3FLNC

P38 kinase crystal structure in complex with r1487
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
350
structure length
343
Chain Sequence
QERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSKPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title The Discovery of Pamapimod, R1503 and R1487 as Orally Bioavailable and Highly Selective Inhibitors of p38 Map Kinase
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 110
structure length 343
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3flnC02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3flnC01
4FIFA 3W32A 3NIZA 1H26A 5HBJA 2PUPA 3MB7A 2YDKA 5DEYA 3CY3A 4V01A 4I22A 4AE9A 1BKXA 3FJQE 4O86A 4FV0A 2HY0A 3HA8A 2RL5A 5CASA 5JQ8A 3OOMA 2ZB1A 2Y7JA 2PZ5A 3VUDA 3P5KA 2FSMX 4DAWA 3KRLA 2P2IA 4UX9A 3QYZA 3R00A 5IQGA 4LOOA 5JH6A 4FTTA 4HPUE 4L45A 2UW3A 4R7BA 4ZEGA 2C3LA 4YHFA 3QTUA 5HG7A 4WHZA 3SOAA 3UNJA 4MX9A 4FKOA 5CI7A 4KD1A 3SKCA 4MNEB 4O0TA 3ENHA 5AIKA 3GCVA 4XP3A 3OW3A 2VTPA 3QTSA 5ANOA 4ZSJA 4RGJA 3ATTA 1Y8GA 5HQ0A 4Y85A 3BEAA 5A4TA 3VS2A 3DB6A 5DEWA 2BILB 2VN9A 3Q5IA 3TM0A 4BWPA 4BDIA 4AWIA 3LCTA 5HIDA 4HVGA 5HLWA 1PRYA 4I0RA 3TCPA 4X6RA 4JR7A 4XV3A 5D1JA 4QYHA 4YTHA 4LUDA 3U4WA 4CGAA 4MXXA 3MIAA 2QG5A 4PRJA 3VUTA 3PE1A 4FKGA 4FZAB 2C5YA 3Q52A 4IH8A 2A27A 3Q2MA 3TT0A 5DR9A 2XBJA 5AP6A 5IEXA 3CPCA 3AD5A 1GZNA 1W84A 2X8EA 4ITJA 4DN5A 5IA4A 1MQBA 4FT7A 2VO0A 2LAVA 4EHEA 2R3GA 3T9IA 2V7AA 2H96A 3G9LX 1GAGA 3RP9A 4YLLA 3KRJA 1JSTA 2VGOA 3OW4A 1FQ1B 3GEQA 3H0YA 4LMUA 1JVPP 3MV5A 4L00A 4RIXB 4WBOA 2IZUA 3Q9XA 1WBWA 2UZBA 4EZ3A 4TL0A 4XG4A 4KBKA 1OZ1A 3P7CA 2JDTA 4EH3A 3E87A 4CZUA 3C0IA 5CU6A 3FUPA 3DCVA 1XHAA 1TVOA 3ITZA 4WA9A 1YOMA 3QCSA 2J0JA 5AP4A 3ZRMA 1PYXA 3NYXA 3R7GA 3ZTXA 4A9SA 5K5XA 4YJVA 4JBVA 4I5PA 5AP5A 2W1DA 3V5WA 1H28A 4Y95A 5HZNA 3OWLA 2CNVA 4I5MA 4CTCA 2H8HA 4DTBA 4WSYA 3SQQA 1CTPE 5KX8A 1FVVA 2WAJA 4G31A 5CF4A 1Q24A 1W8CA 3O8UA 3VF8A 5CU0A 2P2HA 3LXNA 2XYUA 5BUEA 5JRQA 3GP0A 4NWMA 2BHHA 4F08A 3PWDA 3IG7A 3WIGA 1OIUA 5FTQA 3GU5A 4FEQA 4F6UA 3AT4A 4OT6A 4DA5A 5DG5A 1IA8A 3CTQA 4LL5A 1SMHA 3RMFA 3OWPA 3HRCA 3OXTA 4YJSA 3ATSA 3P08A 5FXRA 4MNFA 2CHLA 1H1WA 2XYNA 3RGFA 5I9UA 2AC5A 5BYZA 3BHUA 4FIIA 4OTPA 4ZTRA 4F9YA 4O21A 1FMKA 2WMWA 2YCFA 3A61A 3AG9A 3HMNA 4UZHA 4TT7A 5AP3A 3EFJA 5CY3A 3R9HA 3VQHA 4LI5A 4BFMA 5B7VA 2VU3A 3R30A 2YISA 1OPJA 3RNYA 3MPMA 4J71A 4ZSEA 2HZNA 3GT8A 2CSNA 4EH7A 4ZAUA 5DFPA 1GOLA 3S3IA 3DB8A 2UVZA 2Y0AA 5FM3A 5L2WA 3U6IA 3TNPC 4QP6A 5CXZA 3GGFA 3FLYA 2F49A 3W2PA 3EMGA 4FUXA 3MSSA 3P79A 1L3RE 4K11A 5EK7A 4PPBA 3UPXA 2EWAA 3H4JA 1YWRA 3V01A 5EHYA 3TKUA 5CQWA 4AT4A 3TV4A 4PP7A 2GTMA 4FE2A 4RLKA 3CIKA 4R1YA 4YC8A 2Y4IB 3UQGA 1UVRA 3MIYA 5J7BA 2ZM3A 1VZOA 5IA5A 4D58A 2BALA 3JVRA 4RIYB 3TWJA 1KV2A 3DAKA 2CN5A 4IJ9A 5J5SA 2YWVA 3CJGA 4HW7A 4FTCA 1KUTA 1PY5A 3ZLXA 4CFFA 2QOKA 5JN2A 3NAXA 3W55A 4C4EA 1A48A 3RINA 2Y6OA 1Q41A 2HZ4A 3QTZA 3A99A 5HD4A 4A9UA 1NXKA 3GC9A 3MY5A 3NLBA 5DT3A 1NY3A 3KXZA 3O8TA 4C4IA 3OCSA 1TQPA 2R3LA 4IWQA 4NKAA 4WUNA 4BF2A 4PL4A 4WRGA 2PVHA 5KHXA 4TYGA 3BWFA 4Z55A 3AD4A 5JT2A 2F2CB 1PYEA 2ONLC 2G2FA 3DQXA 2X6EA 2WTKB 4ENXA 4CFNA 4F9CA 3QHRA 3VO3A 2CKQA 5AM6A 3TKIA 3TN8A 4Q9ZA 4F0IA 4K2RA 3FC1X 4FV9A 3AC8A 4JL9A 4ANNA 4ASDA 3D2KA 4IZYA 1O6YA 1PXIA 5IDNA 4YC6A 4FSWA 1IASA 2W99B 2OIBA 3OXZA 3MJ1A 3FSFA 2VTRA 5E90A 2OK1A 3N51A 1PXPA 3NS9A 1V0PA 4D9TA 4D55A 3BE2A 1Z9XA 2BIYA 3BLRA 3BLHA 4O38A 4NKSA 5E92A 4AZTA 3O17A 3VS0A 4E6QA 4FODA 5IU2A 4FNXA 4LYNA 5E1SA 3BHYA 3NMUF 3LQ5A 1MQ4A 2XM8A 3EQCA 3PYYA 3DJ6A 2VV9A 3R7EA 4IEBA 4ZY4A 2ZV2A 4FNZA 3VBQA 2XNPA 3FQHA 2ZM4A 1ZOHA 3DY7A 3PY3A 1E1VA 2QD9A 1YOLA 3PJ8A 1M14A 4L43A 3ZSGA 4MWHA 5A4LA 3I0OA 4I0TA 3CR0A 2VTHA 4QMMA 1SVGA 4E20A 5AR2A 4BTMA 3UPZA 1LP4A 2OH4A 2W96B 5ETAA 3NUUA 4CT1A 4FSNA 4ITHA 5DHJA 5M08A 5KCVA 2BIKB 3K5VA 3KVWA 4ZTNA 1B38A 4RX7A 3SG9A 4BKZA 2P33A 5CF8A 3TG1A 5AUWA 3FZOA 4PNKA 3VIDA 5L4QA 4QMOA 3QTWA 4I21A 4KAOA 4X3JA 3R9DA 1XKKA 5IUIA 5FG8A 4C3RA 3ODZX 4FKJA 4O0XA 4Y83A 1BI8A 3KXGA 3O2MA 4BDHA 3PPZA 4DEDA 4UYAA 4C3FA 2XIKA 4MF0A 4EZ5A 3M1SA 2NPQA 3LFAA 1H01A 2E9PA 3C4FA 1XQZA 2X7FA 1Z5MA 2X6DA 2YLFA 5HE3A 4C4JA 5FXSA 2XBAA 2F9GA 2PULA 4B8LA 2J50A 5DH3A 4F4PA 5IG1A 1PF8A 1QPCA 2RF9A 3PY1A 4AA4A 2WB8A 4ID7A 4BCJA 4FOCA 1PW2A 4EQCA 1J3HA 2LGCA 3E63A 3HZTA 4S33A 4AP7A 4DH5A 1PMUA 4DFUA 5BVOA 1YHVA 2B9IA 3D15A 2VGPA 3DBFA 1YXTA 4UWBA 4WKQA 2W1HA 1MRVA 2VTNA 3LFBA 3QC4A 4QT1A 3TV6A 3W1FA 4O22A 5IPJA 2W17A 3C5IA 1GZ8A 1VYWA 2WFYA 2YM8A 2OXDA 4ACMA 4DG2E 4O7VA 1YDSE 4XX9A 3UIXA 4ENYA 2XMYA 4PP9A 2YIRA 1Q8UA 4O6LA 4C36A 5LOHA 3R8MA 2ZMCA 4AUAA 1F0QA 3Q9ZA 3QUEA 3Q4CA 3W2RA 1J91A 2F2UA 3LFEA 3SHEA 1WVXA 3KMMA 2XK7A 3IQ7A 4IVAA 4FKWA 3WE8A 5AAEA 5A4CA 2GCDA 2J6MA 2PE2A 3OTUA 4HVHA 2A1AB 5CYIA 3OXIA 3MGYA 1RE8A 4E26A 4A4XA 4AZEA 2W5HA 2HIWA 3V04A 2ZVAA 3W8QA 4QMNA 4F65A 2XK9A 3F7WA 3DKFA 4TN6A 4XV2A 2IW8A 5CVHA 4FL2A 2E9NA 2HZIA 4U41A 1K3AA 3S0OA 4D4RA 4B99A 4O7SA 3EQBA 3KXHA 5CZHA 3VBVA 4ZSLA 1R1WA 2J2IB 3AMBA 4RX8A 2C6KA 2BR1A 3KRRA 5K3YA 4YZMA 5C4KA 4DH3A 