2XBJA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
286
Chain Sequence
VYPKALRDEYIMSKTLGSGAGEVKLAFERKTCKKVAIKIISKALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Structure-Based Design of Potent and Selective 2-(Quinazolin-2-Yl)Phenol Inhibitors of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 286
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xbjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xbjA01
5DRDA 5HIBA 2O3PA 3PY1A 4RZVA 4A4XA 4A9SA 3WYXA 3KXGA 3L8VA 1T45A 3FQHA 4S2ZA 5KMOA 4YP8A 4FKIA 3RPYA 1Z57A 4MVFA 3G33A 4DTAA 3TUDA 1K9AA 1WMKA 4X3FA 2VTTA 2XZSA 5EW3A 5HCXA 5I3RA 2W1DA 2F7EE 2WTDA 4U97A 2JC6A 3SX9A 4NM3A 3OF0A 2I0EA 5C8MA 2Z2WA 4FV3A 4W4WA 3TDVA 2BVAA 4KRCA 2YA9A 4I0RA 4F6WA 3RVGA 5IUIA 5DE2A 1J91A 4BCOA 2QOBA 3NNWA 4USFA 2BKKA 4CZYB 1BLXA 3SRVA 4HGSA 5BVEA 5AA9A 5HO6A 2C1BA 2ZMCA 4IM0A 4LL5A 3VBXA 3WF9A 4BBMA 3V5QA 2GNHA 4RA5A 4U79A 5CSVA 4DT9A 4FTUA 2OXYA 3TV7A 5CALA 4FZDB 4CD0A 3KVWA 3LQ5A 3CGOA 2PSQA 2IW8A 2J5EA 3RJCA 3C4CA 2W17A 3NIZA 3CY2A 1UNLA 3NUPA 2UW0A 3QBNA 4I94A 1XBBA 2V22A 4DEIA 4CT1A 2GQGA 3Q3BA 4CFUA 4EYJA 4V04A 5EYMA 3UO5A 3II5A 5AR3A 1BI7A 5ICPA 4QMWA 1H01A 2IO6A 2DUVA 3RGFA 2VTJA 3COMA 1BI8A 5TF9A 4FMQA 1ZXEA 2EXEA 4BHNA 2QO9A 4EYMA 2CMWA 3JY0A 4FR4A 4AP7A 3F3VA 4EK3A 5KHWA 5HD7A 5HVYA 2HXLA 3CE3A 3GCUA 3NYOA 2GNGA 4FT9A 2UW5A 2WZJA 3A62A 3IGOA 4NM0A 4WNPA 3RPVA 3QD0A 5I9YA 4F7NA 4FKSA 2I6LA 4M69A 4E6CA 3EN4A 4XNEA 3NVKI 1OPLA 3AC1A 4C0TA 4YJQA 4W4YA 2FSOX 2NP8A 4YMJA 4WG3A 5HZNA 4NCTC 4CNHA 3H0ZA 5AP5A 3VBQA 3AMAA 2H6DA 5ANEA 2IVVA 3U4UA 2VWYA 5A3XA 1CM8A 4NW6A 2G2IA 2HELA 4YBKA 5TE0A 3FZTA 2X8DA 3OVVA 1ZMWA 5DN3A 3TZMA 5J7HA 4O2PA 5DMZA 3HX4A 1X8BA 1YXSA 3RK5A 3AD4A 4MYGA 4NT4A 5KMIA 3BX5A 1UNHA 3UDBA 4FUYA 5ANGA 1CKJA 1ZYLA 2QOLA 2Y7JA 5AUWA 4P5QA 4EKKA 5BYLA 4CQEA 1UV5A 5LXMA 4H1MA 5FTGA 3PLAE 3LLTA 4EHGA 4QTDA 3WF7A 3C0IA 2ZB0A 3ZZEA 4AXAA 1MQBA 3FAAA 2VAGA 3G90X 3FLSA 4P7EA 3DLZA 3Q9ZA 3ZFMA 1DS5A 2GQRA 5BPYA 2I0VA 4OTQA 4A06A 5E8ZA 4A9TA 4E73A 3PXKA 1OI9A 3IONA 1H1QA 4FKVA 4IAZA 2QHNA 4PDOA 4EZ7A 4BKZA 3WE4A 4S33A 2AYPA 5L2QA 4FNZA 1JSUA 5FEEA 3DAKA 3AT4A 4NH1A 1WZYA 3ODZX 2J90A 3CIKA 3DQWA 1OBGA 4F6SA 1I44A 1LEZA 4FSRA 4QTBA 4D9UA 3QX2A 2CJMA 1NXKA 2F9GA 4MNFA 5JN2A 3PUPA 3BHYA 5IG1A 1L3RE 3BHVA 3ZC5A 4GJ2A 2R3FA 4HZRA 3KRJA 4X3JA 1JAMA 4YC8A 4A4OA 3IDBA 2EXMA 3ITZA 4QP1A 1Y8YA 2J0LA 5H2UA 4L6QA 4R78A 3SXSA 5TR6A 3ZFYA 3D7TB 4JIKA 5GJGA 2Z8CA 1PJKA 3R7GA 4BVUA 4PDSA 1FMKA 4KWPA 3VS5A 3SHEA 4DN5A 5K5XA 2PVMA 4KUJA 3QUDA 4Q5EA 3HEGA 2VGPA 4QP9A 3DFAA 4EHVA 3NIEA 5C4LA 3V04A 3QYZA 4YJNA 4O6EA 3FZRA 1IEPA 3SG9A 2WTKB 4A9UA 4P2KA 3R8LA 4C4EA 3SOCA 3QD3A 4AW1A 3T8OA 4LGHA 4JIAA 2PK9A 4D1SA 2JKOA 3DU8A 3HRCA 4XRJA 3HLLA 2WQBA 4FK3A 5C9CA 4IFGA 1YI6A 4ZZOA 5JEBA 4PMMA 2XCKA 4BICA 3OW4A 5A14A 5FTQA 2ZAZA 3QRIA 4J96A 1P4FA 4B8LA 1SMHA 5HX6A 3WI6A 4B0GA 3LFDA 3ZYAA 1BUHA 4XG3A 1JKSA 4TZRA 2YIXA 1H25A 3GP0A 4R1VA 5CSWA 2VX0A 4RPVA 2P0CA 3MSSA 5FTOA 3F2RA 2XH5A 2JDTA 3Q9XA 2O63A 4AN9A 4UN0C 2X81A 3IKAA 3CTQA 1Q3WA 5D7VA 4DCAA 4PX6A 4QMYA 3MY0A 5KKRC 3MVLA 3K3IA 3NR9A 5L4QA 1B38A 1XH9A 3D5VA 2IG7A 4CKIA 5EW8A 4C02A 2PVLA 5CAVA 4Z9LA 4F9CA 3F82A 4J7BA 4MHAA 3TIYA 4G5JA 1TQPA 2PZIA 3MJ1A 2GCDA 2R3QA 3PA4A 2E9UA 4C57A 3HV5A 2C6KA 4GJ3A 2W1HA 3FLNC 3R30A 2PULA 4E5BA 3KXXA 4KINA 4I20A 1ERKA 5AV4A 2GS6A 5LVPA 4QQ5A 3NW6A 4HGEA 4LM5A 5EOLA 4XYFA 3C5UA 3NNXA 4YPDA 1OM1A 2RFDA 2ZOQA 2PWLA 3FLQA 2P4IA 4NW5A 2IW6A 4MBJA 4X3FB 1OVEA 5HG8A 3N4VA 4O0XA 2QG5A 2BMCA 2P55A 4NK9A 2VZ6A 2YCFA 2RG5A 3TJDA 1IA9A 5EK7A 3Q9YA 3PJCA 5CAOA 3D5UA 4UYNA 3ZSHA 3Q4ZA 4MWIA 4ANMA 3ZLWA 4UMQA 3V8TA 4NTSA 4KKGA 2OGVA 4BYJA 3VAPA 2WMSA 3DCVA 3ZCLA 4IX6A 4DGLC 1YI3A 2OFVA 3C4XA 3LM5A 2B54A 2QOCA 3OMVA 4X2JA 3SRVB 3F7ZA 2W1ZA 2DS1A 2JDRA 1PYXA 5GINE 2V55A 3FMKA 5A4CA 1XH7A 4RIYA 1JLUE 2F57A 4YTFA 4XX9A 1J1BA 4N70A 4U42A 5HNBA 4BI0A 2NNWB 4ZTNA 4RG0A 3U51A 3BBTB 1QPDA 4CCUA 3R83A 2IZUA 4IIRA 2J51A 3FYKX 1Z5MA 5IU2A 4PQNA 4C34A 3POZA 5DIAA 5EYDA 5CYIA 1J7LA 3EFJA 4Z16A 4E4LA 3NW5A 2R5TA 3G6GA 4BGQA 4H39A 3V5JA 3A7HA 1HCKA 5HTCA 3LE6A 1YOJA 4OBPA 4W8EA 3AGMA 3UQCA 3R9OA 3EQHA 2HY81 5ETFA 1OUKA 4OAVB 2X7FA 3WIKA 2R3PA 4JJRA 1YKRA 4MXCA 2ZDTA 5DT0A 3B8RA 2W4OA 3DJ5A 1G8AA 2OZAB 3KCKA 2UZLA 4JX3A 3CCNA 4PPCA 4ASDA 3O0GA 3LFSA 4CFWA 5EHYA 4FTTA 3BGPA 1FPUA 2R64A 4QMZA 2FVDA 2B52A 5CU4A 4GG5A 5HESA 2OXDA 4FA2A 4YLJA 5TOZA 4TXCA 3HMMA 4FTMA 3HGKA 3MJ2A 5EH0A 4AAAA 4DAWA 4EK4A 3IGGA 4M69B 4F63A 3UO4A 4RBLA 3L9NA 3IDPA 5HU3A 1XO2B 3ZXZA 4F1TA 2ITNA 4MXAA 3MH3A 4IH8A 4I1ZA 3LCDA 3LAUA 5M51A 4F70A 3HRFA 4HCVA 3MIAA 4FBXA 4WUNA 3F6XA 4FTRA 3R9RA 3CQEA 2PTKA 4IB3A 4DLJA 2OICA 4X6RA 2A27A 4O7WA 2A1AB 2ETRA 1PY5A 4PP7A 3QTZA 3NAYA 1JKKA 2GNFA 1YXUA 3R8VA 4JAJA 2UZEA 1I09A 2QOKA 4H1JA 3TV6A 5IA0A 4EKLA 1OIQA 3NAXA 4NIFA 2XYNA 2GFSA 3QTXA 3FKOA 2QD9A 3PZHA 4PDPA 1KE5A 3H3CA 2PE2A 3FI4A 4J53A 3UYTA 1ZYCA 3P7BA 2AC5A 4FZ7A 5L2TA 2J6MA 5HLNA 1YXTA 1FVTA 1V1KA 3GFWA 4N4SA 5ANDA 4BDEA 2CN8A 2X2MA 2FSTX 4O6LA 2CGWA 