3FLNC

P38 kinase crystal structure in complex with r1487
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
350
structure length
343
Chain Sequence
QERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSKPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
publication title The Discovery of Pamapimod, R1503 and R1487 as Orally Bioavailable and Highly Selective Inhibitors of p38 Map Kinase
rcsb
source organism Homo sapiens
total genus 110
structure length 343
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3flnC02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3flnC01
2QLUA 2X2MA 2WGJA 2BZIB 3EKNA 3QWKA 5DR2A 4BYIA 2FSMX 5JEBA 1GAGA 3QQHA 5FEQA 3DTWA 4MX9A 4IB1A 4QTCA 2XNPA 3R0TA 4IW0A 3C1XA 4KKGA 1JKKA 3WF7A 3MDYA 4ZAUA 3EN4A 2B55A 4FT5A 3ZUVA 5AUUA 4KKHA 3F3TA 4MXYA 4CEGA 4MEDA 2LAVA 4OTFA 2DS1A 3GFEA 4G17A 4I92A 2OI4X 2WFYA 3AT4A 4M69B 2BRBA 1IAJA 4Y95A 4A7CA 4KWPA 3AC5A 4P7EA 2YWPA 2HZ0A 4EH2A 3C13A 4FVPA 3PP1A 5I0BA 2WOTA 4HYIA 1QPJA 3BCEA 1NT2A 2XNNA 5AP3A 4GUEA 3V8TA 3OMVA 1YWRA 4JRVA 3L9LA 5HICA 2X9FA 1OKWA 3PWYA 4I22A 4IMYA 3Q2MA 3VULA 5JT2A 4U0IA 4D2TA 2V62A 3D0EA 4YZMA 3ZUTA 4QPSA 3CD8A 2WTIA 4QYEA 1U5RA 1CM8A 2WO6A 4RVKA 4TYJA 3SLSA 4DHFA 3ETAA 4U79A 1XQZA 3FI4A 5HVYA 5EFQA 4AGWA 4H1JA 1WBWA 3QX4A 4FV2A 3ZFMA 3EFWA 5L2TA 5HVJA 3HDNA 4FV3A 2RIOA 3VRZA 4X3FA 4ZSLA 5IQAA 3FWQA 4FTNA 4QMZA 2FYSA 3OCSA 4GK2A 4Y73A 3HRBA 1X8BA 2C5NA 4FNYA 2VWWA 3B2WA 5EOLA 1M52A 4JDKA 4BDCA 3TCPA 3QKLA 4EOSA 3C7QA 3UE4A 4V0GB 4XMOA 4AOTA 3MFTA 4TL0A 4F65A 2WMAA 3O0GA 3OXIA 2W05A 5E7RA 3Q53A 5CTPA 2BIYA 2VGPA 4QNYA 3BGZA 2CGXA 4FSYA 1ND4A 2ZM3A 3D7TB 1IR3A 3RHXA 4O7RA 5JSMA 1JVPP 5DI1A 3QA8A 4EQUA 5CU3A 2QOCA 2B9FA 3PTGA 4O0VA 4A4LA 3TEIA 2OXYA 3LFAA 4D4VA 4FKWA 3AC2A 1SVEA 5BNJA 4O81A 1GJOA 3KCKA 4HGTA 2GNGA 4IFCA 3UC3A 1JNKA 4FK3A 3PXQA 4F6WA 3GC0A 2J4ZA 4HOKA 5CI7A 2JAMA 4HCTA 4NH1A 4RX9A 5DBXA 5I4NA 5KMMA 3Q96A 3MFUA 3PZHA 3RTPA 3H10A 4KABA 2SRCA 3KVWA 4NJDA 4PRJA 3UOKA 3WZJA 5E8UA 1G8SA 3FQEA 3NS9A 3R00A 4Y85A 3IONA 4UV0A 3ZZWA 2B1PA 2UVYA 5DPVA 4B8MA 4HZSA 4RIOA 3UNKA 4GT3A 2BDJA 4HJOA 2QOBA 2VWXA 5KE0A 3UZTA 3PDTA 4JR3A 3GC9A 3P79A 3OTUA 4IC7A 4MVFA 3GCPA 3NCGA 2OW3A 4U40A 4KSPA 4CQEA 4D5KA 3P23A 3PVWA 4IE9A 4GEOA 5GHVA 5CEIA 4FZ6A 3DS6A 4BDJA 3LMIA 4O7YA 3DDPA 3GBZA 5GIPE 4Z3VA 2PMOX 2RFEA 4IVCA 2WNTA 2GU8A 2W1HA 2C5OA 3AQVA 3G9LX 5HZNA 2P33A 1W82A 2FH9A 2YHVA 3L8VA 1PHKA 1KOAA 3BLHA 1WVWA 2FB8A 4YR8A 2J51A 4YJVA 1FVVA 3ZSIA 2R3OA 5J9LA 5J1VA 2PMIA 4FIGA 2WMWA 2OXXA 1ZZ2A 3BYSA 4I5CA 3LFNA 5FM3A 3V3VA 3C4EA 5FTQA 3U54A 3EN7A 3VJOA 2PK9A 4EH9A 3MY1A 2C1AA 5IEVA 3FJQE 2HWPA 1OL7A 4M3QA 4BZOA 5FWKK 3FPQA 5BMMA 5JMSA 2VTHA 2YERA 4QMTA 3W2RA 4RPVA 4BDFA 2YITA 3C50A 2ITTA 5EHLA 5D10A 4PMMA 5HLPA 4O0RA 4QQTA 4M8TA 4PMTA 4CQGA 4KB8A 5F94A 1NVSA 4IVBA 3QA0A 5AMNA 5FBNC 4TWCA 5CSVA 1STCE 3GOPA 4XEYA 2PTKA 3N4TA 3QD3A 4XLIA 5BVFA 1UNLA 2C30A 4MD8E 2OU7A 4E6CA 1OKZA 4C59A 4QTBA 2BZKB 3H0YA 3ZC6A 4BIEA 2PVFA 3O17A 2I6LA 3VUIA 3MIAA 3NYVA 4CSVA 5AA8A 1KV1A 1WBVA 2XBAA 4L8MA 3R8VA 5M4IA 4LMNA 2VAGA 4JBQA 4EL9A 4EUUA 3DB8A 3OCTA 1LP4A 5M09A 4MNFA 3DKOA 3HZTA 2W1FA 2EU9A 2HZNA 2QQ7A 2W06A 3HRFA 5CYIA 4AW2A 3R7VA 3FC1X 2WMRA 5DYJA 3EQPA 5HNGA 4C4HA 1PXLA 4EOKA 2W9ZB 5M57A 3OZ6A 3FMEA 1XHAA 3G33A 5A6OA 4DEBA 2A0CX 4OTWA 4P4CA 3U6HA 3LXNA 4O86A 2F4JA 4ZSEA 3E87A 4GT4A 4DGGA 2WMXA 3MB6A 2VWZA 5B2MA 4GJ3A 3DQXA 1PYXA 4G1WA 5IQHA 4EZ7A 3CQWA 3CTJA 2R3FA 4ANOA 4R1VA 3NW6A 3OBGA 4ANQA 1XBBA 3BX5A 2XM9A 3MSSA 4Y5HA 5DR9A 4F9WA 3QBNA 2C5VA 4Z7GA 2QOHA 3MI9A 4BRXA 3C5IA 2J5EA 3QKMA 2VUWA 3VS6A 1H25A 2F9GA 4XP0A 3U4UA 4DG3E 3UDBA 4OAUC 3I5NA 4UB7A 4CTBA 2YIRA 3DU8A 2WELA 4QP8A 4APPA 4YZDA 1IG1A 1URWA 2XJ2A 4G31A 1R1WA 4NIFB 5J95A 2JD5A 4OLIA 1Z9XA 2B0QA 3OC1A 2Q0NA 3UNZA 2IW8A 2QOQA 4U81A 1TQIA 4MF0A 1OPLA 2QHNA 5HKMA 3BRBA 4U42A 2QNJA 3FZTA 4U8ZA 3G2FA 4LUEA 4BCQA 3HV4A 3T9TA 4H05A 2R3KA 4UYAA 3DAKA 4J1RA 3KVXA 3C4FA 2OIQA 4DEGA 5C8NA 5KMKA 1W7HA 3BELA 3ZRLA 2HYYA 3TM0A 2XNGA 4Y83A 4MKCA 3E63A 1LEZA 1Y8YA 2W5HA 2WMVA 2QHMA 2R0UA 2UW9A 3QTXA 5T68A 2YABA 3ZU7A 3Q60A 2NRYA 4M97A 1OBDA 4YO6A 4R7IA 3R8MA 2JLDA 3R7YA 2PZ5A 3FLSA 2HK5A 4F1OA 1PXKA 2X7GA 3OHTA 3KMWA 4FTRA 1WVXA 2FGIA 4LOQA 4PPAA 4ZMEA 4FV4A 1ZOHA 4LQMA 3TUCA 3KREA 3MGYA 3S1HA 3OP5A 4M69A 4FKQA 5HU3A 3H0ZA 3TZ7A 3OT3A 1PKGA 4GIHA 4JJRA 5FEEA 2GTMA 3MTLA 4DT9A 3FLQA 5LARA 2Z7LA 4FE2A 3F3ZA 4ASZA 4IADA 4Y8DA 3ZSHA 3QTUA 3NNVA 4LG4A 4CZUA 5HU9A 3EN5A 4IVAA 5EOBA 3WILA 4JQEA 1H0VA 3UG1A 4ZS4A 2O3PA 1LEWA 4FG7A 4FT0A 4WOVA 4PNKA 3PRFA 4KINA 4LV5A 3NWWA 4DEAA 2R3GA 3ACJA 3ZDUA 4D1XA 5AEPA 4ZJJA 5T6KA 4BIDA 4EWHA 3GVUA 3NNUA 5HGIA 3ZLWA 3FKNA 5K5NA 1UKIA 4GU9A 2WMQA 2C3IB 3KN6A 3LCKA 5FP6A 5EKOA 4ZZNA 4HGEA 2R5TA 4XRJA 3DAEA 4BZNA 2ITXA 4X2FA 2XNMA 4NU1A 4D55A 3TDWA 4BKZA 4EK5A 2PUIA 3VF9A 5JK3A 5IU2A 2ZV2A 4I0RA 4WUNA 4YZBA 3DPKA 1DAYA 1GY3A 4YO4A 4KRDA 1BMKA 3BYMA 3G0EA 2XF0A 5AP0A 3RALA 4BDHA 4QOXA 4JS8A 5FBOA 5TE0A 4I5HA 4UY9A 4E5BA 4CKJA 5ITAA 3H9RA 3CQEA 4E4MA 5F1ZA 3WF8A 2VX0A 5AJQA 3V8WA 