2JBOA 1W98A 3TDVA 5HORA 4FK6A 1MUOA 1R39A 3ODYX 4ZJVA 1BLXA 1KE7A 4EYMA 1OL6A 3NUAA 4FSMA 3JUHA 4XBUA 3UJGA 4FBXA 2QR8A 3AD6A 1FBNA 2JAVA 4RVTA 4DFXE 5A46A 5GINE 3O23A 2I6LA 2WIHA 4FTKA 4D2PA 4FKPA 2OF2A 1I44A 2JLDA 3U6JA 3DBCA 1WVYA 2OFUA 2CNUA 2J90A 4DBNA 4P5ZA 4EC9A 4J52A 3E7OA 4EOIA 4BCGA 1ZZ2A 4UMPA 4IZ7A 5CLPA 4L9IA 4QP2A 4PL3A 3IW4A 3VUKA 3ZOSA 4O7WA 2CCIA 2JIUA 1ZAOA 4RWKA 5EW9A 3C4EA 4AFEA 4K0YA 3TACA 2ITXA 4HYUA 4C0TA 4APCA 4DC2A 2JDOA 3RHKA 4F6WA 2CGUA 2ETRA 3F69A 3LJ1A 3R8VA 2GNLA 4FKUA 4EKLA 4FSYA 5BMSA 3LCSA 2GNIA 3EQDA 3ZU7A 3R02A 3ZDUA 4IAIA 2WTDA 3KRWA 1H27A 4WSQA 3FV8A 2ZJWA 4XP2A 3DLZA 2YHVA 3A4PA 4GIIA 3OT3A 4RVLA 4MNEA 4IM0A 4DH1A 2ITUA 2WEIA 5FGKA 4A06A 1WBNA 4FT9A 4IX3A 3SV0A 3G0EA 5BVEA 1TQIA 3LZBA 3OTVA 5TT7A 4EK5A 4Q2AA 1CMKE 4WNMA 2UW7A 4RIOA 5HNGA 2H6DA 2ZM1A 5I3RA 3NPCA 2YABA 2VO7A 4QQTA 3UOKA 1J7IA 4BCHA 1GIHA 1S9IA 3U9CA 3CKWA 3HKOA 3PXKA 4X0MA 4HGLA 3N4UA 1ZZLA 3ZM9A 4MQ1A 5EG3A 3LMGA 3FHRA 4ONAA 5HVYA 3ZONA 4Z3VA 5BYLA 4KNBA 1LR4A 3IO7A 3CKXA 4AT5A 4AGDA 4EWQA 2W9ZB 4YJRA 3MYGA 1W7HA 4NEUA 2ETMA 1DM2A 3RPRA 4U8ZA 2QURA 3BELA 2VUWA 4IWDA 4QMLA 2V22A 5DT4A 1Y8YA 3FMNA 3QKLA 4ZJIA 3AXWA 5HBEA 5M4IA 4RIXA 3JY9A 4R5SA 2ERZE 4KRCA 1BYGA 3LQ3A 3GC0A 3WYXA 3UYSA 3QRIA 4KWPA 5I3OA 3O0GA 3NYNA 3ZLYA 3LJ0A 3PJ3A 4X7QA 2R3RA 3A7FA 2QHMA 4D1ZA 1M2PA 2A4LA 3W8LA 3F5UA 3HV5A 2QOFA 2O5KA 4E7WA 4V0GB 4WIHA 1GZOA 2XNGA 5D12A 4EOQA 3V6RA 4NYEA 2BMCA 1FVTA 3BGQA 5KZ0A 4I41A 2VO6A 4MHAA 2ZB0A 3WIKA 2YJSA 1KSWA 1JQHA 2QODA 4UY9A 4ZK5A 4ZLZA 4U40A 4DEAA 3PJCA 2QQ7A 2R7IA 1XJDA 3NNWA 4C7TA 1OIYA 2Z8CA 5D41A 4DEIA 4GK3A 2JKQA 5CNOA 1IAHA 3VW6A 4QMQA 3RM7A 2UW4A 4G16A 3BBTB 4XG6A 4EC8A 2QHNA 3BU3A 2BCJA 3ZFYA 4E73A 4E4MA 3H9RA 2OXXA 1W82A 2WELA 2RGPA 4EOJA 3L9PA 2IW6A 5DRBA 3CGFA 4Y8DA 3DA6A 4U5JA 5H9BA 2CMWA 2OJIA 3AC5A 3JXWA 3C7QA 3MWUA 4NIFB 1ZRZA 3LE6A 2QVSE 4F7NA 4B0GA 4FIJA 4NTSA 2E2BA 2J0KA 3R6XA 4R8QA 2QNJA 4UWYA 2X4ZA 1X8BA 3DPKA 3PG3A 4G5JA 4QMUA 5A3XA 1XBBA 2WTVA 1FGIA 3L8PA 2QOQA 3QAME 4TWOA 3LFCA 4F1TA 4KIOA 3BHVA 4FR4A 1H0VA 3NEWA 3R7UA 3DS6A 4K18A 3W2QA 5IMXA 2UW8A 5FEEA 4I4FA 3TZMA 2GDOA 3RNIA 5L6WL 4W4YA 3ZXZA 4DFZE 5IQIA 1SVEA 4QYEA 4EOSA 5CSPA 2Z02A 4CLIA 1YHSA 2BRMA 3ALNA 4IZAA 3G51A 2WMSA 1UWJA 3ORXA 2GFSA 4RQVA 2WGJA 2Z7RA 5IQBA 4APPA 3VBTA 3AGMA 4BR3A 2Z7LA 2ITZA 2VTMA 4NCTA 3U4UA 2R3MA 1DS5A 3CQUA 2G15A 4J97A 5B2MA 3RAHA 4O7ZA 3QQJA 4PX6A 3SXRA 4C58A 5LARA 5EHLA 4L7FA 4WUAA 4OUCA 4BDDA 4G3EA 4ITIA 3MFTA 1SZMA 1YI3A 5LMAA 3IW8A 4MH7A 4BICA 4C34A 4ZIMA 2W4KA 4ZTQA 3SG8A 4YUQA 1ZYDA 3MVMA 2C6OA 4HYHA 4YZCA 2PZYA 4QMXA 4I6FA 5C8MA 3ORZA 3A8WA 5A14A 3Q53A 4NTTA 3R22A 4FSTA 4PMTA 5ANJA 3F3VA 2WMRA 3MBLA 4RC4A 3V6SA 1HOWA 3NCGA 3EN6A 4XV1A 3WZJA 3E7VA 3POOA 4JAJA 4QMVA 3LHJA 1H07A 1BX6A 2P4IA 5LVPA 4BTKA 5L8LA 3FE3A 4FIHA 5KE0A 3SVVA 2BDFA 3A7HA 5LMKC 1ZOGA 3HP2A 1P4OA 4CV9A 4F9AA 5AP1A 3DU8A 4M15A 2UZWE 2G1TA 3N9XA 3QX4A 3BI6A 4YJNA 4M66A 5ANEA 2XP2A 4AN3A 2JGZA 3VF9A 4M97A 3FPQA 2GHGA 1M7NA 4G6NA 3E3PA 4U43A 2H9VA 4HCTA 2XK4A 2JKMA 4BZDA 4AW1A 4BYIA 4AN2A 1Q62A 4ANLA 4EBVA 4JIKA 4XLVA 4C2VA 4G9CA 5E8YA 2IN6A 4DEEA 5CSWA 4OBOA 3PZEA 4IC7A 4YPDA 4EJNA 2J7TA 2ITOA 2P0CA 5TF9A 2SRCA 2XS0A 3TNQB 1A9UA 2BZKB 4D0XA 4AAAA 5KMLA 3EKKA 4PNIA 2XIRA 3ULZA 1QPDA 4UZDA 3LFSA 5FTGA 4XRJA 3ELJA 4YHJA 3SXFA 3QD0A 4BGQA 5HO8A 3PXRA 4WG5A 5IF1A 3CS9A 3R21A 3ZCLA 3KN5A 2FUMA 5L6OA 3V5TA 2WMBA 3FMDA 4L7SA 4RIWB 2YERA 4C38A 3GC7A 4C59A 4KIQA 4U6RA 3L8VA 5EFQA 3HDNA 3QD4A 5AWMA 3LFQA 5L2SA 3O96A 3RPVA 2WTWA 4R3RA 2QO7A 5AIRA 1OBGA 5ANIA 2YIQA 5EYCA 2KULA 4E4NA 3WZUA 3SRVB 2QO2A 2R0IA 4IMYA 4QMSA 4ZXTA 2C0TA 5HLNA 1ZYLA 1G8AA 3FL5A 5D10A 4QP1A 3EN4A 5EI6A 4BI1A 5M4FA 5IUHA 1BL6A 1T46A 3GCUA 2WMXA 1U5RA 4BBEA 4BCIA 3ULIA 4EH5A 3VUMA 1KE8A 2OH0E 3MFSA 1IRKA 1V0OA 5H8GA 3I4BA 4B9DA 4YR8A 2BKKA 3MESA 3TDWA 2V7OA 4RRVA 3KA0A 4ANQA 5HE2A 5EM6A 3OT8A 2PE0A 1H1QA 5HTIA 3Q60A 5E8SA 3IKAA 2ZV8A 2HWOA 5EDRA 3EQPA 3OBGA 5A9UA 4DBXA 1UU9A 3WYYA 3D9VA 5FWKK 1H1PA 3RALA 4XG2A 5AAGA 3SD0A 4FT5A 4BCQA 2GTNA 4TZRA 3Q4UA 2HK5A 5C26A 2GNGA 3QGYA 2YM4A 2BZHB 4JQ7A 4I4EA 2XIYA 4TNBA 5AX3A 2QU6A 4Q5HA 3UOLA 4AT3A 3NVMB 3EQGA 3DFAA 3ROCA 2CPKE 4RX9A 5M09A 5HLPA 3DK6A 5CU3A 4QPMA 4DFBA 3OWKA 1JKKA 5J9ZA 4G1WA 4NW6A 1K9AA 4BWXA 4UXLA 3S2PA 5IA2A 2V0DA 2QC6A 3V3VA 4J95A 2R3HA 5H8EA 4IFGA 1PXJA 5IQDA 5GZ9A 1FINA 5E91A 3O71A 3PXYA 4IE9A 3DJ5A 2OIDA 4GCJA 1PXOA 2HZ0A 2W0JA 4Q9SA 4FF8A 5KMKA 3P78A 1SYKA 2C69A 3BE9A 3R0TA 4GUEA 4DITA 2AUHA 3G6GA 3SGCA 4FVPA 3MI9A 4LOPA 4JBQA 3C4ZA 4W9WA 4F0GA 3NUSA 4F63A 3RPSA 3BQRA 4CV8A 4XG3A 3ZUTA 5CAVA 3IPHA 3T3VA 1PHKA 4E4XA 2W1IA 4OTHA 2VWIA 2ITQA 4L44A 3KULB 3VNTA 5AP7A 3WE4A 4NK9A 4CFVA 2QOHA 1UNHA 3EN9A 4BCOA 3GOKA 2PL0A 3IW7A 4JX3A 4UMQA 3I79A 3ZFMA 5I9WA 1NW1A 2JFMA 4E6CA 2VNYA 3K3JA 3FI2A 4D5HA 4FV8A 5BVNA 4JQEA 3LCKA 4A07A 2PMNX 3NRMA 3CQWA 3RHXA 5J1VA 3OC1A 2WZJA 3ACJA 3NGAA 3OHTA 1S9JA 2A0CX 4BGHA 5J1WA 1OL2A 4RSSA 4HZRA 4RPVA 3ZC5A 4FG7A 4FTQA 2VNWA 4HNFA 1PKGA 4TRLA 4DH8A 4EK3A 3AC2A 2XIZA 5AUUA 1FMOE 2WD1A 4GFMA 