3OWPA 5FP5A 4IB0A 4CG8A 3O7LB 4APCA 2X7GA 3FJQE 5CVHA 5CU0A 5HTBA 3PP0A 5FP6A 5IF1A 4C4JA 3ZOSA 4L67A 1FOTA 5M4CA 2YDKA 4WNKA 4IVDA 2Y8OA 1E1XA 3VS0A 4O83A 5D9HA 3MVMA 2IWIA 1VR2A 2XNMA 3BGZA 4M84A 4ZMEA 1AGWA 2DQ7X 2VNWA 3NUSA 3HMPA 3BZ3A 5JH6A 3S4QA 1LP4A 2PVKA 1KE7A 3C4FA 1TQIA 3A61A 3M11A 4MXOA 2BHEA 3ZDIA 4H05A 4XV3A 3DGKA 2VTLA 1S9JA 3KEXA 4QTCA 4O96A 1GY3A 2XNPA 4O0WA 3ZRKA 1UVRA 4GT4A 3TEIA 4H58A 1JSVA 4BCMA 4F09A 3AC3A 4DFNA 1OZ1A 1DAWA 1TKIA 3MH1A 5KZIA 5CI6A 3CY3A 3DNDA 4CTCA 3BIZA 3EB0A 3SQQA 3PXRA 2RF9A 4MAOA 4NUSA 4XEYA 3QGWA 1YVJA 2RKUA 2VX1A 2EXCX 3DQXA 3BYSA 4IJ9A 5HG5A 3RMFA 1OPKA 4M8TA 3R00A 2V7AA 5J9YA 2PVFA 4IMYA 4QMTA 3GXLA 1KV1A 5M4FA 3RNIA 3K5UA 5LVNA 2W1GA 3GC7A 4RJ7A 1BMKA 4IAFA 4XBRA 2JFMA 3GT8A 4W9WA 4Y83A 4DH8A 4JS8A 4FOBA 3FMDA 3R6XA 5JGBA 2R3OA 4O86A 4FIFA 4FTKA 4JG6A 3COHA 2HXQA 3TDWA 1B6CB 4D4RA 4DEEA 1CMKE 4GFOA 2KTYA 3ID6C 2HAKA 4DG2E 5IQEA 3EQBA 4AF3A 2CLXA 3RAWA 4EJNA 3E7VA 2HYYA 4RIWB 1UU7A 4X0MA 3FZSA 1H26A 3ZEPA 2EB3A 1UWJA 2NRUA 3QTUA 4IM3A 3VF9A 3THBA 4E93A 2OZOA 5L2SA 3A7JA 3QUPA 2HZIA 1HCLA 1H1RA 3HNGA 3NNUA 4FX3A 4CRLA 3BHTA 4EHEA 4EZ5A 4C4IA 1G8SA 5K9IA 3OZ6A 2WTIA 4FI1A 4LGGA 5L6PA 3LFBA 4J52A 4FIIA 3OROA 5DEYA 1M7QA 3COIA 2Q83A 4FODA 5BUJA 4YZNA 4AQCA 1U59A 2C5YA 5AM7A 3WILA 2WGJA 4YURA 3QTIA 4D4YA 2VU3A 3C5IA 4OTDA 4E20A 3BI6A 3ORTA 5EQYA 4M97A 4GT5A 2QR7A 3AC5A 2ZM4A 4IVBA 5BVFA 2ERZE 2WMQA 5M44A 4Y5QA 1OBDA 5CZHA 4L00A 1FBNA 3LM0A 3ORIA 1YRPA 1H00A 3F61A 4AGCA 1NT2A 4ASXA 1XH5A 2C6EA 2RGPA 3MH0A 4CV9A 3VW6A 2CCHA 4AT5A 1ZOEA 2F7XE 2WMAA 3DK7A 3HV4A 2Z7RA 1GIJA 4WUAA 3QALE 4U80A 4FKRA 2FO0A 3PYYA 4ZSGA 3QQUA 4PTGA 2X2KA 2BDWA 1IAHA 4EH5A 4BWKA 5D11A 1NA7A 3LPBA 4FZAB 4S34A 5IQAA 3P0MA 1XQZA 5LVMA 4KIQA 3QTQA 4RIYB 4MNEA 4RIXA 4MX9A 4AGWA 4MQ1A 3S3IA 5LMKA 3UNKA 1JVPP 4I5PA 3UPXA 1R39A 3DLSA 4BYIA 1PW2A 5I9XA 3V51A 1PXKA 3WZDA 3QXOA 4CEGA 2O64A 3BHHA 5HE3A 3AC4A 4ANNA 2RL5A 3EL7A 3LXPA 4M14A 1OKVA 3BRBA 4G3DA 3V5PA 3PRFA 2XK4A 4USDA 4CVAA 3Q5ZA 5B2KA 2BAKA 5EM5A 2BAJA 5H9BA 3RK7A 5IMXA 5I5ZA 4OT5A 1KV2A 1XBAA 3OXTA 4ITIA 5LARA 2W5AA 5J87A 4LG4A 4KIOA 5F1ZA 3QGYA 4F1OA 3PFQA 3GQLA 5M55A 2ZYBA 4IC8A 4FL3A 3GC9A 5CAPA 4CMUA 2W9ZB 5D7AA 4YJVA 4FTNA 3WOWA 3QD2B 3ZUVA 4FL2A 3GU5A 4FIGA 3SDJA 4QP4A 4QPMA 3PA5A 1URCA 4IB1A 3ZRMA 4QMQA 4QT1A 2OW3A 2ITPA 2DYLA 5DGZA 2UW9A 4RX5A 5L8KA 2IN6A 2JAMA 3OUNB 4AGUA 3KMWA 1R78A 4BWXA 3F2NA 4KIPA 2HOGA 4AZTA 5BMSA 3QA0A 3R1SA 3R2BA 3FXZA 5BVKA 4O21A 1Q8WA 2XEZA 4GYIA 1UNGA 4RRVA 3RTPA 4KNBA 3IK3A 3G5DA 2R3GA 3C0GA 4FSQA 4WNMA 5IDNA 3UG2A 4EZ3A 2GS7A 3FMHA 2GHMA 3EN7A 3UO6A 4B6LA 3G0FA 2BZJA 2H96A 3R7IA 2QO7A 3VUIA 5HX8A 5LVLA 2YCSA 4CTBA 1SNUA 4LOPA 2JBPA 2X8IA 2JBOA 2ZJWA 4NIFB 5AP6A 2C5NA 3OXZA 1GIHA 4C2VA 2WMTA 3QA8A 3ZTXA 3D83A 2BZKB 4LI5A 3RAIA 3KN6A 4GRBA 2GS2A 3KRLA 1YHSA 2Y6OA 2XBJA 4FZFB 4PNKA 3HUBA 5CWZA 4II5A 4KBAA 4TNDA 2WIPA 4YO4A 5GZAA 5FQDC 5KO1A 4RIOA 3V6SA 4RC2A 4PL5A 4JVGA 1ZYSA 3JVSA 3M1SA 4APPA 4EH9A 2CHLA 4PL3A 3ZFXA 1PRYA 4BBFA 4BKJA 4BZDA 5DR2A 4LFIA 3EH9A 2OK1A 1BL6A 4ZLOA 5M53A 4QMOA 3IQ7A 5J5SA 3F3UA 4IWPA 2C3LA 4GH2A 2VTPA 4RGJA 4GU6A 4UXQA 4I5MA 4ZTRA 3WZUA 4XG2A 5FUTA 3T9TA 1NY3A 1PXPA 4YHJA 4I5CA 4AS0A 2VTQA 5HHWA 4D2RA 4P4CA 2C5XA 5HGIA 5IA1A 5B0XA 3JVRA 2OXXA 4DH1A 2GHLA 2CDZA 3SKCA 4KSPA 1JWHA 4QMPA 2J9MA 2QKRA 2YM3A 5F94A 3RZBA 4F6UA 4YLLA 4EQUA 3QFVA 4OT6A 4E5AX 2VNYA 3G9LX 3TT0A 4I24A 3QX4A 1SNXA 3VRYA 5E92A 4J97A 4RX8A 4G3FA 2XRUA 4ZXTA 4NFMA 3F69A 2VTHA 4EH3A 4EEVA 1U5QA 1FGKA 3MPAA 3P1AA 4YBJA 4GVJA 3EL8A 2RFEA 1APME 2VO6A 3OY3A 4BCGA 4BCQA 1GIIA 5T68A 4YLKA 5CF4A 4KB8A 2PZPA 4M15A 2UUEA 3EFWA 4RQVA 5CI7A 3QZGA 4HPUE 4IVAA 3HAVA 3NX8A 4BCHA 1ZOGA 3OCGA 4FVRA 4TY1A 4C3FA 3R1QA 3P78A 3DJ7A 4MKCA 4UWCA 3GOKA 4J99A 5DI1A 4KABA 3W33A 3RAHA 4ACHA 4BN1A 2HWOA 4K6ZA 4DINA 2YIRA 4UMRA 3FEGA 2J0JA 3QCXA 4AN2A 2CPKE 4R7IA 4M7IA 2QONA 5HVJA 3RALA 3ZM9A 5AP1A 4PMTA 3S1HA 1MP8A 2XA4A 3OW3A 4G6OA 4NM7A 5DA3A 3GCVA 3HA6A 3DKOA 3VBTA 4FEQA 5HIDA 2R3HA 4I0TA 2P3GX 2YWPA 4EOPA 5FBNC 4HJOA 4BCKA 5BMMA 3DXNA 3UNZA 4C8BA 4CFFA 5AUUA 5E4HA 4WSQA 4FKLA 5JFXA 1P4OA 4ZY6A 3E5AA 2VTMA 2C3JA 3I0QA 5C01A 4RFYA 4PL4A 3F2AA 1H28A 2XJ0A 5CAQA 1S9IA 4GK2A 4JQ7A 4UYAA 4BDDA 5C8NA 3FWQA 5AP3A 3ZMMA 2OI4X 1WVXA 2F4JA 4L43A 2R4BA 1Q3DA 2BRGA 3OEZA 5IMEA 2JKMA 2P2HA 2WMUA 4RC3A 4R6VA 4UWBA 5CSHA 3TNIA 3W2SA 5DR9A 3GU8A 4HYSA 4QOXA 5ACKA 4LMNA 3FHIA 3CTJA 5JFSA 2R3LA 4X2NA 2HW6A 5AMNA 2V7OA 5B7VA 3IOPA 2ETMA 4ARKA 3FI8A 3JS2A 2Y4IB 4O7RA 2IZRA 3TN8A 4MNEB 4RIXB 3KGAA 1Y91A 3DS6A 4RMZA 3ZU7A 2YWVA 5IH6A 4AZFA 4IX5A 4JXFA 5HE2A 2ETKA 3ENMA 3SD0A 4PUZA 4S32A 5GJFA 4HCUA 3ZLYA 3RKBA 4C59A 4DITA 1ZZLA 4EH8A 1CKPA 4D5HA 3OXIA 5GJDA 3RPOA 4XJ0A 4AFJA 4A9RA 5LVOA 1UU9A 2BFXA 4QP7A 5JQ5A 3MN3A 2X4ZA 4C58A 3NUAA 4X2GA 3JPVA 4F1MA 4EQMA 3ATSA 2WTCA 2HZ4A 3VUHA 3POOA 4J71A 2YJSA 3MBLA 5DG5A 4ZY5A 3KF7A 2JFLA 3OCSA 5A4QA 4DEDA 1PXLA 4C4HA 2OZAA 3ENHA 4BZOA 3R7UA 1XWSA 3ORKA 4WG4A 1VZOA 2Y0AA 3VN9A 4MD7E 4GVAA 5JQ8A 3A4PA 3FSKA 4ZY4A 4FK6A 1RQQA 