4DH8A 5CAPA 4OW8A 3QD2B 4V0GA 5HG7A 5TR6A 2XJ1A 4Y46A 3ROYA 4J8NA 4CT1A 4LYNA 2IZSA 3GQIA 2XKFA 4FBXA 3NRMA 1SVGA 2F7XE 3WIGA 4CFXA 3FYKX 3I6UA 3A4PA 3R9NA 4B7TA 4A9SA 2ZJWA 4R6VA 3D7TA 4H3QA 4I5MA 4DE4A 2YFXA 4PTGA 4BVUA 4XH6A 3ZM9A 4ZMFA 2O5KA 5CXZA 3MYGA 4ZY6A 1PMNA 4QYYA 3FL5A 5I9WA 3TV6A 2Z7SA 2ETRA 3BI6A 3UVRA 3SC1A 2Y7JA 2PVLA 5GJDA 3T8OA 3TG1A 3SOCA 4FOBA 4X2NA 3RINA 5EQYA 3JS2A 3D5UA 4EZ5A 3JY9A 3EZRA 4NW6A 4BCHA 1H07A 3QQFA 3FZ1A 5LMKA 4ZIMA 1U4DA 4ZXTA 2OZAB 3UIMA 5HX8A 2ZM4A 4FKVA 5E8ZA 4B8LA 4MWHA 1WBPA 2Z2WA 3LMGA 4HPTE 3L9PA 5AR3A 4D2SA 4KIKB 3GT8A 4NJ3A 4EK6A 2HWOA 2ITOA 4JOAA 2W1DA 3D2KA 4W4VA 4FSMA 4I20A 4XYFA 3LM5A 3O7LB 4I21A 4C4JA 5CZHA 4C58A 2R64A 2R3MA 2JIVA 4EHZA 4ZTHA 5A14A 3CR0A 4A9TA 3KXZA 3IO7A 4GU6A 4OR5A 4WBOA 4L68A 4I6HA 4BB4A 3FHIA 4XG3A 3HNGA 4GKIA 5IQFA 3KKVA 3BPRA 1Y57A 5AV0A 4C3FA 3ORKA 2X39A 4M12A 4B0GA 3BGQA 5IQCA 1JKLA 4YLJA 4WNMA 1RW8A 5HE1A 4X0MA 1G3NA 1Q4LA 3MJ2A 2UZNA 2OGVA 2VTAA 4L45A 4IC8A 4CXAA 3TXOA 3DXNA 4YJUA 5AP4A 3TZMA 5EHYA 2WEIA 5BVWA 4IWDA 2BROA 5D9HA 2HW6A 5ACBC 3ERKA 2C6LA 3UJGA 4AA0A 4JBOA 4IH8A 2HXQA 4IAAA 3FC2A 3CJGA 2UZWE 4EH3A 3U9NA 3RAWA 3MFSA 2V5QA 3MS9A 5BVOA 4OT6A 4E4XA 1OIUA 4XBRA 4USEA 2WMTA 2BKKA 3I7CA 3NUNA 4YJTA 2KTYA 4AXAA 4PTEA 2QU5A 3C4CA 1WBNA 3CTQA 4GRBA 3Q32A 4YJNA 4D58A 2VX3A 5AUVA 4FTMA 2QONA 5J7HA 2OO8X 1OZ1A 3LE6A 4GS6A 4USDA 2X6EA 4F9AA 2ZB1A 3DOGA 3ZLSA 1DM2A 3ULIA 3V8SA 4FV7A 3VUMA 3TNQB 3A7GA 5JGDA 2HOGA 3OFMA 2HY0A 2UW3A 4DAWA 4BHNA 5L2IA 2OLCA 2XIKA 4F7JA 4FNZA 3TV7A 1H26A 4NCTC 5E9EA 4IM3A 3ATTA 1K3AA 2B54A 4TT7A 3R28A 3LJ0A 3CP9A 4U80A 3QZHA 4QMYA 1H27A 2JDVA 4QP1A 3E8EA 4OAVB 1UNHA 2F2UA 4HNIA 4RC4A 2BHHA 1XO2B 4G3GA 4MHAA 5D1JA 4NL0A 3LQ3A 4FZAB 4ITJA 4ZJVA 5HIEA 2ZMCA 3DBQA 1BKXA 2QR7A 2PVHA 4Y72A 4D4SA 4ERWA 2VWBA 5FM2A 4HW7A 2Z8CA 3A61A 3FMNA 3QTRA 4YJQA 3M11A 2ZM1A 3IOPA 4TPTA 5IQBA 1JPAA 3FKLA 1IA9A 1JAMA 5HORA 2PVNA 5E8TA 5CX9A 3C0GA 3K3JA 5FRIA 4QD6A 5HIDA 1G5SA 1ZOGA 3HECA 1ZYSA 1ZXEA 4KIPA 3ZO1A 4D2RA 4NIFA 1OUYA 4OTRA 4AUAA 4NM0A 2Z02A 2R3NA 5C01A 4RJ4A 3DAJA 2GS6A 2VWUA 4ZLZA 1YRPA 2W5AA 4C2WA 5K0KA 2PWLA 4IIRA 3PIZA 4O7LA 3MN3A 2PVJA 3KF4A 1LUFA 4NSTA 2OSCA 3LCTA 3V5LA 4BKJA 3BWJA 5LVLA 3ZSGA 1O9UA 1GIIA 2XK9A 3TV4A 3D9VA 4FVQA 4N4SA 5DT4A 2WIPA 2G2FA 3W32A 5AADA 5I9XA 4LGDA 1YXXA 4ARKA 2RL5A 4X3JA 4NWMA 4ACCA 4XG8A 3TNHA 5LOHA 3FI3A 4GVAA 5ICPA 3A8XA 4CTCA 3GOKA 5A4TA 2YA9A 1OUKA 5T3QA 2HENA 4EH5A 2BUJA 3KFAA 5AV2A 2PE2A 2XIXA 3RAIA 2UZDA 5CAOA 4L46A 4Q2AA 4XUFA 3LFCA 3QRTA 5AAFA 2XK3A 3MH3A 3NUSA 3SD0A 5IMXA 4ITHA 3ZHPC 2CNUA 3NAXA 3A99A 3H9FA 3HUBA 2RKUA 5L2QA 1J1BA 3C4WA 3U6JA 3QRIA 4KA3A 1PXOA 2GNHA 5DRBA 4CZTA 2VTOA 3F2AA 1UVRA 3HRCA 3F69A 4IM0A 4E5WA 3P7CA 3TNPC 5LJJA 1GIHA 2XYNA 4FKJA 1ZYCA 2X8EA 3FY2A 5KZIA 3QZIA 4DF3A 2OJJA 4R5YA 3HA8A 4IVDA 4A9YA 1H0WA 3VUKA 5LWMA 5AV4A 2ITVA 3AD4A 3F5XA 3HGKA 4MH7A 5L6PA 3LLAA 1QMZA 1TQMA 2HY81 3D5VA 4FSTA 5HCZA 3RNYA 3VVHA 5JQ8A 4EUTA 3RKBA 5FXQA 5DMZA 2WAJA 4FV9A 5E92A 3PP0A 4G3CA 5JFXA 1Y6AA 4U44A 4XG2A 2OWBA 3NPCA 3PPJA 4FIFA 3BHYA 3SAYA 5KMOA 3D15A 3LZBA 3PJ2A 4MNEB 3R8UA 4L44A 5IH4A 3VQUA 5DWRA 1JKTA 2J90A 3HMMA 1FVRA 2PUPA 3K2LA 3O8TA 2IZTA 4XG9A 5AUXA 1Q97A 3VHKA 3WE4A 2AC3A 2ITQA 5C4KA 3S95A 1PMUA 4FEWA 4ITIA 4IXPA 4IWPA 3QTZA 5HIBA 5E8XA 3RMFA 5IEXA 4NZWB 1MRUA 4LL0A 4PL4A 3F6XA 4C4IA 5KBQA 3QQJA 3F3VA 4U3ZA 3CD3A 1CKIA 2P0CA 3FXWA 2GNIA 3L9NA 4FSRA 4I5PA 5D12A 3WZKA 5H8BA 4LUDA 4EI4A 4TYEA 5KKRC 2OIBA 3R1QA 4UN0C 5I9ZA 3U8WA 3KB7A 1AGWA 4YSMA 3A2CA 4KRCA 1L8TA 2PU8A 4O84A 5CXHA 1H1RA 5DLSA 4HPUE 4L01A 4DTAA 1VZOA 5JFVA 3T3VA 3R1NA 4AZEA 4M68A 4ENXA 3PXZA 4PDYA 4NM3A 4HGLA 4ALVA 1I09A 3L8XA 5HVKA 3UPXA 4UXQA 4ASDA 5H8EA 2R2PA 2CKQA 4WSYA 4KBAA 1XH8A 1MUOA 3A7JA 3LW0A 2CN8A 5GZ8A 4AFEA 4MBLA 2C6DA 3LXPA 2OKRA 3ZFXA 2X2LA 4V04A 1OIQA 1V0BA 1J7IA 3NW7A 2UW8A 2XIZA 2OZAA 3EZVA 5IMEA 5CEKA 3ZCLA 1Q24A 3DZOA 4XG6A 4DH3A 4KIKA 2FUMA 3VS1A 3ZO3A 4W4YA 3R21A 2H96A 4J99A 3TKUA 2WHBA 3KRJA 2BR1A 3R1YA 4H36A 3O23A 4YTIA 3VUDA 4RJ7A 4GUBA 2DYLA 3FMMA 3NCZA 4WD5A 2OBJA 4OTPA 4F0FA 1Y91A 5DT0A 2Y4IC 3ZUUA 3DDQA 5HTCA 3DGKA 2FSOX 4KS7A 3NIZA 5HG9A 4K9YA 4BYJA 4EK3A 3RK9A 4FSQA 3FLNC 4FMQA 3GENA 3RGFA 2AC5A 5GIOE 3EL7A 4FTLA 3PJCA 4RJ6A 5FXSA 4R77A 4D9UA 2WZJA 1H08A 1S9IA 2C0IA 3U4WA 4FSNA 2R0IA 2XK6A 2C47A 2FVDA 4RX8A 4QT1A 3ATSA 4GT5A 4UBAA 4L53A 2CGVA 4CCBA 3LM0A 3KK8A 3DKFA 3VW6A 1CKPA 3FZPA 4O0TA 2UUEA 5D7AA 4KBCA 4AGCA 5BVDA 3UG2A 3VUGA 5HTIA 5A3XA 5CU2A 4O27B 3HLLA 5F4NA 1YHSA 2JITA 4MQ2A 3RCJA 2W5BA 4U7ZA 3QRUA 4BC6A 2CDZA 5BUIA 5IUIA 2JIIA 3GI3A 4AFJA 3VBWA 3FMLA 2QC6A 4ZTLA 5FXRA 4RFMA 3Q52A 4NW5A 5FLFA 3ZRMA 4EH8A 2VTPA 4UWCA 5DH3A 1MRVA 5ANDA 4AN9A 3RPSA 3E8DA 3OWKA 4G5JA 4Z9LA 2EXCX 2OJ9A 3QUDA 4CNHA 3HKOA 5I5ZA 4DTBA 1GZNA 5C26A 2GS2A 2ETMA 1JLUE 2XKDA 5K5XA 2WQNA 1WCCA 5JRQA 4L52A 3KRXA 2VTNA 5B2KA 2XVDA 2WEVA 3QC4A 5M51A 4AZVA 2EXEA 1L3RE 4R8QA 3EYGA 3C5UA 3DNDA 3R01A 4L7SA 4KAOA 4YC3A 1BX6A 5TO8A 2WPAA 3FI2A 2X6DA 4D28A 3BQRA 4TNDA 5E4HA 4QMPA 4QP4A 3OG7A 1ZMUA 5E1EA 5KKRB 3GGFA 