA 2XBJA 2E9VA 1WBPA 3Q32A 1KV2A 3G90X 2C6TA 1KE8A 4TZRA 3G15A 4QTAA 2CCHA 4C36A 2QR7A 4O0TA 4BCKA 3FLQA 3WARA 3ZDIA 4GS6A 1FMKA 2XARA 1ZYLA 3WILA 4BIEA 4FTNA 4AXEA 1OL2A 5ETAA 5FWKK 4BCMA 1XR1A 3DTWA 3TTIA 4FC0A 3NUSA 4FVPA 5LVOA 3DNDA 3QKKA 3FC1X 3BGPA 3LJ2A 4FKQA 3KU2A 4MD9E 3QF9A 4J97A 3SG8A 3RINA 4DH5A 3HP5A 4LGHA 4Z3VA 2IZSA 4IAAA 3U8WA 3R00A 3KMMA 4D1XA 1PF8A 4YJQA 5AWMA 3FXZA 2GQSA 3LXLA 3MA3A 2BIKB 3SXRA 1ZYCA 3ZLSA 2R3KA 2CKEA 5H8GA 1OBDA 4BTJA 1WMKA 3CQWA 2EWAA 3EQBA 4O4CA 4L00A 3KB7A 4U45A 4F7SA 3ORTA 4L9IA 1VZOA 3OWKA 1R3CA 4FSTA 2PPQA 4I6LA 3UNZA 5A4CA 3HMNA 3V6RA 5DEYA 3TNHA 3ROCA 3RWQA 3UQCA 3C4ZA 4Q9ZA 3E92A 4M66A 4JXFA 4JI9A 3UYSA 3UBDA 2CNQA 1YXVA 4QNAA 5IA1A 5DBXA 4MH7A 1OB3A 2P3GX 1B39A 5AR5A 2NP8A 5HESA 3RP9A 4QMMA 4J99A 4JDHA 3VVHA 4QP2A 4XRJA 5B2MA 3TM0A 4QMUA 4OTRA 1OPKA 3HGKA 3ZO4A 3BLHA 3IS5A 3ZYAA 4E5AX 1QPJA 3R7UA 4AN9A 5CAOA 3ITZA 4EH8A 1O6YA 5JFWA 2B52A 4GT4A 2A1AB 3KVXA 1Y6BA 3C0IA 3CGOA 4B0GA 3PTGA 5DPVA 3VUTA 2R3HA 2Y4IB 4MWIA 3AC1A 1M7NA 3R7IA 3Q2MA 1UVRA 1XH5A 2XIXA 3BX5A 3QRTA 4UWCA 3R9RA 4O27B 3R71A 1JSTA 2PUIA 5CENA 4K2RA 3C7QA 3FL4A 4YNEA 5D7AA 3UIBA 4TYHB 5KBRA 5IDPA 2J50A 4IIRA 4GRBA 3KCKA 4IBMA 4G17A 2QHNA 5IH4A 2BHHA 4O91A 2GNHA 3DPKA 5EW9A 5LMKC 4LGDA 3LVPA 3PJ2A 5KMNA 5J9ZA 5EW8A 1MRVA 3FYJX 3KN5A 1J7LA 2P55A 2ITZA 5TF9A 1H1QA 1JKLA 2Y7JA 4O4EA 2WO6A 3VS3A 2JKQA 5HX8A 3QX4A 3BELA 3HV4A 3U87A 4NL0A 2J7TA 3C51A 2C6IA 1ZZ2A 3BHVA 3C0HA 3D83A 3PSCA 4FIEA 5GNKA 3PLAE 3HDNA 3A8WA 2VAGA 3LFNA 2GS7A 1W82A 4QYHA 4WHZA 4BDIA 3QC9A 3LCKA 4CFWA 5M51A 2BKKA 3QZHA 4KBKA 4FTQA 4EOOA 4EZ7A 3SW7A 1JNKA 5IPJA 4UZHA 3UOLA 3W0OA 4BDFA 5IQFA 5AUZA 1FPUA 2PMOX 1KWPA 2R5TA 2W17A 4O7LA 2FVDA 2VWVA 3FMHA 3I7BA 4IFGA 5IEYA 4IAIA 5EFQA 3U4UA 4C35A 4RIXA 5IA4A 3MVLA 4ANBA 2VTIA 5FM2A 2RL5A 3DCVA 1PXIA 3EYGA 1CKPA 2C5NA 2YM8A 4EOPA 5LVNA 4MD8E 1Q24A 4KNBA 2J51A 3P0MA 3DK6A 2WOTA 4G6NA 3BHUA 5CQWA 4RVMA 4BGHA 1YOLA 2X8IA 3DXNA 4X2FA 5E1SA 2YLFA 3ORMA 3DBFA 5EI2A 5CXZA 