3QQGA 3UMWA 4JQ8A 4NEUA 2JDVA 4BL1A 4EWHA 3U6IA 1OECA 2LAVA 4C61A 3ALOA 2PVRA 1SVGA 2YIYA 3E62A 4ZTMA 2XIRA 4F9WA 3U55A 5TKDA 3I5ZA 1PYEA 2I1MA 3DBQA 3G0EA 3TZ7A 3B8QA 1ND4A 4QQTA 3FKLA 3RHXA 1W83A 4FKWA 4HPTE 2FYSA 2XIZA 3KFAA 3QZFA 3F9NA 2OBJA 2C68A 3CQWA 3S2PA 1YOLA 2OO8X 4OAUC 4E7WA 2ZVAA 3NYXA 2J4ZA 3DT1A 4WKQA 4ERKA 2A4LA 1R0EA 2F7ZE 2QOOA 1KOBA 2WTKC 5EHOA 3UIBA 4UMPA 3TUCA 2UZOA 1Q61A 4EK5A 2UVZA 4B4LA 3HA8A 1KWPA 3D2KA 3EQRA 3OY1A 3PIZA 1OKWA 5HIEA 2XK7A 3R8ZA 5LOHA 3UOJA 3IPHA 3HMOA 2C47A 4DEBA 4EUUA 3O2MA 2CKPA 3KK8A 4WNOA 2W06A 3MI9A 2FSLX 4W4VA 5IH5A 3GB2A 4JNWA 4FV0A 2XK6A 2YITA 4O7VA 5E9EA 3DFCB 4R7BA 4QMNA 5AM6A 4G3CA 3F5XA 2REIA 3KRWA 4O0RA 5AUZA 5HNIX 4QYGA 4BRXA 1LUFA 2UZTA 4JR7A 1XJDA 5JZNA 5HO7A 2UZBA 3OC1A 4YJPA 4E6DA 2IJMA 3EYGA 4TYEA 3RAKA 1ZY4A 4EWQA 3PVBA 1PXNA 5M07A 4DG0E 2A0CX 3BE9A 3F3WA 4FGBA 4RJ3A 3KMMA 4CRSA 4KS7A 1PF8A 2ZM3A 4FKJA 3VHEA 5CU3A 4ACDA 3PY0A 3Q6WA 4DGGA 5DLSA 4BDAA 4CKRA 1YW2A 5KHXA 3DTWA 2CSNA 5HNGA 4DFYA 5EI2A 4M68A 3BLQA 3CPBA 4V05A 4HYIA 5A6NA 2PMIA 3Q53A 3RI1A 3D14A 2H9VA 1MRUA 4KA3A 2VO3A 2C6OA 4X3FC 3AOXA 1SYKA 2PUPA 5EKOA 4AW0A 4O91A 3KVXA 3EYHA 2R9SA 3ACJA 3M2WA 3O17A 3PIYA 2CGUA 4FL1A 4ASZA 5E1EA 5CANA 3FZ1A 3EHAA 4ZS0A 4BB4A 2XB7A 1OUYA 3DNEA 3T9IA 4XP3A 3SOAA 3FPMA 1DM2A 3GUBA 5G6VA 3CEKA 4J8MA 2ITWA 3GU6A 4MF1A 3TI1A 2UZNA 4FSYA 2HZNA 3RZFA 3UVPA 3C7QA 3RM6A 3SW7A 5CX9A 4U6RA 3IS5A 3VS3A 1SVHA 3FMLA 4LOOA 4RIWA 5IPJA 2XYUA 3RWPA 1L8TA 4HGLA 3GENA 4IC7A 4LV8A 3ULIA 1DI9A 5HE1A 2PPQA 3E87A 3C50A 2W5BA 1WAKA 1Q99A 3LJ2A 2B9FA 3PE2A 5FM2A 2G9XA 3D5XA 2QOHA 4EOMA 3AC2A 4KBKA 3NUUA 5C26A 2B9HA 2XIKA 4ZJVA 1M2PA 1REJA 3VS4A 3HDNA 3QWJA 3QU0A 3EZVA 3VS6A 4E6AA 5IA4A 4RWKA 4C4FA 5M4UA 4FSZA 3AD5A 3ZEWA 5KBQA 5DT4A 5HI2A 3R04A 2QVSE 1H07A 4FSUA 3OUKA 3DAEA 3P79A 3IW6A 4D2WA 2PMNX 4CT2A 3VW8A 5JFWA 2WQNA 4Y85A 4BR3A 4ITHA 2VO0A 2YM4A 5DFPA 1A48A 4FEVA 4IAKA 3H9FA 5CENA 4ENYA 3D2IA 4O81A 2XKCA 2J0KA 5DBXA 4A4LA 3TZ9A 3V5LA 5DNRA 4ANSA 4DE4A 5GIPE 4BDKA 3UIMA 5EYCA 4D58A 4ZK5A 4C3PA 4Y5HA 4CV8A 3FMJA 5HORA 4XOYA 4RA4A 3HAMA 3OWLA 1H0VA 4DEGA 4I41A 2FUMA 3C0HA 5J7BA 3LXLA 3EN6A 4WRSA 3EMGA 3QZIA 3KB7A 3ORMA 2WTVA 4DCEA 4EOIA 3Q96A 3OP5A 3UGCA 5EI8A 4PF4A 3RWQA 3UBDA 5J9ZA 5L2IA 4E3CA 4TWPA 4BFMA 5CNNA 2YERA 4TYIA 5HVKA 1YDSE 1FVRA 4UWYA 3DK3A 1YWRA 3IO7A 4XP0A 4AWIA 4TWOA 3BQRA 5HBEA 1PXIA 5CU2A 3LMHA 3DTCA 1Q41A 4FG8A 4C2WA 1BX6A 4XRLA 3PJ8A 3RK9A 1UKIA 2YLEA 4YNEA 5AR5A 2PZRA 3PPKA 4X2FA 4C33A 5CQUA 2HW7A 2XIYA 3CJGA 3L9LA 3QCYA 3ZHPC 2OH4A 2GHGA 5GIOE 1R0PA 3HMNA 3U4WA 5KUPA 4M12A 2C5OA 3CKWA 3PJ1A 2X0GA 4R3PA 4BDHA 3E93A 3ZSGA 5JSMA 5A4TA 4ANOA 4CFMA 3E8DA 3WZKA 3I5NA 3QHWA 4FIJA 4FICA 2BZHB 4CLJA 3N9XA 4G5PA 3VWAA 4O38A 4DYMA 1Y57A 5IISA 1QL6A 4EK8A 3PPZA 4DBXA 4ZLZA 3O51A 1ZAOA 3Q2MA 2X2LA 5EYKA 2BR1A 4ACGA 3FSFA 3Q60A 2JLDA 4FG9A 5IA2A 4DBNA 3G15A 3NZ0A 2VTOA 4FTJA 1YXXA 3DB6A 2BILB 4HYUA 3SW4A 3VJNA 4EH2A 4JBPA 3HV3A 5CU6A 1WBPA 4O7NA 3R01A 4FKUA 3ZXTA 3ROYA 5C8KA 3O8UA 4AN3A 5AAEA 4JL9A 3HV7A 4Z7GA 2W99B 3UTOA 2YDIA 2GTMA 4TYHA 2WPAA 1PMVA 3CTHA 3KXMA 2R3NA 3BV3A 4K77A 5GNKA 2GQSA 1OIUA 4BI2A 3RHKA 4FVQA 2NPQA 4UZHA 2WOTA 3VF8A 5H8GA 2XM8A 4AZSA 1UWHA 3OBJA 4FV1A 3KMUA 4BF2A 5LWNA 1Q4LA 5JRSA 3PIXA 5DVRA 1YDTE 2ONLA 5BYZA 5EM8A 3DDPA 3UIXA 5LWMA 2O65A 3F5UA 3MVHA 4RQKA 1PHKA 4A07A 3PWYA 1KE6A 4MEDA 1Y8GA 4Y8DA 2WQEA 3MTLA 5DRBA 3BWFA 3KRRA 5AV1A 3LFCA 3R1YA 5AJQA 3RBWA 3NNVA 5EI6A 2O0UA 2Y9QA 5F95A 3W8LA 3EQFA 3QRJA 4CMTA 4F08A 4FOCA 1P5EA 1UA2A 2W05A 2BDJA 4RC4A 2HCKA 2XNOA 3NWWA 4IZYA 1JSTA 4LMUA 4U45A 2X7OA 4YSJA 2BTRA 3ANQA 1WBWA 2C5VA 4OBOA 3DB8A 4FTOA 3N4TA 2A19B 3R9DA 1QMZA 2BTSA 2WMXA 4RJ6A 3KREA 5AUVA 2BHHA 2XNEA 3ALNA 3I1AA 4YC6A 4U43A 1UKHA 4YGAA 4C62A 3BWJA 2J5FA 1VYZA 4QP3A 4GKHA 1PKGA 4L9IA 2KULA 2YFXA 3LCSA 4JX7A 4QP8A 2FSMX 4IZ7A 4U9AA 2YZAA 1WBVA 3W2OA 4EC8A 5AEPA 2R2PA 1PMNA 4R5YA 1ZOHA 4V01A 3KQ7A 2XJ2A 4I23A 3LFFA 5AR2A 3UNJA 4BCNA 1H24A 2JIIA 1JKTA 2GSFA 3AT2A 3CS9A 3OEFX 4FKTA 3ZONA 4E4NA 4FV9A 2WMVA 4HVHA 1H08A 3LVPA 3W32A 3R2YA 3R8MA 2QQ7A 2VV9A 4E4XA 3U9CA 3PXZA 2XUUA 4S30A 5AADA 2JKQA 3BKBA 2C4GA 4OGRA 4RFZA 4F9BA 4LRKA 4QQJA 3FXXA 5DR6A 3KULB 3NYVA 3PG3A 3VUTA 2W4KA 3FZPA 4AZWA 5BNJA 3U54A 4IZ5A 4RJ4A 1H1WA 2OIDA 3HKOA 5CQWA 4DC2A 3MW1A 2I7QA 3GI3A 4QYHA 2R7IA 4GS6A 5DYJA 3BE2A 4G31A 1IRKA 4DF3A 2YEXA 3MB6A 3OBGA 3TNPC 3QXPA 4FVPA 4FSNA 4HNIA 4NTTA 4ZSEA 4BCFA 3EQGA 3TTJA 3I7BA 3Q4CA 3LIJA 3P5KA 2HK5A 2AUHA 5CLPA 4BI1A 4LV5A 3R02A 4RWLA 4FEXA 2BIKB 1MUOA 2IVUA 3K2LA 4WRGA 4D2VA 3U6HA 3F5PA 2VTRA 1H27A 1ZYJA 3ZS5A 2F2CB 4IACA 2QNJA 3VQUA 5EKNA 4EHZA 4PP9A 1V0BA 4M0YA 3P9JA 3NRMA 4HGTA 1JOWB 4I6BA 1U5RA 4QO9A 3V6RA 3LW0A 4ALUA 5A54A 5JK3A 3V8WA 3PVGA 4FV5A 3LMGA 1YHWA 5IQIA 3DJ6A 4ZS4A 2G2HA 1JQHA 5M4IA 5BYYA 3KC3A 4FSTA 3UQGA 4GL9A 2HZ0A 5LMBA 2GNJA 4PMSA 4E26A 5CNOA 2QC6A 4K18A 5JRQA 5K0XA 2JD5A 3D9VA 2QODA 3OT8A 2J0MB 2F49A 5CF5A 1WBTA 1R3CA 2YACA 3HV6A 1LEWA 2B9IA 2HENA 1SVEA 4QNYA 3VC4A 4XV2A 3FBVA 4AGDA 1PXOA 3VO3A 3FLYA 3R8PA 