3TZ8A 4K1BA 5ANIA 2W9FB 3AXWA 3IECA 4J53A 4LGHA 1KE8A 3R2BA 4QMVA 4BL1A 3MPTA 4FVRA 2F7EE 3RJCA 5GZAA 4KIOA 4C57A 3RK7A 4UXLA 1R3CA 2OF2A 4F9YA 3F5GA 5EYDA 4D2VA 4FA2A 3TUDA 3E93A 3HAMA 4G6NA 5ETCA 4JG6A 3EYHA 5M4FA 3OROA 5B7VA 2JKQA 2HZ4A 5JGBA 2YCSA 4DG0E 2YM5A 3ORLA 1XKKA 2CMWA 3BHUA 5KMLA 3VBYA 3KF7A 1J1CA 4GYGA 1UV5A 2RGPA 3H30A 2VO0A 3Q2JA 1E9HA 3O51A 3BHVA 4FZ7A 2VTJA 4JBPA 4R78A 4F0GA 4U43A 2BTRA 2YZAA 4M14A 4O91A 4ZTRA 2GTNA 1BI7A 2G2IA 3DQWA 4F7NA 2YLEA 4AACA 1Q8ZA 5G1XA 4ZTMA 3NUAA 4OUCA 4F7LA 2VX1A 3F2RA 4TWOA 5K3YA 3C4ZA 3TZ9A 2PUUA 3EWHA 3FLZA 4GFMA 4KS8A 4EQMA 4HVDA 3JVSA 5L8LA 2HZIA 2ZDTA 3MH2A 2IVSA 2IZRA 3KRWA 3OXTA 4FZDB 3TT0A 4FT9A 3KY2A 2QOIA 3CEKA 3POZA 2C3JA 5C4LA 5EM5A 5J9ZA 1DAWA 3LFEA 3E7VA 3PJ3A 5K9IA 2W99B 4I6QA 4MAOA 5FQDC 4OBQA 4A9UA 5KUPA 3G9NA 2E2BA 5AR2A 3DFAA 1KV2A 5CSXA 4YHJA 4QYHA 4EKLA 1BLXA 3MV5A 3OT8A 4L3JA 3TACA 2NRUA 4GMYA 5AP1A 5FTGA 4AZWA 3V6RA 3AC1A 3AD6A 5KMNA 5CY3A 5HD4A 5KHWA 2QCSA 2X0GA 2BCJA 2RFSA 4FTAA 5TOZA 3MESA 3N4VA 1JKSA 4IZ7A 4DYMA 4UMRA 3BV2A 4GG7A 1OIRA 4M0YA 4E4LA 2QKRA 4L3LA 3UODA 1A06A 3OW4A 4J71A 3K3IA 5HBEA 3W2SA 4FKLA 4O2PA 4CMOA 4FTKA 2LGCA 4UWBA 4AAAA 3NDMA 5EM8A 1WVYA 4OTHA 4X2KA 5FD2A 3MWUA 3QLGA 4TRLA 3ZBXA 5HX6A 5IA4A 3QXPA 4FTTA 5FG8A 5HCXA 3BLQA 2E9NA 3GU6A 4MCVA 3EB0A 4FKOA 1Q3WA 4WUAA 2BAKA 1ZY4A 3Q4TA 3R22A 4AZFA 4XV2A 2JEDA 3P7BA 4YLKA 4EH4A 4FC0A 4YTCA 2ZV8A 4O2ZA 4ANLA 2BKZA 5KBRA 2B9JA 5ETFA 2JKKA 3DBEA 3NX8A 3PVUA 4XV1A 2OICA 4QO9A 3E8NA 1XBCA 1Y6BA 2A19B 2J7TA 3CKXA 3JVRA 2ONLC 3R7GA 4MNEA 4ZY4A 4OTQA 1XWSA 4NCTA 2C6OA 2I40A 3R83A 2QOFA 2WMSA 4O0WA 4BY9E 4BCGA 5IEYA 2QOKA 3C4XA 5CEPA 4YGAA 3PA4A 4D4YA 3F3UA 3VUTA 1R39A 1Q8WA 4YC8A 4C2VA 4OGRA 1VEBA 4RC2A 4GH2A 2RG5A 3AT2A 4X21A 4O7NA 5CEOA 3E62A 3A7HA 4NFMA 3GQLA 2CJMA 1YKRA 4S34A 4F09A 1OL5A 4BCKA 4FUXA 5LCJA 4AT5A 4AW0A 3LFBA 4O38A 3RWPA 3IK3A 3KMMA 3S3IA 4RX5A 5GNKA 4RIXB 3MFRA 1ZMWA 3P9JA 2BRNA 1T45A 3PA5A 1PMEA 4LGGA 3UBDA 2YAAA 4DGOA 3GC8A 1NVQA 4XOZA 4E26A 1FMOE 4E5AX 3SRVB 3NSZA 2XCHA 5AFVA 4OTGA 3A7FA 1UKHA 1K9AA 2F2CB 3OD6X 3G51A 2I1MA 3FL4A 3QXOA 4DH1A 2G1TA 3AC4A 3R9HA 1YI3A 3UO5A 5HBJA 1R78A 2PZRA 4JRNA 4E93A 5JGAA 3E5AA 4JX7A 1TVOA 4WNOA 1O6YA 2CSNA 2VO7A 1BUHA 1WBTA 3P7AA 4NKSA 2IVUA 3R7OA 4CFUA 3A4OX 2J0LA 4LL5A 3R9DA 4CYJA 3EH9A 4TY1A 1OL2A 4AN3A 3E3PA 1OL1A 2XK4A 4FI1A 2JAVA 2GNJA 3NVKI 3HX4A 2ZV9A 2QOOA 3FLWA 3NW5A 4IX6A 4NFNA 3FI8A 1SVHA 2QO2A 3QTIA 4TKSA 4JQ8A 4YBKA 3DBDA 4ZOGA 4C02A 4LOPA 1Q8YA 1YHWA 2C6EA 2GDOA 4MTAA 4HCUA 4RC3A 4EC9A 4C36A 3QTQA 3HMOA 4DH7A 3KXNA 1OKVA 3TL8A 5I9VA 3T3UA 2C5XA 4AX8A 4F1TA 4B6LA 4CKIA 4QMOA 3HP5A 3VS3A 4BCIA 4DFZE 4YUQA 3F2NA 3H4JA 5L2WA 3SW4A 1J7LA 3AC8A 4O21A 3P0MA 4PY1A 4B99A 2H34A 3IW8A 3OUNB 2R3LA 4FTJA 3DV3A 4U41A 2XIRA 1Q62A 2PL0A 2HAKA 3PLSA 1J3HA 1UU9A 1YOJA 5TKDA 2X1NA 3BHHA 1OVEA 2WMBA 4RWJA 5ANEA 4Z7HA 2W4KA 3GCSA 4FGBA 3QALE 5AUYA 3M1SA 4IACA 4AE6A 3PUPA 3E8CA 1JSUA 2ITWA 3U51A 2F49A 3EOCA 3HUCA 4P5ZA 3RPRA 4AT4A 4BI1A 4CD0A 3F3WA 4E6DA 1H24A 4W4WA 3OF0A 3VO3A 3RCDA 3CQUA 3I7BA 2R4BA 3RVGA 4FIEA 2Z7RA 4IJ9A 4U9AA 4DA5A 2YCRA 3MY5A 3RK5A 1JSTA 1OITA 5BPYA 5DRDA 2QO9A 2H8HA 4F7SA 3SG8A 2YLFA 4OTIA 2C5YA 1XH4A 3LHJA 2UV2A 4CMTA 4O7WA 3ORIA 4GW8A 1Q5KA 3I1AA 4ZJIA 3TI1A 3MIYA 4WG5A 4CV9A 5BVNA 1JQHA 4R3CA 3OTVA 4FG8A 2PZPA 4UMQA 4CRLA 4YSJA 4WSQA 3F7ZA 3Q4ZA 2QODA 4FKGA 2JFMA 4ZLOA 4U97A 3BU6A 3H3CA 2X4ZA 2YDJA 1WBOA 4EOMA 4I0TA 1BI8A 2PSQA 2J2IB 1G8AA 2X81A 3PE1A 4FYNA 3MVMA 5HHWA 4BGGA 4QRCA 3G6HA 3LCOA 5IDNA 3P08A 4K11A 1BL7A 3EL8A 1REJA 3BQCA 5K4IA 4J8MA 3EQCA 4S31A 4M84A 4L42A 3W33A 3BU5A 3DZQA 3QQGA 2G15A 5I3OA 3COKA 4YTHA 5EQEA 1V0OA 1U5QA 4AQCA 4AG8A 3ANRA 4L3PA 5HE3A 3TKIA 5JFWA 4BCPA 3BU3A 3CJFA 3LCSA 1AQ1A 1ZYDA 3PJ1A 4O22A 3VIDA 3W8LA 4RFZA 2GQSA 3TIYA 2RFDA 1ZMVA 3TTJA 2VV9A 3WIKA 3U55A 1YOMA 3FZRA 4HCVA 2ITYA 4HYSA 5H8GA 3GU4A 2XA4A 4S32A 4EBVA 4HVHA 5AR4A 5AIKA 3PFQA 1HOWA 1UNGA 3SGCA 2B4SB 3IKAA 4G3FA 3KRLA 1H01A 3EN6A 3VJNA 2XEZA 3OS3A 3KGAA 1E1VA 3KXMA 3Q4UA 2WQEA 1YHVA 3ALNA 3Q6UA 2R7BA 4JAIA 2YZLA 3G15A 2J50A 5CSHA 3AGLA 4IAYA 1WAKA 2EVAA 4H1MA 4EOJA 3Q5ZA 2X7FA 3W2PA 1AD5A 1PXJA 4Z55A 5K0XA 5IDPA 3NR9A 3RI1A 3IQ7A 3ZFYA 3MTFA 2BVAA 4XCUA 4QTAA 4PF4A 3R7IA 3RPOA 5LVPA 4G3EA 2W1ZA 2VTQA 3IW6A 3REPA 3I5ZA 4ZZOA 2PVRA 3IG7A 4LMUA 3D5WA 4RMZA 5IQIA 2V55A 3PXKA 2G9XA 4BTMA 5AX3A 1FPUA 3LVPA 4MBJA 4WG4A 2CLXA 2BAQA 3PLAE 1CDKA 5FDXA 5L2SA 4K0YA 1IRKA 1U59A 4F4PA 4G2FA 5ETIA 4AT3A 2PVYA 4IDVA 4BCJA 3W55A 3EQHA 1FINA 2OZOA 1W98A 3V01A 3OWJA 2EWAA 1KUTA 3MJ1A 1DI8A 4V05A 2VZ6A 4JIKA 4NTTA 3PSBA 2EXMA 4JQ7A 2QI8A 4FTCA 4MD9E 5CLPA 5LCKA 2WTKC 4CMUA 3FKOA 2JDSA 3WF6A 2IW9A 1GNGA 2P2HA 3ODYX 4FTUA 1BYGA 5ANKA 5ANJA 2W7XA 3II5A 3NIEA 3ZS5A 2VTMA 3ELJA 5KCVA 4ANNA 3V5WA 3F5PA 4AZSA 5J79A 2BFXA 2R3PA 4F9CA 2DWBA 2X2KA 1M17A 1ATPE 3D7ZA 3VW8A 4BTFA 3O71A 5EI6A 3BHTA 5BYZA 4ZLYA 4O0XA 4J7BA 1KE5A 2YM8A 3QC9A 3CTHA 4E6QA 5M53A 2VU3A 2YAKA 5L6WL 5CVHA 2BDWA 4D2WA 3SDJA 4PMSA 5A4CA 3V6SA 4MBIA 3B8RA 4IEBA 5EDPA 5IG1A 4GK3A 5M07A 3ALOA 2VO3A 