5JKGA 3KK8A 2P3GX 3OF0A 4IC8A 5K9IA 3ZO2A 4N57A 5ETIA 2A2AA 3DTCA 5J79A 1YWNA 3QRUA 3R73A 4AGCA 5DWRA 4LGGA 5ACKA 4PUZA 4U80A 4H39A 1V1KA 4I92A 3F5PA 3ZEWA 1P4FA 3IONA 3QTIA 2PY3A 3JPVA 4UALA 3AT2A 3LLTA 2XNMA 2W5BA 3F2RA 3P7BA 1PXMA 5FDPA 4WD5A 4X6QC 3PPJA 3DK7A 3RCJA 4OTDA 4DGNA 4II5A 4ZTLA 1U54A 2WU7A 2G2HA 2VTQA 2YEXA 4PL5A 3D5XA 4RJ3A 4CRSA 3RBWA 3VRYA 4BIDA 5LJJA 4N4SA 2WMTA 1KOBA 4FTUA 4M69A 5DN3A 5GHVA 4CKJA 4CFWA 5HG5A 3RAKA 3HV6A 2QU5A 3NW5A 3RPYA 3IOPA 3NUPA 3F3ZA 1ND4A 3EN5A 1JSUA 4ANBA 1R0EA 3E8NA 5CWZA 4UN0C 3FZPA 4CCBA 4DINA 5HIEA 3F2AA 1BL7A 3VS7A 4G3CA 4GVJA 1UNLA 5HX6A 5L8KA 3QQLA 4CLJA 4KUJA 4OBPA 2XCKA 5BQ0A 3S1HA 3DNDA 3LFFA 4H05A 3W2OA 3NDMA 4ASXA 4KS7A 4MBLA 3ZYAA 4F99A 3IGGA 3G6HA 2C5VA 4FX3A 4D4SA 2X8IA 2BFXA 5A4QA 3BU6A 4U9AA 2IZTA 3EHAA 2PUNA 4G3FA 3GOPA 4FSRA 4RWIA 3II5A 2JEDA 3HGKA 2XVDA 2E9UA 4HCUA 4W4XA 3VS5A 4O7YA 2KTYA 3NAYA 4O0UA 5IKWA 1GIIA 4QTBA 2ITPA 4FV7A 4CYIA 3UG2A 1XBCA 4MD9E 2J4ZA 3I7CA 4PV0A 3PSDA 3HMOA 3JR1A 4FEWA 2HELA 2RFDA 2X0GA 3L8XA 3Q9YA 1V0BA 2JD5A 4JT3A 1XH4A 3ID6C 3IS5A 4OLIA 5LVOA 3QZGA 5ANKA 2AYPA 3QHWA 2UZEA 2EXMA 3B2TA 5EYDA 4AOTA 4QTCA 2GPHA 2CGVA 2FGIA 3VHEA 2EB3A 3ZLSA 3FXZA 3KMUA 4KS8A 3WZEA 2XRWA 4KBAA 5LVMA 3OFMA 2W4JA 3OOGA 5AR4A 3QXOA 5M51A 4WT6A 3UC3A 4D2RA 1PXKA 5GJDA 4O2ZA 2VX0A 2OZAB 3CJFA 1U5QA 3LMHA 2JKKA 3Q2JA 3BRBA 3OUNB 4O0VA 5AV1A 3D94A 3KU2A 4C02A 2BZIB 2FO0A 5JGDA 3UODA 4G17A 2E9OA 4D1XA 4JDKA 2B9JA 4FYNA 5D9HA 4BDAA 3F3WA 4G3DA 5M57A 1R3CA 4QTEA 3EQIA 3MVLA 4FIEA 4IHPA 4UMUA 4TW9A 4FKIA 4D2TA 1YKRA 5BYYA 3LKMA 3FQEA 2HWPA 3QWKA 4S30A 5J87A 2JAMA 2W4OA 3N4VA 3GNIB 2C6EA 5FQDC 4I5CA 3E88A 4LL0A 4B4LA 2YM5A 4EHVA 3BYUA 3QYWA 5TO8A 2Z2WA 1UV5A 1ZLTA 3COKA 2OZOA 3GXLA 3IW6A 3MPTA 3QKKA 4FICA 4YPSA 4EEVA 4GH2A 5FTOA 3VN9A 4LG4A 4NIFA 4QYGA 2IPXA 1OKYA 4AE6A 2HXLA 2I0HA 2ITWA 3NUNA 2O64A 5KKRC 5AV2A 2X4FA 5CAUA 4BBMA 3GQIA 4C33A 3QLFA 3MA3A 4KIKA 5BX0A 4NJ3A 2PVRA 2Y6MA 5LWNA 4RJ8A 5FBNC 3LM0A 4GFOA 4XG9A 3V5LA 1J1CA 4EH6A 2UW9A 4XJ0A 4QYFA 3ACKA 5K4IA 1UU3A 3R71A 2EVAA 5C8KA 2ZOQA 2R3KA 1YRPA 4YNOA 4BL1A 4EQMA 3QTXA 3KXNA 5CSXA 2ZDTA 4CT2A 3ZDIA 3QUDA 4X3FA 2C5NA 3Q96A 2FSTX 3NYVA 1GY3A 2OJGA 4R7IA 3WZDA 4GYGA 3HMIA 2B0QA 1JWHA 3C4WA 4TWNA 5AV0A 2WMAA 3FYJX 4QTDA 5IISA 2CN8A 4M0ZA 4CCUA 3UE4A 3FMLA 5F20A 2WO6A 1FGKA 1G3NA 4J1RA 3S4QA 2WU6A 5F95A 2YZLA 5CSHA 1UA2A 2CGXA 2R7BA 3R9OA 4ORKA 2X2MA 2B54A 4OGRA 4F0FA 2EB2A 4IAAA 3TV7A 3D2IA 3MN3A 3MS9A 4BC6A 4CZYB 5HTCA 2FVDA 4K33A 4TWCA 2W1FA 4TYHA 3OY3A 3K54A 4BCFA 1Q8WA 4O91A 1QMZA 3FZSA 3QQUA 4RFYA 4S31A 3VAPA 3E8CA 2ZV9A 5AUZA 3UG1A 2BZJA 3NNVA 1BMKA 5T6KA 3GCSA 4JS8A 4BYJA 3NW7A 3HAVA 1F5QA 2OJJA 2YIXA 4L68A 3C5UA 3EQFA 3MVJA 5L2TA 2ZV7A 4QMYA 3RK5A 3RTPA 4LOQA 1U46A 3FDNA 1OECA 4I0SA 3FHIA 3TZ7A 3P7AA 4D2SA 4LM5A 5C9CA 1OKWA 1XO2B 2R3QA 1WBVA 4JJRA 4ALUA 2X1NA 3C9WA 4QMWA 2JDRA 2WTCA 3ETAA 1O6KA 3BGPA 3EZVA 4KBCA 3RJCA 4ZSAA 4JDHA 2OJFE 1QCFA 2UZUE 3TI1A 3C1XA 4XHKB 4OT5A 1OL1A 3QC9A 4U3ZA 4LRMA 5HOAA 4DGOA 3P23A 1OIQA 2R64A 4JNWA 2YIWA 1OIRA 4MTAA 4P7EA 4D28A 2XKEA 1I09A 5AP2A 4HYIA 5CEKA 5FEQA 4E6DA 1PJKA 3UOHA 1T45A 1ZY5A 2BTRA 4GJ3A 4ACDA 4YP8A 3DKGA 2X81A 3L8SA 4FI1A 4MAOA 2GS6A 4JRNA 4PTCA 4RLLA 3CP9A 3HV4A 3PIZA 3NNXA 2CJMA 5TOZA 5M56A 1M2RA 4GEOA 1XH6A 2ESMA 4J96A 1AD5A 2BRBA 3SDJA 3TZ9A 1RW8A 4I6QA 2IW9A 1VR2A 4BBFA 3FMHA 3G33A 5ICPA 2VWXA 3DZQA 4O1OA 3HVCA 5HU3A 3SOCA 3AMAA 2IVSA 4HPTE 4R1VA 2OICA 4XP0A 1XH8A 5IZFA 5A6OA 3TJCA 3KXMA 4PPCA 4R7HA 5CVFA 1SVHA 2B4SB 5FD2A 4Y72A 3D5VA 4BHZA 4CQGA 3KFAA 2CKPA 2GQGA 4ZS4A 5F4NA 2C6LA 3AQVA 2I0YA 4AA5A 4K77A 5M07A 4LMNA 4C37A 5IDPA 2PVMA 3TEIA 4WOVA 2B1PA 5I5ZA 3BZ3A 4AGWA 4AFJA 3PP1A 4IVBA 5BNJA 5KBRA 2XNEA 2XIXA 4I20A 3RVGA 3WOWA 2UZDA 5DRDA 5KMOA 2CCHA 2PK9A 4A9TA 3D7TA 4JXFA 5F9EA 2XKDA 3UQFA 1ZOEA 5CQUA 3VULA 4RVKA 3TUBA 3QCQA 2ZDUA 4AU8A 4L3JA 4YMJA 3KREA 1KE6A 2YCRA 3ERKA 3UO6A 3RPOA 3A2CA 2QOOA 3BHTA 5CTPA 1Q8TA 5AR5A 4WO5A 5DVRA 4EK6A 4IB0A 4JDIA 3GENA 4XS2A 2OU7A 5AEPA 1R78A 2XK6A 2X2LA 1WBSA 1REKA 3GVUA 4V05A 4YBJA 2GNHA 5FM2A 4RBLA 3A62A 3BGZA 2Y4PA 2I7QA 3ROYA 4A4LA 4FSQA 3RCDA 4IAZA 4G34A 3LXPA 3I7BA 4IWOA 2GQRA 1MRUA 2PZRA 4Z16A 2PMLX 2XA4A 4HOKA 4JR3A 3F88A 4GIHA 3T3UA 4H1JA 2W06A 2C3IB 3RK7A 2YWPA 3FKNA 1YI4A 4JRVA 4I3ZA 4EH9A 5AR3A 3G5DA 2EU9A 5EKOA 3R28A 5I4NA 4O7TA 5GIPE 3F5GA 3MB6A 3GU8A 4QOXA 1TQMA 5JSMA 2QONA 3BBWA 3BHHA 2OFVA 3HA6A 5HVJA 4OTRA 3TUCA 4YGAA 5AUXA 3CTHA 4GW8A 4QP3A 1M7QA 5JFXA 4R6VA 2OI4X 3G90X 1FOTA 3JVSA 4OW8A 4BDKA 3CY2A 4EJ7A 4OR5A 4QMTA 4QMPA 5HBHA 5CAPA 1JKSA 3TTJA 4DT8A 4GS6A 2XH5A 2Y8OA 1KE9A 3RM6A 4FYOA 3VRZA 4CXAA 4DG3E 3R63A 4ZP5A 2F7XE 4RG0A 1GJOA 2YM3A 1H0WA 3QLGA 3FMJA 5J95A 5D7VA 5BVKA 5KMMA 4UEUA 3F3TA 3ORPA 4FG8A 1WFCA 2G2IA 3MY0A 3R7VA 1O6LA 2XEZA 3KULA 3ZBFA 2WTJA 4J99A 4BB4A 5IH6A 2I1MA 2DQ7X 4PDOA 3NIEA 1H24A 4QMZA 5ETFA 3W10A 2YDJA 4KB8A 1UU8A 2Q83A 1XH9A 1YXXA 3H3CA 3D0EA 2JDSA 3JY0A 4I94A 4JIAA 5E8WA 4A9YA 5H2UA 3BQCA 3PSBA 4EORA 3ZH8A 5AADA 2YFXA 4BCNA 4YC3A 3GCQA 4MKCA 4EZ7A 3G9NA 1YVJA 3EH9A 