3F66A 4FT5A 1YQJA 2XVDA 1FGIA 4WBBB 2YM5A 2UW4A 4ACCA 3PSCA 4M66A 4CQGA 1Q8YA 3MY1A 4ZOGA 3CLYA 4AT4A 1H1SA 1U4DA 1GOLA 3UVRA 2W1FA 2PZ5A 4V0GA 4YJRA 3O7LD 4KS8A 3TL8A 4MBLA 1ZWSA 1IAJA 4IHPA 4L46A 4CFVA 5AFVA 4X7QA 2DWBA 5LQFA 3N51A 1IA8A 4ZMFA 5HQ0A 5IZFA 1GZ8A 4ACMA 4RFMA 4ZTQA 3FMEA 3WZEA 2R3MA 4WSYA 5E91A 4YTCA 4L3LA 3JR1A 4CYIA 5DHJA 4MCVA 3QTSA 4D9TA 5IUGA 4DEHA 3EFLA 4F9YA 1XH8A 2PYWA 3ZC6A 2OIQA 4CFNA 4B99A 1TQMA 4CLIA 4YU2A 3HECA 3PWDA 4NWMA 4YNOA 4QMLA 3VBYA 4Y46A 3BGQA 3SG8A 4D1ZA 4DH7A 1W8CA 4GUEA 1O6LA 3HUCA 4K8AA 4Z7HA 1E1VA 3D5WA 4BWPA 4EORA 3TKUA 3V8SA 2ZV2A 1XH6A 4JG7A 2XF0A 3V5WA 3PSDA 5G1XA 2ITUA 4QTAA 5HE0A 2VD5A 4GUBA 4YZBA 4AT3A 4D5KA 3U6JA 2C6DA 4Q5HA 3SLSA 3NMUF 1CKIA 3EN9A 1BYGA 4FNYA 3NGAA 1LR4A 5I3OA 3TCPA 2ZV8A 4G34A 3R7EA 3TNQB 4AU8A 2BRBA 3PY3A 3A8XA 4LUEA 4AG8A 1OGUA 2SRCA 3D15A 4I92A 4OTIA 2I0YA 4EOKA 4JDIA 4TYHB 3WZJA 2CNVA 2C6LA 3FL4A 2ITYA 2NO3A 3NPCA 2P33A 3CBLA 4XH6A 5EFQA 5JMSA 4O7LA 1QPCA 2VRXA 2WU7A 3WYYA 4FV7A 2BRMA 4FT7A 4HVSA 3TNWA 3BV2A 1QCFA 5A4LA 5JFVA 1E9HA 3FZOA 4QYYA 3ZUTA 4MXXA 4NKSA 2YCQA 3MWUA 3SXFA 3BPRA 4C38A 4QMXA 3TV4A 3VS1A 3U87A 4O84A 2UZUE 4CZTA 4DH5A 5A46A 5K5NA 2XK3A 2EU9A 3I81A 4O7SA 4E8AA 4G3EA 3ORLA 4X6QC 5KMKA 3OWKA 2G2FA 4NU1A 4YZ9A 3FXWA 4UY9A 4Z55A 4EJ7A 2BFYA 5I9WA 4YZCA 5F4NA 5K3YA 3AGLA 3QUEA 2OF4A 2XRWA 4JLCA 4ALWA 2XKEA 4FF8A 4F7JA 2JGZA 4YUQA 4G9CA 4JT3A 3LOKA 2VWZA 4E6QA 4YJTA 3QKLA 3OT3A 5CTPA 3LFEA 3MPTA 1Q97A 5FDPA 3ANRA 4FIHA 5EHLA 4KAOA 3LFNA 4YZDA 5H8EA 5AP2A 3BHUA 4CKJA 3EQDA 4G9RA 4M0ZA 3PDTA 3LQ8A 4P90A 3HP2A 3FMNA 3TM0A 3BEAA 3D0EA 4QRCA 3ZZWA 3P08A 5EQPA 2YZLA 2VUWA 4I6FA 5CAUA 3QQFA 4O7TA 3DKFA 2X6DA 3GCSA 4O0SA 4L3PA 2QLQA 5KMJA 5KMMA 4DFLA 4LUDA 5CVGA 3IW4A 3DPKA 1K3AA 2R0UA 4OUCA 4AFEA 5M56A 2WELA 3DXQA 4QMVA 3O50A 4AA0A 4ID7A 2UW7A 4YHFA 3VVHA 2X39A 2NRYA 3G2FA 3UPZA 5CVFA 2BPMA 4FYNA 2W4JA 4JDKA 3Q6UA 1PXMA 5CSXA 5JT2A 5IEYA 1R1WA 1PKDA 2V0DA 4IADA 3C4ZA 5I9ZA 4XG9A 3MIYA 4UMUA 1YHVA 4O7ZA 3GQIA 1OL7A 3W16A 2AC3A 3C4WA 3NSZA 4NSTA 3IW8A 2Y4IC 1ZZ2A 2Q0NA 4OBQA 3DA6A 3PA3A 4EC9A 3MGYA 3UODA 4Q9SA 1RE8A 5LMKC 4AOJA 5ITAA 2UW8A 3FI2A 4FEWA 3GNIB 4N57A 2ZMDA 4ZEGA 4FTCA 2YLFA 5E8TA 2QOFA 1OIRA 4PTEA 3ZUUA 3W2CA 4AOTA 5CEMA 4FE2A 5M57A 4FUXA 4YTHA 3GOPA 4IAYA 4W8DA 2B53A 2EUFB 3FC1X 2J7TA 5E8YA 2GFCA 2E9PA 4U81A 3QYWA 4BDBA 3ODYX 5EM6A 2VGOA 3EKNA 4XCUA 4BDJA 4FEUA 5HU9A 2YM8A 3P23A 4G17A 4RVKA 4AZEA 3H30A 2H8HA 3ACKA 4L45A 5J79A 3BLRA 2X8EA 3NUYA 5CT0A 2VTNA 5C03A 4JBQA 2YISA 5J95A 3BU5A 5KBRA 2XKDA 3NUNA 5D12A 2C0IA 4B9DA 1BL7A 4CSVA 3VJOA 1WFCA 4GCJA 3C4EA 1OMWA 2PE1A 1OL1A 2UVXA 4C35A 3BELA 1NVSA 3NCGA 3ERKA 3TNHA 3FHRA 3TKHA 2OJ9A 4QTEA 5LMAA 3R21A 1W0XC 2GPHA 4TTHB 2IVTA 3KL8A 5BQ0A 5IQHA 5I0BA 2J0IA 4U5JA 4LRMA 4E5WA 2JKKA 3MH2A 2X6EA 4ANLA 5AV0A 4ANQA 4MWHA 3VBVA 4OR5A 4XOZA 2Y6MA 3VQHA 4ZJIA 3FE3A 2UZVA 4CYJA 1RW8A 4EOLA 4L44A 3KN5A 4WT6A 1W82A 5I9VA 3TUBA 4HVGA 5BX0A 1P14A 5AA8A 4GSBA 5M08A 2QURA 5LCJA 1QPJA 1JBPE 5DEWA 4Q2AA 4TWNA 5L8LA 3E7OA 2JAVA 5AP7A 2W5HA 4V0GB 4ZP5A 2WMBA 3Q4TA 4RX9A 4ZSAA 4EBVA 5H8BA 1B39A 2Y4PA 3KXHA 2ACXA 4N6YA 4NJDA 5IQBA 4D2TA 4AE6A 4TRLA 4MQ2A 4AX8A 2WAJA 3H9RA 3Q4UA 2ERKA 3KCFA 3LKMA 3K54A 2VWUA 3I60A 4MXYA 2IZTA 3UC4A 5IEVA 3LCOA 4FTAA 4GIHA 3NS9A 4G6LA 5I9UA 4UV0A 4FIEA 3OD6X 1Q24A 3EN5A 4JDHA 4D28A 3TJCA 2C3KA 4DGOA 5CZIA 3H10A 2VN9A 4Y73A 3UP2A 1KOAA 3BYMA 4C4GA 3FC2A 2C1AA 3FYJX 4DEAA 3KU2A 3NUXA 4JRNA 3W2QA 4QQCA 4IZAA 2XK9A 2ITTA 3PE1A 5EDQA 4X2KA 2PZYA 3TXOA 3OHTA 4O1OA 2W7XA 3EZRA 3A2CA 5AX9A 4Y95A 2GNLA 3IDCA 4EOSA 2OH0E 3SV0A 3LLAA 1MQ4A 4F0GA 2H34A 2VWIA 1A06A 3FDNA 3FLWA 3QQKA 4GT3A 3GC0A 1WBSA 4GYGA 5IQGA 3QTWA 3BU3A 2ZV7A 3VUMA 2ZV9A 1P2AA 3W8QA 3P7CA 1ZMUA 2OKRA 4UALA 5K0KA 5FEDA 4L8MA 4MBIA 5CASA 2UZWE 4FTIA 5F20A 5EOBA 4YZMA 4AW2A 4RSSA 1Q5KA 2PY3A 1NVQA 4U7ZA 3PSBA 3FUPA 4BTFA 4KSQA 4XG4A 2Z7QA 3MFRA 3MV5A 3CD8A 3QZHA 4P5ZA 5EM7A 3H9OA 5H3QA 4ZTHA 3O96A 4G2FA 3P86A 3VS2A 5DH3A 3OOGA 1G3NA 4EQCA 4O0UA 5AIRA 3FI3A 5CEPA 3UE4A 3OTVA 2XNGA 3R0TA 4PPBA 3AG9A 5ACBC 3I0OA 4I4FA 3AMBA 4K2RA 5A6OA 5T6KA 3QKMA 4R7HA 2C69A 4GW8A 4EOJA 1O9UA 4TPTA 4GIIA 4IDVA 5AV2A 2B1PA 2GNIA 3MY5A 3ZO1A 2VWVA 3AD6A 3C9WA 4UEUA 2E2BA 2IPXA 5E8UA 2WEIA 2BKZA 4NM5A 2Z02A 1H0WA 3V3VA 1HOWA 1WCCA 3R7YA 3CJFA 4ASEA 4G1WA 1TVOA 5E8WA 4RLLA 3GU4A 4ENXA 1GAGA 3RCJA 5BVOA 1IR3A 1OIYA 4EONA 4N6ZA 3KA0A 5AWMA 5C27A 5C1QB 3EJ1A 4XS2A 2RFNA 4IBMA 4XG8A 3KKVA 3LFQA 4U8ZA 4NZWB 3VUKA 3MS9A 3QCQA 2VWXA 4FGRA 4RX7A 5L8JA 3JUHA 3L9PA 3L1SA 4O0YA 4H36A 5K4JA 3GC8A 4R3RA 5AIKA 3E88A 3VNTA 4WBOA 2B9JA 3G51A 2FGIA 3UMXA 3I7CA 1XKKA 2ESMA 3GVUA 3KRXA 3UZPA 4EH4A 3F5GA 3HYHA 3VULA 4ONAA 3R9HA 4UZDA 4D1XA 3SGCA 5CXZA 3FQEA 4OTFA 4FZ6A 4M67A 4DGNA 4IWOA 4XV1A 2YM7A 2W0JA 2W9FB 2JIUA 2CN5A 3FKNA 4FKPA 4I93A 4QPSA 5JGAA 5M09A 4ANBA 2X1NA 2QKWB 3CPCA 4ZZNA 3GCPA 3KULA 5BUIA 3R63A 2WD1A 2PE0A 1VYWA 4I4EA 3D4QA 3F7WA 2CKQA 3EFKA 4CFXA 4DHFA 4GFGA 4FNXA 3EQCA 2E9OA 3ZBXA 2JITA 4J1RA 4DH3A 5KMLA 5KNJA 4L52A 2GU8A 4R3CA 2R3KA 2Z7LA 