4I5HA

Crystal structure of a double mutant rat erk2 complexed with a type ii quinazoline inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
335
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVADLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKILDFGLARVADPLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Sequence determinants of a specific inactive protein kinase conformation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 101
structure length 335
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i5hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i5hA01
4QNAA 3FLWA 3H0ZA 3MJ1A 4BDCA 5A4EA 4E8AA 4NCTA 3ACJA 4F6SA 4X2NA 5H2UA 5AX3A 1BL6A 5KX8A 4L43A 5AIRA 4AOIA 4BI1A 1IAJA 1CDKA 5KZIA 2YITA 4FYNA 2VWIA 4JQ7A 1XHAA 4GYGA 1R39A 2P2IA 2ZDTA 3QZGA 4IDVA 4C4EA 2J0IA 5AJQA 4D2WA 5LWMA 4HZSA 4JQ8A 4O7RA 1OUKA 4NK9A 5L4QA 3K3JA 5BVEA 1YRPA 3SX9A 3BHHA 3EKKA 5AP4A 2PYWA 1UU9A 1ZY4A 2ZM3A 4WA9A 3AGLA 2QNJA 4D28A 5A9UA 5JEBA 4GFGA 5BMMA 3QYWA 3D14A 1YWNA 3BE2A 3GOPA 3I60A 2BFXA 4FSMA 3ORTA 2HENA 5AUUA 3FWQA 3A7HA 1L3RE 4FNWA 1G5SA 5E7RA 2CNQA 1IRKA 4GJ2A 3V3VA 4AT3A 4BVUA 3IOPA 5DR6A 3II5A 3OC1A 4JDKA 1OMWA 3E3BX 4E4NA 3SW7A 4FKSA 3HMMA 4EKKA 3T3VA 4I22A 3RBWA 5KBQA 2I0VA 3WZDA 4RFYA 2QG5A 1PYEA 2VTJA 2QR8A 2PK9A 5EH0A 4C4GA 4PTCA 1OKVA 1RQQA 2R3PA 4FR4A 5D41A 1Z57A 3LCOA 4IE9A 4NU1A 3W2PA 4ZY6A 4YMJA 3A60A 3KRJA 2GQSA 5FEEA 3PA4A 4BN1A 2BUJA 5HE0A 3B8RA 3KU2A 3PWDA 3RMFA 2W5AA 4XEYA 3KMMA 1KE5A 4R7BA 4ZY4A 3FPQA 4CLJA 5C27A 4MEDA 2PL0A 3GU8A 4HYIA 3R83A 3F3VA 3A61A 2XK9A 4QP6A 3KK8A 4DGGA 5DRDA 2HWPA 4LL0A 3BYOA 5ANJA 2JBOA 3DJ6A 3GI3A 4FUYA 2YM6A 4HYUA 1CKJA 1SNUA 2B9JA 2GCDA 3F3WA 3FE3A 3ODYX 4EOOA 2YZAA 3F82A 5HO6A 3DJ5A 2C1AA 1QCFA 2VWBA 3QWJA 4ZTRA 1ZY5A 3F61A 4O86A 3PXQA 4C59A 5CY3A 4N70A 3ZRLA 5AP3A 4EEVA 4FT3A 4L3PA 4RJ7A 5EW3A 2YM4A 4L00A 2VTRA 4KBKA 3HRFA 3NIEA 4J96A 5CU0A 5IEXA 1FVTA 1OL7A 4GS6A 3QQLA 5IUIA 2YFXA 3QLFA 4G3DA 4MQ1A 4BDDA 2ITOA 3Q4TA 3SXSA 4C37A 3OBGA 3HMOA 3EQHA 3FEGA 3R7EA 1V0OA 4UMPA 5DT3A 1FMKA 1GZNA 4O7LA 1UKHA 5JMSA 2J0JA 4LOQA 2YERA 3GENA 4FK6A 4USDA 4CEGA 4RZVA 2OK1A 3EN6A 4FI1A 4OBOA 4EH4A 3E8DA 2BALA 4LM5A 3OWPA 4QQCA 3WILA 3WE8A 1RJBA 2WIHA 4AFJA 4HOKA 3FZPA 4TNDA 2HZIA 2JDRA 4FV4A 2HELA 5C9CA 4FICA 2XIKA 3QWKA 3NVKI 1TQIA 3CD8A 3EB0A 2G2FA 3HMNA 3LXNA 3PIYA 4R78A 4I24A 5HIBA 2GS6A 3POOA 3SOAA 4AP7A 4CZTA 5DMZA 4O84A 4CFMA 3ORNA 2JKQA 4G1WA 1OL2A 4PWNA 3TXOA 4BL1A 4FSTA 5HCZA 3Q3BA 2XK7A 3Q04A 3O17A 3RALA 2UZBA 2XA4A 3VAPA 2ITVA 4FNZA 4TWNA 4UEUA 3VS2A 3LQ3A 4HYHA 5IQHA 5EYKA 5CVFA 5EHYA 3GCPA 2OXXA 3SG8A 3BYMA 1MQBA 5T6KA 3WZKA 3DQXA 3FZ1A 2FUMA 3FL5A 4ANBA 1K9AA 5DR9A 4DHFA 2CNUA 1JQHA 2UZVA 3IDBA 5I3OA 4RIOA 5DIAA 1WCCA 4B7TA 4JBQA 3DZQA 3HV6A 3REPA 3OMVA 4KUJA 3UNZA 3O96A 4XV3A 4D1XA 3CXWA 1KV1A 1W0XC 3LFBA 3CJGA 4R6VA 1YHWA 4WBBB 4BCKA 2HWOA 4GVJA 3IK3A 2OLCA 4FTUA 4LOOA 4MWHA 1OVEA 3E87A 4DFZE 5AP6A 5BVFA 3JVRA 2ETKA 1ZYSA 2C6TA 3M1SA 3MPMA 2ITZA 3QKMA 3CQWA 5AUTA 2OXDA 3DNDA 5J9ZA 3DAEA 2G2IA 4U0IA 4BKJA 4O1OA 2X7OA 4G6LA 3IQ7A 4EBWA 2OBJA 2CDZA 3K5UA 4YO6A 3WF6A 1Y8GA 3QGWA 5I4NA 3D4QA 5KCVA 3AGMA 2XK4A 4ANSA 3V01A 4ERKA 4ZSAA 2O63A 5HTIA 2UW7A 4NSTA 5ACKA 3L9LA 5KMLA 5JH6A 4RVMA 3U6HA 3DQWA 3Q2MA 4RX9A 3F3TA 4PY1A 2XKCA 3G9LX 3PSCA 5AP0A 3FMMA 4WIHA 3W55A 3MY1A 2B0QA 1GZOA 4IMYA 4RIXA 4DGMA 3UOJA 1OKYA 1GIHA 2W4OA 2WOUA 2WQOA 4FTQA 4PPCA 3PJ1A 3NUNA 1ZYCA 3C4XA 2IZTA 2JAMA 3FMLA 4I6FA 4AOTA 5BNJA 1OKWA 4OT6A 1LEZA 5ANEA 1U54B 4KIPA 2V0DA 5HBHA 3KKVA 3LCKA 3WZUA 5IQFA 2WPAA 3RM7A 4E93A 3KRRA 3W8LA 3QKKA 4F99A 3I5ZA 5JQ8A 2B9IA 4Q2AA 3B2WA 3ZHPC 4HPTE 3Q9ZA 2X7GA 2UW3A 2VTIA 1Q62A 3CQUA 5D7VA 4J53A 3R00A 3GCSA 3ZUVA 5I9ZA 3N4UA 4O1PA 3K54A 1Q8UA 3NEWA 4JQEA 1XO2B 3TNWA 2I0HA 4IH8A 2ZMCA 3KULB 4BKZA 2JITA 4D4RA 4DITA 5CAPA 3FMDA 3CBLA 5BVNA 3A99A 5I3RA 2C6KA 1WBTA 3OOGA 4K2RA 2R3IA 5JZNA 4ZIMA 5CZHA 3W8QA 4JG7A 4H3BA 1MRYA 3R1QA 3TDWA 2IVVA 5EHOA 4NUSA 4ASEA 2CMWA 4H36A 3C1XA 4F1OA 5C8MA 3UIMA 4AGUA 3IW7A 4X6QC 4M84A 4R3CA 3QC4A 3E63A 3BV2A 4YZMA 5LVNA 4XS2A 1SMHA 2QR7A 4F63A 1SYKA 1ZOGA 2P3GX 4ZZMA 4UN0C 5I9VA 4QTBA 4C0TA 3R01A 3FI8A 3Q53A 4X2KA 4QP2A 4Y73A 1UU8A 2ZOQA 2VTPA 3QTQA 4XG3A 4NYEA 3CY3A 3ORPA 4L46A 3WF7A 3MGYA 1PXOA 2F7ZE 4APPA 1UWJA 1KOBA 4MBLA 5J9LA 4O7YA 2HXQA 3G0EA 1OPJA 4A07A 3MPAA 4FG9A 3VF8A 1JKLA 4TZRA 1U46A 3VWAA 2ITYA 3EQGA 4RC3A 4ZTNA 3VS0A 5KZ0A 5AV1A 1AD5A 4RIWA 3BHUA 4HCTA 3PXRA 1YI4A 2F57A 3EWHA 3HX4A 3NS9A 4Y72A 3Q4ZA 3V5JA 2QOIA 4P7EA 1H28A 3O71A 3FAAA 5AWMA 3I1AA 5KHXA 2QC6A 1LPUA 4EUTA 3V5TA 4OTDA 5JT2A 4RWJA 5K3YA 1WMKA 5GZ9A 4D4VA 1NVQA 4R1YA 4EZ7A 5AIKA 3ZDIA 2IPXA 3R8UA 3LZBA 4GK2A 4EH6A 3L9PA 5BPYA 5M07A 2PWLA 1NW1A 4FIIA 3VHKA 1H08A 1H01A 2PZYA 4WG4A 4GFMA 3LKMA 1CMKE 5ETFA 4KABA 4PNIA 5CI6A 5L3AA 2WTDA 3PVUA 4A9RA 1OPLA 3GC7A 1OB3A 2UZTA 4G9CA 3R22A 3TL8A 1H0VA 1PYXA 4AU8A 1PW2A 4K8AA 1ERKA 3HNGA 4O21A 2HCKA 3KN5A 3PJ2A 4JX3A 2OF2A 3PVBA 5CAQA 5L2QA 4IZ7A 1SVHA 2WTVA 4XP3A 2WMRA 2ITPA 4JT3A 4QMYA 4D0WA 1AQ1A 4EH7A 3QCYA 2B7AA 3QRIA 