4OTDA 3ZZEA 1H4LA 5DHJA 3HL7A 4EC8A 3DJ7A 1CSNA 3N9XA 3VBQA 5CEMA 2YIXA 2UVZA 4G5PA 4R5SA 3R02A 2GCDA 3Q9XA 4F0IA 2XB7A 4B9DA 2FSLX 3UMXA 3RM6A 2XIYA 5IKWA 4UX9A 4BR3A 4LFIA 5HD7A 3SVVA 2GPHA 2GHMA 2W1IA 5DG5A 3ZLYA 1H28A 2FA2A 4CFMA 1BL6A 4QMQA 3CS9A 5CAVA 5KX8A 4CFNA 1HCKA 3F66A 2PMNX 2V7OA 2XS0A 3PSCA 5KNJA 4ANBA 3TUBA 3ZYAA 5C9CA 4L00A 3DKGA 2YACA 3LIJA 2BRGA 2YDKA 2EUFB 2NP8A 3KN5A 4MXXA 3R8PA 3NVMB 2CKEA 5DIAA 5AV1A 4RIXA 3UNJA 1OMWA 2I0HA 3JXWA 4CG9A 3G0FA 3VQHA 4DBNA 5IQDA 3A7IA 5FGKA 4B4LA 5DE2A 2QKWB 2WU7A 4CG8A 4QTEA 3SRVA 3PSDA 5EYMA 5HO6A 2W4OA 2PUNA 2JGZA 5L3AA 5LVOA 2YM4A 4F64A 4BTKA 3R73A 5IUHA 3D4QA 5CQUA 3FQHA 3ROCA 5E1SA 3SV0A 4RIWB 4C7TA 3UQFA 3QCQA 3LCDA 4NYEA 4FKUA 4FUYA 2OK1A 1OB3A 5EQPA 1TQPA 5BYYA 2X7OA 4CT2A 5IA0A 1Q8TA 1H00A 3PG3A 3SKCA 3HMIA 2WD1A 3P4KA 3QLFA 4KKEA 5C27A 4RRVA 3PJ8A 3LKMA 5HQ0A 2OF4A 4MWIA 4DEDA 5E8VA 2QU6A 1YDRE 2ETKA 3QU0A 5J87A 3A60A 5JQ5A 5JFSA 4DLJA 4PNIA 4ENYA 1JBPE 5EI8A 2KULA 4WA9A 2VWVA 5DNRA 4I0SA 1OPKA 2VD5A 4HGSA 4XX9A 1R0PA 1KE9A 1WMKA 2RG6A 5JZJA 4MF1A 3QHWA 4RZVA 2OJFE 2IPXA 3JUHA 4X7QA 3OVVA 3VUHA 2XRUA 4GSBA 4F9BA 5L8JA 1UWJA 2C6KA 3IW7A 2JDRA 2XM8A 2W1CA 4NM5A 4YJOA 3KA0A 4C3PA 3Q9WA 3OBJA 2VTLA 4I93A 4JBVA 5CWZA 3VS7A 5HNIX 3AMAA 3EHAA 1U54B 3IDBA 3MPAA 4GL9A 3VHEA 4UMPA 5EKNA 4XS2A 2WTKB 3ULZA 5A54A 5IH5A 2V7AA 4LRJA 1QCFA 3PZEA 3IDCA 2R9SA 4QYFA 2P3GX 3W16A 4YMJA 5A4QA 1OECA 2ACXA 2YN8A 3ZM4A 3ORMA 3LJ1A 4K6ZA 4RT7A 3HA6A 3FSKA 1YXSA 1ZAOA 3DFCB 4YHFA 3N4UA 5CU6A 4Q5EA 4FTIA 5LMAA 4EYJA 4U5JA 1JSVA 4YPDA 5FDPA 4W8DA 4K18A 4MXOA 3AD5A 4RFYA 4NKAA 4K33A 2REIA 3QQUA 4PPBA 2GHLA 2J5FA 4IWOA 3VN9A 4IX4A 5EW9A 2GNLA 2CNVA 4FGRA 4BDIA 2OJGA 3CKWA 3SXSA 3Q04A 2UVXA 4RVLA 4ZTNA 3UYSA 3AOXA 4O82A 4AF3A 3PPZA 4TWNA 1KSWA 2ONLA 4BWXA 5J5SA 3OOGA 5GINE 5D41A 4G16A 3KRRA 3DA6A 3QTWA 2IVTA 4FSUA 1KOBA 2QLQA 4NT4A 4W9XA 4C38A 4TWPA 4I4FA 4XG7A 4F70A 2I7QA 2VGOA 4CYIA 5IH6A 1LPUA 2YM7A 2HW7A 3ZEWA 2OH4A 1I44A 3HV5A 3GCUA 1PW2A 2R3QA 3FMKA 4DFUA 1W83A 3CY2A 2CLQA 2R3RA 2BZHB 3PE2A 4C35A 3KC3A 4O0UA 4RLLA 3Q4CA 3TNWA 4R7BA 2CN5A 2XCKA 3FMJA 2Z60A 1H1PA 3I6WA 4QYGA 4N6YA 5B0XA 3SXFA 2QG7A 3JYAA 4YHTA 4BCNA 4E8AA 4FEQA 3UPZA 3E88A 2V0DA 1YDTE 4JXFA 3Q9YA 5DOSA 3QUPA 2PYWA 2X4FA 4H3BA 3EQGA 3BBWA 4XV9A 2XUUA 4A4OA 4WG3A 5HG5A 4ALWA 5FUTA 3ORZA 2ZOQA 4E20A 2IZUA 1P2AA 3WARA 3GU8A 3QRJA 3GCVA 3PY1A 4A4XA 1Z5MA 1OI9A 3C51A 3PRIA 4LRKA 2WTJA 1ZOEA 5I3RA 1OPJA 2UW5A 3NGAA 4IAIA 3UZRA 1T46A 3ZONA 2QURA 3PWDA 5C8MA 4I41A 2ZAZA 3FHRA 3ORPA 4M13A 5EW3A 3LFFA 3NYXA 1KWPA 3EN9A 3CXWA 4IM2A 3W2CA 2O64A 3C0IA 2CCIA 3F9NA 2JBOA 4ZK5A 2F57A 1KE7A 4L6QA 3MY0A 4RJ8A 5AUTA 2OXDA 5CI6A 2B9HA 2E9PA 4I1ZA 5CQWA 3QL8A 3D83A 5M06A 2WTWA 2JFLA 3GP0A 3M42A 4PDSA 4PPCA 3WYYA 3BE2A 1OKYA 2OJIA 4ACMA 4KIQA 4FIJA 3GFWA 4CRSA 4L43A 4O1PA 4DEHA 4DGNA 3ITZA 4EHVA 4EZ3A 5A4EA 2YCFA 4BDDA 3ZRKA 1UU8A 3D5XA 4I94A 3RPYA 4MXZA 1Q8UA 5LWNA 4QP2A 5AR5A 3COMA 3ZXZA 3UYTA 3TIZA 3OWLA 3QGYA 1RDQE 1W0XC 3G5DA 2YIWA 3NYOA 3PYYA 4YJPA 5M4UA 3W18A 4G9RA 3G90X 2C0TA 2WTCA 3R04A 3QYZA 3UZPA 3NAYA 3QYWA 2QVSE 1KE6A 1OM1A 4J98A 3BKBA 4FEVA 3LXLA 2XH5A 2O2UA 2XBJA 3AMBA 3O2MA 2UZLA 4BTJA 3OW3A 5CVGA 3NUPA 2IO6A 3D94A 5A46A 1B6CB 3R6XA 5EDRA 4K77A 4XBUA 3UIBA 4O7ZA 4RBLA 4QQ5A 3PY3A 4DFBA 4FOCA 3EMGA 4DFNA 3HEGA 2NNWB 4AWIA 1ZZLA 4FKIA 4DT8A 3PA3A 5FEDA 3P1AA 3GUBA 3OCGA 5M56A 5HLNA 3GXLA 1XH6A 3QKKA 4JG8A 4RX7A 3GCQA 3JR1A 4USFA 2AYPA 3QD4A 4S30A 2IG7A 3CIKA 3FPMA 5IA1A 4FNWA 4BDEA 4H3PA 3VF8A 4TW9A 5CF8A 5KO1A 4LV8A 3TNIA 2HXLA 3LPBA 5CF4A 4BN1A 4RZWA 4D0XA 2B7AA 2O0UA 4GIIA 4Y5QA 5BYLA 4ALUA 4E6AA 2FO0A 2X9EA 1PY5A 4ID7A 4XHKB 3OCBA 5JRSA 4PTCA 4YNEA 5GJFA 3FE3A 3U87A 4V01A 2V22A 5KMIA 3HMNA 2W1EA 3R8LA 3SQQA 3QFVA 3S00A 2BIKB 1YXTA 2WU6A 3DNEA 3VBXA 3VBVA 3ZC5A 4RLKA 4C61A 3MPMA 2HELA 4FV5A 3DK3A 4BGHA 1M2RA 3BBTB 2R3HA 1H1WA 4EJ7A 3GU7A 4WKQA 2ZDUA 2EB2A 2BDFA 2UZUE 3IS5A 4D4RA 1YI6A 3QWJA 3P78A 3OXZA 4XLVA 4LOOA 2F7ZE 4A07A 4D0WA 5J1WA 3DXPA 2YDIA 3OY3A 1ZARA 4ANSA 2UZEA 3PY0A 3FUPA 4BKYA 3LFDA 4DITA 2XKEA 3TDVA 3DJ6A 5H9BA 3TJDA 5LVNA 4YJSA 4KBKA 4FIIA 4O7TA 5C03A 3I0OA 3HDMA 3KULA 3KL8A 3OEFX 2DUVA 4F99A 3N51A 2GS7A 1A9UA 4M15A 4L9IA 3SA0A 3QQLA 4I6FA 2Y0AA 4BCMA 2XP2A 4QMXA 1OL6A 4EBWA 4IBMA 5IISA 2GSFA 3B8QA 1Y8GA 2UW4A 4GFGA 4TN6A 2A2AA 2WMUA 4MD7E 4YZNA 1GZOA 4RSSA 4ZSJA 3R8ZA 1ERKA 4R3RA 4RIWA 2AUHA 5KMJA 4AP7A 3QUEA 4XP2A 5BMSA 4H39A 2PE0A 3BIZA 4PV0A 4AGUA 2BRHA 1EH4A 2XNOA 1ZY5A 3MA3A 4DINA 1APME 4HVGA 5A6NA 1O6KA 4JVGA 4P5QA 1WFCA 2O8YA 3F5UA 3RNIA 3OUKA 3U9CA 3EQBA 4I4EA 3UQGA 4FKRA 5CALA 4BI0A 3QCYA 4EOIA 2Y4IB 5DGZA 3QD0A 3QTSA 5EH0A 4ZEGA 1ZYJA 4TYHA 4BF2A 4TYIA 4FYOA 5DEYA 3THBA 3LJ2A 2BFYA 3BGPA 1J7UA 1JWHA 5EHOA 4QQJA 5CT7A 3O8UA 2PMLX 3FZOA 2UZOA 4MYGA 4D1ZA 1PRYA 4ANMA 4O7SA 4R3PA 1MP8A 2YIQA 1Q61A 4YJRA 2G01A 3NEWA 4FICA 4EK8A 2UZVA 4ERKA 5AA9A 1SNUA 3BEAA 4MXCA 5IA2A 4EORA 3UP2A 1WBSA 2VTTA 3F7WA 3RAHA 4FTOA 3ZDIA 1U54A 3AGMA 1PF8A 4E3CA 4XP3A 1F5QA 5BX0A 4JLCA 2J9MA 4BCOA 2EB3A 3PVGA 5AAGA 4BZDA 3SW7A 3KMUA 3M2WA 