1U54B 4XV9A 4IVCA 4OTRA 1W98A 2I40A 3VBWA 3S95A 3CGFA 4YPSA 5HCYA 2ZDUA 4Y72A 3WBLA 1M7NA 5KX8A 5L6WL 3UVQA 2CKEA 4FV4A 3I4BA 4XG6A 2G1TA 4PDYA 1OL6A 2B7AA 5HG7A 2JEDA 4W4XA 2XMYA 1FVVA 3TWJA 4E4MA 1Q8TA 3NEWA 3W10A 2GTNA 5T3QA 4XMOA 3R7OA 5DT3A 3D7ZA 3DKCA 3ORNA 3Q2JA 4R77A 2PVJA 4HNFA 3V5TA 3OFMA 1OKZA 5IQDA 4I3ZA 5J1VA 5CY3A 4O0TA 4MXZA 4CCBA 4DFXE 4RWIA 4O7YA 1V0PA 4WOVA 5E1SA 4FKQA 3IG7A 4AW5A 2QCSA 3KXZA 3H4JA 3L8SA 4R1YA 4PV0A 4YR8A 3AT3A 1GNGA 1Q62A 2QLUA 5GHVA 3RCDA 5HEZA 4PTCA 5HBHA 4DG3E 1K2PA 3PTGA 4MH7A 2A2AA 3ETAA 4AE9A 4DFBA 4CMOA 1WBNA 4L68A 1Y6BA 4F7LA 2UVYA 2YIWA 3VHKA 2C0TA 4BCPA 3TACA 3ORXA 3VS7A 3O23A 3TTIA 2C3IB 1ATPE 4O27B 3ZO2A 5FXQA 4F0IA 2PU8A 3UG1A 3P7AA 1M2RA 2VX3A 4TW9A 5CXHA 1DI8A 4L01A 4O22A 4EOOA 4IXPA 3S0OA 1NW1A 4H3QA 3GGFA 2B55A 2VWWA 3BYOA 4DLIA 4F4PA 4L7SA 3OOMA 3DK6A 5FWKK 1AD5A 3R73A 2O5KA 4WD5A 4QP2A 4YO6A 2YAKA 4U40A 5F9EA 4OW8A 2IZSA 3BYVA 4J95A 4HW7A 2EB2A 4FC0A 2VO7A 2E9NA 3LMIA 1V0OA 2FA2A 5IQCA 1H1PA 3S00A 3ORPA 4AACA 5AV3A 3HDMA 5EG3A 3A7GA 3MDYA 5AUXA 3ZDUA 4C3RA 3JXWA 5BUEA 5JZJA 4EUTA 2C0OA 4IW0A 1JKLA 2EVAA 3QD4A 3QWKA 5EDRA 1W7HA 4U3ZA 4EL9A 4B7TA 4KRDA 5KKRB 4USEA 2QU5A 4JG8A 3P4KA 3BCEA 3R9NA 3ET7A 3EQPA 1FQ1B 2QR8A 2VWBA 3R1NA 2YN8A 4D2PA 5AAFA 4EOQA 4IAAA 4I21A 3DV3A 3CKXA 3SAYA 4WG5A 5CSPA 4FSWA 1WVWA 4GG7A 1ZMVA 2QHMA 5AUTA 4AA5A 2QU6A 2VTAA 5HLWA 1PXJA 4LRJA 3VIDA 4CZUA 3CC6A 2PMLX 3QKKA 1QPEA 5HKMA 4XLIA 3ZH8A 5IDPA 5HG9A 3Q52A 5KZ0A 4QMSA 2BIYA 3A4OX 2PUIA 4TT7A 3CD3A 3T3UA 1CDKA 4LL0A 4JR3A 3CQUA 4BZNA 1XR1A 2YHVA 4DTKA 4CG9A 3FLZA 4RLKA 3QLGA 3LZBA 4TNBA 5AR4A 5L2WA 2HWPA 2W1IA 3SA0A 1WVYA 2XBAA 4FT3A 5J5TA 2CLQA 1KE9A 1FMOE 2WMWA 3BU6A 3MB7A 3QL8A 4UXLA 4S31A 3RPSA 5J1WA 4BDCA 4ZSJA 4OLIA 3UZTA 4GEOA 1GZNA 4IE9A 4OTWA 3QQLA 4PRJA 3OS3A 3ZLSA 3F3ZA 3PLSA 5IEXA 4XLVA 3CP9A 3ELJA 4FV8A 4HYHA 3LQ3A 1UU8A 4BDFA 3SVVA 3K3JA 4FKGA 4D4SA 3B2TA 1U46A 5GZ9A 1YXVA 5LCKA 3C13A 3I6UA 3R28A 2YJRA 4EH6A 4GK4A 2C30A 3WE8A 4GK3A 1J1CA 4RWJA 4CGAA 2ITXA 2J50A 4EI4A 3ZO3A 2OSCA 4LYNA 1CSNA 2PUUA 2Z7SA 1STCE 5FXRA 3RPRA 5AX3A 3NW7A 4KIKA 5AUYA 1OITA 5HICA 5K4IA 4PWNA 3UIUA 1YDRE 3W2PA 1FINA 2WMRA 4OTHA 4ZTLA 2CKOA 3W2RA 1NVRA 3FV8A 2OJFE 5TT7A 2GDOA 2I0HA 3FMMA 3WF8A 2V5QA 3EOCA 2BALA 3L8PA 2QOQA 4TWCA 5ETIA 3DZQA 3OG7A 4FV6A 4A7CA 4ZJJA 1F3MC 4AZVA 5M06A 4JQEA 5IUHA 4KKEA 4DGMA 3WARA 2V62A 4RT7A 3ORZA 4FNWA 4D2SA 3Q32A 4K0YA 4W9XA 2WHBA 1MRVA 2HIWA 3LJ1A 3UP7A 2BUJA 3UOLA 4AUAA 1Q8UA 2RG6A 4JDJA 4HZSA 5AP4A 2ITQA 3E3BX 1ZY5A 2WXVA 5EDPA 1GJOA 4KBCA 3NYNA 4HCTA 5FD2A 3DBDA 4D4VA 4NFNA 5EQEA 4G16A 3GFEA 4K33A 3TKIA 1UU3A 3ZBFA 5GZ8A 3EKKA 4WHZA 3DXPA 4IAIA 3ZLXA 2WEVA 3A60A 4TL0A 2R0IA 3COKA 4YSMA 3AMYA 3FQSA 3PRIA 2OG8A 4M3QA 5KMNA 2WKMA 2E9VA 2WTWA 4YJOA 3L9MA 4J98A 3Q5IA 3M42A 4L42A 5FXSA 1LPUA 5E90A 1J7UA 4U41A 1KE8A 4PMPA 2J2IB 5CF8A 4BTKA 4GV1A 4N0SA 3DKGA 4RZWA 4X21A 3DAJA 3LCKA 3ROCA 5BVNA 1REKA 5ETAA 4O2ZA 2R3IA 2OJIA 4D0XA 1F0QA 3E8CA 3NCZA 2EWAA 3LCTA 2JDSA 1XHAA 4GFMA 5TO8A 2WU6A 3PVUA 5ETCA 4YTIA 3MFTA 1JPAA 3I6WA 3R8UA 3MPMA 3PP1A 3PXQA 4CXAA 2WQMA 3LXKA 4U0IA 3W55A 3MYGA 2IW9A 3W1FA 4YC3A 4IEBA 3PJ3A 4WIHA 4DTBA 2PHKA 5B2MA 2JDOA 4I5HA 5HO8A 3MFUA 1GZOA 5ANOA 3IW7A 2CCIA 1WBOA 2WQOA 3VUDA 2XKFA 2F2UA 4JI9A 3ULZA 4BCIA 4NL0A 4KKHA 4NYEA 4MD9E 5J9LA 4XHKB 4DFUA 3E8NA 2QO2A 3G6HA 3HRBA 3Q04A 3AQVA 3TG1A 5D41A 2XIXA 1DAYA 3DOGA 1W84A 3LHJA 5E8SA 3W18A 4ERWA 4JOAA 1IG1A 3IOKA 3D94A 2RIOA 2O2UA 3A7FA 3E92A 1YWNA 2X4FA 1EH4A 4HOKA 2CGVA 4ITJA 4OTPA 4AA4A 4BIDA 3DBFA 2XM9A 2C6MA 4J8NA 4E1ZA 1H4LA 4ZZMA 3PG1A 3RNYA 4F0FA 5L3AA 3FY2A 3UQFA 4K11A 1M2QA 3ATTA 4U3YA 2OWBA 3WF6A 4ORKA 3AXWA 3OCTA 5EW9A 3SC1A 5KCVA 3RM7A 4UMTA 2XK8A 2ZB1A 1OB3A 1ZRZA 2ITVA 4R8QA 4EBWA 3MESA 2VTIA 4MD8E 5E7RA 1URWA 3EQIA 3JY9A 5HLPA 3EWHA 2YCRA 4UX9A 4RVMA 2ONLC 4D0WA 1KSWA 5FLFA 4MTAA 4IFCA 4XG7A 3QAME 3MFSA 5FG8A 4ZSLA 5AAGA 4FTLA 2BDFA 2BROA 3R22A 5ANKA 4IX3A 4HVIA 3HP5A 3CSVA 2BZIB 5D10A 4FTQA 4IJPA 4BGGA 3LJ0A 3F3TA 4F99A 3C51A 4YJUA 4QD6A 4BIEA 4C36A 2XCHA 2WNTA 2XEYA 3DBCA 4FG7A 4G6NA 5FEQA 5CT7A 3IECA 1VEBA 1YI4A 1OPJA 1XBCA 4PY1A 2FB8A 3HMIA 4Q9ZA 4R5SA 3WIGA 4LGDA 2YABA 4FV2A 5CEQA 4BIBA 3OWJA 4BDIA 2GMXA 3QHRA 3E3PA 4GMYA 3GCQA 3A7IA 3OTUA 4KD1A 1ZARA 3T3VA 1IASA 5DOSA 2IVSA 4QMUA 2UW6A 3LFAA 5IA5A 4K9YA 3FPQA 5FDXA 4IANA 3PXYA 3NVMB 5HTIA 4DT8A 3UJGA 2UW3A 4UB7A 1M14A 3QC9A 2G15A 2XNNA 2YDJA 3FL5A 2PUNA 3VRZA 4DA5A 2ITOA 3QTRA 2JIVA 4RVLA 3V01A 2BCJA 2WIHA 5D1JA 5CEKA 5CF6A 1O6KA 4RJ8A 1F5QA 2YM6A 4HVDA 4GKIA 5JGDA 2X9EA 5FRIA 5AP0A 3BEGA 5DWRA 4F64A 4L53A 1VJYA 2XP2A 3QC4A 4FSMA 4C37A 1XH4A 4IDTA 4L3JA 2P2IA 5BVWA 5HD4A 5CS6A 4JRVA 4D55A 4U44A 3RP9A 3ZM4A 3BQCA 2OIBA 1AQ1A 3DDQA 3L8XA 4IB5A 4BTMA 4WA9A 4EK6A 3BLHA 3UZRA 2FH9A 3U9NA 3UC3A 3IW5A 5C4KA 1Y6AA 4BBEA 4C7TA 3I79A 4DFZE 3GEQA 2OU7A 3KY2A 2B0QA 4I0SA 4NKAA 5HCZA 2W1CA 1KUTA 1JNKA 1SZMA 2OJJA 2R3RA 3QLFA 2OF2A 1A9UA 3OCBA 4O0VA 5CEOA 2G01A 2YIQA 3O8PA 5HOAA 3R7VA 3TIZA 2PVNA 3KK9A 3QRUA 3PJ2A 5HBJA 1RJBA 4H3PA 3R71A 