3U4WA 5EKNA 4C3PA 4GJ3A 4DN5A 4TYHB 3LJ0A 4HVSA 5HESA 2EU9A 5EK7A 2W1CA 4C2VA 3PG3A 3PPKA 4GK3A 4I3ZA 4IEBA 3QA8A 5AM6A 3DBFA 3ZFMA 2PVMA 4P2KA 3KN6A 3UVPA 2FO0A 2PZPA 4ONAA 4WNOA 2OJGA 4DGLC 5TF9A 4Z7GA 1KOAA 2WAJA 5GNKA 5HLPA 3VRZA 1PXJA 5FD2A 3Q6WA 4HGLA 3F3ZA 4QOXA 4QTCA 4XG8A 2W4JA 3EYHA 3MFTA 4I94A 5IQBA 2C5OA 3I7CA 3ZONA 2XBAA 2OZOA 3KVWA 5IZFA 4PMSA 3QBNA 3R1YA 3D5WA 4RJ5A 1J1BA 4C57A 4RA4A 2BDFA 2YLFA 4GIHA 1GNGA 3AMAA 5I9UA 1GJOA 3QZFA 2V5QA 3JPVA 3TWJA 1UWHA 3R9RA 4PDPA 2EVAA 2R3KA 4J98A 4XH6A 5HE2A 5CNNA 3C5IA 1QMZA 4DT9A 1JSTA 2HW7A 4C4JA 1K2PA 4RFZA 5KUPA 1WFCA 1PKDA 1SVEA 4MTAA 1M2RA 3VBVA 1U5QA 4IWDA 3QXPA 4O0RA 3GP0A 3KMWA 2HW6A 4MD7E 5J8IA 4EYJA 2XK3A 5FP5A 4C33A 4JXFA 2BTRA 5HEZA 5AX9A 4RIYB 4DH1A 3COHA 1ATPE 4WNKA 4JLCA 3DZOA 2F2UA 3NUUA 4XV9A 1TKIA 2O2UA 3E88A 2VWWA 5D9HA 4UYAA 3LFAA 4U43A 3EQDA 2J90A 4ZLOA 2R3JA 4H3QA 4TTHB 2ZM4A 3PLSA 1Y6BA 1R0PA 3D2KA 3W33A 4GMYA 4BDBA 2OFVA 2XCKA 2W96B 3EZRA 4EHVA 1ZRZA 4DH3A 4CT1A 2PUPA 4EH5A 3UZRA 4QMSA 3N9XA 4L7FA 1QPCA 4IB0A 1P4OA 1YDSE 2XIXA 4AE9A 4O7VA 3CQEA 3HUCA 4RRVA 4UZHA 5AP7A 2LAVA 4E73A 4CG9A 3OEZA 2Z7SA 2OZAA 3ZLWA 3OCTA 5CASA 2VNYA 1QPEA 1P4FA 1OBDA 3MPTA 3ZBXA 4J7BA 4F0GA 4E4XA 3C0HA 4PTEA 4O38A 4HJOA 1REJA 5E90A 2I7QA 3U9CA 5L6WL 4QMVA 4DBXA 3DS6A 1YDRE 3L8SA 4CRLA 4NJ3A 4NJDA 3EYGA 4EH3A 5BVWA 3DAJA 4CGAA 3EFJA 3MH0A 3OHTA 5EG3A 1SM2A 2PU8A 3ZCLA 3MWUA 3PVWA 2YLEA 1Q3WA 4ENXA 3COIA 1P2AA 2XIRA 4GV1A 2JLDA 4I23A 4IWQA 5HG8A 3LCTA 2YWPA 4TWPA 1J3HA 5K4JA 4EOIA 5HNIX 1JLUE 2QO7A 1Y6AA 3ZUTA 3P86A 4FZDB 4W4WA 4MAOA 4UV0A 2JDSA 3CP9A 2XKEA 4ZSJA 5FTOA 3DKGA 3LMGA 4NZWB 2GNIA 5IDPA 4AN3A 1UKIA 5IG1A 5EYCA 3BBWA 1H07A 1ZYDA 1J7LA 3QQJA 4HCUA 5FBNC 3MV5A 5L6PA 3F88A 2Z7RA 4O7SA 4EOPA 1Q8YA 2BIKB 3LVPA 3Q52A 3QQGA 5A6OA 5IA1A 2RFEA 2PVKA 2WHBA 1IR3A 4EOLA 1M52A 4LUEA 4O0WA 5IQCA 3R9NA 2QOBA 5TT7A 4FV6A 4NW5A 3F6XA 1J7IA 1H00A 4QMOA 3HP2A 4EC9A 3FSKA 4ANQA 3KRXA 1W98A 3D5VA 3OT3A 3SRVA 2YHVA 3HV3A 4BYIA 3PJ3A 4ACCA 2CKPA 4DCEA 4FTJA 3S95A 4DH5A 1TVOA 1BI8A 4Y8DA 3BPRA 4C3RA 3WBLA 1Q5KA 4UXLA 2WZJA 3QRKA 3ZU7A 4AE6A 4DEBA 5EM6A 4J95A 1MP8A 1URCA 1O9UA 4DH8A 4EBVA 4EH9A 3AC5A 4I0TA 4QD6A 3FC2A 3Q4UA 3VHEA 4NIFB 4X3FA 1IG1A 2GFSA 1WBVA 4PPBA 4WNMA 4Z55A 4YLLA 3F3UA 5K5XA 2EXCX 2I0YA 3D94A 4LGGA 5CQWA 1LP4A 4EK3A 4M0ZA 1XKKA 5EI2A 3FZRA 4FKWA 1GY3A 3KXMA 4V04A 4EQCA 3FC1X 1JOWB 4U97A 4YJNA 4EZ5A 3BGZA 4CZYB 5IQIA 5ETIA 2C1BA 3MBLA 4G5JA 3TT0A 5IH4A 3UQFA 3QRUA 2GTNA 4F64A 3EH9A 4IZ5A 4GK4A 4BIEA 2ITNA 2BPMA 4IAAA 3E3PA 4LYNA 5CT7A 4A4LA 4NKAA 4FKPA 4NM7A 3F2RA 3DA6A 3E7VA 5CVHA 3F5XA 2JKKA 3EN9A 2GQRA 3AG9A 4Q5HA 5CQUA 3CD3A 4G6OA 3NAYA 2DUVA 3MW1A 2G1TA 2G9XA 2J9MA 2WTKC 2XNOA 1FMOE 4APCA 5IISA 4BI2A 4D4YA 4YJOA 4BIBA 1ZMUA 1OBGA 2XNBA 3AC1A 3A62A 2GQGA 4QP7A 4K18A 5AR7A 1YDTE 3SLSA 1RE8A 4GRBA 4HNFA 4FG8A 3I0OA 2GHGA 2W1EA 4M69B 2XB7A 2WMQA 4IAIA 4W4XA 2WMUA 5EDPA 5EM5A 4RVKA 1P5EA 4F6WA 1FGIA 4EOMA 1YI6A 1YXTA 5GHVA 2BHEA 2WTJA 3BGPA 3C0GA 3DBQA 5JFSA 2FSLX 5JKGA 5DWRA 5BUJA 5TKDA 3P79A 2ESMA 2PZRA 2VX0A 4Y95A 4JDIA 5CTPA 1M7NA 4DAWA 3HV7A 5HCYA 4W4YA 3KXHA 4I4EA 4E4LA 4U3YA 4LQMA 5L8KA 4KIOA 2E9UA 5HTBA 1Q97A 3R73A 3WZEA 3DJ7A 4BCQA 2IVTA 3IGGA 2C5XA 2WB8A 1VYZA 5F4NA 3PFQA 1JKSA 3KXGA 5M09A 3VNTA 5J1VA 2PMIA 5H3QA 2NRUA 3JR1A 3EN7A 4M15A 3H9OA 3RPSA 4F65A 3AC4A 5CAOA 4A7CA 1FVVA 3FMEA 3N51A 4YZNA 2X8IA 1YOMA 1PXNA 2YDIA 3VULA 1ZARA 3FXWA 3LOKA 1G8AA 3Q5IA 2C6DA 2V62A 3UO4A 4YZ9A 3DU8A 4WUAA 2XUUA 4DFXE 4R7HA 1WBOA 4CMOA 5L2WA 4PPAA 1KV2A 4ACGA 4I4FA 1YQJA 4LV8A 3OVVA 3OUKA 4MNEA 3PA3A 5CAVA 4FV8A 3E62A 4W9XA 5FEDA 4F0FA 5I9XA 4FZ6A 4U80A 4ZS0A 3ZTXA 4M0YA 2BKZA 5D11A 3Q96A 5IKWA 4CFNA 4LG4A 3GU4A 3MIYA 3UNJA 2Z8CA 3C4WA 1OECA 3OCBA 5JRQA 3QUDA 3ZO3A 3D15A 2NO3A 4E5AX 4XV1A 4X3JA 4DFUA 3OF0A 2CKOA 3DXQA 4IWPA 2RFNA 4GIIA 4E6AA 3R63A 4N57A 3UOHA 4X2GA 2IN6A 2BMCA 4QYEA 2UUEA 3ZSHA 3G6HA 1KE8A 4O91A 4XMOA 3SDJA 3GC0A 2FH9A 3R0TA 2WGJA 4N0SA 3RPYA 3VW8A 4BHZA 4JVGA 4AA0A 2R9SA 5CS6A 3R8LA 2XM8A 5E8YA 4RFMA 5J7HA 5EOBA 5HORA 3UP7A 5JFXA 5AUWA 2X2MA 5A54A 1Y57A 2B9HA 4FTOA 2PZIA 1ZOHA 3H9FA 4XHKB 5CNOA 4GU9A 3E92A 2OJJA 2WMAA 3ZO1A 3SGCA 3L8PA 4A9YA 3PIZA 4RWLA 3PDTA 2OIQA 3ULIA 2PY3A 1XH4A 4ALUA 4B8MA 3F5GA 3U55A 2G01A 3LW0A 3M11A 3SXFA 4F9CA 1QPDA 1UNHA 3CGOA 4G3EA 3V5QA 4IC7A 4BDEA 4D2PA 4EZ3A 3P7BA 2PE1A 4L44A 4GKIA 4XLVA 3LQ5A 3WYXA 2QHNA 2WFYA 5EQEA 5HBJA 4JRVA 4FKIA 3EHAA 3LQ8A 4G2FA 3R7GA 4I93A 3P0MA 3S2PA 1W84A 2OU7A 2B53A 3HA6A 4K0YA 4FL2A 2CN5A 4EK8A 5M4FA 3LAUA 1KE9A 3RAKA 4U5JA 4BDJA 5HOAA 3NLBA 2VTNA 2WMBA 2GU8A 3PSBA 4X21A 4CD0A 1IA9A 1WZYA 2Z2WA 4I0SA 1XJDA 2B1PA 1MRUA 3E93A 4P5QA 4YJQA 2EB3A 4B4LA 3PY3A 3WYYA 2QI8A 5E8XA 3QX4A 2DWBA 2WXVA 2C5YA 4S34A 3EQCA 5ACBC 3V5PA 4FV5A 4PTGA 3VQUA 5L2IA 2CHLA 1M2PA 4QYFA 5DG5A 3C5UA 3DDQA 4M12A 4WSYA 4BDKA 5BYLA 2C3JA 3PY0A 4FKGA 3EQPA 2V7OA 4FV7A 3R02A 2JD5A 2Y9QA 4AGCA 3P78A 1Q3DA 2QOLA 4JL9A 3PXFA 4P90A 4PMMA 3UQGA 1OIUA 2R0IA 4L52A 2IWIA 5A4QA 2NPQA 4LOPA 4FT0A 3IW4A 1W82A 3ANQA 3LFQA 5DBXA 2BZHB 4ANOA 3QRJA 