1ZMVA 3LIJA 4L3LA 4FTIA 1E9HA 4IDVA 3DJ7A 3HRBA 4LV8A 4W4WA 5DR6A 1ZWSA 2E9VA 2J0IA 5AMNA 4AXAA 3EL8A 3IDCA 2VWYA 3LVPA 3MFUA 3IK3A 4Y73A 3UDBA 3OEZA 4MXYA 4EL9A 2YLEA 4BCMA 4X2NA 3C4XA 2GHMA 3FYKX 3LQ8A 3L9MA 2VX1A 4O0SA 2QKWB 4G2FA 3GFEA 4UYNA 3RZBA 5M06A 4ALWA 4DFLA 2PZIA 4RJ5A 3U55A 4ZTMA 4LFIA 2OF4A 3D14A 4EWHA 2CLQA 3Q3BA 5TE0A 3UP2A 5HO6A 1OKVA 2VWBA 3M2WA 2OJ9A 3SXSA 5JZNA 4XH6A 4AZSA 3L9NA 2R5TA 4FEUA 3E64A 5HGIA 3KXXA 3VUIA 3GUBA 4LV5A 1Q97A 3FXXA 4NT4A 3L9LA 3DNEA 1JSVA 4IADA 4AZVA 3GU7A 5JMSA 5EW8A 1PMNA 3UGCA 2B9HA 3V8WA 5KBQA 3HMPA 2GMXA 4BDCA 3E93A 3KC3A 5T3QA 4ACHA 3FLQA 5GJGA 1YXVA 3PDTA 5H8BA 2QO9A 5AX9A 1B39A 4IJPA 3RWPA 5EM5A 3V5JA 3QA0A 2XK3A 1M2QA 2WMUA 4MQ2A 2J5EA 2XKFA 3BIZA 4FTJA 4B7TA 1P14A 5FLFA 5DGZA 5A54A 5GZAA 3CBLA 4PDYA 4EHZA 1E1XA 2FB8A 2Z7QA 2R4BA 4LUEA 4UWCA 3CPBA 2JBPA 3PA5A 5CF5A 2RKUA 4RZVA 2C6TA 2JITA 3QXPA 1H8FA 4G3GA 2PTKA 3U51A 4BDEA 2G9XA 4CFXA 4USEA 5JQ5A 3CCNA 3HLLA 4FSZA 2I0EA 4NCTC 2Y4IC 4YZDA 5G6VA 5HCZA 1CDKA 4EUTA 4I6BA 5CVGA 3CSVA 3EQRA 3PZHA 3R9RA 4E4LA 4DH7A 3DTWA 1OPLA 2ITNA 2VTTA 3Q5ZA 2UUEA 4PTEA 4U97A 3VS3A 2J9MA 2O8YA 2WQEA 3AC4A 5JZJA 4TWPA 2ERKA 4MD7E 4AA0A 4EUUA 2C0IA 3R04A 4E5BA 5FBOA 4MYGA 2J0LA 1H25A 5HI2A 5AV3A 1ZY4A 4AZFA 4K9YA 5KKRB 1CKJA 3FPMA 2YIYA 4O6EA 3UNKA 4R5YA 4X2JA 3OG7A 4RIYA 5C03A 3VJOA 5HO7A 4QQJA 2PHKA 1LUFA 2BPMA 2G01A 1EH4A 3FY2A 3DDPA 3FMMA 1XWSA 3OBJA 3F3UA 2X8DA 1Y6AA 5CNNA 4ERKA 3U87A 3GC8A 3DGKA 4JDJA 2OG8A 2UV2A 4JX7A 4NM3A 4L46A 3D83A 4RWLA 3Q6WA 4JLCA 5DI1A 4ZY6A 2IG7A 5F94A 3PVUA 1KE5A 4ASZA 4O1PA 2VTOA 4E93A 3OROA 3UIMA 3BKBA 3GI3A 4TY1A 3BLQA 3F61A 4FG9A 2WMQA 5CXHA 1ZMUA 2OKRA 3FL4A 5IQHA 1PKDA 4B6LA 4F6SA 4ZLYA 1PXLA 5IQCA 2UZLA 3VBYA 4ZLOA 2OLCA 3VUGA 3C50A 1NVQA 3EYHA 3MY1A 3RZFA 3UO4A 4DLIA 4Z7GA 1PMEA 4L01A 2FA2A 3MDYA 4O96A 3D5WA 3QTQA 5LWMA 1ZYJA 4RT7A 3WBLA 5LCJA 5CT7A 5GZ8A 4YZ9A 3TL8A 3BCEA 5HE1A 5JGAA 1WBTA 4HNIA 3PXQA 2C6MA 4H58A 4IX6A 3DXPA 5FEDA 5KMIA 4X2GA 2JKOA 5DNRA 5EH0A 2QR7A 3C13A 2PVNA 4H36A 4M3QA 3NNUA 1VEBA 2Z7SA 2ZMDA 4G6LA 3FLWA 3KF4A 4X2KA 4AQCA 4QP4A 5I0BA 3MTFA 2VO3A 5IA3A 1UKIA 4RC3A 3DXNA 1PXNA 4YSMA 4YLKA 4U81A 1LPUA 2VTJA 1UWHA 4ZZNA 3T8OA 4IM2A 3KL8A 3GBZA 4FEVA 4RFZA 5J9YA 1MP8A 4YBKA 2GSFA 2VWZA 1P5EA 3DQWA 4FTNA 4K1BA 5FP6A 3SC1A 5IQAA 4CTBA 1G8SA 3MA6A 2BVAA 3PJ1A 4N6YA 4HVDA 4BDBA 5DMZA 4NZWB 5T68A 5HVKA 5BMMA 3G15A 1NVRA 3Q4ZA 5E8XA 4YJUA 2PYWA 4I6HA 2I0VA 2R9SA 4IAKA 3LPBA 5B2LA 2XF0A 2VZ6A 2WXVA 3JYAA 2IVTA 3ORKA 4JBPA 5EYKA 3VS1A 4AN9A 3NZ0A 2PMIA 3OP5A 4FV2A 4U7ZA 4TKSA 3R7IA 3WF9A 4DT9A 4OBQA 5AR7A 3C0GA 4E6AA 4IWPA 4YJPA 4JAIA 4YJQA 4LGDA 4BKYA 5E8TA 4EOPA 5K5NA 2JDVA 3VQUA 4J53A 2WKMA 4KKHA 2XJ0A 5M44A 2B53A 1BUHA 4FT0A 3U8WA 2UZNA 3WILA 3QA8A 4EI4A 2ZAZA 3DDQA 4DYMA 2UW0A 1ZYSA 4O7LA 2BTSA 4A7CA 3R2YA 4YO4A 3L1SA 2A19B 3LLAA 1URWA 4FTMA 5EI2A 3EFKA 2JIVA 4FV6A 2DUVA 3R7YA 2YJRA 5E8VA 4O0YA 3NSZA 2XB7A 3NW6A 1OM1A 3COIA 3DK3A 2RFNA 3P4KA 3ZRLA 3Q9WA 4M0YA 3EKNA 2W5AA 3F5XA 4TYEA 5FRIA 3KY2A 1OB3A 5L2QA 5CEQA 4IAYA 2C5OA 4RX5A 3ZUUA 4EHGA 4IQ6A 3P0MA 3EB0A 3FWQA 1QL6A 4FGBA 4BTFA 4O2PA 4N6ZA 2C68A 4XUFA 5HICA 3B2WA 1YXSA 2QG7A 4NM0A 4E5AX 5IQEA 4CZTA 2RIOA 2X2KA 1APME 2XK8A 4GG5A 4MBIA 3OY1A 4M14A 1IG1A 4Y46A 5DBXA 5GIOE 3NUYA 4RMZA 4U0IA 3PSCA 4I5HA 2VTIA 2WQNA 4RJ4A 3DBQA 3DBEA 2VAGA 5D11A 4AW5A 1L8TA 3R1YA 4N70A 2F7EE 4JQ8A 4CFUA 2JFLA 2JIIA 4C62A 3UMXA 4F7SA 3UIBA 4NM5A 1U59A 1YXUA 4D2VA 5AA9A 4MXAA 3KF7A 5CS6A 3ZZEA 4BRXA 3D7ZA 3LM5A 3BYMA 5LXMA 2WQBA 2RG5A 2IVUA 2ZYBA 2WNTA 2XNNA 3BEGA 2REIA 3SA0A 3PRFA 4NFNA 5M53A 4GUBA 3DBDA 1IR3A 2WEVA 3KCFA 3QCYA 4KINA 3UP7A 4FV3A 5JFVA 2YCSA 3N4TA 2VWWA 4KA3A 3RK9A 4Z9LA 3CE3A 4AF3A 4OAUC 3O51A 5EYMA 3MTLA 3B8RA 3PA3A 3DV3A 3SW4A 2F4JA 3QRJA 2IVVA 4BI2A 4D1SA 4CVAA 2O63A 3ZZWA 3TIZA 2VWUA 4PMPA 4GKHA 4W8DA 2C4GA 2ITTA 5LQFA 3UZRA 3E92A 3HUBA 3TXOA 4CKRA 4QQCA 3GU6A 3TZ8A 4BCPA 1G5SA 2CKEA 1OGUA 3KN6A 3S00A 1AGWA 1YDRE 1IAJA 3ZM4A 1O9UA 4IX4A 1ATPE 2Z60A 4KIPA 2R3JA 3PJ2A 4FTLA 5CU4A 2R0UA 4EQUA 4OTGA 4MXZA 2O2UA 5BUJA 2RFSA 4NU1A 4ZOGA 3UVRA 2W05A 3JS2A 2VRXA 4DTAA 4IVDA 4WNOA 4L67A 2WMVA 5E9EA 2W1CA 4EH4A 3U9NA 4YURA 3OD6X 3M42A 4F09A 4F7LA 4WG4A 1YHWA 3EJ1A 4R78A 1W83A 1Y57A 4GT5A 5LMBA 2YCQA 4ANSA 4FKRA 4GT3A 3H30A 4MCVA 4CEGA 4RA4A 3VWAA 2DS1A 1B6CB 3FY0A 1QPEA 5EOBA 4F70A 3EL7A 2CDZA 2XZSA 2BROA 2OXYA 5JGBA 3S95A 4CSVA 4WBBB 2WPAA 5DYJA 3LFNA 3ORTA 3IOKA 3BV3A 1ZXEA 4J7BA 2C6IA 3IW5A 1FVRA 3FMKA 4W9XA 1WVWA 4MK0A 4NJDA 4QQ5A 4XLIA 1U4DA 5HKMA 4UXQA 2NRUA 5CEOA 2NNWB 2BAKA 1Q5KA 1STCE 4FTAA 4GYIA 4HGTA 3KRXA 4GU6A 5D7AA 5BPYA 4KSQA 1Q3WA 1JAMA 1IEPA 3RAWA 3ORMA 1HCKA 4L52A 4EBWA 4CFMA 5C27A 4BVUA 3KCKA 3CXWA 3HYHA 3OS3A 1NVSA 4XYFA 3I5ZA 1NA7A 3LXLA 5EQEA 3PIXA 4FZFB 3WF8A 3A7IA 4I24A 1OL5A 2I40A 4AW2A 1Q4LA 3ALOA 3BYVA 4HGSA 5CEMA 4U42A 2X9FA 3TKHA 1JBPE 1REJA 3R01A 4M67A 3HX4A 5E8ZA 4LQMA 4S2ZA 3KVXA 2HYYA 2VTSA 1Q61A 3HUCA 4NSTA 4YJOA 3V5PA 3KEXA 3PVBA 4XRLA 3RKBA 3OCBA 4C4GA 4CMOA 4MVFA 5CSVA 5AUVA 3R8PA 5ANGA 5JFWA 5HEZA 3OZ6A 3FXWA 2ITYA 1JOWB 