1OKYA 1Z9XA 4IM2A 4RJ5A 4BDGA 5AR7A 2WTJA 4TYJA 4KIKB 3ZSIA 2BAQA 1PMEA 3DZOA 4YJSA 2WO6A 4A9YA 4WO5A 5FM3A 3QCSA 1PMUA 4ZLYA 3JYAA 3CXWA 3E8EA 3GU7A 3O71A 5E8XA 2CNUA 3H0YA 2OFUA 3PZEA 4I22A 4NJ3A 3MVJA 3ZRLA 4BTJA 3HZTA 3UOKA 3LXNA 5JKGA 3GBZA 3UYSA 3DBEA 3PXFA 4ALVA 4RVTA 3B2WA 4I6HA 3E64A 1T46A 3PVWA 4G3GA 4TKSA 5CEIA 3F88A 3FY0A 2OJGA 4FYOA 5L6OA 4IQ6A 1OL5A 4XP2A 5FBOA 3C1XA 3MA3A 2Z60A 1RDQE 4QPAA 4IWQA 5J8IA 3QF9A 3NDMA 5AR8A 3HL7A 3DY7A 4JBVA 3WF5A 3TZ8A 4F9AA 3O8TA 2CGXA 1SM2A 2HY0A 3Q9WA 4M13A 4NCTA 4BGHA 3CR0A 3D7TA 3U8WA 1YWVA 5A9UA 3KXNA 3EIDA 4EH7A 4QYFA 2VTSA 4FKOA 3REPA 1CTPE 4ZTSA 2C6IA 2ITZA 2O8YA 3UOHA 2UZDA 2CNQA 3G9NA 4QP6A 5FGKA 2YAAA 2PVYA 5BVDA 4BCJA 3E63A 4MK0A 2ZM1A 5ANIA 1J3HA 4I6QA 5E8VA 4F65A 2W1EA 1O6YA 2BRHA 4YHTA 2PVHA 4UBAA 1U54A 1H8FA 2XJ1A 3N4UA 4GU9A 5A4EA 4JBOA 2C6TA 4O82A 5LJJA 4ZAUA 4QNAA 4PPAA 4XUFA 4XBUA 1GZKA 2XNBA 4BC6A 5IA3A 4OTGA 2QI8A 4QMMA 2RFSA 2PL0A 1OL2A 4FT0A 3VUGA 1G5SA 2BRNA 4BHZA 2WOUA 4L7FA 4K1BA 4TYGA 1J7IA 4IX4A 4TN6A 2R7BA 4LOQA 4F7SA 2PMOX 3AC8A 3BBWA 2LGCA 5DPVA 2WB8A 2UV2A 2RSVA 3K5VA 3QQJA 4MF0A 4QYEA 2X9FA 5B2LA 3MA6A 3QRTA 3HVCA 4BY9E 5ANJA 4JAIA 2XS0A 3A99A 4AOIA 4B8MA 2QG7A 4H3BA 1M52A 4PNIA 4BKYA 4LQMA 4Z3VA 3QRKA 3MTFA 2W96B 3QQHA 4O1PA 5IQFA 2QOIA 4ZIMA 3ZO4A 3NLBA 3PPJA 1ZLTA 4IWDA 2R3JA 2OLCA 3BYUA 5IH4A 1BKXA 5I4NA 1Q8ZA 5KE0A 1MRYA 1M17A 1ZYDA 2WFYA 3KF4A 3RINA 2Q0BA 2B4SB 3A8WA 5IKWA 3SXRA 1YOMA
chains in the Genus database with same CATH superfamily
5DRDA 5HIBA 2O3PA 3PY1A 4RZVA 4A4XA 4A9SA 3WYXA 3KXGA 3L8VA 1T45A 3FQHA 4S2ZA 5KMOA 4YP8A 4FKIA 3RPYA 1Z57A 4MVFA 3G33A 4DTAA 3TUDA 1K9AA 1WMKA 4X3FA 2VTTA 2XZSA 5EW3A 5HCXA 5I3RA 2W1DA 2F7EE 2WTDA 4U97A 2JC6A 3SX9A 4NM3A 3OF0A 2I0EA 5C8MA 2Z2WA 4FV3A 4W4WA 3TDVA 2BVAA 4KRCA 2YA9A 4I0RA 4F6WA 3RVGA 5IUIA 5DE2A 3W0NA 1J91A 4BCOA 2QOBA 3NNWA 4USFA 2BKKA 4CZYB 1BLXA 3SRVA 4HGSA 5BVEA 5AA9A 5HO6A 2C1BA 2ZMCA 4IM0A 4LL5A 3VBXA 3WF9A 4BBMA 3V5QA 2GNHA 4RA5A 4U79A 5CSVA 4DT9A 4FTUA 2OXYA 3TV7A 5CALA 4FZDB 4CD0A 3KVWA 3LQ5A 3CGOA 2PSQA 2IW8A 2J5EA 3RJCA 3C4CA 2W17A 3NIZA 3CY2A 1UNLA 3NUPA 2UW0A 3QBNA 4I94A 1XBBA 2V22A 4DEIA 4CT1A 2GQGA 3Q3BA 3BL9A 4CFUA 4EYJA 4V04A 5EYMA 3UO5A 3II5A 5AR3A 1BI7A 5ICPA 4QMWA 1H01A 2IO6A 2DUVA 3RGFA 2VTJA 3COMA 1BI8A 5TF9A 4FMQA 1ZXEA 2EXEA 4BHNA 2QO9A 4EYMA 2CMWA 3JY0A 4FR4A 4AP7A 3F3VA 4EK3A 5KHWA 5HD7A 5HVYA 2HXLA 3CE3A 3GCUA 3NYOA 2GNGA 4FT9A 2UW5A 2WZJA 3A62A 3IGOA 4NM0A 4WNPA 3RPVA 3QD0A 5I9YA 4F7NA 4FKSA 2I6LA 4M69A 4E6CA 3EN4A 4XNEA 3NVKI 1OPLA 3AC1A 4C0TA 4YJQA 4W4YA 2FSOX 2NP8A 4YMJA 4WG3A 5HZNA 4NCTC 4CNHA 3H0ZA 5AP5A 3VBQA 3AMAA 2H6DA 5ANEA 2IVVA 3U4UA 2VWYA 5A3XA 1CM8A 4NW6A 2G2IA 2HELA 4YBKA 5TE0A 3FZTA 2X8DA 3OVVA 1ZMWA 5DN3A 3TZMA 5J7HA 4O2PA 5DMZA 3HX4A 1X8BA 1YXSA 3RK5A 3AD4A 4MYGA 4NT4A 5KMIA 3BX5A 1UNHA 3UDBA 4FUYA 5ANGA 1CKJA 1ZYLA 2QOLA 2Y7JA 5AUWA 4P5QA 4EKKA 5BYLA 4CQEA 1UV5A 5LXMA 4H1MA 5FTGA 3PLAE 3LLTA 4EHGA 4QTDA 3WF7A 3C0IA 2ZB0A 4FJVA 3ZZEA 4AXAA 1MQBA 3FAAA 2VAGA 3G90X 3FLSA 4P7EA 3DLZA 3Q9ZA 3ZFMA 1DS5A 2GQRA 5BPYA 2I0VA 4OTQA 4A06A 5E8ZA 4A9TA 4E73A 3PXKA 1OI9A 3IONA 1H1QA 4FKVA 4IAZA 2QHNA 4PDOA 4EZ7A 4BKZA 3WE4A 4S33A 2AYPA 5L2QA 4FNZA 1JSUA 5FEEA 3DAKA 3AT4A 4NH1A 1WZYA 3ODZX 2J90A 3CIKA 3DQWA 1OBGA 4F6SA 1I44A 1LEZA 4FSRA 4QTBA 4D9UA 3QX2A 2CJMA 1NXKA 2F9GA 4MNFA 5JN2A 3PUPA 3BHYA 5IG1A 3W0RA 1L3RE 3BHVA 3ZC5A 4GJ2A 2R3FA 4HZRA 3KRJA 4X3JA 1JAMA 4YC8A 4A4OA 3IDBA 2EXMA 3ITZA 4QP1A 1Y8YA 2J0LA 5H2UA 4L6QA 4R78A 3SXSA 5TR6A 3ZFYA 3D7TB 4JIKA 5GJGA 2Z8CA 1PJKA 3R7GA 4BVUA 4PDSA 1FMKA 4KWPA 3VS5A 3SHEA 4DN5A 5K5XA 2PVMA 4KUJA 3QUDA 4Q5EA 3HEGA 2VGPA 4QP9A 4AXEA 3DFAA 4EHVA 3NIEA 5C4LA 3V04A 3QYZA 4YJNA 4O6EA 3FZRA 1IEPA 3SG9A 3W0OA 2WTKB 4A9UA 4P2KA 3R8LA 3AKLA 4C4EA 3SOCA 3QD3A 4AW1A 3T8OA 4LGHA 4JIAA 2PK9A 4D1SA 2JKOA 3DU8A 3HRCA 4XRJA 3HLLA 2WQBA 4FK3A 5C9CA 4IFGA 1YI6A 4ZZOA 4I6LA 5JEBA 4PMMA 2XCKA 4BICA 3OW4A 5A14A 5FTQA 2ZAZA 3QRIA 4J96A 1P4FA 4B8LA 1SMHA 5HX6A 3WI6A 4B0GA 3LFDA 3ZYAA 1BUHA 4XG3A 1JKSA 4TZRA 2YIXA 1H25A 3GP0A 4R1VA 5CSWA 2VX0A 4RPVA 2P0CA 3MSSA 5FTOA 3F2RA 2XH5A 2JDTA 3Q9XA 2O63A 4AN9A 4UN0C 2X81A 3IKAA 3CTQA 1Q3WA 5D7VA 4DCAA 4PX6A 4QMYA 3MY0A 5KKRC 3MVLA 3K3IA 3NR9A 5L4QA 1B38A 1XH9A 3D5VA 2IG7A 4CKIA 5EW8A 4C02A 2PVLA 5CAVA 4Z9LA 4F9CA 3F82A 4J7BA 4MHAA 3PUFC 3TIYA 4G5JA 1TQPA 2PZIA 3MJ1A 2GCDA 2R3QA 3PA4A 2IF8A 4AXFA 2E9UA 4C57A 3HV5A 2C6KA 4GJ3A 2W1HA 3FLNC 3R30A 2PULA 4E5BA 3KXXA 4KINA 4I20A 1ERKA 5AV4A 2GS6A 5LVPA 4QQ5A 3NW6A 4HGEA 4LM5A 5EOLA 4XYFA 3C5UA 3NNXA 4YPDA 1OM1A 2RFDA 2ZOQA 2PWLA 3FLQA 2P4IA 4NW5A 2IW6A 4MBJA 4X3FB 1OVEA 5HG8A 3N4VA 4O0XA 2QG5A 2BMCA 2P55A 4NK9A 2VZ6A 2YCFA 2RG5A 3TJDA 1IA9A 5EK7A 3Q9YA 3PJCA 5CAOA 3D5UA 4UYNA 3ZSHA 3Q4ZA 4MWIA 4ANMA 3ZLWA 4UMQA 3V8TA 4NTSA 4KKGA 2OGVA 4BYJA 3VAPA 2WMSA 3DCVA 3ZCLA 4IX6A 4DGLC 1YI3A 2OFVA 3C4XA 3LM5A 2B54A 2QOCA 3OMVA 4X2JA 3SRVB 3F7ZA 2W1ZA 2DS1A 2JDRA 1PYXA 5GINE 2V55A 3FMKA 5A4CA 1XH7A 4RIYA 1JLUE 2F57A 4YTFA 4DHZA 4XX9A 1J1BA 4N70A 4U42A 5HNBA 