4FSRA 3UTOA 4FL1A 4CT2A 2YN8A 3MA6A 4JS8A 4MF1A 4UBAA 4RQVA 2ZV8A 3D9VA 4TN6A 4DG0E 4EOKA 4M14A 2IW6A 4NH1A 3QQUA 5FLFA 4E6CA 1PXIA 2VD5A 3RTPA 4Q5EA 5LVOA 3MESA 2ONLC 4FGRA 4TY1A 2QOQA 3UC3A 5A4TA 4DTAA 4E4MA 4O27B 5EKOA 4PMPA 3LFSA 2WELA 4V0GA 4KRCA 2KTYA 4CTCA 3PIXA 4FTIA 4DYMA 1ZAOA 3FHIA 4J8NA 3PRFA 5H8EA 5HX8A 2QURA 2QCSA 3NDMA 4IXPA 4OAVB 1IASA 4MNFA 4FTAA 3NUXA 3RM6A 2E9OA 4A9TA 2B4SB 3KVXA 1CM8A 3R04A 4E5BA 1LUFA 3AMBA 3MVLA 1F0QA 3FYJX 4C38A 4MD9E 4DGNA 3LIJA 3HLLA 5GJGA 2G2HA 2H34A 3FMNA 4K77A 3MN3A 4LI5A 5DR2A 4D0XA 4XOZA 3U6IA 3OXTA 1YXXA 4OTHA 1JWHA 2YCFA 4RG0A 5F94A 4AF3A 3TKIA 4USFA 5LMKA 5E8VA 2JKOA 5KE0A 4GG7A 3AQVA 4FT5A 5J95A 5KMMA 3Q2JA 3BWJA 2Y0AA 1JVPP 5KNJA 2X8DA 2R3OA 4R3RA 4UMQA 1UU7A 5EDRA 4FTRA 2OSCA 4O0SA 3SVVA 2PVLA 4FEWA 3P9JA 3QQKA 3TUCA 5DOSA 4FEXA 2JBPA 1LR4A 5EFQA 4BTMA 4EOSA 2QKRA 5LMAA 4PDOA 1W7HA 5IMEA 2QHMA 1OGUA 1ND4A 5BYYA 4W8EA 2C68A 1MQ4A 4IBMA 5M56A 4I6HA 4EWHA 2W9FB 4FTMA 4ASZA 2RKUA 3MH1A 2UZNA 5CSVA 5D10A 4EI4A 2UZWE 2WMVA 3FQSA 3JS2A 3Q32A 4Q9ZA 4YU2A 4O81A 1E9HA 5HHWA 4IAZA 2VTTA 2C3IB 3KEXA 1NY3A 4FTCA 2B52A 4G31A 4QRCA 3MTLA 4H3PA 2OF4A 4D2TA 3QTZA 5HNBA 1GAGA 2VX3A 3SRVB 3TTJA 3HV4A 3RK7A 2WIPA 3DB8A 4JIAA 5IA3A 3GCUA 3ZMMA 3H3CA 5HD4A 3RKBA 3DDPA 3L9NA 4PL3A 4CSVA 3QQHA 4Z3VA 1T45A 4TYEA 4RZWA 4E26A 4QNYA 4IAYA 5FXSA 5EDQA 1BL7A 3VJOA 1TQMA 4ANMA 5FDXA 1NXKA 4U45A 1CSNA 4R8QA 1SZMA 3DK7A 3OTUA 2Q0BA 3TEIA 3WIKA 3W18A 1YXSA 2PPQA 4AAAA 5FTQA 4RVLA 3ID6C 2VWYA 4AX8A 5FBOA 2OXYA 1PHKA 1BKXA 2W9ZB 3BU5A 4ANNA 4BICA 3F7WA 3DK3A 4C02A 3T9IA 4D1ZA 4MX9A 4EK4A 4KKGA 2YM8A 2E9VA 5E8SA 4ZJVA 5E9EA 3ATSA 3AC2A 4FSQA 4XOYA 3BGQA 2A19B 3NAXA 1O6KA 5CZIA 2X7FA 3QD3A 1PMEA 2BRMA 4ITJA 3G2FA 5JK3A 5AR4A 3ZLSA 2GFCA 1DM2A 2C6EA 3D7TB 3EN5A 3K5VA 4V01A 3FMKA 5HE3A 4DH7A 1XH5A 4QPSA 4AN9A 2PVHA 1PXLA 1KE6A 5CX9A 5LVLA 5AAFA 3SC1A 5CANA 3LFFA 4QTDA 3AC8A 3VQHA 3DV3A 2Y6OA 4OR5A 5C26A 5AFVA 3TI1A 5LVMA 2C30A 2VUWA 3QHRA 1KSWA 3R8VA 5AAEA 2P2HA 5JGDA 3PA5A 2CCIA 4R77A 5CSWA 2C47A 2W5HA 4J99A 2ERZE 4L42A 4XBRA 4FIFA 3OUNB 4Y85A 2YJSA 5AV2A 2QLUA 3RGFA 4EOQA 4DFBA 3GGFA 5J1WA 3OBJA 1FQ1B 4OTFA 4DBNA 4NL0A 3F69A 4RWKA 4WSQA 3UGCA 4BDIA 3PLAE 4F9YA 2BR1A 3KB7A 5KHWA 3O7LD 2GHLA 5AAGA 3G90X 5CSPA 2VN9A 3FKOA 4Y5QA 2PVNA 2UVZA 2Z7LA 1NVSA 1JAMA 3DLZA 3EKNA 4MBIA 1ZZLA 4OT5A 4C4HA 3Q9YA 4LFIA 3FXXA 3NCZA 2BKKA 1K3AA 3VUTA 5KMKA 2YEXA 2GTMA 4M8TA 3VUKA 2YJRA 1Y8YA 5HG5A 4EQMA 4F7NA 4ZMFA 5HLNA 4PQNA 4D5HA 1H0WA 3LXKA 4EH8A 1UA2A 4FF8A 4K11A 3S0OA 3O8TA 4I5HA 5GINE 5HG9A 4DT8A 4BGHA 5LWNA 3NNWA 1SVGA 4X6RA 2GMXA 4IACA 2QVSE 4Z7HA 3VC4A 3UZTA 3G51A 2VWUA 1R0EA 4FX3A 5M44A 2ITWA 3P23A 4DFYA 5HKMA 4G5PA 5H8BA 4FZ7A 4ERWA 2QOOA 1NT2A 2YCRA 2UW5A 3EQFA 3LHJA 4YJTA 5E1EA 1PMUA 1W83A 1Q41A 2GNGA 3O2MA 4PL4A 5FP6A 2IJMA 3A7IA 2P4IA 5BUIA 2QKWB 4E5WA 3CE3A 4NM5A 4L01A 5HG7A 3FMJA 3TCPA 4OBQA 3VRYA 3ZS5A 2VGOA 2WEVA 3BV3A 3JVSA 2ZJWA 3W2SA 2XIZA 4LGDA 5AM7A 4F7LA 2ERKA 3HA8A 3TJDA 3VO3A 4UXQA 2ACXA 1M2QA 2VAGA 1O6LA 2VTLA 4TYJA 3DKCA 2JGZA 4Z16A 4TXCA 2FB8A 2F2CB 4EORA 4RX7A 4IJPA 3BI6A 4KSQA 4EJNA 3RHKA 3ZSGA 3IS5A 1FINA 2BRHA 2ZB1A 3R71A 3AC3A 5A46A 3O50A 3ZXZA 1J91A 4TT7A 3OWLA 4U42A 3IECA 4QT1A 4BCHA 2XK8A 1B38A 4MWIA 3EQIA 4XV2A 5CSHA 1JKKA 4D58A 1PJKA 4C34A 2C0IA 4D2RA 4DEEA 2AYPA 3NNXA 4S30A 2JIVA 3EOCA 3POZA 4NWMA 3C4FA 4IVAA 2PE0A 3QALE 2X4ZA 1YVJA 3FI4A 3LMHA 2QU5A 3TZ8A 3U4UA 4U9AA 3AD5A 1ZWSA 5LARA 3PXYA 5CLPA 4F9BA 3V8SA 5BX0A 4G34A 1E1XA 1JSUA 3R6XA 5DEWA 5IQDA 5DRBA 3R7IA 2BDWA 3PXKA 4JIKA 1M17A 1GIJA 3RPOA 4D2VA 4IX4A 1F3MC 2OO8X 4TKSA 4A9SA 2JDOA 3TNPC 1LEWA 2KULA 5FDPA 5M53A 2PZ5A 1ZYJA 5A14A 3IGOA 5CI7A 3AOXA 3BBTB 3CLYA 4AXAA 2OJIA 2R3NA 4CFUA 4AS0A 3LCSA 1I09A 4QQJA 2CLXA 2O65A 2YISA 2X81A 5JFVA 4ZSLA 5I5ZA 4FTKA 2REIA 3EMGA 3ZXTA 1I44A 3TV4A 4AWIA 5HGIA 5H9BA 3R7YA 4CKRA 4DCAA 5AP2A 5AUXA 2RG6A 2RL5A 1UU3A 3F2NA 3FKLA 3RPVA 2W7XA 3CGFA 5AR3A 3FI3A 5M51A 4AW5A 4BCJA 4W9WA 5L6OA 3G9NA 2WTWA 1BX6A 3O23A 3P7AA 4H05A 3TDVA 3CJFA 3HAVA 4MQ2A 3CY2A 3UOLA 2YDKA 2VO6A 3TUDA 4XP2A 4OBPA 4YTCA 2GHMA 4ZJIA 2YDJA 3KFAA 2W17A 4XBUA 3KY2A 4XG9A 4F1MA 2Z60A 1YI3A 3LM0A 4JAIA 3NW5A 4KINA 2X6DA 2WMXA 4L45A 3VUIA 2J6MA 4JX7A 4YJPA 5CF6A 3KA0A 3R8MA 4CMTA 3HAMA 3E8NA 5AA9A 5ETCA 4QQTA 5J87A 5A3XA 3RK9A 4WRSA 2OJ9A 4O83A 5C8NA 4WO5A 4EHEA 3HEGA 4UALA 3HECA 3C4EA 5ANDA 4AZWA 4FK3A 5FEQA 2P33A 1YWVA 3GNIB 5DPVA 3DBEA 2PUUA 3GB2A 5LOHA 2PUNA 5HVYA 3S1HA 3R2YA 3DFCB 3TJCA 3HP5A 5KMOA 3PVGA 4QYYA 2BDJA 3TNHA 3S00A 3RCDA 3L8XA 3UIBA 3U6JA 2RG5A 2X8EA 4IM2A 5IQEA 3OFMA 3MS9A 3QCSA 5J79A 2P55A 3MVHA 4YHJA 2J7TA 3OT8A 4FKLA 4YJVA 5TO8A 1JBPE 3LJ1A 2O64A 4BBFA 2UW8A 5DLSA 3RI1A 4F08A 5M06A 4FV3A 3MH2A 5IA5A 4OTGA 2HZ4A 4M97A 4EH2A 2VTHA 2WU6A 2X1NA 4FSYA 4G3CA 5AV4A 3PYYA 4JDHA 5EW9A 2R3MA 4BKYA 3KK9A 4XRLA 3RZBA 2R3LA 4ZJJA 5M4IA 3EN4A 4AW1A 2NRYA 5L8JA 3I4BA 4D1SA 2Y4IB 2YA9A 4P5ZA 3ACKA 1QL6A 4EWQA 5M4UA 2HZ0A 3O7LB 3ZZEA 4C7TA 5CEOA 5ICPA 2QOCA 4E20A 4EL9A 3UODA 1OITA 2BZIB 2GNFA 4YSMA 5HD7A 5CU4A 5DI1A 3DNEA 3WF5A 5EQYA 3BHTA 