2IN6A 4QMLA 4N57A 4EH7A 3C9WA 3SX9A 1ZWSA 5LXMA 3KU2A 3BLRA 2YM6A 3C0HA 5L8KA 5HNBA 3DLZA 4IX3A 1PYEA 3UO6A 1UA2A 2PHKA 4FL2A 5C1QB 3LMHA 4RJ5A 1VYWA 4WBBB 3VRYA 3IGGA 3WF5A 3QZFA 3BWFA 1VJYA 3HP2A 3SHEA 5GJGA 4R7HA 2GFSA 4MXAA 4E7WA 2E9UA 2Z7QA 4UALA 1TKIA 2XRWA 3MH0A 3NUXA 4QP3A 4F6UA 5AM7A 4F08A 4IB0A 1WZYA 1H1SA 1XH5A 2FSTX 3VBTA 2OH0E 3WI6A 5ANGA 2XNBA 2VN9A 3V5PA 3ZLXA 4IQ6A 3ACKA 3K54A 3RM7A 2X8IA 3ZXTA 3K5UA 3R71A 4DC2A 2PVMA 5AUWA 4U6RA 2DQ7X 4EHGA 3VC4A 1A48A 1URCA 3VWAA 3BEGA 3VS4A 2ZYBA 3E92A 4OBPA 5HCYA 3MA6A 3KQ7A 4APCA 4EK4A 1SZMA 4C3RA 2BALA 1M7QA 4BWPA 2B53A 3EQDA 3RWQA 4WHZA 3UP7A 3W8QA 3IGOA 2I0EA 4G6OA 4IB5A 3D2IA 1PXPA 1NA7A 3H9OA 3DK6A 5ETAA 3DBFA 2PPQA 4FV1A 4AA4A 2J0JA 3PG1A 4FL1A 3ZBFA 3ANQA 2UW6A 4GG5A 4WRGA 3HYHA 1P5EA 3PPKA 1QL6A 3FXXA 3PIYA 3VAPA 3IW5A 2JC6A 2Y6MA 3GC7A 1F0QA 1QPEA 5HESA 2YCQA 4PDPA 5CZIA 5AR8A 1XH7A 4GVJA 3R9RA 3E64A 3BE9A 2UZTA 4IDTA 3CCNA 2J0MB 2J0IA 3EJ1A 3KEXA 4AOIA 5I9YA 1VR2A 3VS0A 3AT3A 5HOAA 2B9IA 4IX5A 4K2RA 4BBFA 2VTIA 1NW1A 2PULA 2YJRA 3RPVA 5LVMA 2RSVA 4QP9A 1JOWB 4HVSA 2IWIA 3V51A 4FF8A 4A06A 3ID6C 3FXZA 4RQKA 3F88A 4DFXE 5CF6A 2CKPA 2NPQA 2WOUA 3CE3A 3NNXA 3VS2A 4PWNA 1YVJA 2WB8A 4YLLA 4ACDA 4QP6A 3AG9A 3DJ5A 1NVRA 1FQ1B 3DXQA 5TF9A 3U6IA 3R1SA 4RIYA 4QMSA 3ZO4A 4DEIA 4YTFA 4G9CA 3A62A 4KSQA 4DEEA 5DA3A 3GNIB 3O50A 4A9RA 3VS5A 4M0ZA 2YEXA 4N0SA 5M4CA 1GIJA 4RA5A 4EOPA 3KXGA 5E8YA 2WQMA 5CNOA 4AE9A 4O6LA 2Y9QA 2ZV7A 4ZSGA 5EM6A 2UW7A 4ASXA 4FODA 3LAUA 3EQRA 2C4GA 3KK9A 3HV7A 3L8SA 4FG9A 4FT3A 4BBMA 2WTVA 4BICA 1M7NA 2YWVA 3AMYA 2ITPA 5HLWA 3FV8A 2O65A 2ZMDA 3UOHA 3QQKA 4FEXA 3PVBA 5IA3A 3NNWA 2W0JA 4E1ZA 4DGLC 1ZYLA 4BI2A 1PKDA 5HTBA 1OBGA 4FL3A 4FV0A 4G3DA 2OIDA 1M2QA 5G6VA 3LQ8A 3DCVA 4FK6A 1PJKA 4YNOA 4DFYA 5EG3A 3WF9A 3MW1A 3CBLA 4K8AA 4G34A 4FSWA 2C68A 4GCJA 1MQ4A 3IPHA 3COHA 4IZAA 2CGWA 2CGUA 4CFVA 1CTPE 5HBHA 3QX2A 4JAJA 1YWVA 2OFUA 1Z57A 3ORNA 4FKPA 3FEGA 2BAJA 5H2UA 5DN3A 5I9UA 2C6TA 1V1KA 1XH9A 4PUZA 4X6QC 3FBVA 1F3MC 1P4OA 3EQIA 4EWQA 2BILB 3WBLA 2P55A 3WZUA 3EIDA 5KHXA 4PL3A 4LM5A 4X2GA 2QOLA 2JIUA 1QPCA 4J95A 4DFLA 3PIXA 2JBPA 5JN2A 3F61A 1PXNA 2P2IA 5AP2A 5TT7A 3TWJA 3TTIA 2VWIA 2B52A 2H9VA 5AV3A 4DCAA 3MH1A 1NY3A 2BPMA 1O6LA 2C3KA 4AA5A 5M44A 3R2YA 3BV3A 4O83A 1DS5A 3EFKA 1MQBA 3FAAA 3P86A 4X3FC 4FV6A 3S4QA 3WZEA 4I24A 3P5KA 3DK7A 3F82A 5H3QA 4O6EA 3FZSA 2W1GA 1DI9A 2HIWA 4P90A 2UW0A 4BIBA 1CMKE 4ONAA 4BFMA 1V0PA 4TYGA 3WE8A 4QMNA 4YZCA 4KD1A 2PZYA 5AX9A 5CENA 2ERZE 4M66A 4YBJA 3L1SA 4D2PA 4UWYA 2XZSA 3OOMA 1YOLA 1R0EA 4FZFB 4QNAA 5L4QA 2XNEA 1FVTA 1PXMA 2BMCA 4JI9A 4N70A 3V5JA 2O63A 3E7OA 1S9JA 2JKMA 3DTCA 3G6GA 3RP9A 5F20A 4AU8A 2OFVA 2J6MA 4UEUA 5FP5A 3CPBA 2QR8A 2BRMA 3RAKA 3UIXA 4DH5A 4EH6A 4JX3A 4JT3A 3FY0A 5DVRA 3EFJA 1OIYA 4YURA 3KCFA 4UYNA 5AAEA 5BUJA 5A9UA 5EM7A 5CEQA 5BUEA 4FEUA 1FMKA 2BZJA 3UQCA 3O7LD 4IAKA 5ACKA 1W8CA 4QTDA 5J7BA 4EJNA 4FNXA 4D5HA 4M67A 2UZBA 1Q41A 3RHKA 1YQJA 3DT1A 1GZ8A 2HCKA 4CCUA 1IEPA 4E4NA 5DR6A 3QGWA 4PL5A 2JKOA 5F9EA 4RA4A 5IPJA 1IA8A 3W10A 4BDKA 4UZHA 1B39A 3FLYA 4WRSA 2IW6A 3ET7A 3FMDA 4I6BA 4EQCA 1VYZA 4PQNA 3V5QA 4H58A 3ZTXA 3VNTA 4EEVA 5JH6A 3W2QA 4FKTA 4U45A 4ZTSA 5LMBA 3IW4A 3RZBA 4C0TA 3SOAA 3NMUF 2YJSA 2P4IA 5EYKA 2J0KA 2XEYA 4YP8A 3LLTA 4IWQA 2ZB0A 4L7FA 3TN8A 4YU2A 3R7UA 4ZSAA 4ZY5A 2A1AB 2W96B 2CNQA 4RG0A 2C0OA 3ZO2A 4HVIA 2VTRA 3QHRA 2ERKA 3MB7A 4JDJA 4O7VA 4IHPA 1FGIA 4BDAA 4QMMA 1P14A 3KXHA 5JZNA 3Q9ZA 4QMWA 4ZZMA 4CLJA 4Q9SA 4XV3A 1YXUA 3LFSA 4GFOA 5CU4A 4P2KA 4NTSA 3Q3BA 3B2TA 3BYUA 3LXKA 3O8PA 4UZDA 4GV1A 5EDQA 5LQFA 3MVHA 4OBOA 5CANA 3R30A 5CSWA 2PE1A 2PZIA 2RF9A 2XK8A 2GFCA 2CCHA 4J97A 3OWPA 3ORTA 4U3YA 4YPSA 5EI2A 2G2HA 3ZH8A 5AP7A 4CZYB 2IVVA 3UOLA 1ZLTA 4F1MA 4EOLA 4Z16A 4FX3A 4ZS0A 4J96A 2E9VA 3CSVA 4ORKA 3BZ3A 3LFQA 2A4LA 3FYJX 4EKKA 5CU0A 4EOQA 1J91A 4O0YA 4BBEA 4WT6A 2RFNA 4X2JA 2ITZA 4CLIA 4IAFA 4QPAA 4C4EA 1YXVA 2I0VA 4X3FB 5CAUA 3UIUA 3HAVA 5DEWA 2GMXA 3QAME 5IQEA 4O1OA 4WIHA 5AUZA 2W4JA 4AW5A 1RE8A 3KULB 3ZOSA 1SMHA 3S2PA 1RJBA 1XR1A 2YISA 3WOWA 2JDTA 1ZRZA 5AWMA 1SNXA 3A8WA 3NYNA 3ENMA 4FR4A 3DY7A 1E1XA 5CS6A 4ZP5A 4GYIA 5HE2A 4BDBA 2CPKE 4PDOA 4W4XA 4IZYA 2ESMA 3ODZX 3O96A 1UWHA 4D9TA 4UMUA 1M2PA 5EW8A 1CKJA 2XMYA 4C4GA 5E90A 3HVCA 2X8DA 4HZRA 5BQ0A 4EONA 3RBWA 5A4LA 4DBXA 2R3IA 2C3LA 2YIYA 3CC6A 3OEZA 3MVLA 4YC6A 4AN2A 2GHGA 4G6LA 4QQCA 3R63A 4DN5A 5JKGA 4W9WA 3QZGA 5AR7A 2QG5A 3I60A 1GZKA 5ANOA 3SG9A 4NUSA 5C8KA 4C8BA 4DLIA 4NEUA 4C4FA 4FV8A 5HG8A 3CY3A 3UVQA 2Q0BA 3IOKA 4I23A 2WIHA 4IAZA 2PY3A 4TYHB 4ZTQA 3UO4A 3R7EA 1QPDA 4IB3A 3Q6WA 1FBNA 4TNBA 4AOJA 1B38A 3CGFA 3WZDA 3UC4A 2Q83A 1H8FA 4I3ZA 3UTOA 4QPMA 2ITNA 3IDPA 4AZTA 4HYUA 3UOJA 5IQGA 3I0QA 4W8EA 3I4BA 1K2PA 3I81A 4CV8A 1PXIA 4FT7A 5M08A 3PXYA 4RGJA 4EYMA 4RVTA 2XJ0A 4FSZA 4D1SA 2XYUA 4IFGA 4TTHB 5IUGA 1FGKA 4BDGA 2JDOA 4Q9ZA 4RWIA 4JDHA 1W84A 5CASA 5E8SA 4ACGA 4J52A 3GEQA 2CHLA 4KNBA 5D7VA 4IANA 4UMTA 4CKRA 1LR4A 2Y4PA 4II5A 4O0SA 1MRYA 2VTSA 4JIAA 4NK9A 4LRMA 5HO8A 2A27A 4DTKA 5HO7A 1RQQA 4GKHA 3L9MA 4WNPA 3EQFA 4MK0A 3ZEPA 1Q3DA 