4BI0A 2NNWB 4ZTNA 4RG0A 3U51A 3BBTB 1QPDA 4CCUA 3R83A 2IZUA 4IIRA 2J51A 3FYKX 1Z5MA 5IU2A 4PQNA 4C34A 3POZA 5DIAA 5EYDA 5CYIA 1J7LA 3EFJA 4Z16A 4E4LA 3NW5A 2R5TA 3G6GA 4BGQA 4H39A 3V5JA 3A7HA 1HCKA 5HTCA 3LE6A 1YOJA 4OBPA 4W8EA 3AGMA 3UQCA 3R9OA 3EQHA 2HY81 5ETFA 1OUKA 4OAVB 2X7FA 3WIKA 2R3PA 4JJRA 1YKRA 4MXCA 2ZDTA 5DT0A 4F78A 3B8RA 2W4OA 3DJ5A 1G8AA 2OZAB 3KCKA 2UZLA 4JX3A 3CCNA 4PPCA 4ASDA 3O0GA 3LFSA 4CFWA 5EHYA 4FTTA 3BGPA 1FPUA 2R64A 4QMZA 2FVDA 2B52A 5CU4A 4GG5A 5HESA 2OXDA 4FA2A 4YLJA 5TOZA 4TXCA 3HMMA 4FTMA 3HGKA 3MJ2A 5EH0A 4AAAA 4DAWA 4EK4A 3IGGA 4QDEA 4M69B 4F63A 3UO4A 4RBLA 3L9NA 3IDPA 5HU3A 1XO2B 3ZXZA 4F1TA 2ITNA 4MXAA 3MH3A 4IH8A 4I1ZA 3LCDA 3LAUA 5M51A 4F70A 3HRFA 4HCVA 3MIAA 4FBXA 4WUNA 3F6XA 4FTRA 3R9RA 3CQEA 2PTKA 4IB3A 4DLJA 2OICA 4X6RA 2A27A 4O7WA 2A1AB 2ETRA 1PY5A 4PP7A 3QTZA 3NAYA 1JKKA 2GNFA 1YXUA 3R8VA 4JAJA 2UZEA 1I09A 2QOKA 4H1JA 3TV6A 5IA0A 4EKLA 4MUQA 1ST0A 1OIQA 3NAXA 4NIFA 2XYNA 2GFSA 3QTXA 3FKOA 2QD9A 3PZHA 4PDPA 1KE5A 3H3CA 2PE2A 3FI4A 4J53A 3UYTA 1ZYCA 3P7BA 2AC5A 4FZ7A 5L2TA 2J6MA 5HLNA 1YXTA 1FVTA 1V1KA 3GFWA 4N4SA 5ANDA 4BDEA 2CN8A 2X2MA 2FSTX 4O6LA 2CGWA 3OWPA 5FP5A 4IB0A 4CG8A 3O7LB 4APCA 2X7GA 3FJQE 5CVHA 5CU0A 5HTBA 3PP0A 5FP6A 5IF1A 4C4JA 3ZOSA 4L67A 1FOTA 5M4CA 2YDKA 4WNKA 4IVDA 2Y8OA 1E1XA 3VS0A 4O83A 5D9HA 3MVMA 2IWIA 1VR2A 2XNMA 3BGZA 4M84A 4ZMEA 1AGWA 2DQ7X 2VNWA 3NUSA 3HMPA 3BZ3A 5JH6A 1OGYA 3S4QA 1LP4A 2PVKA 1KE7A 3C4FA 1TQIA 3A61A 3M11A 4MXOA 2BHEA 3ZDIA 4H05A 4XV3A 3DGKA 2VTLA 3ML1A 1S9JA 3KEXA 4QTCA 4O96A 1GY3A 2XNPA 4O0WA 3ZRKA 1UVRA 4GT4A 3TEIA 4H58A 1JSVA 4BCMA 4F09A 3AC3A 4DFNA 1OZ1A 1DAWA 1TKIA 3MH1A 5KZIA 5CI6A 3CY3A 3DNDA 4CTCA 3BIZA 3EB0A 3SQQA 3PXRA 2RF9A 4MAOA 4NUSA 4XEYA 3QGWA 1YVJA 2RKUA 2VX1A 2EXCX 3DQXA 3BYSA 4IJ9A 5HG5A 3RMFA 4JMQA 1OPKA 4M8TA 3R00A 2V7AA 5J9YA 2PVFA 4IMYA 4QMTA 3GXLA 1KV1A 5M4FA 3RNIA 3K5UA 5LVNA 2W1GA 3GC7A 4RJ7A 1BMKA 4IAFA 4XBRA 2JFMA 3GT8A 4W9WA 4Y83A 4DH8A 4JS8A 4FOBA 3FMDA 3R6XA 5JGBA 2R3OA 4O86A 4FIFA 4FTKA 4JG6A 3COHA 2HXQA 3TDWA 1B6CB 4D4RA 4DEEA 1CMKE 4GFOA 2KTYA 3ID6C 2HAKA 4DG2E 5IQEA 3EQBA 4AF3A 2CLXA 3RAWA 4EJNA 3E7VA 2HYYA 4RIWB 1UU7A 4X0MA 3FZSA 1H26A 3ZEPA 2EB3A 1UWJA 2NRUA 3QTUA 4IM3A 3VF9A 3THBA 4E93A 2OZOA 5L2SA 3A7JA 3QUPA 2HZIA 1HCLA 1H1RA 3HNGA 3NNUA 4FX3A 4CRLA 3BHTA 4EHEA 4EZ5A 4C4IA 1G8SA 5K9IA 3OZ6A 2WTIA 4FI1A 4LGGA 5L6PA 3LFBA 4J52A 4FIIA 3OROA 5DEYA 1M7QA 3COIA 2Q83A 4FODA 5BUJA 4YZNA 4AQCA 1U59A 2C5YA 5AM7A 3WILA 2WGJA 4YURA 3QTIA 4D4YA 2VU3A 3C5IA 4OTDA 4E20A 3BI6A 3UDZA 3ORTA 5EQYA 4M97A 4GT5A 2QR7A 3AC5A 2ZM4A 4IVBA 5BVFA 2ERZE 2WMQA 5M44A 4Y5QA 1OBDA 5CZHA 4L00A 1FBNA 3LM0A 1G8JA 3ORIA 1YRPA 1H00A 3F61A 4AGCA 1NT2A 4ASXA 1XH5A 2C6EA 2RGPA 3MH0A 4CV9A 3VW6A 4O4DA 2CCHA 4AT5A 1ZOEA 2F7XE 2WMAA 3DK7A 3HV4A 2Z7RA 1GIJA 4WUAA 3QALE 4U80A 4FKRA 2FO0A 3PYYA 4ZSGA 3QQUA 4PTGA 2X2KA 2BDWA 1IAHA 4EH5A 4BWKA 5D11A 1NA7A 3LPBA 4FZAB 4S34A 5IQAA 3P0MA 1XQZA 5LVMA 4KIQA 3QTQA 4RIYB 4MNEA 4RIXA 4MX9A 4AGWA 4MQ1A 3S3IA 5LMKA 3UNKA 1JVPP 4I5PA 3UPXA 1R39A 3DLSA 4BYIA 1PW2A 5I9XA 3V51A 1PXKA 3WZDA 3QXOA 4CEGA 2O64A 3BHHA 5HE3A 3AC4A 4ANNA 2RL5A 3EL7A 3LXPA 4M14A 1OKVA 3BRBA 4G3DA 3V5PA 3PRFA 2XK4A 4USDA 4CVAA 3Q5ZA 5B2KA 2BAKA 4O4CA 5EM5A 2BAJA 5H9BA 3RK7A 5IMXA 5I5ZA 4OT5A 1KV2A 1XBAA 3OXTA 4ITIA 5LARA 2W5AA 5J87A 4LG4A 4KIOA 5F1ZA 3QGYA 4F1OA 3PFQA 3GQLA 4FRFA 5M55A 2ZYBA 4IC8A 4FL3A 3GC9A 5CAPA 4CMUA 2W9ZB 5D7AA 4YJVA 4FTNA 3WOWA 3QD2B 3ZUVA 4FL2A 3GU5A 4FIGA 3SDJA 4QP4A 4QPMA 3PA5A 1URCA 4IB1A 3ZRMA 4QMQA 4QT1A 2OW3A 2ITPA 2DYLA 5DGZA 2UW9A 4RX5A 5L8KA 2IN6A 2JAMA 3OUNB 4AGUA 3KMWA 1R78A 4BWXA 3F2NA 4KIPA 2HOGA 4AZTA 5BMSA 3QA0A 3R1SA 3R2BA 3FXZA 5BVKA 4O21A 1Q8WA 2XEZA 4GYIA 1UNGA 4RRVA 3RTPA 4KNBA 3IK3A 3G5DA 2R3GA 3C0GA 4FSQA 4WNMA 5IDNA 3UG2A 4EZ3A 2GS7A 3FMHA 2GHMA 3EN7A 3UO6A 4B6LA 3G0FA 2BZJA 2H96A 3R7IA 2QO7A 3VUIA 5HX8A 5LVLA 2YCSA 4CTBA 1SNUA 4LOPA 2JBPA 2X8IA 2JBOA 2ZJWA 4NIFB 5AP6A 2C5NA 3OXZA 1GIHA 4C2VA 2WMTA 3QA8A 3ZTXA 3D83A 2BZKB 4LI5A 3RAIA 3KN6A 4GRBA 2GS2A 3KRLA 1YHSA 2Y6OA 2XBJA 4FZFB 4PNKA 3P5JC 3HUBA 5CWZA 4II5A 4KBAA 4TNDA 2WIPA 4DDGA 4YO4A 5GZAA 5FQDC 5KO1A 4RIOA 3V6SA 4RC2A 4PL5A 4JVGA 1ZYSA 3JVSA 3M1SA 4APPA 4EH9A 2CHLA 4PL3A 3ZFXA 1PRYA 4BBFA 4BKJA 4BZDA 5DR2A 4LFIA 3EH9A 2OK1A 1BL6A 4ZLOA 5M53A 4QMOA 3IQ7A 5J5SA 3F3UA 4IWPA 2C3LA 4GH2A 2VTPA 4RGJA 4GU6A 4UXQA 4I5MA 4ZTRA 3WZUA 4XG2A 5FUTA 3UDTA 3T9TA 1NY3A 1PXPA 4YHJA 4I5CA 4AS0A 2VTQA 5HHWA 4D2RA 4P4CA 2C5XA 5HGIA 3BLAA 5IA1A 5B0XA 3JVRA 2OXXA 4DH1A 2GHLA 2CDZA 3SKCA 4KSPA 1JWHA 4QMPA 2J9MA 2QKRA 2YM3A 5F94A 3RZBA 4F6UA 4YLLA 4EQUA 3QFVA 4OT6A 4E5AX 2VNYA 3G9LX 3TT0A 4I24A 3QX4A 1SNXA 3VRYA 5E92A 4J97A 4RX8A 4G3FA 2XRUA 4ZXTA 4NFMA 3F69A 2VTHA 4EH3A 4EEVA 1U5QA 1FGKA 3MPAA 3P1AA 4YBJA 4GVJA 3EL8A 2RFEA 1APME 2VO6A 3OY3A 4BCGA 4BCQA 1GIIA 5T68A 4YLKA 5CF4A 4KB8A 2PZPA 4M15A 2UUEA 3EFWA 4RQVA 5CI7A 3QZGA 4HPUE 4IVAA 3HAVA 3NX8A 4BCHA 1ZOGA 3OCGA 4FVRA 4TY1A 4C3FA 3R1QA 3P78A 3DJ7A 4MKCA 4UWCA 3GOKA 4J99A 5DI1A 4KABA 3W33A 3RAHA 