2YIWA 3PP0A 2W1GA 4IM3A 3SHEA 3TV7A 3QZHA 5FTGA 2B54A 4N6YA 3SA0A 1PXPA 4FEQA 4KIKA 4DLJA 2CNVA 2XM9A 2VU3A 3UO5A 1CTPE 2HK5A 2IZSA 2F9GA 4U6RA 4UWYA 4EK6A 4G3FA 1YXUA 4FMQA 2XJ0A 3HRCA 1OIRA 4XNEA 4DEIA 2XIYA 3BU3A 5FWKK 1V0BA 5FUTA 1GZ8A 5HICA 4NTSA 3LFEA 3IDCA 3GQLA 3VN9A 2QD9A 4AN2A 3Q6UA 3TKHA 3WE4A 4R5YA 3C7QA 4K6ZA 4BC6A 3GQIA 4UMRA 4FT9A 4RQKA 5ANGA 5AV0A 4C8BA 4LL5A 3RHXA 4IFGA 4FIJA 4MBJA 1HCKA 3QFVA 4GT5A 5EI6A 3TM0A 3TZ9A 2LGCA 3DBDA 3R21A 1YXVA 4S31A 4NCTC 5EM8A 3W16A 4NTTA 4TRLA 1JNKA 1B39A 4IX5A 3FXZA 4DFLA 4I6QA 4HGEA 2WQMA 2OIDA 4B9DA 2A0CX 2IZRA 5EW8A 3BYUA 2R4BA 1ZMVA 3VUHA 3PUPA 2R5TA 2DS1A 3UG1A 1WVYA 3KL8A 5G1XA 4IZYA 4AGWA 5J5SA 1H25A 1UV5A 3P4KA 2XNMA 3R8ZA 4U81A 3R8PA 3ZOSA 3ZSIA 4ACHA 4IB1A 4ZS4A 3R7UA 3KXNA 4I5CA 4KRDA 4HVGA 4ZTMA 1H8FA 3MB6A 1WBWA 3FDNA 2J4ZA 2FSOX 3O8PA 4FKTA 3ZZWA 4QMUA 3IW8A 5FGKA 3BEGA 4BBEA 4CYJA 2WQBA 4IX6A 4BHNA 2UW6A 4L3JA 5K5NA 4K33A 4CLIA 4AW2A 1OL6A 1EH4A 4KAOA 4GG5A 4EQUA 2VGPA 3GVUA 3FI2A 4TL0A 2XH5A 3ZBFA 4RIXB 3Q9WA 4FVRA 3BYSA 3A8XA 4IB5A 1IA8A 4O7ZA 4WT6A 1U5RA 2J0LA 3EL7A 3RK5A 2JFLA 3QX2A 1BLXA 4Y5HA 3VF9A 4DEGA 3FY2A 1HOWA 2HOGA 3HKOA 3OROA 4RBLA 4ZZNA 5AUZA 2ZM1A 5DNRA 1U54A 3UDBA 4H39A 1DI9A 3BLRA 4BDAA 2W0JA 3MVMA 3LFNA 2OJFE 4RJ4A 5BVKA 3RPRA 3UZPA 2VTOA 3HVCA 4TNBA 2PVJA 3T9TA 4FE2A 2BRNA 3RWPA 1XBCA 5JRSA 3W2OA 3L8VA 3WARA 4O7TA 4KA3A 3ELJA 3K2LA 4KB8A 4ZTLA 5JQ5A 1OIQA 2X39A 4BR3A 4ZTHA 5DT4A 3SXRA 3DT1A 3UE4A 3WZJA 3NUAA 4GH2A 3PWYA 4QMNA 4MYGA 4XG7A 1CKIA 2ZV2A 3DY7A 3NGAA 5CT0A 2DYLA 5M55A 2BRGA 5HIEA 3GUBA 3NPCA 1WVWA 4BB4A 3PPZA 4IC8A 4DEAA 5HVJA 3LE6A 1RW8A 3ET7A 5EHLA 4FC0A 4BTFA 3G33A 1CKPA 2OW3A 2C3KA 4NT4A 4RA5A 3CR0A 5DT0A 4M13A 3DK6A 5M57A 3W1FA 4UZDA 4JNWA 4CKJA 3FBVA 5HIDA 2QOFA 2W5BA 3OW4A 2BZKB 3W2CA 4L7SA 3IKAA 3RWQA 2HY0A 3PE2A 3OXZA 2AC3A 4QPMA 3QAME 4GEOA 5D7AA 4C35A 1PF8A 3BRBA 3C4ZA 4YC3A 5K0XA 2Y4IC 5CF4A 2RIOA 2XYNA 3MTFA 4TWOA 3VUGA 2I6LA 2WU7A 3CPBA 2A1AB 4KKEA 3ORXA 1ZOEA 3QU0A 3RNIA 5IUHA 4QYGA 4O0TA 2XVDA 3R9OA 4LRJA 4RIWB 5DH3A 1OL1A 3ALOA 3I7BA 3V04A 5IEVA 3UIXA 5J5TA 3OZ6A 4L53A 5E1SA 4QP8A 1ZLTA 2I1MA 4YURA 2ITXA 1L8TA 4S32A 3CIKA 4XCUA 3AD6A 4R5SA 3EFKA 5TE0A 4YC6A 3AT3A 3ZFXA 4QTAA 4CV9A 4GFOA 3FZSA 2ZV9A 1Q99A 4AW0A 2XZSA 2GSFA 3ZLXA 3HV5A 3D0EA 4KS8A 2WEIA 5D1JA 3DCVA 3EL8A 4ZP5A 3GC8A 3RJCA 3VW6A 4BCOA 1V1KA 3R1NA 5FG8A 1A48A 4FNXA 3FUPA 3SOCA 2QODA 2OWBA 2P0CA 4XG6A 3A7JA 3A8WA 1OI9A 3JY9A 2J0KA 4IANA 5IEYA 4RJ6A 2W1FA 3KCFA 3OEFX 4QP9A 5KBRA 3HGKA 4F7SA 4LUDA 3HDMA 2PULA 3G6GA 4FKJA 4I41A 1Q8ZA 4FG7A 4BWKA 3DLSA 2QQ7A 3TN8A 3UC4A 5DYJA 2UW0A 2YIXA 4C2WA 3W2QA 3CSVA 4FKUA 4A9UA 4FIHA 3MY0A 3PPJA 3BX5A 4AGDA 3MJ2A 2ZB0A 4I1ZA 4MD8E 4R3PA 1Q8TA 2C4GA 2ZYBA 4FEUA 2H96A 5HVKA 4YHTA 3IDPA 4E6DA 3RAHA 1R3CA 4FV2A 5B2KA 4F7JA 5ANKA 3TNQB 3ANRA 4Q9SA 4A06A 4TYHA 3PE1A 2QU6A 4TYIA 3GU7A 1QPJA 3WF9A 3FHRA 4WNPA 3UYSA 4FT7A 1ZMWA 3OY3A 2C3LA 3I6WA 5ITAA 2O8YA 4RT7A 2JEDA 4NM0A 3E8CA 4YHFA 3AMYA 3S4QA 4DF3A 4HYSA 4JBVA 2QO9A 3LFCA 4L67A 4BY9E 4B6LA 4JG6A 3P5KA 3OS3A 4C4FA 4CCUA 1YOJA 2JIIA 2R7IA 2UVXA 3DKOA 3FLSA 1VEBA 4B8LA 4FNYA 2QG7A 4KKHA 1UVRA 3BHVA 3H9RA 4YTIA 3M2WA 3Q5ZA 3VUDA 4DG2E 2EUFB 2CGWA 2HYYA 2JKMA 1NVRA 3FY0A 3I79A 4O0VA 3VVHA 3ZYAA 4CCBA 4GW8A 5GJFA 4GYIA 5HBEA 4M7IA 4WRGA 5KKRB 3R7OA 3R30A 4UMTA 5IMXA 4Y46A 3IW5A 5BYZA 4AZSA 3QC9A 3RVGA 3R9DA 2XK6A 2ZMDA 3ENHA 2PHKA 5IA4A 5J9YA 4HVHA 4CZUA 4F70A 5C4KA 3OWKA 3DGKA 5A6NA 2PVRA 3E64A 4ASDA 2BILB 3L9MA 3DBCA 1BI7A 1KE7A 3KREA 1XBAA 1TQPA 2GS2A 4O2ZA 4FZAB 3NCGA 3P1AA 2PVYA 4FL3A 2IVUA 4RIYA 3ZDUA 5IUGA 1GIIA 4NEUA 4AT4A 5A4CA 2XRWA 2VNWA 5E92A 3FLQA 4BZOA 3ZO4A 2OFUA 5D12A 1A06A 3CTQA 3UG2A 1OM1A 2WQEA 4FKOA 2RGPA 3UMWA 2YIYA 4KD1A 3SG9A 3MFUA 4WUNA 4ACMA 3QTWA 3IOKA 2RFSA 3KXZA 4QQ5A 1PMVA 3OD6X 3OG7A 4ITHA 5DHJA 2WO6A 3VS6A 3KF4A 1S9IA 3JY0A 4FGBA 4FSWA 4AG8A 4E3CA 2OKRA 4RWIA 2H9VA 2OZAB 3SD0A 3VS1A 4J97A 3LXLA 4O0UA 2X6EA 5AV3A 4OTIA 3GEQA 3IW6A 4FODA 5E91A 4A4OA 4UYNA 3E8EA 4CYIA 1XWSA 3DKFA 3JXWA 4HCVA 2UVYA 4ALVA 4O7WA 4A4XA 5E8TA 4XG2A 1PKGA 3PZHA 4FV1A 4MKCA 4RX8A 2G15A 2FSMX 4WOVA 2Z02A 5GZ8A 3VUMA 3GC9A 4IVDA 5CEKA 3GFWA 4M66A 4N4SA 5CEMA 2VWVA 2OIBA 4KBCA 4F9WA 2BHHA 2CKEA 2UZUE 5DA3A 2JIUA 3UIUA 3BKBA 2YACA 3LFDA 4BWXA 2X9FA 2H8HA 2VX1A 2XBJA 3MYGA 4G6NA 4MXZA 3QRTA 2F4JA 5CU2A 4IVCA 3B2TA 3BQCA 3BLHA 5B2MA 4MXYA 5CEQA 3FQEA 4WBOA 3H0YA 3ZRMA 3MY5A 4HVIA 4GCJA 1H1RA 3UO6A 2WTCA 4AZVA 2UZEA 4FOBA 2XNPA 1PMNA 2YM7A 5AP5A 4RC2A 3R28A 2O0UA 3C0IA 3DOGA 3LLAA 3GU5A 4AFEA 4D2SA 5HLWA 4FV0A 4I20A 4DE4A 4G3GA 3WF8A 2I0EA 4BDGA 4QMLA 4S33A 4BDFA 4YPSA 5KO1A 4KIKB 4D5KA 4L68A 4O6LA 3ORMA 5DE2A 2Z7QA 1YHSA 2EWAA 2ITQA 3CPCA 3D5UA 2HIWA 3FYKX 3SKCA 4ANLA 1IEPA 3ERKA 3PRIA 4IADA 4JDJA 3ENMA 2C6OA 3NUYA 5CENA 4BRXA 2QOKA 5AR5A 2OG8A 4TYGA 3ROCA 4NFNA 2YAAA 4AQCA 2BZJA 1U4DA 5CALA 3ZH8A 3MFSA 5BVOA 4YTHA 4DGOA 3E7OA 3OW3A 4QP1A 3PTGA 3DPKA 4FKRA 2FSTX 2X2LA 3DAKA 3ORLA 1XQZA 5IDNA 5GZAA 4M3QA 4HNIA 5EYMA 2UZOA 3C13A 4F6UA 4E6QA 4FYOA 3VBQA 2HZNA 4ZK5A 2QO2A 4J71A 4X3FB 