3K5VA 3CLYA 2VO6A 3NLBA 4TZRA 5CVFA 5DFPA 1GOLA 3LOKA 4FTQA 4F63A 5K4JA 5BVKA 3GB2A 1UU7A 3BYVA 4PMPA 2E9OA 3NUYA 2BHEA 3FMHA 1SYKA 5DT3A 4BHZA 1U46A 5L6OA 2Y8OA 3FSFA 4BGQA 4AS0A 4PP7A 2GQRA 3LQ5A 4XRLA 3CPCA 3RZFA 4CFWA 1NXKA 2ZVAA 3COIA 4RVMA 3T9IA 3HMPA 1IAHA 5E8WA 4RQVA 4CFFA 4IJPA 3MVJA 4Q5HA 5BVEA 2WXVA 5HE0A 1FOTA 2GNFA 3I79A 3JPVA 2I0YA 5CAQA 4O96A 5IZFA 3HV6A 3PXFA 4YZ9A 3EKKA 3UGCA 4FKSA 2Y6OA 4QP7A 3QF9A 2W17A 4L67A 5J9YA 2QD9A 4C34A 3S0OA 4LI5A 4XOYA 5EK7A 2C1BA 5FTOA 5J8IA 4JDIA 5J5TA 2H6DA 2R7IA 3DBCA 1SM2A 2C69A 2CKOA 1OGUA 3POOA 5AP6A 3UVPA 4C62A 4GJ2A 5IA5A 4ACHA 4R1YA 1XJDA 4XJ0A 2VNYA 3W1FA 5GZ9A 2VNWA 1P4FA 2C6IA 3E3BX 3W2OA 2YM3A 5D11A 4HYHA 4RWKA 3D14A 3OY1A 3AC3A 3QRKA 5HEZA 4N6ZA 1YWNA 3ENHA 4RWLA 4JNWA 4S2ZA 2XKCA 4CVAA 3JY0A 1HCLA 4F6SA 4EOOA 4BWKA 2VRXA 3GU5A 3V5TA 2IJMA 4WNKA 4EHEA 2WQOA 3DKCA 3FQSA 5AIRA 1H1QA 4GK4A 5E91A 3EFLA 4MQ1A 3CGOA 2WKMA 4E73A 4AW1A 5EYCA 4OT5A 1UU3A 1YI4A 5KZ0A 1YDSE 5AM6A 3WYXA 1M14A 2ITUA 2VWYA 4JL9A 4S33A 2PVKA 4RJ3A 3TKHA 4DGMA 5IF1A 4XNEA 4PP9A 4XG4A 3QCSA 5M55A 2GQGA 4PX6A 3L8PA 4RIYB 5CNNA 2WQBA 5HI2A 4C37A 3SXRA 4KUJA 4ASEA 3KXXA 3HV3A 4IZ5A 4BCFA 4DCEA 3Q5IA 3ORXA 4TXCA 1REKA 4HNFA 3TJCA 1YW2A 4C33A 5B2LA 1PMVA 4WO5A 3DB6A 3NUUA 2XK7A 4X6RA 4QMUA 5LMKC 3FDNA 2OG8A 1XBAA 2WTDA 3QCXA 3DLSA 2C6MA 5CT0A 3MBLA 3NZ0A 4JG7A 5CSPA 3R9OA 5AP5A 1IASA 2QO7A 4DG2E 4CGAA 4AGDA 2BTSA 4JR7A 3V04A 1Q99A 2R3JA 5F95A 3PXRA 4FIHA 3UMWA 3ZMMA 5CF5A 2NO3A 4NM7A 3BYOA 4M7IA
chains in the Genus database with same CATH superfamily
2QLUA 2X2MA 2WGJA 2BZIB 3EKNA 3QWKA 5DR2A 4BYIA 2FSMX 5JEBA 1GAGA 3QQHA 5FEQA 3DTWA 4MX9A 4IB1A 4QTCA 2XNPA 3R0TA 4IW0A 3C1XA 4KKGA 1JKKA 3WF7A 3MDYA 4ZAUA 3EN4A 2B55A 4FT5A 3ZUVA 5AUUA 4KKHA 3F3TA 4MXYA 4CEGA 4MEDA 2LAVA 4OTFA 2DS1A 3GFEA 4G17A 4I92A 2OI4X 2WFYA 3AT4A 4M69B 2BRBA 1IAJA 4Y95A 4A7CA 4KWPA 3AC5A 4P7EA 2YWPA 2HZ0A 4EH2A 4LV7A 3C13A 4FVPA 3PP1A 5I0BA 2WOTA 4HYIA 1QPJA 3BCEA 1NT2A 2XNNA 5AP3A 4GUEA 3V8TA 3OMVA 1YWRA 4JRVA 3TYKA 3L9LA 5HICA 2X9FA 1OKWA 3PWYA 4I22A 4IMYA 3Q2MA 3VULA 5JT2A 4U0IA 4D2TA 2V62A 3D0EA 4YZMA 3ZUTA 4QPSA 3CD8A 2WTIA 4QYEA 1U5RA 1CM8A 2WO6A 4RVKA 4TYJA 3SLSA 4DHFA 3ETAA 4U79A 1XQZA 3FI4A 5HVYA 5EFQA 4AGWA 4H1JA 1WBWA 3QX4A 4FV2A 3ZFMA 3EFWA 5L2TA 5HVJA 3HDNA 4FV3A 2RIOA 3VRZA 4X3FA 4ZSLA 5IQAA 3FWQA 4FTNA 4QMZA 2FYSA 3OCSA 4GK2A 4Y73A 3HRBA 1X8BA 2C5NA 4FNYA 2VWWA 3B2WA 5EOLA 1M52A 4JDKA 4BDCA 3TCPA 3QKLA 4EOSA 3C7QA 3UE4A 4V0GB 4XMOA 4AOTA 3MFTA 4TL0A 4F65A 2WMAA 3O0GA 3OXIA 2W05A 5E7RA 3Q53A 5CTPA 2BIYA 2VGPA 4QNYA 3BGZA 3TMOA 2CGXA 4FSYA 1ND4A 2ZM3A 3D7TB 1IR3A 3RHXA 4O7RA 5JSMA 1JVPP 5DI1A 3QA8A 4EQUA 5CU3A 2QOCA 2B9FA 3PTGA 4O0VA 4A4LA 3TEIA 2OXYA 3LFAA 4D4VA 4FKWA 3AC2A 1SVEA 5BNJA 4DDIA 4O81A 1GJOA 3KCKA 4HGTA 2GNGA 4IFCA 3UC3A 1JNKA 3VONA 4FK3A 3PXQA 4F6WA 3GC0A 2J4ZA 4HOKA 5CI7A 2JAMA 4HCTA 4NH1A 4RX9A 5DBXA 5I4NA 5KMMA 3Q96A 3MFUA 3PZHA 3RTPA 1ST4A 3H10A 4KABA 2SRCA 3KVWA 4NJDA 4PRJA 3UOKA 3WZJA 5E8UA 1G8SA 3FQEA 3NS9A 3R00A 4Y85A 3IONA 4UV0A 3ZZWA 2B1PA 2UVYA 5DPVA 4B8MA 4HZSA 4RIOA 3UNKA 4GT3A 2BDJA 4HJOA 2QOBA 2VWXA 5KE0A 3UZTA 3PDTA 4JR3A 3GC9A 3P79A 3OTUA 4IC7A 4MVFA 3GCPA 3NCGA 2OW3A 4U40A 4KSPA 4CQEA 4D5KA 3P23A 3PVWA 4IE9A 4GEOA 5GHVA 5CEIA 4FZ6A 3DS6A 4BDJA 3LMIA 4O7YA 3DDPA 3GBZA 5GIPE 4Z3VA 2PMOX 2RFEA 4IVCA 2WNTA 2GU8A 2W1HA 2C5OA 3AQVA 3G9LX 5HZNA 2P33A 1W82A 4DDGA 2FH9A 2YHVA 3L8VA 1PHKA 1KOAA 3BLHA 1WVWA 2FB8A 4YR8A 2J51A 4YJVA 1FVVA 3ZSIA 2R3OA 5J9LA 5J1VA 2PMIA 4FIGA 2WMWA 2OXXA 1ZZ2A 3BYSA 4I5CA 3LFNA 5FM3A 3V3VA 3C4EA 5FTQA 3U54A 3EN7A 3VJOA 2PK9A 4EH9A 3MY1A 2C1AA 5IEVA 3FJQE 2HWPA 1OL7A 4M3QA 4BZOA 5FWKK 3FPQA 5BMMA 5JMSA 2VTHA 2YERA 4QMTA 3W2RA 4AXDA 4RPVA 4BDFA 2YITA 3C50A 2ITTA 5EHLA 5D10A 4PMMA 5HLPA 1XMMA 4O0RA 4QQTA 4M8TA 4PMTA 4CQGA 4KB8A 5F94A 1NVSA 4IVBA 3QA0A 5AMNA 5FBNC 4TWCA 5CSVA 1STCE 3GOPA 4XEYA 2PTKA 3N4TA 3QD3A 4XLIA 5BVFA 1UNLA 2C30A 4MD8E 2OU7A 4E6CA 1OKZA 4C59A 4QTBA 2BZKB 3H0YA 3ZC6A 4BIEA 2PVFA 3O17A 2I6LA 3VUIA 3MIAA 3NYVA 4CSVA 5AA8A 1KV1A 1WBVA 2XBAA 4L8MA 3R8VA 5M4IA 4LMNA 3UDZA 2VAGA 4JBQA 4EL9A 4EUUA 3DB8A 3OCTA 1LP4A 5M09A 4MNFA 3DKOA 3HZTA 2W1FA 2EU9A 2HZNA 2QQ7A 2W06A 3HRFA 5CYIA 4AW2A 3R7VA 3FC1X 2WMRA 5DYJA 3EQPA 5HNGA 4C4HA 1PXLA 4EOKA 2W9ZB 5M57A 3OZ6A 3FMEA 1XHAA 3G33A 5A6OA 4DEBA 2A0CX 4OTWA 4P4CA 3U6HA 3LXNA 4O86A 2F4JA 4ZSEA 3E87A 4GT4A 4DGGA 2WMXA 3MB6A 2VWZA 5B2MA 4GJ3A 3DQXA 1PYXA 4G1WA 5IQHA 4EZ7A 3CQWA 3CTJA 2R3FA 4ANOA 4R1VA 3NW6A 3OBGA 4ANQA 1XBBA 3BX5A 2XM9A 3MSSA 4Y5HA 5DR9A 4F9WA 3QBNA 2C5VA 4Z7GA 2QOHA 3MI9A 4BRXA 3C5IA 2J5EA 3QKMA 2VUWA 2X0PA 3VS6A 1H25A 2F9GA 4XP0A 3U4UA 4DG3E 3UDBA 4OAUC 3I5NA 4UB7A 4CTBA 2YIRA 3DU8A 2WELA 4QP8A 4APPA 4YZDA 1IG1A 1URWA 2XJ2A 4G31A 1R1WA 4NIFB 5J95A 2JD5A 4OLIA 1Z9XA 2B0QA 3OC1A 2Q0NA 3UNZA 2IW8A 2QOQA 4U81A 1TQIA 4MF0A 1OPLA 2QHNA 5HKMA 3BRBA 4U42A 2QNJA 3FZTA 4U8ZA 3G2FA 4LUEA 4BCQA 3HV4A 3T9TA 4H05A 2R3KA 4UYAA 3DAKA 4J1RA 3KVXA 3C4FA 2OIQA 4DEGA 5C8NA 5KMKA 1W7HA 3BELA 3ZRLA 2HYYA 3TM0A 2XNGA 4Y83A 4MKCA 3E63A 