3PTGA 4FV1A 4FKVA 4V0GA 2FSLX 2W7XA 5C4LA 3KK9A 1AQ1A 1URCA 3O7LB 3QZHA 4FNWA 4GK2A 3MFRA 2DWBA 5CF6A 3MH3A 4DFNA 4IZ5A 4M12A 3HV3A 4ZSGA 3PVWA 2C5XA 4LGHA 2WIPA 1DAWA 4FZDB 3FQSA 4O84A 3VHKA 1YDTE 5M55A 3MW1A 2Y9QA 1GNGA 4IB5A 3ZFXA 5L8JA 5IQFA 4R3PA 2PVJA 4BWKA 4NFMA 2C3KA 4H3BA 1WBOA 3EN7A 5DR2A 5M4CA 3FBVA 4OTFA 1WBPA 2ACXA 3PA4A 2OSCA 3W16A 4XG8A 4PTGA 4FV4A 4EH8A 4D4VA 3ZMMA 5DPVA 3LAUA 4EOMA 4QP8A 4XV9A 5IUGA 4M68A 3C0HA 5C01A 1CSNA 3C4CA 3F66A 4M13A 3UNZA 4C4HA 5I9VA 3OVVA 4FNYA 5AV4A 1TKIA 2ONLA 3A7JA 3CGOA 3QQFA 4OTWA 4TTHB 3SAYA 3RAIA 3K5UA 4PDPA 3F2NA 1IA9A 4YHTA 4P90A 3GB2A 2JC6A 4RZWA 2WQOA 4WNKA 4X3FC 5LVLA 5I9ZA 2GHLA 5HHWA 3ZEPA 5LCKA 4EKKA 4F1OA 3FC2A 4XEYA 3E3BX 4MEDA 4RJ6A 3OCTA 5C1QB 3FMEA 4Y5HA 4GSBA 1OKZA 1XH5A 2XKCA 2XEYA 4GRBA 5BVWA 3BV2A 1OI9A 3ZUVA 1WMKA 3ENMA 4YO6A 4DGGA 2B52A 2DYLA 2NRYA 3ANRA 1BI7A 3FSKA 3QQGA 4QP7A 2BFYA 4O0WA 4DF3A 3RI1A 3M11A 4H3QA 3H9OA 4U79A 1DI8A 3LMIA 3P86A 4WG3A 2QI8A 3B8QA 4X2FA 4YSJA 2RSVA 1LEWA 1QPJA 4BZNA 2QOLA 5EOLA 3WF5A 5E4HA 2GNJA 2VTAA 4MWIA 2W9FB 3IDBA 2J0MB 5G1XA 5FUTA 3I6WA 5E7RA 4TYIA 2ETKA 4FKTA 4I93A 4ARKA 2R3OA 3UYTA 3PFQA 3OMVA 4GU9A 4IX5A 2C3JA 3AOXA 3QD2B 2QKRA 5CI6A 4ZTHA 4EOKA 5HTBA 4FIGA 5CZIA 4O7NA 2XRUA 4TNDA 2PUUA 5FDXA 2XCHA 4BN1A 3LCOA 3ZSIA 1ERKA 3CTJA 4BGGA 4FVQA 2IO6A 3EWHA 3NYOA 2X7OA 5HCYA 2C30A 5GNKA 2HY81 4FSUA 1F3MC 5H3QA 3DKCA 5I9YA 5IH5A 3I60A 2PPQA 4HGEA 5E8UA 3ORIA 4IB1A 4L6QA 4XNEA 5AP0A 4JVGA 5HIBA 3FZRA 1UNGA 4CYJA 4CKIA 3ZXTA 1FPUA 1H1SA 3W2SA 2HW6A 4ZS0A 3COMA 4JI9A 4PWNA 3IGOA 4E3CA 2NP8A 5HESA 4C2WA 3DOGA 3QZIA 3UC4A 3KKVA 3U54A 3R9NA 3R1QA 5KHWA 2FH9A 5DLSA 3CLYA 5CEIA 1LEZA 3PRIA 3QKMA 5IMEA 3HNGA 5EDPA 4PQNA 4U45A 4H3PA 2W1GA 4DLJA 4BKJA 3QD3A 4WRSA 2OWBA 5HG8A 4BTJA 5LVNA 1Y6BA 3R1SA 4FOBA 4ALVA 2CKOA 3WF6A 3MVHA 2EXCX 5M4UA 4O7RA 4DGLC 4U3YA 2V62A 3POZA 3F82A 2BRGA 5I9XA 4G6OA 5KMNA 3NR9A 3QRKA 3PY0A 5K0KA 5CENA 2X39A 3FZTA 3BYOA 2P55A 2UZVA 3FI4A 4HVSA 2OIQA 2XNBA 2R3PA 2GNFA 3HRFA 4QRCA 2ITVA 3UZTA 3D4QA 4OAVB 2XJ1A 4AG8A 4F1MA 4F7JA 3TNWA 4C61A 5J9LA 2X7GA 4O83A 3KGAA 4RIWA 5BVDA 2B9FA 4ACGA 3UMWA 5J7HA 4Z7HA 4OTQA 4R3CA 3R83A 3QQKA 3VS4A 5BVFA 3O8PA 2O65A 4QNAA 4CRLA 3QCXA 3VBXA 3WI6A 1XH7A 4PMMA 3OEFX 4FT3A 4QD6A 2B55A 3RWQA 2YM7A 4BHNA 4U44A 4EOLA 3DFCB 3SRVA 3DKOA 2RFEA 4FMQA 3TTIA 4HJOA 5ACBC 4BI0A 4HYSA 3EFWA 3HL7A 3GFWA 3UQCA 4KRDA 4DG0E 1J1BA 3QF9A 4PF4A 2IZRA 4PDSA 4R77A 4FTRA 2VD5A 2XJ2A 3P9JA 3R1NA 4IFCA 3ZSHA 1H1RA 2VX3A 5IEVA 3QU0A 3I6UA 3F7ZA 1YW2A 1SNUA 4ZMFA 1JKLA 1JLUE 3VBWA 4QYYA 3QRTA 4XBRA 3LFDA 3AMYA 2CGWA 3MH1A 1CKIA 5CU2A 4FA2A 5IH4A 1WAKA 3O7LD 4IIRA 4L42A 3NVKI 2PE1A 3NX8A 2XUUA 4QO9A 3ZS5A 2QCSA 2IJMA 4RQKA 1RQQA 2R3FA 1Q99A 4QPSA 4JG7A 3SX9A 3UVPA 4C35A 4NH1A 2UZOA 1W0XC 3F6XA 3ANQA 4IBMA 3VC4A 1KWPA 1H00A 2BUJA 4KSPA 3E5AA 4UV0A 3CQEA 3EFLA 2FYSA 4BIEA 4G9RA 5DIAA 5IA0A 4P4CA 4A4OA 5L2IA 3CC6A 5B0XA 1OL7A 4ZY5A 4D0WA 1OBDA 2R3IA 3U6HA 4DEHA 3EYGA 5A6NA 4ZZOA 1XR1A 2AC3A 4IM3A 2UVYA 3E8EA 4M84A 4RWJA 3PUPA 4IB3A 2IWIA 4BDFA 5IEYA 1M17A 4FL1A 4QP9A 3UVQA 1XBAA 4W8EA 2C6DA 3HDMA 3OUKA 3PPKA 1U54B 3GCPA 4H1MA 5J8IA 4GT4A 4GMYA 3ZHPC 4DHFA 5CEPA 3PXZA 1WCCA 4M69B 3I0QA 4YU2A 5JK3A 1J7LA 1H08A 3LXKA 4O81A 5AA8A 4AACA 5KNJA 2Q0BA 2VTLA 2O3PA 3ORNA 4C3PA 4DCAA 3LW0A 5AUTA 3THBA 1Z57A 4YZBA 4CNHA 1YWVA 3CD8A 5JEBA 2C0OA 3D5UA 3TJDA 4CG8A 2YA9A 3TNHA 4DGMA 4C4FA 3ZO4A 4P5QA 3UO5A 3Q4TA 4JG6A 2HW7A 3MPAA 4HVIA 1CKPA 4Q5EA 5EDQA 2BAJA 4KKGA 4V04A 4DE4A 4FV5A 2YACA 4ZZMA 4CQEA 4GV1A 4UMTA 3UTOA 1ZYCA 1NT2A 3DT1A 1UKHA 4RA5A 1RDQE 3R2BA 4AS0A 3BYSA 3I5NA 3QWJA 4FZ6A 2YN8A 4JOAA 4L53A 4MXCA 1WZYA 2VWVA 3AGLA 2RG6A 1DAYA 3O50A 1JNKA 1ZMWA 2PMOX 3VW8A 4BZOA 3FI8A 4IW0A 4YNEA 1R0PA 4PY1A 4YTCA 3VVHA 3QX2A 4AX8A 3R8ZA 4EH2A 4USDA 3ZO3A 3H0ZA 5J5TA 3V8TA 5DT0A 4AZWA 4EYJA 4F9WA 2OGVA 4IVCA 4O27B 2W1EA 1M52A 2WQMA 5AUYA 3QALE 1HCLA 4IACA 4IDTA 4W4VA 4CD0A 3OWJA 5IA1A 3DZOA 3UIUA 5KMJA 3GU4A 4K6ZA 4XOYA 3FZ1A 4IAFA 3ZLWA 4CMTA 4J8MA 5FXQA 2OW3A 2HXQA 2PZPA 3KQ7A 3Q04A 4Y5QA 3Q32A 5TKDA 4C8BA 3PWYA 3BPRA 3K2LA 4TXCA 3VS6A 4DCEA 4FZ7A 5HX8A 1OPKA 4CMUA 2QLQA 4ACCA 1JPAA 2GS7A 3WF7A 5CX9A 4ZTSA 3PE2A 1OUYA 3A4OX 3FKOA 3PP0A 3ZC6A 3F9NA 3EOCA 1OVEA 2UW6A 1H4LA 4ASEA 5HG9A 3FLSA 2HENA 4RC2A 3PLSA 4D5KA 3DXQA 3R8LA 3H10A 5HE0A 3UBDA 4CG9A 3AC1A 5E1EA 5AJQA 4DEGA 3OCGA 4YTIA 4EOOA 3ZBXA 2W1ZA 5AFVA 5KZIA 2QLUA 3PIYA 5DOSA 3MH2A 2PVKA 2PWLA 3DAEA 4XG7A 3CD3A 2PVFA 4YTFA 2WHBA 5C8NA 4FGRA 4TYJA 3QZFA 1Y91A 2BDJA 3BX5A 3V5QA 3QTRA 1PMVA 5TR6A 4F64A 3KMWA 5HU9A 4K8AA 3R8UA 2WOTA 1A06A 1UU7A 3W18A 2BDWA 3PLAE 3E8DA 3QFVA 4QPAA 1YQJA 3ZO1A 3FI3A 4AW0A 2WOUA 1YOJA 4GK4A 3ORLA 4GVAA 3REPA 4XCUA 5JRSA 4AOJA 2J5FA 4S34A 3IDPA 4GKIA 4LRJA 3FEGA 4D2WA 3A7GA 5KUPA 2IZSA 2NO3A 4KIKB 2YAKA 4M7IA 2C47A 2UVXA 4MBJA 2GU8A 1KOAA 4J98A 2BRNA 5HD7A 1GZKA 4EONA 1JKTA 2PVYA 3GQLA 2HAKA 4JBOA 5HCXA 4FTOA 3VUHA 3TNIA 4E1ZA 2QOCA 1RJBA 5F1ZA 4PMSA 3AT3A 3W33A 4X3FB 2OBJA 3NCZA 3BU5A 4X21A 2YAAA 3TIYA 4E8AA 1OUKA 4GL9A 4UMRA 2V5QA 2WTKC 4BY9E 2CLXA 4WNPA 