4GUBA 5E8WA 2WOTA 3R9HA 2HAKA 3NX8A 3PXZA 4W4VA 4BF2A 4TPTA 1DS5A 4RC4A 2YABA 4YJUA 4PP9A 4H1JA 3KC3A 3ROYA 4NIFA 3FSFA 1O6YA 1PXMA 1YKRA 2F7EE 2X2KA 5K0KA 4BGQA 4RLKA 4UMUA 3HMIA 1XR1A 5FXQA 3TG1A 3G15A 4UWCA 4EONA 1KWPA 2I40A 4D4SA 4C61A 4R7IA 4QTEA 2W99B 2PMLX 3RP9A 4GT4A 2Q0NA 4FA2A 5HZNA 4YZCA 2CGXA 5KKRC 4JG8A 1WVXA 3ORIA 4TWCA 5AUYA 1JSVA 5TR6A 3THBA 5DGZA 5M08A 5CVGA 3RINA 4YO4A 1REKA 4KSPA 1G8SA 3HMPA 4G16A 4LV5A 5HU3A 3GXLA 3U51A 4CQEA 3ODZX 5CEPA 5CXHA 2CJMA 3O0GA 4KWPA 1JKTA 4OTWA 1F5QA 3CS9A 3T3UA 5T3QA 4FIEA 3H30A 5DEYA 4BCMA 3ATTA 1BUHA 3QD0A 3COMA 2XMYA 4LMUA 3O51A 4CFVA 2GS7A 3PJCA 4BCIA 5F1ZA 3V8TA 2E9PA 2XCHA 3P08A 4D9UA 2WKMA 2A2AA 5IA0A 2R3GA 4ZZOA 2BCJA 4QMMA 4DEHA 4E1ZA 2UW4A 4FBXA 4FSNA 4LGHA 2PVFA 1T46A 1APME 1PY5A 5F9EA 2DQ7X 4DINA 3TACA 4RX5A 3TUBA 1H26A 4JAJA 4M69A 1UNGA 3ULZA 4WG5A 3DTWA 3G0FA 3UVRA 1OIYA 4PDYA 4YBKA 2BAJA 3F5UA 3A7FA 3NYXA 5BUEA 3ORKA 3N4TA 3KRLA 5C03A 4FTTA 4XJ0A 3MB7A 3I0QA 4PDSA 4RJ3A 4EJ7A 5HTCA 3VIDA 4GL9A 3UYTA 2ZVAA 3FPMA 4C4IA 2WTIA 2YIRA 5CU6A 5CYIA 2VWZA 4UY9A 4YJSA 3RNYA 2VO3A 5C01A 3JUHA 4YUQA 4XP0A 4WD5A 3F9NA 4JJRA 2F49A 5HO7A 2H6DA 3KXXA 4PV0A 5LCJA 5LMBA 2JDVA 1URWA 3CC6A 2XRUA 3DTCA 2PE2A 3BCEA 4GUEA 5DVRA 4CXAA 3KRWA 5F20A 5M4CA 2GNLA 2RF9A 5L8LA 3HUBA 4GT3A 4LRKA 4B0GA 4AA4A 2FGIA 2GDOA 5IU2A 4ZOGA 5IQGA 4CMUA 5GIOE 1VJYA 2CCHA 4QP3A 2C6MA 2ONLA 5HE1A 5CXZA 3GBZA 3ZRKA 3D83A 5HQ0A 2R2PA 2V7AA 3BEAA 3KCKA 4XLIA 4CVAA 3VS3A 4HVDA 1Q24A 2JC6A 2IW8A 5CF8A 2BVAA 2HXLA 2EB2A 3OOMA 4QMWA 4MNEB 2YZLA 2OICA 4C36A 1XH9A 3HDNA 2RSVA 4OUCA 1B6CB 3A4PA 3EIDA 3MH3A 3ALNA 4EUUA 3QCQA 5ANOA 3IO7A 4YZBA 3NUSA 5CSXA 4PL5A 3BIZA 2IW9A 4IWOA 4OAUC 4HGSA 4QMXA 2PSQA 3PG1A 3UJGA 1OUYA 2YCSA 3NVMB 2CGVA 3FV8A 3MI9A 2OH4A 4OW8A 5FRIA 3FQHA 4XYFA 3NUPA 4ZAUA 2BAQA 3MSSA 3QD4A 5B0XA 3SAYA 3HZTA 1E1VA 1R1WA 4E7WA 4F1TA 3OTVA 4XX9A 2A4LA 1FOTA 2FYSA 2VTAA 4M67A 4NKSA 2IO6A 4AT5A 5CEIA 2ZAZA 3I81A 5G6VA 4KBAA 4U40A 3IONA 3D2IA 3VJNA 1MUOA 4IVBA 2W1IA 1M7QA 5CWZA 5T68A 5FM3A 2Y4PA 4L3LA 4S2ZA 2WMSA 4CRSA 2BROA 3QCXA 1OKZA 4PUZA 4DTKA 5C8KA 5I0BA 4I21A 3CTJA 4CTBA 4ZLZA 3GCQA 3VBTA 3VS4A 2X0GA 3ZFYA 4U41A 3QXOA 1XH8A 3EQBA 4FVPA 3TIZA 1XH6A 2QLQA 1STCE 1FVRA 2EXMA 3EJ1A 3VBYA 4PP7A 5J7BA 2WQNA 4XG4A 2CN8A 2ETRA 3KMUA 1Z5MA 3FLNC 4C62A 5CAUA 5HX6A 4X3FC 4N6ZA 4PRJA 4D9TA 1VYWA 4YGAA 4I92A 1Q8WA 4GKHA 3QD2B 2CLQA 5I9WA 3IG7A 3AT4A 1H4LA 5HCXA 4L6QA 5E8ZA 4BFMA 5BVDA 4CG8A 3LLTA 5FQDC 2XNGA 5C4LA 3ZEWA 4YPDA 3TZ7A 4YC8A 3H4JA 4BCNA 3LXPA 4I5PA 1R78A 1BYGA 3FZTA 3BYVA 1WBNA 3C9WA 4JR7A 3FL4A 4IFCA 2PMNX 4MK0A 4AZFA 2BFYA 4DC2A 3R1SA 5LCKA 3DXNA 3E5AA 2XEZA 3CCNA 3U87A 4CNHA 4F9AA 4FEVA 3B8QA 3CTHA 3GT8A 4QMTA 4O0XA 2FA2A 3UP2A 3PY1A 2VV9A 4B99A 3GU6A 3C50A 3ITZA 4OTPA 4G17A 4HW7A 3VBWA 2NP8A 3ZEPA 1V0PA 3OXIA 3ZUUA 4IDTA 2EXEA 3IPHA 2Y6MA 4MCVA 3DB6A 2VZ6A 4L9IA 3W32A 1A9UA 3FLZA 4BZNA 4ZXTA 2VRXA 2V55A 2OGVA 1AGWA 1XBBA 4H58A 4USEA 1H1PA 4MXAA 4ZLYA 5EOLA 3NWWA 4ZSEA 3WOWA 3TZMA 3BLQA 1OZ1A 2X9EA 3DFAA 3HL7A 4RMZA 2OI4X 3LM5A 2CGUA 2GPHA 3HRBA 1GOLA 2QONA 3NYNA 5L2SA 2XNNA 3U8WA 4DEDA 2AC5A 1BMKA 5DN3A 1SNXA 3BU6A 3KGAA 4L8MA 4DLIA 4YLKA 5CU3A 5K4IA 4I5MA 3MFRA 3F66A 4FSUA 1RDQE 4AUAA 2PMOX 3ZC5A 3EQRA 2WTKB 3NYVA 3TIYA 4AZTA 3LJ2A 5AMNA 4BYJA 4QYHA 1M14A 4X2JA 4ASXA 4AA5A 4FOCA 3H10A 4YSJA 3F2AA 5AR8A 3NMUF 3MDYA 4BI0A 3JYAA 3MIAA 1YOLA 2YM5A 4IQ6A 3CKXA 3NIZA 4BTKA 4FTLA 5LQFA 4QMPA 5AADA 3QTRA 4V0GB 2GNJA 1VZOA 3FKNA 2VTMA 3CEKA 2UZDA 1YHVA 4U44A 3FJQE 3V6SA 4AZEA 5KMNA 3FMHA 4FSZA 3C4CA 4WG3A 5EYDA 3I5NA 4PF4A 2W4KA 5K9IA 3AD4A 1Y91A 1FGKA 2W1ZA 2PUIA 3SW4A 5GIPE 4EHGA 3Q4CA 4O96A 2WMWA 3A4OX 1ZZ2A 4BGGA 1Z9XA 3QYZA 4KNBA 4RLLA 3TV6A 1H1WA 3NW6A 3UVQA 4CV8A 5B2LA 3CKWA 3NSZA 5GJDA 3EFWA 3LPBA 3EFLA 4UWBA 4GSBA 4EK5A 2XYUA 2ZV7A 1W8CA 3ZC6A 1P14A 5JN2A 4JI9A 1UNLA 1H1SA 3PP1A 4ITIA 4ZSGA 2YWVA 2VTQA 3V5LA 5KMIA 4H1MA 2B55A 3O8UA 2XF0A 4J1RA 2V22A 1H1QA 4ZEGA 3QA0A 4YZDA 4K9YA 2ZDUA 2Q83A 2J2IB 1NA7A 4RJ8A 2BRBA 2AUHA 2X4FA 3D5XA 2NNWB 4FKQA 1ZYLA 2R3QA 2CSNA 3U9NA 4ID7A 3RCJA 4XUFA 4IHPA 5H8GA 2VTSA 5AP1A 4F09A 2GNHA 2YCQA 4ZTSA 2CPKE 2W1DA 2Y8OA 4EOJA 5L2TA 2C5VA 1OPKA 4O7NA 4J8MA 2C0OA 3BQRA 1YWRA 2W05A 2XNEA 3GCVA 4BBMA 2CKQA 1JPAA 2XKFA 4FIGA 4YNEA 3VS7A 1Q61A 1WBPA 4CFXA 3OCSA 3QHWA 4JBPA 3QTXA 2VO7A 4CFWA 3K3IA 5JSMA 3N4VA 3QKLA 1MRVA 1J7UA 5IPJA 3NRMA 3G5DA 5E8UA 4HZRA 2JFMA 4ZMEA 4YP8A 1H27A 2W06A 4IAFA 3OY1A 2Y7JA 3D7ZA 4QMQA 5AEPA 3GFEA 4IAKA 2ITUA 4C58A 4QPAA 4O2PA 4W8DA 2XP2A 3ZM9A 4WKQA 3R7VA 4F0IA 4DA5A 4JBOA 4DFNA 5EQPA 3PJ8A 2J5FA 4Z9LA 5IA2A 1FPUA 3BWFA 4KS7A 4IM0A 2O3PA 2JDTA 4F4PA 5A4LA 4R1VA 2R3FA 5HNGA 4OTQA 2E2BA 4EHZA 2J51A 1ZXEA 2XKDA 4AACA 2C5NA 4I6BA 3UPXA 4BIDA 4YJRA 3OP5A 4BCGA 5B7VA 4U79A 5C1QB 2UV2A 4X0MA 4ZTQA 4JR3A 3VBXA 3PSDA 3GOKA 4U7ZA 3A2CA 5HI2A 1U59A 5I9YA 4ACDA 4FKVA 5ANIA 4CFFA 4OLIA 5JGAA 3M42A 3Q60A 4NW6A 3UPZA 3QQFA 4RGJA 4ALWA 3QGYA 3S3IA 3C51A 2PTKA 3P7CA 3NZ0A 4I0RA 3LMIA 3UOKA 3UMXA 2R64A 4JRNA 5IH5A 2ETMA 4ARKA 3OWJA 1WAKA 5LXMA 3D7TA 3AXWA 1YW2A 3COKA 