1LEZA 1Y8YA 2W5HA 2WMVA 2QHMA 2R0UA 2UW9A 3QTXA 5T68A 2YABA 3ZU7A 3Q60A 2NRYA 4M97A 1OBDA 4YO6A 4R7IA 3R8MA 2JLDA 3R7YA 2PZ5A 3FLSA 2HK5A 4F1OA 1PXKA 2X7GA 3OHTA 3KMWA 4FTRA 1WVXA 2FGIA 4LOQA 4PPAA 4ZMEA 4FV4A 1ZOHA 4LQMA 3TUCA 3KREA 3MGYA 3S1HA 3OP5A 4M69A 4FKQA 5HU3A 3AKKA 3H0ZA 3TZ7A 3AKJA 3OT3A 2XAMA 1PKGA 4GIHA 4JJRA 5FEEA 2GTMA 3MTLA 4DT9A 3FLQA 5LARA 2Z7LA 4FE2A 3F3ZA 4ASZA 4IADA 4Y8DA 3ZSHA 3QTUA 3NNVA 4LG4A 4CZUA 5HU9A 3EN5A 4IVAA 5EOBA 3WILA 4JQEA 1H0VA 3UG1A 4ZS4A 2O3PA 1LEWA 4FG7A 4FT0A 3O5AA 4WOVA 4PNKA 3PRFA 4KINA 4LV5A 3NWWA 4DEAA 2R3GA 3ACJA 3ZDUA 4D1XA 5AEPA 4ZJJA 5T6KA 4BIDA 4EWHA 3GVUA 3NNUA 5HGIA 3ZLWA 3W0MA 3FKNA 5K5NA 1UKIA 4GU9A 2WMQA 2C3IB 3KN6A 3LCKA 5FP6A 5EKOA 4ZZNA 4HGEA 2R5TA 4O4EA 4XRJA 3DAEA 4BZNA 2ITXA 4X2FA 2XNMA 4NU1A 4D55A 3TDWA 4BKZA 4EK5A 2PUIA 3VF9A 5JK3A 5IU2A 2ZV2A 4I0RA 4WUNA 4YZBA 3DPKA 1DAYA 1GY3A 4YO4A 4KRDA 1BMKA 3BYMA 3G0EA 2XF0A 5AP0A 3RALA 4BDHA 4QOXA 4JS8A 5FBOA 5TE0A 4I5HA 4UY9A 4E5BA 4CKJA 5ITAA 3H9RA 3CQEA 4E4MA 5F1ZA 3WF8A 2VX0A 5AJQA 3V8WA 4DH8A 5CAPA 4OW8A 3QD2B 4V0GA 5HG7A 5TR6A 2XJ1A 4Y46A 3ROYA 4J8NA 4CT1A 4LYNA 2IZSA 3GQIA 2XKFA 4FBXA 3NRMA 1SVGA 2F7XE 3WIGA 4CFXA 3FYKX 3I6UA 3A4PA 3R9NA 4B7TA 4A9SA 2ZJWA 4R6VA 3D7TA 4H3QA 4I5MA 4DE4A 2YFXA 4PTGA 4BVUA 3W0QA 4XH6A 3ZM9A 4ZMFA 2O5KA 5CXZA 3MYGA 4ZY6A 1PMNA 4QYYA 3FL5A 5I9WA 3TV6A 2Z7SA 2ETRA 3BI6A 3UVRA 4O4FA 3SC1A 2Y7JA 2PVLA 5GJDA 3T8OA 3TG1A 3SOCA 4FOBA 4X2NA 3RINA 5EQYA 3JS2A 3D5UA 4EZ5A 3JY9A 3EZRA 4NW6A 4BCHA 1H07A 3QQFA 3FZ1A 5LMKA 4ZIMA 1U4DA 4ZXTA 2OZAB 3UIMA 5HX8A 4DHIB 2ZM4A 4FKVA 5E8ZA 4B8LA 4MWHA 1WBPA 2Z2WA 3LMGA 4HPTE 3L9PA 5AR3A 4D2SA 4KIKB 3GT8A 4NJ3A 4EK6A 2HWOA 2ITOA 4JOAA 2W1DA 3D2KA 4W4VA 4FSMA 4I20A 4XYFA 3LM5A 3O7LB 4I21A 4C4JA 5CZHA 4C58A 2R64A 2R3MA 2JIVA 4EHZA 4ZTHA 5A14A 3CR0A 1G8JA 4A9TA 3KXZA 3IO7A 4GU6A 4OR5A 4WBOA 4L68A 4I6HA 4BB4A 3FHIA 4XG3A 3HNGA 4GKIA 5IQFA 3KKVA 3BPRA 1Y57A 5AV0A 4C3FA 3ORKA 2X39A 4M12A 4B0GA 3BGQA 5IQCA 1JKLA 4YLJA 4WNMA 1RW8A 5HE1A 4X0MA 1G3NA 1Q4LA 3MJ2A 2UZNA 2OGVA 2VTAA 4L45A 4IC8A 4CXAA 3TXOA 3DXNA 4YJUA 5AP4A 3TZMA 5EHYA 2WEIA 5BVWA 4IWDA 2BROA 5D9HA 2HW6A 5ACBC 3ERKA 2C6LA 3UJGA 4AA0A 4JBOA 4IH8A 2HXQA 4IAAA 3FC2A 3CJGA 2UZWE 4EH3A 3U9NA 3RAWA 3MFSA 2V5QA 3MS9A 5BVOA 4OT6A 4E4XA 1OIUA 4XBRA 4USEA 2WMTA 2BKKA 3I7CA 3NUNA 4YJTA 2KTYA 4AXAA 4PTEA 2QU5A 3C4CA 1WBNA 3CTQA 4GRBA 3Q32A 4YJNA 4D58A 2VX3A 5AUVA 4FTMA 2QONA 5J7HA 2OO8X 1OZ1A 3LE6A 4GS6A 4USDA 2X6EA 4F9AA 2ZB1A 3DOGA 3ZLSA 1DM2A 3ULIA 3V8SA 4FV7A 3VUMA 3TNQB 3A7GA 5JGDA 2HOGA 3OFMA 2HY0A 2UW3A 4DAWA 4BHNA 5L2IA 2OLCA 2XIKA 4F7JA 4FNZA 3TV7A 1H26A 4NCTC 5E9EA 4IM3A 3ATTA 1K3AA 2B54A 4TT7A 3R28A 3LJ0A 3CP9A 4U80A 3QZHA 4QMYA 1W2FA 1H27A 2JDVA 4QP1A 3E8EA 4OAVB 1UNHA 2F2UA 4HNIA 4RC4A 2BHHA 1XO2B 4G3GA 4MHAA 5D1JA 4NL0A 3LQ3A 4FZAB 4MUQA 4ITJA 4ZJVA 5HIEA 2ZMCA 3DBQA 1BKXA 2QR7A 2PVHA 4Y72A 4D4SA 4ERWA 2VWBA 5FM2A 4HW7A 2Z8CA 3A61A 3FMNA 3QTRA 4YJQA 3M11A 2ZM1A 3IOPA 4TPTA 5IQBA 1JPAA 3FKLA 1IA9A 1JAMA 5HORA 2PVNA 5E8TA 5CX9A 3C0GA 3K3JA 5FRIA 4QD6A 5HIDA 1G5SA 1ZOGA 3HECA 1ZYSA 1ZXEA 4KIPA 3ZO1A 4D2RA 4NIFA 3W0NA 1OUYA 4OTRA 4AUAA 4NM0A 2Z02A 2R3NA 5C01A 4RJ4A 3DAJA 2GS6A 2VWUA 4ZLZA 1YRPA 2W5AA 4C2WA 5K0KA 2PWLA 4IIRA 3PIZA 4O7LA 3MN3A 2PVJA 3KF4A 1LUFA 4NSTA 2OSCA 3LCTA 3V5LA 4BKJA 3BWJA 5LVLA 3ZSGA 1O9UA 1GIIA 2XK9A 3TV4A 3D9VA 4FVQA 4N4SA 5DT4A 2WIPA 2G2FA 3W32A 5AADA 5I9XA 4LGDA 1YXXA 4ARKA 2RL5A 4X3JA 4NWMA 4ACCA 4XG8A 3TNHA 5LOHA 3FI3A 2AQXA 2X0OA 4GVAA 5ICPA 3A8XA 4CTCA 3GOKA 5A4TA 2YA9A 1OUKA 5T3QA 2HENA 4EH5A 2BUJA 3KFAA 5AV2A 2PE2A 2XIXA 3RAIA 2UZDA 4AXFA 5CAOA 4L46A 4Q2AA 4XUFA 3LFCA 3QRTA 5AAFA 2XK3A 3MH3A 3NUSA 3SD0A 5IMXA 4ITHA 3ZHPC 2CNUA 3NAXA 3A99A 3H9FA 3HUBA 2RKUA 5L2QA 1J1BA 3C4WA 3U6JA 3QRIA 4KA3A 1PXOA 2GNHA 5DRBA 4CZTA 2VTOA 3F2AA 1UVRA 3HRCA 3F69A 4IM0A 4E5WA 3P7CA 3TNPC 5LJJA 1GIHA 2XYNA 4FKJA 1ZYCA 2X8EA 3FY2A 5KZIA 3QZIA 4DF3A 2OJJA 4R5YA 3HA8A 4IVDA 4A9YA 1H0WA 3VUKA 5LWMA 5AV4A 2ITVA 3AD4A 3F5XA 3HGKA 4MH7A 5L6PA 3LLAA 1QMZA 1TQMA 2HY81 3D5VA 4FSTA 5HCZA 3RNYA 3VVHA 5JQ8A 4EUTA 3RKBA 5FXQA 5DMZA 2WAJA 4FV9A 5E92A 3PP0A 4G3CA 5JFXA 1Y6AA 4U44A 4XG2A 2OWBA 3NPCA 3PPJA 4FIFA 3BHYA 3SAYA 5KMOA 3D15A 3LZBA 3PJ2A 4MNEB 3R8UA 4L44A 5IH4A 3VQUA 5DWRA 1JKTA 2J90A 3HMMA 1FVRA 2PUPA 3K2LA 3O8TA 2IZTA 4XG9A 5AUXA 1Q97A 3VHKA 3WE4A 2AC3A 2ITQA 5C4KA 3S95A 1PMUA 4FEWA 4ITIA 4IXPA 4IWPA 3QTZA 5HIBA 5E8XA 3RMFA 5IEXA 4NZWB 1MRUA 4LL0A 4PL4A 3F6XA 4C4IA 5KBQA 3QQJA 3F3VA 4U3ZA 3CD3A 1CKIA 2P0CA 3FXWA 2GNIA 3L9NA 4FSRA 4I5PA 5D12A 3WZKA 5H8BA 4LUDA 4EI4A 4TYEA 3PUFC 5KKRC 2OIBA 3R1QA 4UN0C 5I9ZA 3U8WA 3KB7A 1AGWA 4YSMA 3A2CA 4KRCA 1L8TA 2PU8A 4O84A 5CXHA 1H1RA 5DLSA 4HPUE 4L01A 4DTAA 1VZOA 5JFVA 3T3VA 3R1NA 4AZEA 4M68A 4ENXA 3PXZA 4PDYA 4NM3A 4HGLA 4ALVA 1I09A 3L8XA 5HVKA 3UPXA 4UXQA 4ASDA 5H8EA 2R2PA 2CKQA 4WSYA 4KBAA 1XH8A 1MUOA 3A7JA 3LW0A 2CN8A 5GZ8A 4AFEA 4MBLA 2C6DA 3LXPA 2OKRA 3ZFXA 2X2LA 4V04A 1OIQA 1V0BA 1J7IA 3NW7A 2UW8A 2XIZA 2OZAA 3EZVA 5IMEA 5CEKA 3ZCLA 1Q24A 3DZOA 4XG6A 4DH3A 4KIKA 2FUMA 