3FLNC 2F7ZE 3DAJA 3A60A 2Q0NA 3AC3A 2OZAA 4J8NA 4JG8A 4FKLA 1J7UA 2XNOA 3K3IA 3G2FA 5K0XA 2UW5A 3HECA 1KV1A 5EHOA 4TYHB 4IANA 4O82A 3BWJA 3LJ2A 4B8MA 2HOGA 4ANOA 1Q8YA 5DE2A 3QQHA 2PVLA 4FKQA 4L8MA 3QL8A 4KABA 2B7AA 4FEXA 5CT0A 1K2PA 3H9FA 4HZSA 2H34A 4GJ2A 4NW5A 1SNXA 4YLJA 3HP5A 4MD8E 3FLZA 3COHA 3LCDA 4KKEA 5AM7A 3V8SA 4BCKA 4EK4A 4YZNA 4RJ7A 2BAQA 2R2PA 3R7OA 5AAFA 5DA3A 1Q8ZA 2V55A 3CEKA 3V51A 4E5WA 5L3AA 5ETCA 4D4YA 3UZPA 2YITA 3QBNA 4FK3A 4GFGA 3W2CA 4O0RA 4GG7A 4FVRA 4RFMA 4NM7A 3ZRKA 2PU8A 4BIBA 2FSOX 3WARA 5CANA 4TPTA 2J51A 3QGWA 3EZRA 3G0FA 4UBAA 5LMKA 3C51A 4S32A 3EQHA 2UZTA 4FUYA 2GQSA 5FP5A 5CAQA 2BRHA 4AGUA 4M8TA 5GJFA 4DFYA 4I23A 4PPAA 4N0SA 2BKZA 5B2KA 4ERWA 3UOJA 2BHEA 2C1AA 5EW3A 4AOIA 2R3NA 3DLSA 5JFSA 5L6PA 2GFCA 4RVMA 3NWWA 4C57A 3FKLA 5BUIA 5ITAA 4D9UA 1GIJA 5ANDA 3PVGA 1VJYA 5EM7A 5AR8A 3EIDA 4QNYA 5CALA 2F57A 4XOZA 3SW7A 4A9RA 5EM8A 4ZMEA 4FC0A 1YI6A 2EXEA 3PG1A 5EKNA 2OO8X 4NUSA 2YDIA 1MRYA 3A8XA 4DTKA 3Q6UA 5HNBA 2PSQA 3I1AA 4NL0A 3PXFA 3MH0A 3T9TA 2O0UA 5EQPA 4MXOA 4DEBA 3FAAA 4OTIA 3SLSA 4G5PA 5KO1A 2QOIA 3I81A 4I1ZA 4LRKA 1DI9A 1OMWA 2X9EA 4HCVA 5A4EA 3TUDA 5HNIX 3ET7A 4BDGA 3IECA 4QTAA 3MJ2A 3HV7A 3QUPA 4F9BA 1Q3DA 2C1BA 2EUFB 2YZAA 3NUXA 3HAMA 4FKSA 4ZJJA 4BDJA 2XM9A 5CAOA 1P2AA 2PUIA 2GS2A 1OITA 2HCKA 3KB7A 1CM8A 4P2KA 4USFA 5EQYA 3D7TB 4L3PA 4IXPA 4ANMA 4XMOA 3WZKA 3E62A 4FL3A 1SM2A 3HEGA 4UB7A 3HMMA 5EI8A 4EK8A 2QOBA 1ZARA 3P1AA 4YJTA 2WTIA 2YM6A 3VJNA 2CNQA 3LOKA 4MF1A 5K4JA 1VYZA
chains in the Genus database with same CATH superfamily
4FIFA 3W32A 3NIZA 1H26A 5HBJA 2PUPA 3MB7A 2YDKA 5DEYA 3CY3A 4V01A 4I22A 4AE9A 1BKXA 3FJQE 4O86A 4FV0A 2HY0A 3HA8A 2RL5A 5CASA 5JQ8A 3OOMA 2ZB1A 2Y7JA 2PZ5A 3VUDA 3P5KA 2FSMX 4DAWA 3KRLA 2P2IA 4UX9A 3QYZA 3R00A 5IQGA 4LOOA 5JH6A 4FTTA 4HPUE 4L45A 2UW3A 4R7BA 4ZEGA 2C3LA 4YHFA 3QTUA 5HG7A 4WHZA 3SOAA 3UNJA 4MX9A 4FKOA 5CI7A 4KD1A 3SKCA 4MNEB 4O0TA 3ENHA 5AIKA 3GCVA 4XP3A 3OW3A 2VTPA 3QTSA 5ANOA 4ZSJA 4RGJA 3ATTA 1Y8GA 5HQ0A 4Y85A 3BEAA 5A4TA 3VS2A 3DB6A 5DEWA 2BILB 2VN9A 3Q5IA 3TM0A 4BWPA 4BDIA 4AWIA 3LCTA 5HIDA 4HVGA 5HLWA 1PRYA 4I0RA 3TCPA 4X6RA 4JR7A 4XV3A 5D1JA 4QYHA 4YTHA 4LUDA 3U4WA 4CGAA 4MXXA 3MIAA 2QG5A 4PRJA 3VUTA 3PE1A 4FKGA 4FZAB 2C5YA 3Q52A 4IH8A 2A27A 3Q2MA 3TT0A 5DR9A 2XBJA 5AP6A 5IEXA 3CPCA 3AD5A 1GZNA 1W84A 2X8EA 4ITJA 4DN5A 5IA4A 1MQBA 4FT7A 2VO0A 2LAVA 4EHEA 2R3GA 3T9IA 2V7AA 2H96A 3G9LX 1GAGA 3RP9A 4YLLA 3KRJA 1JSTA 2VGOA 3OW4A 1FQ1B 3GEQA 3H0YA 4LMUA 1JVPP 3MV5A 4L00A 4RIXB 4WBOA 2IZUA 3Q9XA 1WBWA 2UZBA 4EZ3A 4TL0A 4XG4A 4KBKA 1OZ1A 3P7CA 2JDTA 4EH3A 3E87A 4CZUA 3C0IA 5CU6A 3FUPA 3DCVA 1XHAA 1TVOA 3ITZA 4WA9A 1YOMA 3QCSA 2J0JA 5AP4A 3ZRMA 1PYXA 3NYXA 3R7GA 3ZTXA 4A9SA 5K5XA 4YJVA 4JBVA 4I5PA 5AP5A 2W1DA 3V5WA 1H28A 4Y95A 5HZNA 3OWLA 2CNVA 4I5MA 4CTCA 2H8HA 4DTBA 4WSYA 3SQQA 1CTPE 5KX8A 1FVVA 2WAJA 4G31A 5CF4A 1Q24A 1W8CA 3O8UA 3VF8A 5CU0A 2P2HA 3LXNA 2XYUA 5BUEA 5JRQA 3GP0A 4NWMA 2BHHA 4F08A 2XARA 3PWDA 3IG7A 3WIGA 1OIUA 5FTQA 3GU5A 4FEQA 4F6UA 3AT4A 4OT6A 4DA5A 5DG5A 1IA8A 3CTQA 4LL5A 1SMHA 3RMFA 3OWPA 3HRCA 3OXTA 4YJSA 3ATSA 3P08A 5FXRA 4MNFA 2CHLA 1H1WA 2XYNA 3RGFA 5I9UA 2AC5A 5BYZA 3BHUA 4FIIA 4OTPA 4ZTRA 4F9YA 4O21A 1FMKA 2WMWA 2YCFA 3A61A 3AG9A 3HMNA 4UZHA 4TT7A 5AP3A 3EFJA 5CY3A 3R9HA 3VQHA 4LI5A 4BFMA 5B7VA 2VU3A 3R30A 2YISA 1OPJA 3RNYA 3MPMA 4J71A 4ZSEA 2HZNA 3GT8A 2CSNA 4EH7A 4ZAUA 5DFPA 1GOLA 3S3IA 3DB8A 2UVZA 2Y0AA 5FM3A 5L2WA 4BJJB 3U6IA 3TNPC 4QP6A 5CXZA 3GGFA 3FLYA 2F49A 3W2PA 3EMGA 4FUXA 3MSSA 3P79A 1L3RE 4K11A 5EK7A 4PPBA 3UPXA 2EWAA 3H4JA 1YWRA 3V01A 5EHYA 3TKUA 5CQWA 4AT4A 3TV4A 4PP7A 2GTMA 4FE2A 4RLKA 3CIKA 4R1YA 4O4CA 4YC8A 2Y4IB 3UQGA 1UVRA 3MIYA 5J7BA 2ZM3A 1VZOA 5IA5A 4D58A 2BALA 3JVRA 4RIYB 3TWJA 1KV2A 3BLAA 2IF8A 3DAKA 2CN5A 4IJ9A 5J5SA 2YWVA 3CJGA 4HW7A 4FTCA 1KUTA 1PY5A 3ZLXA 4CFFA 2QOKA 5JN2A 3NAXA 3W55A 4C4EA 2XALA 1A48A 3RINA 2Y6OA 1Q41A 2HZ4A 3QTZA 3A99A 5HD4A 4A9UA 1NXKA 3GC9A 3MY5A 3NLBA 5DT3A 1NY3A 3KXZA 3O8TA 4C4IA 3OCSA 1TQPA 2R3LA 4IWQA 4NKAA 4WUNA 4BF2A 4PL4A 4WRGA 2PVHA 5KHXA 4TYGA 3BWFA 4Z55A 3AD4A 5JT2A 2F2CB 1PYEA 2ONLC 2G2FA 3DQXA 2X6EA 2WTKB 4ENXA 4CFNA 4F9CA 3QHRA 3VO3A 2CKQA 5AM6A 3TKIA 3TN8A 4Q9ZA 4F0IA 4K2RA 3FC1X 4FV9A 3AC8A 4JL9A 4ANNA 4ASDA 3D2KA 4IZYA 1O6YA 1PXIA 5IDNA 4YC6A 4FSWA 1IASA 2W99B 2OIBA 3OXZA 3MJ1A 3FSFA 2VTRA 5E90A 2OK1A 3N51A 1PXPA 3NS9A 1V0PA 4D9TA 4D55A 3BE2A 1Z9XA 2BIYA 3BLRA 3TYKA 3BLHA 4O38A 4NKSA 5E92A 4AZTA 3O17A 3VS0A 4E6QA 4FODA 5IU2A 4FNXA 4LYNA 5E1SA 3BHYA 3NMUF 3LQ5A 1MQ4A 2XM8A 3EQCA 4DHZA 3PYYA 3DJ6A 2VV9A 3R7EA 4IEBA 4ZY4A 2ZV2A 4FNZA 3VBQA 2XNPA 3FQHA 2ZM4A 1ZOHA 3DY7A 3PY3A 1E1VA 2QD9A 1YOLA 3PJ8A 1M14A 4L43A 3ZSGA 4MWHA 5A4LA 3I0OA 4I0TA 3CR0A 2VTHA 3P5JC 3ML1A 4QMMA 1SVGA 4E20A 5AR2A 4BTMA 3UPZA 1LP4A 2OH4A 2W96B 5ETAA 3NUUA 4CT1A 4O4EA 4FSNA 4ITHA 5DHJA 5M08A 5KCVA 2BIKB 3K5VA 3KVWA 4ZTNA 1B38A 4RX7A 3SG9A 4BKZA 2P33A 5CF8A 3TG1A 5AUWA 3FZOA 4PNKA 3VIDA 5L4QA 4QMOA 3QTWA 4I21A 4KAOA 4X3JA 3R9DA 1XKKA 5IUIA 5FG8A 4C3RA 3ODZX 4FKJA 4O0XA 4Y83A 1BI8A 3KXGA 3O2MA 