3QLGA 3BELA 4J52A 4K1BA 4U3ZA 1X8BA 2WMTA 4JOAA 3MVJA 3NYOA 4X2FA 4EYMA 5BMSA 2WD1A 4MXOA 3F5PA 3ZLYA 5DFPA 3W2RA 1GZKA 2R3HA 5TOZA 5BQ0A 2IVSA 2WNTA 4MH7A 3ORZA 2F7XE 4M68A 4ENYA 1OL5A 5CF5A 4U8ZA 2VO0A 3RZFA 3OCGA 2C6LA 3VS5A 2J5EA 3KULA 4ORKA 4IX3A 3MA3A 2QOHA 4PX6A 4QP4A 1DAYA 3QUEA 4CQGA 2BAKA 3HYHA 2A27A 3ZO2A 5F95A 4YLJA 4MVFA 4FV9A 1HCLA 4RVTA 3SQQA 5LJJA 4UX9A 2ITTA 4BZDA 3DXPA 2IG7A 3Q9XA 3I6UA 5ETAA 4MXXA 3QZIA 4EC8A 3A7GA 5KMJA 3UBDA 1IAHA 3SV0A 3KQ7A 4OTRA 5JGBA 5JZJA 3U54A 3WIGA 3RAIA 4XRJA 1PXKA 2SRCA 2IZUA 4O6EA 4BDHA 4HGTA 4IZAA 4BWPA 2XS0A 3AT2A 4AOJA 4LMNA 3F7ZA 4DTBA 5AUVA 3R2BA 4FVQA 3FLYA 1PRYA 3L1SA 3BZ3A 4DG3E 1S9JA 4X7QA 4NFMA 4YNOA 4O82A 5LMKC 2J50A 3ETAA 1DI8A 3FZOA 5HO8A 3UNKA 1XH7A 3V8WA 5JFWA 4TW9A 4V05A 5EI8A 2XJ2A 2O5KA 2XJ1A 5HU9A 2OH0E 3QUPA 4KIQA 4QO9A 5AR2A 4BCFA 3W10A 3WI6A 2B9FA 1WBSA 3EZVA 2J0MB 4Y83A 3TKUA 5LVPA 3KF7A 1DAWA 4G9RA 4YTFA 4MF0A 1G3NA 4BCPA 4II5A 3BHYA 3LCDA 3QF9A 4FZFB 4PNKA 2W1HA 4YR8A 2BIYA 2E9NA 4QMZA 3V5WA 3RAWA 4CKIA 3UQCA 3QTSA 3NNVA 2RFDA 2FVDA 5IH6A 1FBNA 2BTSA 4GVAA 2YIQA 4O0YA 1J1CA 2C69A 3TTIA 3T8OA 4LRMA 3V6RA 3QTIA 5FXRA 2VWXA 4HPUE 4ZY5A 2YM3A 3QTUA 4IW0A 2R7BA 4RPVA 3ZM4A 4WHZA 2XEYA 2R0UA 4FUXA 2C0TA 4NM3A 4IB3A 1KUTA 4IJ9A 4BTJA 4YBJA 3TNIA 1VR2A 2C6IA 3NW7A 3PZEA 5IF1A 5AA8A 4OGRA 5E4HA 3NNUA 4D55A 2YAKA 3V51A 2UW9A 3BE9A 4MHAA 2JAVA 4FTNA 4PMTA 4GU6A 5IQAA 1H24A 2HY81 4RSSA 2UZLA 3NR9A 4C3FA 3QL8A 4IIRA 4UB7A 2R3RA 4EKLA 1Q4LA 4O22A 5FM2A 4P4CA 4MXCA 5EM7A
chains in the Genus database with same CATH superfamily
4QNAA 3FLWA 3H0ZA 3MJ1A 4BDCA 5A4EA 4E8AA 4NCTA 3ACJA 4F6SA 4X2NA 5H2UA 5AX3A 1BL6A 5KX8A 4L43A 5AIRA 4AOIA 4BI1A 1IAJA 1CDKA 5KZIA 2YITA 4FYNA 2VWIA 4JQ7A 1XHAA 4GYGA 1R39A 2P2IA 2ZDTA 3QZGA 4IDVA 4C4EA 2J0IA 5AJQA 4D2WA 5LWMA 4HZSA 4JQ8A 4O7RA 1OUKA 4NK9A 5L4QA 3K3JA 5BVEA 1YRPA 3SX9A 3BHHA 3EKKA 5AP4A 2PYWA 1UU9A 1ZY4A 2ZM3A 4WA9A 3AGLA 2QNJA 4D28A 5A9UA 5JEBA 4GFGA 5BMMA 3QYWA 3D14A 1YWNA 3BE2A 3GOPA 3I60A 2BFXA 4FSMA 3ORTA 3UDSA 2HENA 5AUUA 3FWQA 3A7HA 1L3RE 4FNWA 3P5JC 1G5SA 5E7RA 2CNQA 1IRKA 4GJ2A 3V3VA 4AT3A 4BVUA 3IOPA 5DR6A 3II5A 3OC1A 4JDKA 1OMWA 3E3BX 4E4NA 3SW7A 4FKSA 3HMMA 4EKKA 3T3VA 4I22A 3RBWA 5KBQA 2X0PA 2I0VA 3WZDA 4RFYA 2QG5A 1PYEA 2VTJA 2QR8A 2PK9A 5EH0A 4C4GA 4PTCA 1OKVA 1RQQA 2R3PA 4FR4A 5D41A 1Z57A 3LCOA 4IE9A 4NU1A 3W2PA 4ZY6A 4YMJA 3A60A 3KRJA 2GQSA 5FEEA 3PA4A 4BN1A 2BUJA 5HE0A 3B8RA 3KU2A 3PWDA 3RMFA 2W5AA 4XEYA 3KMMA 1KE5A 4R7BA 4ZY4A 3FPQA 4CLJA 5C27A 4MEDA 2PL0A 3GU8A 4HYIA 3R83A 3F3VA 3A61A 2XK9A 4QP6A 3KK8A 4DGGA 5DRDA 2HWPA 4LL0A 3BYOA 5ANJA 2JBOA 3DJ6A 3GI3A 4FUYA 2YM6A 4HYUA 1CKJA 1SNUA 2B9JA 2GCDA 3F3WA 3FE3A 3ODYX 4EOOA 2YZAA 3F82A 5HO6A 3DJ5A 2C1AA 1QCFA 2VWBA 3QWJA 4ZTRA 1ZY5A 3F61A 4O86A 3PXQA 4BJJB 4C59A 5CY3A 4N70A 3ZRLA 5AP3A 4EEVA 4FT3A 4L3PA 4RJ7A 5EW3A 2YM4A 4L00A 2VTRA 4KBKA 3HRFA 3NIEA 4J96A 5CU0A 5IEXA 1FVTA 1OL7A 4GS6A 3QQLA 5IUIA 2YFXA 3QLFA 4G3DA 4MQ1A 4BDDA 2ITOA 3Q4TA 3SXSA 4C37A 3OBGA 3HMOA 3EQHA 3FEGA 3R7EA 1V0OA 4UMPA 5DT3A 1FMKA 1GZNA 4O7LA 1UKHA 5JMSA 2J0JA 4LOQA 2YERA 3GENA 4FK6A 4USDA 4CEGA 4RZVA 2OK1A 3EN6A 4FI1A 4OBOA 4EH4A 3E8DA 2BALA 4LM5A 3OWPA 4QQCA 3WILA 3WE8A 1RJBA 2WIHA 4AFJA 4HOKA 3FZPA 4TNDA 2HZIA 2JDRA 4FV4A 2HELA 5C9CA 4FICA 2XIKA 3QWKA 3NVKI 1TQIA 3CD8A 3EB0A 2G2FA 3HMNA 3LXNA 3PIYA 4R78A 4I24A 5HIBA 2GS6A 3POOA 3SOAA 4AP7A 4CZTA 5DMZA 4O84A 4CFMA 3ORNA 2JKQA 4G1WA 1OL2A 4PWNA 3TXOA 4BL1A 4FSTA 5HCZA 3Q3BA 2XK7A 3Q04A 3O17A 3RALA 2UZBA 2XA4A 3VAPA 2ITVA 4FNZA 4TWNA 4UEUA 3VS2A 3LQ3A 4HYHA 5IQHA 5EYKA 5CVFA 5EHYA 3GCPA 2OXXA 3SG8A 3BYMA 1MQBA 5T6KA 3WZKA 3DQXA 3FZ1A 2FUMA 3FL5A 4ANBA 1K9AA 5DR9A 4DHFA 2CNUA 1JQHA 2UZVA 3IDBA 5I3OA 4RIOA 5DIAA 1WCCA 4B7TA 4JBQA 3DZQA 3HV6A 3REPA 3OMVA 4KUJA 3UNZA 3O96A 4XV3A 4D1XA 3CXWA 1KV1A 1W0XC 3LFBA 3CJGA 4R6VA 1YHWA 4WBBB 4BCKA 2HWOA 4GVJA 3IK3A 2OLCA 4FTUA 4LOOA 4MWHA 1OVEA 3E87A 4DFZE 5AP6A 5BVFA 3JVRA 2ETKA 1ZYSA 2C6TA 3M1SA 3MPMA 2ITZA 3QKMA 3CQWA 5AUTA 2OXDA 3DNDA 5J9ZA 3DAEA 2G2IA 4U0IA 4BKJA 4O1OA 2X7OA 4G6LA 3IQ7A 4EBWA 2OBJA 2CDZA 3K5UA 4YO6A 3WF6A 1Y8GA 3QGWA 5I4NA 3D4QA 5KCVA 3AGMA 2XK4A 4ANSA 3V01A 4ERKA 4ZSAA 2O63A 5HTIA 2UW7A 4NSTA 5ACKA 3L9LA 5KMLA 5JH6A 4RVMA 3U6HA 3DQWA 3Q2MA 4RX9A 3F3TA 4PY1A 2XKCA 3G9LX 3PSCA 5AP0A 3FMMA 4WIHA 3W55A 3MY1A 2B0QA 1GZOA 4IMYA 4RIXA 4DGMA 3UOJA 4QDVA 1OKYA 1GIHA 2W4OA 2WOUA 2WQOA 4FTQA 4PPCA 3PJ1A 3NUNA 1ZYCA 3C4XA 2IZTA 2JAMA 3FMLA 4I6FA 4AOTA 5BNJA 1OKWA 4OT6A 1LEZA 5ANEA 1U54B 4KIPA 2V0DA 5HBHA 3KKVA 3LCKA 3WZUA 5IQFA 2WPAA 3RM7A 4E93A 3KRRA 3W8LA 3QKKA 4F99A 3I5ZA 5JQ8A 2B9IA 3SG9A 4Q2AA 3B2WA 3ZHPC 4HPTE 3Q9ZA 2X7GA 2UW3A 4AQKA 2VTIA 1Q62A 3CQUA 5D7VA 4J53A 3R00A 3GCSA 4AXCA 3ZUVA 5I9ZA 3N4UA 4O1PA 3K54A 1Q8UA 3NEWA 4JQEA 1XO2B 3TNWA 2I0HA 4IH8A 2ZMCA 3KULB 4BKZA 2JITA 4D4RA 4DITA 5CAPA 3FMDA 3CBLA 5BVNA 3A99A 5I3RA 2C6KA 1WBTA 3OOGA 4K2RA 2R3IA 5JZNA 4ZIMA 5CZHA 3W8QA 4JG7A 4H3BA 1MRYA 3R1QA 3TDWA 2IVVA 5EHOA 4NUSA 4ASEA 3O5AA 2CMWA 4H36A 3C1XA 4F1OA 2X0OA 5C8MA 3UIMA 4AGUA 3IW7A 4X6QC 