3VS1A 3ZO3A 4W4YA 3R21A 2H96A 4J99A 3TKUA 2WHBA 3KRJA 2BR1A 3R1YA 4H36A 3O23A 4YTIA 3VUDA 4RJ7A 4GUBA 2DYLA 3FMMA 3NCZA 4WD5A 2OBJA 4OTPA 4F0FA 1Y91A 5DT0A 2Y4IC 3ZUUA 3DDQA 5HTCA 3DGKA 2FSOX 4KS7A 3NIZA 5HG9A 4K9YA 4BYJA 4EK3A 3RK9A 4FSQA 3FLNC 4FMQA 3GENA 3RGFA 2AC5A 5GIOE 3EL7A 4FTLA 3PJCA 4RJ6A 5FXSA 4R77A 4D9UA 2WZJA 1H08A 1S9IA 2C0IA 3U4WA 4FSNA 2R0IA 2XK6A 2C47A 2FVDA 4RX8A 4QT1A 3ATSA 4GT5A 4UBAA 4L53A 2CGVA 4CCBA 3UDSA 3LM0A 3KK8A 3DKFA 3VW6A 1CKPA 3FZPA 4O0TA 2UUEA 5D7AA 4KBCA 4AGCA 5BVDA 3UG2A 3VUGA 5HTIA 5A3XA 5CU2A 4O27B 3HLLA 5F4NA 1YHSA 2JITA 4MQ2A 3RCJA 2W5BA 4U7ZA 3QRUA 4BC6A 2CDZA 5BUIA 5IUIA 2JIIA 3GI3A 4AFJA 3VBWA 3FMLA 2QC6A 4ZTLA 5FXRA 4RFMA 3Q52A 4NW5A 5FLFA 3ZRMA 4EH8A 2VTPA 4UWCA 5DH3A 1MRVA 5ANDA 4AN9A 3RPSA 3E8DA 3OWKA 4G5JA 4Z9LA 3UDTA 4LDTA 2EXCX 2OJ9A 3QUDA 4CNHA 3HKOA 5I5ZA 4DTBA 1GZNA 5C26A 2GS2A 2ETMA 1JLUE 2XKDA 5K5XA 2WQNA 1WCCA 5JRQA 4L52A 3KRXA 2VTNA 5B2KA 2XVDA 2WEVA 3QC4A 5M51A 4AZVA 2EXEA 1L3RE 4R8QA 3EYGA 3C5UA 3DNDA 3R01A 4L7SA 4KAOA 4YC3A 1BX6A 5TO8A 2WPAA 3FI2A 2X6DA 4D28A 3BQRA 4TNDA 5E4HA 4QMPA 4QP4A 3OG7A 1ZMUA 5E1EA 5KKRB 3GGFA 3TZ8A 4K1BA 5ANIA 2W9FB 3AXWA 3IECA 4J53A 4LGHA 1KE8A 3R2BA 4QMVA 4BL1A 3MPTA 4FVRA 2F7EE 3RJCA 5GZAA 4KIOA 4C57A 3RK7A 4UXLA 1R3CA 2OF2A 4F9YA 3F5GA 5EYDA 4D2VA 4FA2A 3TUDA 3E93A 3HAMA 4G6NA 5ETCA 4JG6A 3EYHA 5M4FA 3OROA 5B7VA 2JKQA 2HZ4A 5JGBA 2YCSA 4DG0E 2YM5A 3ORLA 1XKKA 2CMWA 3BHUA 5KMLA 3VBYA 3KF7A 1J1CA 4GYGA 1UV5A 2RGPA 3H30A 2VO0A 3Q2JA 1E9HA 3O51A 3BHVA 4FZ7A 2VTJA 4JBPA 4R78A 4F0GA 4U43A 2BTRA 2YZAA 4M14A 4O91A 4ZTRA 2GTNA 1BI7A 2G2IA 3DQWA 4F7NA 2YLEA 4AACA 1Q8ZA 5G1XA 4ZTMA 3NUAA 4OUCA 4F7LA 2VX1A 3F2RA 4TWOA 5K3YA 3C4ZA 3TZ9A 2PUUA 3EWHA 3FLZA 4GFMA 4KS8A 4EQMA 4HVDA 1ST0A 3JVSA 5L8LA 2HZIA 2ZDTA 3MH2A 2IVSA 2IZRA 3KRWA 3OXTA 4FZDB 3TT0A 4FT9A 3KY2A 2QOIA 3CEKA 3POZA 2C3JA 5C4LA 5EM5A 5J9ZA 1DAWA 3LFEA 3E7VA 3PJ3A 5K9IA 2W99B 4I6QA 4MAOA 5FQDC 4OBQA 4A9UA 5KUPA 4QDVA 3G9NA 2E2BA 5AR2A 3DFAA 1KV2A 5CSXA 4YHJA 4QYHA 4EKLA 1BLXA 3MV5A 3OT8A 4L3JA 3TACA 2NRUA 4GMYA 5AP1A 5FTGA 4AZWA 3V6RA 3AC1A 3AD6A 5KMNA 5CY3A 5HD4A 5KHWA 2QCSA 2X0GA 2BCJA 2RFSA 4FTAA 5TOZA 3MESA 3N4VA 1JKSA 4IZ7A 4DYMA 4UMRA 3BV2A 4GG7A 1OIRA 4M0YA 4E4LA 2QKRA 4L3LA 3UODA 1A06A 3OW4A 4J71A 3K3IA 5HBEA 3W2SA 4FKLA 4O2PA 4CMOA 4FTKA 2LGCA 4O4DA 4UWBA 4AAAA 3NDMA 5EM8A 1WVYA 4OTHA 4X2KA 5FD2A 3MWUA 3QLGA 4TRLA 3ZBXA 5HX6A 5IA4A 3QXPA 4FTTA 5FG8A 5HCXA 3BLQA 2E9NA 3GU6A 4MCVA 3EB0A 4FKOA 1Q3WA 4WUAA 2BAKA 1ZY4A 3Q4TA 3R22A 4AZFA 4XV2A 2JEDA 3P7BA 3BL7A 4YLKA 4EH4A 4FC0A 4YTCA 2ZV8A 4O2ZA 4ANLA 2BKZA 5KBRA 2B9JA 5ETFA 2JKKA 3DBEA 3NX8A 3PVUA 4XV1A 2OICA 4QO9A 3E8NA 1XBCA 1Y6BA 2A19B 2J7TA 3CKXA 3JVRA 2ONLC 3R7GA 4MNEA 4ZY4A 4OTQA 1XWSA 4NCTA 2C6OA 2I40A 3R83A 2QOFA 2WMSA 4O0WA 4BY9E 4BCGA 5IEYA 2QOKA 3C4XA 5CEPA 4YGAA 3PA4A 4D4YA 3F3UA 3VUTA 1R39A 1Q8WA 4YC8A 4C2VA 4OGRA 1VEBA 4RC2A 4GH2A 2RG5A 3AT2A 4X21A 4O7NA 5CEOA 3E62A 3A7HA 4NFMA 3GQLA 2CJMA 1YKRA 4S34A 4F09A 1OL5A 4BCKA 4FUXA 5LCJA 4AT5A 4AW0A 3LFBA 4O38A 3RWPA 3IK3A 3KMMA 3S3IA 4RX5A 5GNKA 3W0PA 4RIXB 3MFRA 1ZMWA 3P9JA 2BRNA 1T45A 3PA5A 1PMEA 4LGGA 3UBDA 2YAAA 4DGOA 3GC8A 1NVQA 4XOZA 4E26A 1FMOE 4E5AX 3SRVB 3NSZA 2XCHA 5AFVA 4OTGA 3A7FA 4I6LA 3NFGB 1UKHA 1K9AA 2F2CB 3OD6X 3G51A 2I1MA 3FL4A 3QXOA 4DH1A 2G1TA 3AC4A 3R9HA 1YI3A 3UO5A 5HBJA 1R78A 2PZRA 4JRNA 4E93A 5JGAA 3E5AA 4JX7A 1TVOA 4WNOA 1O6YA 2CSNA 2VO7A 1BUHA 1WBTA 3P7AA 4NKSA 2IVUA 3R7OA 4CFUA 2XALA 3A4OX 2J0LA 4LL5A 3R9DA 4CYJA 3EH9A 4TY1A 1OL2A 4AN3A 3E3PA 1OL1A 2XK4A 4FI1A 2JAVA 2GNJA 3NVKI 3HX4A 2ZV9A 2QOOA 3FLWA 3NW5A 4IX6A 4NFNA 3FI8A 1SVHA 2QO2A 3QTIA 4TKSA 4JQ8A 4YBKA 3DBDA 4ZOGA 4C02A 4LOPA 1Q8YA 1YHWA 2C6EA 2GDOA 4MTAA 4HCUA 4RC3A 4EC9A 4C36A 3QTQA 3HMOA 4DH7A 3KXNA 1OKVA 3TL8A 5I9VA 3T3UA 2C5XA 4AX8A 4F1TA 4O4BB 4B6LA 4CKIA 4QMOA 3HP5A 3VS3A 4BCIA 4DFZE 4YUQA 3F2NA 3H4JA 5L2WA 3SW4A 4AXCA 1J7LA 3AC8A 4O21A 3P0MA 4PY1A 4B99A 2H34A 3IW8A 3OUNB 2R3LA 4FTJA 3DV3A 4U41A 2XIRA 1Q62A 2PL0A 2HAKA 3PLSA 1J3HA 1UU9A 1YOJA 5TKDA 2X1NA 3BHHA 1OVEA 2WMBA 4RWJA 5ANEA 4Z7HA 2W4KA 3GCSA 4FGBA 3QALE 5AUYA 3M1SA 4IACA 4AE6A 3PUPA 3E8CA 1JSUA 2ITWA 3U51A 2F49A 3EOCA 3HUCA 4P5ZA 3RPRA 4AT4A 4BI1A 4CD0A 3F3WA 4E6DA 1H24A 4W4WA 3OF0A 3VO3A 3RCDA 3CQUA 3I7BA 2R4BA 3RVGA 4FIEA 2Z7RA 4IJ9A 4U9AA 4DA5A 2YCRA 3MY5A 3RK5A 1JSTA 1OITA 5BPYA 5DRDA 2QO9A 2H8HA 4F7SA 3SG8A 2YLFA 4OTIA 2C5YA 1XH4A 3LHJA 2UV2A 4CMTA 4O7WA 3ORIA 4GW8A 1Q5KA 3I1AA 4ZJIA 3TI1A 3MIYA 4WG5A 4CV9A 5BVNA 1JQHA 4R3CA 3OTVA 4FG8A 2PZPA 4UMQA 4CRLA 4YSJA 4WSQA 3F7ZA 3Q4ZA 2QODA 4FKGA 2JFMA 4ZLOA 4U97A 3BU6A 3H3CA 2X4ZA 2YDJA 1WBOA 4EOMA 4I0TA 1BI8A 2PSQA 2J2IB 1G8AA 2X81A 3PE1A 4FYNA 3MVMA 5HHWA 4BGGA 4QRCA 3G6HA 3LCOA 5IDNA 3P08A 4K11A 1BL7A 3EL8A 1REJA 3BQCA 5K4IA 4J8MA 3EQCA 4S31A 4M84A 4L42A 3W33A 3BU5A 3DZQA 3QQGA 2G15A 5I3OA 3COKA 4YTHA 5EQEA 1V0OA 1U5QA 4AQCA 4AG8A 3ANRA 4L3PA 5HE3A 3TKIA 5JFWA 4BCPA 3BU3A 3CJFA 3LCSA 1AQ1A 1ZYDA 3PJ1A 4O22A 3VIDA 3W8LA 4RFZA 2GQSA 3TIYA 2RFDA 1ZMVA 3TTJA 2AEGA 2VV9A 3WIKA 3U55A 1YOMA