4ACHA 4BN1A 2HWOA 4K6ZA 4DINA 2YIRA 4UMRA 3FEGA 2J0JA 3QCXA 4AN2A 2CPKE 4R7IA 4M7IA 2QONA 5HVJA 3RALA 3ZM9A 5AP1A 4PMTA 3S1HA 1MP8A 2XA4A 3OW3A 4G6OA 4NM7A 5DA3A 3GCVA 3HA6A 3DKOA 3VBTA 4FEQA 5HIDA 2R3HA 4I0TA 2P3GX 2YWPA 4EOPA 5FBNC 4HJOA 4BCKA 5BMMA 3DXNA 3UNZA 4C8BA 4CFFA 5AUUA 5E4HA 4WSQA 4FKLA 5JFXA 1P4OA 4ZY6A 3E5AA 2VTMA 2C3JA 3I0QA 5C01A 4RFYA 4PL4A 3F2AA 1H28A 2XJ0A 5CAQA 1S9IA 4GK2A 4JQ7A 4UYAA 4BDDA 5C8NA 3FWQA 5AP3A 3ZMMA 2OI4X 1WVXA 2F4JA 4L43A 2R4BA 1Q3DA 2BRGA 3OEZA 5IMEA 2JKMA 2P2HA 2WMUA 4RC3A 4R6VA 4UWBA 5CSHA 3TNIA 3W2SA 5DR9A 3GU8A 4HYSA 4QOXA 5ACKA 4LMNA 3FHIA 3CTJA 5JFSA 2R3LA 4X2NA 2HW6A 5AMNA 2V7OA 5B7VA 3IOPA 2ETMA 4ARKA 3FI8A 3JS2A 2Y4IB 4O7RA 2IZRA 3TN8A 4MNEB 4RIXB 3KGAA 1Y91A 3DS6A 4RMZA 3ZU7A 2YWVA 5IH6A 4AXCA 4AZFA 4IX5A 4JXFA 5HE2A 2ETKA 3ENMA 3SD0A 4PUZA 4S32A 5GJFA 4HCUA 3ZLYA 3RKBA 4C59A 4DITA 1ZZLA 4EH8A 1CKPA 4D5HA 3OXIA 5GJDA 3RPOA 4XJ0A 4AFJA 4A9RA 5LVOA 1UU9A 2BFXA 4QP7A 5JQ5A 3MN3A 2X4ZA 4C58A 3NUAA 4X2GA 3JPVA 4F1MA 4EQMA 3ATSA 2WTCA 2HZ4A 3VUHA 3POOA 4J71A 2YJSA 3MBLA 5DG5A 4ZY5A 3KF7A 2JFLA 3OCSA 5A4QA 4DEDA 1PXLA 4C4HA 2OZAA 3ENHA 4BZOA 3R7UA 1XWSA 3ORKA 4WG4A 1VZOA 2Y0AA 3VN9A 4MD7E 4GVAA 5JQ8A 3A4PA 3FSKA 4ZY4A 4FK6A 1RQQA 3QQGA 3UMWA 4JQ8A 4NEUA 2JDVA 4BL1A 4EWHA 3U6IA 1OECA 2LAVA 4C61A 3ALOA 2PVRA 1SVGA 2YIYA 3E62A 4ZTMA 2XIRA 4F9WA 4QEBA 3U55A 5TKDA 3I5ZA 1PYEA 2I1MA 3DBQA 3G0EA 3TZ7A 3B8QA 1ND4A 4QQTA 3FKLA 3RHXA 1W83A 4FKWA 4HPTE 2FYSA 2XIZA 3KFAA 3QZFA 3F9NA 2OBJA 2C68A 3CQWA 3S2PA 1YOLA 2OO8X 4OAUC 4E7WA 2ZVAA 3NYXA 2J4ZA 3DT1A 4WKQA 4ERKA 2A4LA 1R0EA 2F7ZE 2QOOA 1KOBA 2WTKC 5EHOA 3UIBA 4UMPA 3TUCA 2UZOA 1Q61A 4EK5A 2UVZA 4B4LA 3HA8A 1KWPA 3D2KA 3EQRA 3OY1A 3PIZA 1OKWA 5HIEA 2XK7A 3R8ZA 5LOHA 3UOJA 3IPHA 3HMOA 2C47A 4DEBA 4EUUA 3O2MA 2CKPA 3KK8A 4WNOA 2W06A 3MI9A 2FSLX 1W2CA 4W4VA 5IH5A 3GB2A 4JNWA 4FV0A 2XK6A 2YITA 4O7VA 5E9EA 3DFCB 4R7BA 4QMNA 5AM6A 4G3CA 3F5XA 2REIA 3KRWA 4DHJA 4O0RA 5AUZA 5HNIX 4QYGA 4BRXA 1LUFA 2UZTA 4JR7A 1XJDA 5JZNA 5HO7A 2UZBA 3OC1A 4YJPA 4E6DA 2IJMA 3EYGA 4TYEA 3RAKA 1ZY4A 4EWQA 3PVBA 1PXNA 5M07A 4DG0E 2A0CX 3BE9A 3F3WA 4FGBA 4RJ3A 3KMMA 4CRSA 4KS7A 1PF8A 2ZM3A 4FKJA 3VHEA 5CU3A 4ACDA 3PY0A 3Q6WA 4DGGA 5DLSA 4BDAA 4CKRA 1YW2A 5KHXA 3DTWA 2CSNA 5HNGA 4DFYA 5EI2A 4M68A 3BLQA 3CPBA 4V05A 4HYIA 5A6NA 2PMIA 3Q53A 3RI1A 3D14A 2H9VA 1MRUA 4KA3A 2VO3A 2C6OA 4X3FC 3AOXA 1SYKA 2PUPA 4DDIA 5EKOA 4AW0A 4O91A 3KVXA 3EYHA 2R9SA 3ACJA 3M2WA 3O17A 3PIYA 2CGUA 4FL1A 4ASZA 5E1EA 5CANA 3FZ1A 3EHAA 4ZS0A 4BB4A 2XB7A 1OUYA 3DNEA 3T9IA 4XP3A 3SOAA 4LV7A 3FPMA 1DM2A 3GUBA 5G6VA 3PFYA 3CEKA 4J8MA 2ITWA 3GU6A 4MF1A 3TI1A 2UZNA 4FSYA 2HZNA 3RZFA 3UVPA 3C7QA 3RM6A 3SW7A 5CX9A 4U6RA 3IS5A 3VS3A 1SVHA 3FMLA 4LOOA 4RIWA 5IPJA 2XYUA 3RWPA 1L8TA 4HGLA 3GENA 4IC7A 4LV8A 3ULIA 1DI9A 5HE1A 2PPQA 3E87A 3C50A 2W5BA 1WAKA 1Q99A 4QDVA 3LJ2A 2B9FA 3PE2A 5FM2A 2G9XA 3D5XA 2QOHA 4EOMA 3AC2A 4KBKA 3NUUA 3NFGB 5C26A 2B9HA 2XIKA 4ZJVA 1M2PA 1REJA 3VS4A 3HDNA 3QWJA 3QU0A 3EZVA 3VS6A 4E6AA 5IA4A 4RWKA 4C4FA 5M4UA 4FSZA 3AD5A 3ZEWA 5KBQA 5DT4A 5HI2A 3R04A 2QVSE 1H07A 4FSUA 3OUKA 3DAEA 3P79A 3IW6A 4D2WA 2PMNX 4CT2A 3VW8A 5JFWA 2WQNA 4Y85A 4BR3A 4ITHA 2VO0A 2YM4A 5DFPA 1A48A 4FEVA 4IAKA 3H9FA 5CENA 4ENYA 3D2IA 4O81A 2XKCA 2J0KA 5DBXA 4A4LA 3TZ9A 3V5LA 5DNRA 4ANSA 4DE4A 5GIPE 4BDKA 3UIMA 5EYCA 4D58A 4ZK5A 4C3PA 4Y5HA 4CV8A 3FMJA 5HORA 4XOYA 4RA4A 3HAMA 3OWLA 1H0VA 4DEGA 4I41A 2FUMA 3C0HA 5J7BA 3LXLA 3EN6A 4WRSA 3EMGA 3QZIA 3KB7A 3ORMA 2WTVA 4DCEA 4EOIA 3Q96A 3OP5A 3UGCA 5EI8A 4PF4A 3RWQA 3UBDA 5J9ZA 5L2IA 4E3CA 4TWPA 4BFMA 5CNNA 2YERA 4TYIA 5HVKA 1YDSE 1FVRA 4UWYA 3DK3A 1YWRA 3IO7A 4XP0A 4AWIA 4TWOA 3BQRA 5HBEA 1PXIA 5CU2A 3LMHA 3DTCA 1Q41A 4FG8A 4C2WA 1BX6A 4XRLA 3PJ8A 3RK9A 1UKIA 2YLEA 4YNEA 5AR5A 2PZRA 3PPKA 4X2FA 4C33A 5CQUA 2HW7A 2AQXA 2XIYA 3CJGA 3L9LA 3QCYA 3ZHPC 2OH4A 2GHGA 5GIOE 1R0PA 3HMNA 3U4WA 5KUPA 4M12A 2C5OA 3CKWA 3PJ1A 2X0GA 4R3PA 4BDHA 3E93A 3ZSGA 5JSMA 5A4TA 4ANOA 4CFMA 3E8DA 3WZKA 3I5NA 3QHWA 4FIJA 4FICA 2BZHB 4CLJA 3N9XA 4G5PA 3VWAA 4O38A 4DYMA 1Y57A 5IISA 1QL6A 4EK8A 3PPZA 4DBXA 4ZLZA 3O51A 1ZAOA 3Q2MA 2X2LA 5EYKA 2BR1A 4ACGA 3FSFA 3Q60A 2JLDA 4FG9A 5IA2A 4DBNA 3G15A 3NZ0A 2VTOA 4FTJA 1YXXA 3DB6A 2BILB 4HYUA 3SW4A 3VJNA 4EH2A 4JBPA 3HV3A 5CU6A 1WBPA 4O7NA 3R01A 4FKUA 3ZXTA 3ROYA 5C8KA 3O8UA 4AN3A 5AAEA 4JL9A 3HV7A 4Z7GA 2W99B 3UTOA 2YDIA 2GTMA 4TYHA 2WPAA 1PMVA 3CTHA 3KXMA 2R3NA 3BV3A 4K77A 5GNKA 2GQSA 1OIUA 4BI2A 3RHKA 4FVQA 2NPQA 4UZHA 2WOTA 3VF8A 5H8GA 2XM8A 4AZSA 1UWHA 3OBJA 4FV1A 3KMUA 4BF2A 5LWNA 1Q4LA 5JRSA 3PIXA 5DVRA 1YDTE 2ONLA 5BYZA 5EM8A 3DDPA 3UIXA 5LWMA 2O65A 3F5UA 3MVHA 4RQKA 1PHKA 4A07A 3PWYA 1KE6A 4MEDA 1Y8GA 4Y8DA 2WQEA 3MTLA 5DRBA 3BWFA 3KRRA 5AV1A 3LFCA 3R1YA 5AJQA 3RBWA 3NNVA 5EI6A 2O0UA 2Y9QA 5F95A 3W8LA 3EQFA 3QRJA 4CMTA 4F08A 4FOCA 1P5EA 1UA2A 2W05A 2BDJA 4RC4A 3KIOC 4DHIB 2HCKA 2XNOA 3NWWA 4IZYA 1JSTA 4LMUA 4U45A 2X7OA 4YSJA 2BTRA 3ANQA 1WBWA 2C5VA 4OBOA 3UDSA 3DB8A 4FTOA 3N4TA 2A19B 3R9DA 1QMZA 2BTSA 2WMXA 4RJ6A 3KREA 5AUVA 2BHHA 2XNEA 3ALNA