4BDHA 3PPZA 4DEDA 4UYAA 4C3FA 2XIKA 4MF0A 4EZ5A 3M1SA 2NPQA 3LFAA 1H01A 2E9PA 3C4FA 1XQZA 2X7FA 1Z5MA 2X6DA 2YLFA 5HE3A 4C4JA 5FXSA 2XBAA 2F9GA 2PULA 4B8LA 3BL7A 2J50A 5DH3A 4F4PA 5IG1A 1PF8A 1QPCA 2RF9A 3PY1A 4AA4A 2WB8A 4ID7A 4BCJA 4FOCA 1PW2A 4EQCA 1J3HA 2LGCA 3E63A 3HZTA 4S33A 4AP7A 4DH5A 1PMUA 4DFUA 5BVOA 1YHVA 2B9IA 3D15A 2VGPA 3DBFA 1YXTA 4UWBA 4WKQA 2W1HA 1MRVA 2VTNA 3LFBA 3QC4A 4QT1A 3TV6A 3W1FA 4O22A 5IPJA 2W17A 3C5IA 1GZ8A 1VYWA 2WFYA 2YM8A 2OXDA 4ACMA 4DG2E 4O7VA 1YDSE 4XX9A 3UIXA 4ENYA 2XMYA 4PP9A 2YIRA 1Q8UA 4O6LA 4C36A 5LOHA 3R8MA 2ZMCA 4AUAA 1F0QA 3Q9ZA 3QUEA 3Q4CA 3W2RA 1J91A 2F2UA 3LFEA 3SHEA 1WVXA 3KMMA 2XK7A 3IQ7A 4IVAA 4FKWA 3WE8A 5AAEA 5A4CA 2GCDA 2J6MA 2PE2A 3OTUA 4HVHA 2A1AB 5CYIA 3OXIA 3MGYA 1RE8A 4F78A 4E26A 4A4XA 4AZEA 2W5HA 2HIWA 3V04A 2ZVAA 3W8QA 4QMNA 4F65A 2XK9A 3F7WA 3DKFA 4TN6A 4XV2A 2IW8A 5CVHA 4FL2A 2E9NA 2HZIA 4U41A 1K3AA 3S0OA 4D4RA 4B99A 4O7SA 3EQBA 3KXHA 5CZHA 3VBVA 4ZSLA 1R1WA 2J2IB 3AMBA 4RX8A 2C6KA 2BR1A 3KRRA 5K3YA 4YZMA 5C4KA 4DH3A 2JBOA 1W98A 3TDVA 5HORA 4FK6A 1MUOA 1R39A 3ODYX 4ZJVA 1BLXA 1KE7A 4EYMA 1OL6A 3NUAA 3PUFC 4FSMA 3JUHA 4XBUA 3UJGA 4FBXA 2QR8A 3AD6A 1FBNA 2JAVA 3W0NA 4RVTA 4DFXE 5A46A 5GINE 3O23A 2I6LA 2WIHA 4FTKA 4D2PA 4FKPA 2OF2A 1I44A 2JLDA 3U6JA 3DBCA 1WVYA 2OFUA 2CNUA 2J90A 4DBNA 4DHIB 4P5ZA 4EC9A 4J52A 3E7OA 4EOIA 4BCGA 1ZZ2A 4UMPA 4IZ7A 5CLPA 4L9IA 4QP2A 4PL3A 3IW4A 3VUKA 3ZOSA 4O7WA 2CCIA 2JIUA 1ZAOA 4RWKA 5EW9A 3C4EA 4AFEA 4K0YA 3TACA 2ITXA 4HYUA 4C0TA 4APCA 4DC2A 2JDOA 3RHKA 4F6WA 2CGUA 2ETRA 3F69A 3LJ1A 3R8VA 2GNLA 4FKUA 4EKLA 4FSYA 5BMSA 3LCSA 2GNIA 3EQDA 3ZU7A 3R02A 3ZDUA 4IAIA 2WTDA 3KRWA 1H27A 4WSQA 3FV8A 2ZJWA 4XP2A 3DLZA 2YHVA 3A4PA 4GIIA 3OT3A 4RVLA 4MNEA 4IM0A 4DH1A 2ITUA 2WEIA 5FGKA 4A06A 1WBNA 4FT9A 4IX3A 3SV0A 3G0EA 5BVEA 1TQIA 3LZBA 3OTVA 5TT7A 4EK5A 2XANA 4Q2AA 1CMKE 4WNMA 2UW7A 4RIOA 5HNGA 2H6DA 2ZM1A 5I3RA 3NPCA 2YABA 2VO7A 4QQTA 3UOKA 1J7IA 4BCHA 1GIHA 1S9IA 3U9CA 3CKWA 3HKOA 3PXKA 4X0MA 4HGLA 3N4UA 1ZZLA 3ZM9A 4MQ1A 5EG3A 3LMGA 3FHRA 4ONAA 5HVYA 3ZONA 4Z3VA 5BYLA 4KNBA 1LR4A 3IO7A 3CKXA 4AT5A 4AGDA 4EWQA 3UDSA 2W9ZB 4YJRA 3MYGA 1W7HA 4NEUA 2ETMA 1DM2A 3RPRA 4U8ZA 2QURA 3BELA 2VUWA 4IWDA 4QMLA 2V22A 5DT4A 1Y8YA 3FMNA 3QKLA 4ZJIA 3AXWA 5HBEA 5M4IA 4RIXA 3JY9A 4R5SA 2ERZE 4KRCA 1BYGA 3LQ3A 3GC0A 3WYXA 3UYSA 3QRIA 4KWPA 5I3OA 3O0GA 3NYNA 3ZLYA 3LJ0A 3PJ3A 4X7QA 1G8KA 2R3RA 3A7FA 2QHMA 4D1ZA 1M2PA 2A4LA 3W8LA 3F5UA 3HV5A 2QOFA 2O5KA 4E7WA 4V0GB 4WIHA 3UDZA 1GZOA 2XNGA 5D12A 4EOQA 3V6RA 4NYEA 2BMCA 1FVTA 3BGQA 5KZ0A 4I41A 2VO6A 4MHAA 2ZB0A 3WIKA 2YJSA 1KSWA 1JQHA 2QODA 4UY9A 4ZK5A 4ZLZA 4U40A 4DEAA 3PJCA 2QQ7A 2R7IA 1XJDA 3NNWA 4C7TA 1OIYA 2Z8CA 5D41A 4DEIA 4GK3A 2JKQA 5CNOA 1IAHA 3VW6A 4QMQA 3RM7A 2UW4A 4G16A 3BBTB 4XG6A 4EC8A 2QHNA 3BU3A 2BCJA 3ZFYA 4E73A 4E4MA 3H9RA 2OXXA 1W82A 2WELA 2RGPA 4EOJA 3L9PA 2IW6A 5DRBA 3CGFA 5BV3A 4Y8DA 3DA6A 4U5JA 5H9BA 2CMWA 2OJIA 3AC5A 3JXWA 3C7QA 3MWUA 4NIFB 1ZRZA 3LE6A 2QVSE 4F7NA 3KIOC 4B0GA 4FIJA 4NTSA 2E2BA 2J0KA 3R6XA 4R8QA 2QNJA 4UWYA 2X4ZA 1X8BA 3DPKA 3PG3A 4G5JA 4QMUA 5A3XA 1XBBA 2WTVA 1FGIA 3L8PA 2QOQA 3QAME 4TWOA 3LFCA 4F1TA 4KIOA 3BHVA 1W2CA 4FR4A 1H0VA 3NEWA 3R7UA 3DS6A 4K18A 3W2QA 5IMXA 4BJJA 2UW8A 5FEEA 4I4FA 3TZMA 2GDOA 3RNIA 5L6WL 4W4YA 3ZXZA 4DFZE 5IQIA 1SVEA 4QYEA 4EOSA 5CSPA 2Z02A 4CLIA 1YHSA 2BRMA 3ALNA 4IZAA 3G51A 2WMSA 1UWJA 3ORXA 2GFSA 4RQVA 2WGJA 2Z7RA 5IQBA 4APPA 3VBTA 3AGMA 4BR3A 2Z7LA 2ITZA 2VTMA 4NCTA 3U4UA 2R3MA 3W0PA 1DS5A 3CQUA 2G15A 4J97A 5B2MA 3RAHA 4O7ZA 3QQJA 4PX6A 3SXRA 4C58A 5LARA 5EHLA 4L7FA 4WUAA 4OUCA 4BDDA 4G3EA 4ITIA 3MFTA 1SZMA 1YI3A 5LMAA 3IW8A 4MH7A 4BICA 4C34A 4ZIMA 2W4KA 4ZTQA 3SG8A 4YUQA 1ZYDA 3MVMA 2C6OA 4HYHA 4YZCA 2PZYA 4QMXA 4I6FA 5C8MA 3ORZA 3A8WA 5A14A 3Q53A 4NTTA 3R22A 4FSTA 4PMTA 5ANJA 3F3VA 2WMRA 3MBLA 4RC4A 3V6SA 1HOWA 3NCGA 3EN6A 2XAOA 4XV1A 3WZJA 3E7VA 3POOA 4JAJA 4QMVA 3LHJA 1H07A 1BX6A 2P4IA 5LVPA 4BTKA 5L8LA 3FE3A 4FIHA 5KE0A 3SVVA 2BDFA 3A7HA 5LMKC 1ZOGA 3HP2A 1P4OA 4CV9A 4F9AA 5AP1A 3DU8A 4M15A 2UZWE 2G1TA 3N9XA 3QX4A 3BI6A 4YJNA 4M66A 5ANEA 2XP2A 4AN3A 2JGZA 3VF9A 4M97A 3FPQA 2GHGA 1M7NA 4G6NA 3E3PA 4U43A 2H9VA 4HCTA 2XK4A 2JKMA 4BZDA 4AW1A 4BYIA 4AN2A 1Q62A 4ANLA 4EBVA 4JIKA 4XLVA 4C2VA 4G9CA 5E8YA 2IN6A 3NFFB 4DEEA 5CSWA 4OBOA 3PZEA 4IC7A 4YPDA 4EJNA 2J7TA 2ITOA 2P0CA 5TF9A 2SRCA 2XS0A 3TNQB 1A9UA 2BZKB 4D0XA 4AAAA 5KMLA 3EKKA 4PNIA 2XIRA 3ULZA 1QPDA 4UZDA 3LFSA 5FTGA 4XRJA 3ELJA 4YHJA 3SXFA 3QD0A 4BGQA 5HO8A 3PXRA 4WG5A 5IF1A 3CS9A 3R21A 3ZCLA 3KN5A 2FUMA 5L6OA 3V5TA 2WMBA 3FMDA 4L7SA 4RIWB 2YERA 4C38A 3GC7A 4C59A 4KIQA 4U6RA 3L8VA 5EFQA 3HDNA 3QD4A 5AWMA 3LFQA 5L2SA 3O96A 3RPVA 2WTWA 4R3RA 2QO7A 5AIRA 1OBGA 5ANIA 2YIQA 5EYCA 2KULA 4E4NA 3WZUA 3SRVB 2QO2A 2R0IA 4IMYA 4QMSA 4ZXTA 2C0TA 5HLNA 1ZYLA 1G8AA 3FL5A 5D10A 4QP1A 3EN4A 5EI6A 4BI1A 5M4FA 5IUHA 1BL6A 1T46A 3GCUA 2WMXA 1U5RA 4BBEA 4BCIA 3ULIA 4EH5A 3VUMA 1KE8A 2OH0E 3MFSA 1IRKA 1V0OA 5H8GA 3I4BA 4B9DA 4YR8A 2BKKA 3MESA 3TDWA 2V7OA 4RRVA 3KA0A 4ANQA 5HE2A 3PFYA 5EM6A 3OT8A 2PE0A 1H1QA 5HTIA 3Q60A 5E8SA 