1W7HA 2UV2A 1TQMA 5EW3A 4NIFB 4C57A 4X2KA 1YWVA 1R78A 4XUFA 4XX9A 5CAVA 4OAUC 2X1NA 3SQQA 5I9YA 5CSPA 5I9VA 2V62A 4F09A 4FT7A 5AX9A 3ZMMA 1DAWA 3IGGA 1E1VA 4YJOA 4EK8A 4DHZA 1XH9A 4FODA 3O8UA 3O71A 5HLPA 1XWSA 2FSMX 3F69A 5AA9A 4IB3A 1LEZA 2R3RA 5BNJA 1R0EA 2C6DA 3VS6A 1U59A 3MI9A 1KE5A 5E8UA 2YN8A 4AW0A 3AC5A 3BKBA 1Q8YA 1Z57A 4CMOA 5EDPA 2BIYA 5CVFA 4YURA 3LXKA 3KK8A 5AP0A 2XEYA 1VJYA 4M84A 5CQUA 3W1FA 4LOPA 5HLNA 4EQMA 4GFOA 4AW5A 2GQGA 1P4FA 5D9HA 2AC5A 5I5ZA 5CSXA 4E20A 2ZM3A 3EQHA 4TYEA 4YJSA 1WBWA 4ZTSA 4B9DA 2XMYA 4XOZA 5IA2A 3H0ZA 4BDCA 3G33A 3HMOA 1R0PA 3DZOA 2WTKB 2NRYA 4UWYA 4N6YA 3FLNC 2WEIA 4A06A 4MXCA 3BYUA 5L6WL 3U9NA 4L3PA 2GFSA 2E9OA 4CFUA 1YOMA 5HTCA 2JDTA 1OL1A 2R9SA 1W2FA 4G6OA 4CKJA 2EU9A 4Y85A 4LMNA 1Z9XA 3GVUA 3A7HA 4QP6A 5HG7A 5L8JA 3W32A 3FKNA 4AOIA 1PXMA 4XYFA 2Y8OA 3PE1A 4JNWA 4Y72A 3WOWA 4QMNA 3EFKA 4WO5A 3H30A 3R8PA 3ZBFA 2OFUA 4BTFA 4WKQA 3CGFA 4UN0C 3ID6C 2WXVA 4FZFB 4JBVA 3BZ3A 3GC8A 4UXQA 5J5SA 3E8DA 5KMIA 1CTPE 3QQUA 4Q5HA 5ANKA 1TFFA 5HICA 2DYLA 2ITWA 1AD5A 3KRRA 3QQJA 3C4EA 4C02A 4H1JA 3WYXA 2XB7A 4GIIA 4J1RA 3K3JA 3NZ0A 1Q4LA 4AT3A 2JIVA 3LQ8A 4L46A 4NJDA 4JOAA 4UXLA 4F78A 3O7LB 4IAYA 4FTLA 1T45A 4PPBA 3IPHA 3C4WA 4FKSA 4P90A 4DFZE 4UZDA 4W9XA 4WG5A 3OOGA 3G51A 3PA4A 3MV5A 1UNLA 3HUBA 2XJ2A 3DAEA 4I5PA 4CEGA 2YWVA 4JBQA 4YTCA 4HZSA 4EJNA 4EK5A 2G15A 2QCSA 4XBRA 5D10A 2YITA 1WVXA 1Z5MA 2FYSA 3P4KA 5HE2A 4NW6A 4FRFA 4QQTA 5ETFA 2CSNA 2JD5A 1V0OA 2QOQA 3F61A 3MIYA 4XG4A 4DTKA 3TIYA 2CLXA 5EYKA 3N4TA 4AX8A 5B0XA 4LOQA 3FUPA 1BI7A 4FV3A 3PVGA 4RFYA 5DFPA 3RPVA 3KN6A 5GZAA 3PG3A 4X2GA 4FSWA 3QHRA 2VD5A 2CGWA 5DRDA 5JQ5A 5GIPE 2W06A 4HGEA 2VWXA 4KINA 5M56A 4J95A 4EWHA 5L2SA 3KFAA 3CE3A 4DGNA 4K0YA 4QPMA 3VQUA 4ITJA 4BBEA 5JMSA 1PJKA 2CGXA 4XG6A 4PMTA 2Y4PA 3RGFA 3FLYA 1W2CA 4IANA 4RBLA 3Q2JA 3QRJA 2WAJA 4L3LA 2XS0A 1XO2B 3FY2A 4I1ZA 1DAYA 1JQHA 4FL2A 4JX3A 4I21A 3C1XA 3QD3A 4KIPA 3RCJA 5FP5A 4HYSA 4UY9A 3ZXZA 5A14A 3W0MA 3V5JA 4MHAA 5EI6A 4AFEA 3MFTA 2P4IA