4M84A 4R3CA 3QC4A 3E63A 3BV2A 4YZMA 5LVNA 4XS2A 1SMHA 2QR7A 4F63A 1SYKA 1ZOGA 2P3GX 4ZZMA 4UN0C 5I9VA 4QTBA 3BLAA 4C0TA 3R01A 3FI8A 3Q53A 4X2KA 4QP2A 4Y73A 1UU8A 2ZOQA 2VTPA 3QTQA 4XG3A 4NYEA 3CY3A 3ORPA 4L46A 3WF7A 3MGYA 1PXOA 2F7ZE 4APPA 1UWJA 1KOBA 4MBLA 5J9LA 4O7YA 2HXQA 3G0EA 1OPJA 4A07A 3MPAA 4FG9A 3VF8A 1JKLA 4TZRA 1U46A 3VWAA 2ITYA 3EQGA 4RC3A 4ZTNA 3VS0A 5KZ0A 5AV1A 1AD5A 4RIWA 3BHUA 4HCTA 3PXRA 1YI4A 2F57A 3EWHA 3HX4A 3NS9A 4Y72A 3Q4ZA 3V5JA 2QOIA 4P7EA 1H28A 3O71A 3FAAA 5AWMA 3I1AA 5KHXA 2QC6A 1LPUA 4EUTA 3V5TA 4OTDA 5JT2A 4RWJA 5K3YA 1WMKA 5GZ9A 4D4VA 1NVQA 4R1YA 4EZ7A 5AIKA 3ZDIA 2IPXA 3R8UA 3LZBA 4GK2A 4EH6A 3L9PA 5BPYA 5M07A 2PWLA 1NW1A 4FIIA 3VHKA 1H08A 1H01A 2PZYA 4JMQA 4WG4A 4GFMA 3LKMA 1CMKE 5ETFA 4KABA 4PNIA 5CI6A 5L3AA 2WTDA 3PVUA 4A9RA 1OPLA 3GC7A 1OB3A 2UZTA 4G9CA 3R22A 3TL8A 1H0VA 1PYXA 4AU8A 1PW2A 4K8AA 1ERKA 3HNGA 4O21A 2HCKA 3KN5A 3PJ2A 4JX3A 2OF2A 3PVBA 5CAQA 5L2QA 4IZ7A 1SVHA 2WTVA 4XP3A 2WMRA 2ITPA 4JT3A 4QMYA 4D0WA 1AQ1A 4EH7A 3QCYA 2B7AA 3QRIA 3U4WA 5EKNA 4C3PA 4GJ3A 4DN5A 4TYHB 3LJ0A 4HVSA 5HESA 2EU9A 5EK7A 2W1CA 4C2VA 3PG3A 3PPKA 4GK3A 4I3ZA 4IEBA 3QA8A 5AM6A 3DBFA 3ZFMA 2PVMA 4P2KA 3KN6A 3UVPA 2FO0A 2PZPA 4ONAA 4WNOA 2OJGA 4DGLC 5TF9A 4Z7GA 1KOAA 2WAJA 5GNKA 5HLPA 3VRZA 1PXJA 5FD2A 3Q6WA 4HGLA 3F3ZA 4QOXA 4QTCA 4XG8A 2W4JA 3EYHA 3MFTA 4I94A 5IQBA 2C5OA 3I7CA 3ZONA 2XBAA 2OZOA 3KVWA 5IZFA 1ST4A 4PMSA 3QBNA 3R1YA 3D5WA 4RJ5A 1J1BA 4C57A 4RA4A 2BDFA 2YLFA 4GIHA 1GNGA 3AMAA 5I9UA 1GJOA 3QZFA 2V5QA 3JPVA 3TWJA 1UWHA 3R9RA 4PDPA 2EVAA 2R3KA 4J98A 4XH6A 5HE2A 5CNNA 3C5IA 1QMZA 4DT9A 1JSTA 2HW7A 4C4JA 1K2PA 4RFZA 5KUPA 1WFCA 1PKDA 1SVEA 4MTAA 1M2RA 3VBVA 1U5QA 4IWDA 3QXPA 4O0RA 3GP0A 3KMWA 2HW6A 4MD7E 5J8IA 4EYJA 2XK3A 5FP5A 4C33A 4JXFA 2BTRA 5HEZA 5AX9A 4RIYB 4DH1A 3COHA 1ATPE 4WNKA 4JLCA 3DZOA 2F2UA 3NUUA 4XV9A 1TKIA 2O2UA 3E88A 2VWWA 5D9HA 4UYAA 3LFAA 4U43A 3EQDA 2J90A 4ZLOA 2IEWA 2R3JA 4H3QA 4TTHB 2ZM4A 3PLSA 1Y6BA 1R0PA 3D2KA 3W33A 4GMYA 4BDBA 2OFVA 2XCKA 2W96B 3EZRA 4EHVA 1ZRZA 4DH3A 4CT1A 2PUPA 4EH5A 3UZRA 4QMSA 3N9XA 4L7FA 1QPCA 4IB0A 1P4OA 1YDSE 2XIXA 4AE9A 4O7VA 3CQEA 3HUCA 4RRVA 4UZHA 5AP7A 2LAVA 4E73A 4CG9A 3OEZA 2Z7SA 2OZAA 3ZLWA 3OCTA 5CASA 2VNYA 1QPEA 1P4FA 1OBDA 3MPTA 3ZBXA 4J7BA 4F0GA 4E4XA 3C0HA 4PTEA 4O38A 4HJOA 1REJA 5E90A 2I7QA 3U9CA 5L6WL 4QMVA 4DBXA 3DS6A 1YDRE 3L8SA 4CRLA 4NJ3A 4NJDA 3EYGA 4EH3A 5BVWA 3DAJA 4CGAA 3EFJA 3MH0A 1VLRA 3OHTA 5EG3A 1SM2A 2PU8A 3ZCLA 3MWUA 3PVWA 2YLEA 1Q3WA 4ENXA 3COIA 1P2AA 2XIRA 4GV1A 2JLDA 4I23A 4IWQA 5HG8A 3LCTA 2YWPA 4TWPA 1J3HA 5K4JA 4EOIA 5HNIX 1JLUE 2QO7A 1Y6AA 3ZUTA 3P86A 4FZDB 4W4WA 4MAOA 4UV0A 2JDSA 3CP9A 2XKEA 4ZSJA 5FTOA 3DKGA 3LMGA 4NZWB 2GNIA 5IDPA 4AN3A 1UKIA 5IG1A 5EYCA 3BBWA 1H07A 1ZYDA 1J7LA 3PFYA 3QQJA 4HCUA 5FBNC 3MV5A 5L6PA 3F88A 2Z7RA 4O7SA 4EOPA 1Q8YA 2BIKB 3LVPA 3Q52A 3QQGA 5A6OA 5IA1A 2RFEA 2PVKA 2WHBA 1IR3A 4EOLA 1M52A 4LUEA 4O0WA 5IQCA 3R9NA 2QOBA 5TT7A 4FV6A 4NW5A 3F6XA 1J7IA 1H00A 4QMOA 3HP2A 4EC9A 3FSKA 4ANQA 3KRXA 1W98A 3D5VA 3OT3A 3SRVA 2YHVA 3HV3A 4BYIA 3PJ3A 4ACCA 2CKPA 4DCEA 4FTJA 3S95A 4DH5A 1TVOA 1BI8A 4Y8DA 3BPRA 4C3RA 3WBLA 1Q5KA 4UXLA 2WZJA 3QRKA 3ZU7A 4AE6A 4DEBA 5EM6A 4J95A 1MP8A 1URCA 1O9UA 4DH8A 4EBVA 4EH9A 3AC5A 4I0TA 4QD6A 3FC2A 3Q4UA 3VHEA 4NIFB 4X3FA 1IG1A 2GFSA 1WBVA 4PPBA 4WNMA 4Z55A 4YLLA 3F3UA 3AKKA 5K5XA 2EXCX 2I0YA 3D94A 4LGGA 5CQWA 1LP4A 4EK3A 3W0OA 4M0ZA 1XKKA 5EI2A 3FZRA 4FKWA 1GY3A 3KXMA 4V04A 4EQCA 3FC1X 1JOWB 4U97A 4YJNA 4EZ5A 3BGZA 4CZYB 5IQIA 5ETIA 2C1BA 3MBLA 4G5JA 3TT0A 5IH4A 3UQFA 3QRUA 2GTNA 4F64A 3EH9A 4IZ5A 4GK4A 4BIEA 2ITNA 2BPMA 4IAAA 3E3PA 4LYNA 5CT7A 4A4LA 4NKAA 4FKPA 4NM7A 3F2RA 3DA6A 3E7VA 5CVHA 3F5XA 2JKKA 3EN9A 2GQRA 3AG9A 4Q5HA 5CQUA 3CD3A 3TYKA 4G6OA 3NAYA 2DUVA 3MW1A 2G1TA 2G9XA 2J9MA 2WTKC 2XNOA 1FMOE 4APCA 5IISA 4BI2A 4D4YA 4YJOA 4BIBA 1ZMUA 1OBGA 2XNBA 3AC1A 3A62A 2GQGA 4QP7A 4K18A 5AR7A 1YDTE 3SLSA 1RE8A 4GRBA 4HNFA 4FG8A 3I0OA 2GHGA 2W1EA 4M69B 2XB7A 2WMQA 4IAIA 4O4DA 2WMUA 4W4XA 5EM5A 4RVKA 1P5EA 4F6WA 1FGIA 4EOMA 1YI6A 1YXTA 5GHVA 2BHEA 2WTJA 3BGPA 3C0GA 3DBQA 5JFSA 2FSLX 5JKGA 5DWRA 5BUJA 5TKDA 3P79A 2ESMA 2PZRA 2VX0A 4Y95A 4JDIA 5CTPA 1M7NA 4DAWA 2IF8A 3HV7A 5HCYA 4W4YA 3KXHA 4I4EA 4E4LA 4U3YA 4LQMA 2XANA 5L8KA 4KIOA 4LV7A 2E9UA 5HTBA 1Q97A 3R73A 3WZEA 3DJ7A 4BCQA 2IVTA 3IGGA 2C5XA 2WB8A 1VYZA 5F4NA 3PFQA 1JKSA 3KXGA 5M09A 3VNTA 5J1VA 2PMIA 5H3QA 2NRUA 3JR1A 3EN7A 4M15A 3H9OA 3RPSA 4F65A 3AC4A 5CAOA 4A7CA 1FVVA 3FMEA 3N51A 4YZNA 3W0NA 2X8IA 1YOMA 1PXNA 2YDIA 3VULA 1ZARA 3FXWA 3LOKA 1G8AA 3Q5IA 2C6DA 2V62A 3UO4A 4YZ9A 3DU8A 4WUAA 2XUUA 4DFXE 4R7HA 1WBOA 4CMOA 5L2WA 4PPAA 1KV2A 4ACGA 4I4FA 1YQJA 4LV8A 3OVVA 3OUKA 4MNEA 3PA3A 5CAVA 4FV8A 3E62A 4W9XA 5FEDA 4F0FA 5I9XA 4FZ6A 4U80A 4ZS0A 3ZTXA 4M0YA 2BKZA 5D11A 3Q96A 5IKWA 4CFNA 4LG4A 3GU4A 3MIYA 3UNJA 2Z8CA 3C4WA 1OECA 3OCBA 5JRQA 3QUDA 3ZO3A 3D15A 2NO3A 4E5AX 4XV1A 4X3JA 4DFUA 3OF0A 2CKOA 3DXQA 4IWPA 2RFNA 4GIIA 4E6AA 3R63A 4N57A 3UOHA 4X2GA 2IN6A 2BMCA 4QYEA 2UUEA 3ZSHA 3G6HA 1KE8A 4O91A 4XMOA 3SDJA 3GC0A 2FH9A 3R0TA 