3IKAA 2ZV8A 2HWOA 5EDRA 3EQPA 3OBGA 5A9UA 4DBXA 1UU9A 3WYYA 3D9VA 5FWKK 1H1PA 3RALA 4XG2A 5AAGA 3SD0A 4FT5A 4BCQA 2GTNA 4TZRA 3Q4UA 2HK5A 5C26A 2GNGA 3QGYA 2YM4A 2BZHB 4JQ7A 4I4EA 2XIYA 4TNBA 5AX3A 2QU6A 4Q5HA 3UOLA 4AT3A 4AXDA 3NVMB 3EQGA 3DFAA 3ROCA 2CPKE 2X0OA 4RX9A 5HLPA 3DK6A 5M09A 5CU3A 4QPMA 4DFBA 3OWKA 1JKKA 5J9ZA 4G1WA 4NW6A 1K9AA 4BWXA 4UXLA 3S2PA 5IA2A 2V0DA 2QC6A 3V3VA 3NFGB 4J95A 2R3HA 5H8EA 4IFGA 1PXJA 5IQDA 5GZ9A 1FINA 5E91A 3O71A 3PXYA 4IE9A 3DJ5A 2OIDA 4GCJA 1PXOA 2HZ0A 2W0JA 4Q9SA 4FF8A 5KMKA 3P78A 1SYKA 2C69A 3BE9A 3R0TA 4GUEA 4DITA 2AUHA 3G6GA 3SGCA 4FVPA 3MI9A 4LOPA 4JBQA 3C4ZA 4W9WA 4F0GA 3NUSA 4F63A 4DHJA 3RPSA 3BQRA 4CV8A 4XG3A 3ZUTA 5CAVA 3IPHA 3T3VA 1PHKA 4E4XA 2W1IA 4OTHA 2VWIA 2ITQA 4L44A 3KULB 3VNTA 5AP7A 3WE4A 4NK9A 4CFVA 2QOHA 1UNHA 3EN9A 4BCOA 3GOKA 2PL0A 3IW7A 4JX3A 4UMQA 3I79A 3ZFMA 5I9WA 1NW1A 2JFMA 4E6CA 2VNYA 3K3JA 3FI2A 4D5HA 4FV8A 5BVNA 4JQEA 3LCKA 4A07A 2PMNX 3NRMA 3CQWA 3RHXA 5J1VA 3OC1A 2WZJA 3ACJA 3NGAA 3OHTA 1S9JA 2A0CX 4BGHA 5J1WA 1OL2A 4RSSA 4HZRA 4RPVA 3ZC5A 4FG7A 4FTQA 2VNWA 4HNFA 1PKGA 4TRLA 4DH8A 4EK3A 3AC2A 2XIZA 5AUUA 1FMOE 2WD1A 4GFMA 5JKGA 3KK8A 2P3GX 3OF0A 4IC8A 5K9IA 3ZO2A 4N57A 5ETIA 2A2AA 3DTCA 5J79A 1YWNA 3QRUA 3R73A 4AGCA 5DWRA 4LGGA 5ACKA 4PUZA 4U80A 4H39A 1V1KA 4I92A 3F5PA 3ZEWA 1P4FA 3IONA 3QTIA 2PY3A 3JPVA 4UALA 3AT2A 3LLTA 2XNMA 2W5BA 3F2RA 3P7BA 1PXMA 5FDPA 4WD5A 4X6QC 3PPJA 3DK7A 3RCJA 4OTDA 4DGNA 4II5A 4ZTLA 1U54A 2WU7A 2G2HA 2VTQA 2YEXA 4PL5A 3D5XA 4RJ3A 4CRSA 4JMQA 3RBWA 3VRYA 4BIDA 5LJJA 4N4SA 2WMTA 1KOBA 4FTUA 4M69A 4AXFA 3BL9A 5DN3A 5GHVA 4CKJA 4CFWA 5HG5A 3RAKA 3HV6A 2QU5A 3NW5A 3RPYA 3IOPA 3NUPA 3F3ZA 1ND4A 3EN5A 1JSUA 4ANBA 1R0EA 3E8NA 5CWZA 4UN0C 3FZPA 4CCBA 4DINA 5HIEA 3F2AA 1BL7A 2ZFYA 3VS7A 4G3CA 4GVJA 1UNLA 5HX6A 5L8KA 3QQLA 4CLJA 4KUJA 4OBPA 2XCKA 5BQ0A 3S1HA 3DNDA 3LFFA 4H05A 3W2OA 3NDMA 4ASXA 4KS7A 4MBLA 3ZYAA 4F99A 3IGGA 3G6HA 2C5VA 4FX3A 4D4SA 2X8IA 2BFXA 5A4QA 3BU6A 4U9AA 2IZTA 3EHAA 2PUNA 4G3FA 3GOPA 4FSRA 4RWIA 3II5A 2JEDA 3HGKA 2XVDA 2E9UA 4HCUA 4W4XA 3VS5A 1ST4A 4O7YA 2KTYA 3NAYA 4O0UA 5IKWA 1GIIA 4QTBA 2ITPA 4FV7A 4CYIA 3UG2A 1XBCA 4MD9E 2J4ZA 3I7CA 4PV0A 3PSDA 3HMOA 3JR1A 3AKLA 4FEWA 2HELA 2RFDA 2X0GA 3L8XA 3Q9YA 1V0BA 2JD5A 4JT3A 1XH4A 3ID6C 3IS5A 4OLIA 5LVOA 3QZGA 5ANKA 2AYPA 3QHWA 2UZEA 2EXMA 3B2TA 5EYDA 4AOTA 4QTCA 2GPHA 2CGVA 1G8JA 2FGIA 3VHEA 2EB3A 3ZLSA 3FXZA 3KMUA 4KS8A 3WZEA 2XRWA 4KBAA 5LVMA 3OFMA 2W4JA 3OOGA 5AR4A 3QXOA 5M51A 4WT6A 3UC3A 4D2RA 1PXKA 5GJDA 4O2ZA 2VX0A 2OZAB 3CJFA 1U5QA 3LMHA 2JKKA 3Q2JA 3BRBA 3OUNB 4O0VA 5AV1A 3D94A 3KU2A 4C02A 2BZIB 2FO0A 5JGDA 3UODA 4G17A 2E9OA 4D1XA 4JDKA 2B9JA 4FYNA 5D9HA 4BDAA 3F3WA 4G3DA 5M57A 1R3CA 4QTEA 3EQIA 3MVLA 4FIEA 4IHPA 4UMUA 4TW9A 4FKIA 4D2TA 1YKRA 5BYYA 3LKMA 3FQEA 2HWPA 3QWKA 4S30A 5J87A 2JAMA 2W4OA 3N4VA 3GNIB 2C6EA 5FQDC 4I5CA 3E88A 4LL0A 4B4LA 2YM5A 4EHVA 3W0MA 3BYUA 3QYWA 5TO8A 2Z2WA 1UV5A 1ZLTA 3COKA 2OZOA 3GXLA 3IW6A 3MPTA 3QKKA 4FICA 4YPSA 4EEVA 4GH2A 5FTOA 3VN9A 4LG4A 4NIFA 4QYGA 2IPXA 1OKYA 4AE6A 2HXLA 2I0HA 2ITWA 3NUNA 2O64A 5KKRC 2A98A 5AV2A 2X4FA 5CAUA 4BBMA 3GQIA 4C33A 3QLFA 3MA3A 4KIKA 5BX0A 4NJ3A 2PVRA 2Y6MA 5LWNA 4RJ8A 5FBNC 3LM0A 4GFOA 4XG9A 3V5LA 1J1CA 4EH6A 2UW9A 4XJ0A 4QYFA 3ACKA 5K4IA 1UU3A 3R71A 2EVAA 5C8KA 2ZOQA 2R3KA 1YRPA 4YNOA 4BL1A 4EQMA 3QTXA 3KXNA 5CSXA 2ZDTA 4CT2A 3ZDIA 3QUDA 4X3FA 2C5NA 3Q96A 2FSTX 2IEWA 3NYVA 1GY3A 2OJGA 4R7IA 3WZDA 4GYGA 3HMIA 2B0QA 1JWHA 3C4WA 4TWNA 5AV0A 2WMAA 3FYJX 4QTDA 5IISA 2CN8A 4M0ZA 4CCUA 3UE4A 3FMLA 5F20A 2WO6A 1FGKA 1G3NA 4J1RA 3S4QA 2WU6A 5F95A 2YZLA 5CSHA 1UA2A 2CGXA 2R7BA 3R9OA 4ORKA 2X2MA 2B54A 4OGRA 4F0FA 2EB2A 4IAAA 3TV7A 3D2IA 3MN3A 3MS9A 4BC6A 4CZYB 5HTCA 2FVDA 4K33A 4TWCA 2W1FA 4TYHA 3OY3A 3K54A 4BCFA 1Q8WA 4O91A 1QMZA 3FZSA 3QQUA 4RFYA 4S31A 3VAPA 3E8CA 2ZV9A 5AUZA 3UG1A 2BZJA 3NNVA 2NYAA 1BMKA 5T6KA 3GCSA 4JS8A 4BYJA 3NW7A 3HAVA 1F5QA 2OJJA 2YIXA 4L68A 3C5UA 3EQFA 3MVJA 5L2TA 2ZV7A 4QMYA 3RK5A 3RTPA 4LOQA 1U46A 3FDNA 1OECA 4I0SA 3FHIA 3TZ7A 3P7AA 4D2SA 4LM5A 5C9CA 1OKWA 1XO2B 2R3QA 1WBVA 4JJRA 4ALUA 2X1NA 3C9WA 4QMWA 2JDRA 2WTCA 3ETAA 1O6KA 3BGPA 3EZVA 4KBCA 3RJCA 4ZSAA 4JDHA 2OJFE 1QCFA 2UZUE 3TI1A 3C1XA 4XHKB 4OT5A 1OL1A 3QC9A 4U3ZA 4LRMA 5HOAA 4DGOA 3P23A 1OIQA 2R64A 4JNWA 2YIWA 1OIRA 4MTAA 4P7EA 4D28A 2XKEA 1I09A 5AP2A 4HYIA 5CEKA 5FEQA 4E6DA 1PJKA 3UOHA 1T45A 1ZY5A 2BTRA 4GJ3A 4ACDA 4YP8A 3DKGA 2X81A 3L8SA 4FI1A 4MAOA 2GS6A 4JRNA 4PTCA 4RLLA 3CP9A 3HV4A 3PIZA 3NNXA 2CJMA 1W2FA 5TOZA 5M56A 1M2RA 4GEOA 1XH6A 2ESMA 4J96A 1AD5A 2BRBA 3SDJA 3TZ9A 1RW8A 4I6QA 2IW9A 1VR2A 4BBFA 3FMHA 3G33A 5ICPA 2VWXA 3DZQA 4O1OA 3HVCA 5HU3A 3SOCA 3AMAA 2IVSA 1W2DA 4HPTE 4R1VA 2OICA 4XP0A 1XH8A 5IZFA 5A6OA 3TJCA 3KXMA 4PPCA 4R7HA 5CVFA 1SVHA 2B4SB 5FD2A 4Y72A 3D5VA 4BHZA 4CQGA 3KFAA 2CKPA 2GQGA 2XAMA 4ZS4A 5F4NA 2C6LA 3AQVA 2I0YA 4AA5A 4K77A 5M07A 4LMNA 4C37A 5IDPA 2PVMA 3TEIA 4WOVA 2B1PA 5I5ZA 3BZ3A 4AGWA 4AFJA 3PP1A 4IVBA 5BNJA 5KBRA 2XNEA 2XIXA 4I20A 3RVGA 3WOWA 2UZDA 5DRDA 5KMOA 2CCHA 2PK9A 4A9TA 3D7TA 4JXFA 5F9EA 2XKDA 3UQFA