2WGJA 4N0SA 3RPYA 3VW8A 4BHZA 4JVGA 4AA0A 2R9SA 5CS6A 3R8LA 2XM8A 5E8YA 4RFMA 5J7HA 5EOBA 5HORA 3UP7A 5JFXA 5AUWA 2X2MA 5A54A 1Y57A 2B9HA 4FTOA 2PZIA 1ZOHA 3H9FA 4XHKB 5CNOA 4GU9A 3E92A 2OJJA 2WMAA 3ZO1A 3SGCA 3L8PA 4A9YA 3PIZA 4RWLA 3PDTA 2OIQA 3ULIA 2PY3A 1XH4A 4ALUA 4B8MA 3F5GA 3U55A 2G01A 3LW0A 3M11A 3SXFA 4F9CA 1QPDA 1UNHA 3CGOA 4G3EA 3V5QA 4IC7A 4BDEA 4D2PA 4EZ3A 3P7BA 2XAOA 2PE1A 4L44A 4GKIA 4XLVA 3LQ5A 3WYXA 2QHNA 2WFYA 5EQEA 5HBJA 4JRVA 4FKIA 3EHAA 3LQ8A 4G2FA 3R7GA 4I93A 3P0MA 3S2PA 1W84A 2OU7A 2B53A 3HA6A 4K0YA 4FL2A 2CN5A 4EK8A 5M4FA 3LAUA 1KE9A 3RAKA 4U5JA 4BDJA 5HOAA 3NLBA 2VTNA 2WMBA 2GU8A 3PSBA 4X21A 4CD0A 1IA9A 1WZYA 2Z2WA 4I0SA 1XJDA 2B1PA 1MRUA 3E93A 4P5QA 4YJQA 2EB3A 4B4LA 3PY3A 3WYYA 2QI8A 5E8XA 3QX4A 2DWBA 2WXVA 2C5YA 4S34A 3EQCA 5ACBC 3V5PA 4FV5A 4PTGA 3VQUA 5L2IA 2CHLA 1M2PA 4QYFA 5DG5A 3C5UA 3DDQA 4M12A 4WSYA 4BDKA 5BYLA 2C3JA 3PY0A 4FKGA 3EQPA 2V7OA 4FV7A 3R02A 2JD5A 2Y9QA 4AGCA 3P78A 1Q3DA 2QOLA 4JL9A 3PXFA 4P90A 4PMMA 3UQGA 1OIUA 2R0IA 4L52A 2IWIA 5A4QA 2NPQA 4LOPA 4FT0A 3IW4A 1W82A 3ANQA 3LFQA 5DBXA 2BZHB 4ANOA 3QRJA 4FSRA 3UTOA 4FL1A 4CT2A 2YN8A 3MA6A 4JS8A 4MF1A 4UBAA 4RQVA 2ZV8A 3D9VA 4TN6A 4DG0E 4EOKA 4M14A 2IW6A 4NH1A 3QQUA 5FLFA 4E6CA 1PXIA 2VD5A 3RTPA 4Q5EA 5LVOA 3MESA 2ONLC 4FGRA 4TY1A 2QOQA 3UC3A 5A4TA 4DTAA 4E4MA 4O27B 5EKOA 4PMPA 3LFSA 2WELA 4V0GA 4KRCA 2KTYA 4CTCA 3PIXA 4FTIA 4DYMA 1ZAOA 3FHIA 4J8NA 3PRFA 5H8EA 5HX8A 2QURA 2QCSA 3NDMA 4IXPA 4OAVB 1IASA 4MNFA 4FTAA 3NUXA 3RM6A 2E9OA 4A9TA 2B4SB 3KVXA 1CM8A 3R04A 4E5BA 1LUFA 3AMBA 3MVLA 1F0QA 3FYJX 4C38A 4MD9E 4DGNA 3LIJA 3HLLA 5GJGA 2G2HA 2H34A 3FMNA 1W2CA 3MN3A 4K77A 4LI5A 5DR2A 4XOZA 4D0XA 2ZFYA 3U6IA 3OXTA 1YXXA 4OTHA 1JWHA 2YCFA 4RG0A 5F94A 4AF3A 3TKIA 4USFA 5LMKA 5E8VA 2JKOA 5KE0A 4GG7A 3AQVA 4FT5A 5J95A 5KMMA 3Q2JA 3BWJA 2Y0AA 1JVPP 5KNJA 2X8DA 2R3OA 4R3RA 4UMQA 1UU7A 5EDRA 4FTRA 2OSCA 4O0SA 3SVVA 2PVLA 4FEWA 3P9JA 3QQKA 3TUCA 5DOSA 4FEXA 2JBPA 1LR4A 5EFQA 4BTMA 4EOSA 2QKRA 5LMAA 4PDOA 1W7HA 5IMEA 2QHMA 1OGUA 1ND4A 5BYYA 4W8EA 2C68A 1MQ4A 4IBMA 5M56A 4I6HA 4EWHA 2W9FB 4FTMA 4ASZA 2RKUA 3MH1A 2UZNA 5CSVA 5D10A 4EI4A 2UZWE 2WMVA 3FQSA 3JS2A 3Q32A 4Q9ZA 4YU2A 4O81A 1E9HA 5HHWA 4IAZA 2VTTA 2C3IB 3KEXA 1NY3A 4FTCA 2B52A 4G31A 4QRCA 3MTLA 4H3PA 2OF4A 4D2TA 3QTZA 5HNBA 1GAGA 2VX3A 3SRVB 3TTJA 3HV4A 3RK7A 2WIPA 3DB8A 4JIAA 5IA3A 3GCUA 3ZMMA 3H3CA 5HD4A 3RKBA 3DDPA 3L9NA 4PL3A 4CSVA 3QQHA 4Z3VA 1T45A 4TYEA 4RZWA 4E26A 4QNYA 4IAYA 5FXSA 5EDQA 1BL7A 3VJOA 1TQMA 4ANMA 5FDXA 1NXKA 4U45A 1CSNA 4R8QA 1SZMA 1TZDA 3DK7A 2Q0BA 3OTUA 3TEIA 3W18A 1YXSA 3WIKA 4AAAA 5FTQA 4RVLA 3ID6C 2VWYA 4AX8A 5FBOA 2OXYA 1PHKA 1BKXA 2W9ZB 3BU5A 4ANNA 4BICA 3F7WA 3DK3A 4C02A 3T9IA 4D1ZA 4MX9A 4EK4A 4KKGA 2YM8A 2E9VA 5E8SA 4ZJVA 5E9EA 3ATSA 3AC2A 4FSQA 4XOYA 3BGQA 3KIOC 2A19B 3NAXA 1O6KA 3UDTA 5CZIA 4DHJA 2X7FA 3QD3A 1PMEA 2BRMA 4ITJA 3G2FA 5JK3A 5AR4A 3ZLSA 2GFCA 1DM2A 2C6EA 3D7TB 3EN5A 3K5VA 4V01A 3FMKA 5HE3A 4DH7A 1XH5A 4QPSA 4AN9A 2PVHA 4MUQA 1PXLA 1KE6A 5CX9A 5LVLA 5AAFA 3SC1A 5CANA 3LFFA 4QTDA 3AC8A 3VQHA 3DV3A 2Y6OA 4OR5A 5C26A 5AFVA 3TI1A 5LVMA 2C30A 2VUWA 3QHRA 1KSWA 3R8VA 5AAEA 2P2HA 5JGDA 3PA5A 2CCIA 4R77A 5CSWA 2C47A 2W5HA 4J99A 2ERZE 4L42A 4XBRA 4FIFA 3OUNB 4Y85A 2YJSA 5AV2A 2QLUA 3RGFA 4EOQA 4DFBA 3GGFA 5J1WA 3OBJA 1FQ1B 4OTFA 4DBNA 4NL0A 3F69A 4RWKA 4WSQA 3UGCA 4BDIA 3PLAE 4F9YA 2BR1A 3KB7A 5KHWA 3O7LD 2GHLA 5AAGA 3G90X 5CSPA 2VN9A 3FKOA 4Y5QA 1W2DA 2PVNA 2UVZA 2Z7LA 1NVSA 1JAMA 3DLZA 3EKNA 4MBIA 1ZZLA 4OT5A 4C4HA 3Q9YA 4LFIA 3FXXA 3NCZA 2BKKA 1K3AA 3VUTA 5KMKA 2YEXA 2GTMA 4M8TA 3VUKA 2YJRA 1Y8YA 5HG5A 4EQMA 4F7NA 4ZMFA 5HLNA 4PQNA 4D5HA 1H0WA 3LXKA 4EH8A 1UA2A 4FF8A 4K11A 3S0OA 3O8TA 4I5HA 5GINE 5HG9A 4DT8A 4FJVA 4BGHA 5LWNA 3NNWA 1SVGA 4X6RA 2GMXA 4IACA 2QVSE 4Z7HA 3VC4A 3UZTA 3G51A 2VWUA 1R0EA 4FX3A 5M44A 2ITWA 3P23A 4DFYA 5HKMA 4G5PA 5H8BA 4FZ7A 4ERWA 2QOOA 1NT2A 2YCRA 2UW5A 3EQFA 3LHJA 4YJTA 5E1EA 1PMUA 1W83A 1Q41A 2GNGA 3O2MA 4PL4A 5FP6A 2IJMA 3A7IA 2P4IA 5BUIA 2QKWB 4E5WA 3CE3A 4NM5A 4L01A 5HG7A 3FMJA 3TCPA 4OBQA 3VRYA 3ZS5A 2VGOA 2WEVA 3BV3A 3JVSA 2ZJWA 3W2SA 2XIZA 4LGDA 5AM7A 4F7LA 2ERKA 3HA8A 3TJDA 3VO3A 4UXQA 2ACXA 1M2QA 2VAGA 1O6LA 2VTLA 4TYJA 3DKCA 2JGZA 4Z16A 4TXCA 2FB8A 2F2CB 4EORA 4RX7A 4IJPA 3BI6A 4KSQA 4EJNA 3RHKA 3ZSGA 3IS5A 2AEGA 1FINA 2BRHA 2XARA 2ZB1A 3R71A 3AC3A 5A46A 3O50A 3ZXZA 1J91A 4TT7A 3OWLA 4U42A 3IECA 4QT1A 4BCHA 2XK8A 1B38A 4MWIA 3EQIA 4XV2A 5CSHA 1JKKA 4D58A 1PJKA 4C34A 2C0IA 4D2RA 4DEEA 2AYPA 3NNXA 4S30A 2JIVA 3EOCA 3POZA 2PPQA 4NWMA 3C4FA 4IVAA 2PE0A 4AAYA 3QALE 2X4ZA 1YVJA 3FI4A 3LMHA 2QU5A 3TZ8A 3U4UA 4U9AA 3AD5A 1ZWSA 5LARA 3PXYA 5CLPA 4F9BA 3V8SA 5BX0A 4G34A 1E1XA 1JSUA 3R6XA 5DEWA 5IQDA 3TMOA 5DRBA 3R7IA 2BDWA 3PXKA 4JIKA 1M17A 1GIJA 3RPOA 4D2VA 4IX4A 1F3MC 2OO8X 4TKSA 4A9SA 2JDOA 3TNPC 1XMMA 1LEWA 2KULA 5FDPA 5M53A 2PZ5A 1ZYJA 5A14A 3IGOA 5CI7A 3AOXA 3BBTB 3CLYA 4AXAA 2OJIA 2R3NA 4CFUA 4AS0A 3LCSA 1I09A 4QQJA 2CLXA 2O65A 2YISA 2X81A 5JFVA 4ZSLA 5I5ZA 4FTKA 2REIA 3EMGA 3ZXTA 1I44A 3TV4A 4AWIA 5HGIA 5H9BA 3R7YA 4CKRA 4DCAA