4I5HA

Crystal structure of a double mutant rat erk2 complexed with a type ii quinazoline inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
335
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVADLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKILDFGLARVADPLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence determinants of a specific inactive protein kinase conformation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
total genus 101
structure length 335
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i5hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i5hA01
3BU5A 3QLGA 4ZZMA 5GIPE 3R2YA 2GNFA 3C7QA 4G17A 4PTGA 3BZ3A 2GQGA 5AJQA 3DXQA 2X2KA 5EI6A 2GS2A 2GNHA 5AUXA 3H4JA 4YZBA 3JPVA 3GC8A 3QCXA 4DC2A 5GZ8A 1Q61A 4QQCA 3QD4A 3FMNA 3U87A 2IPXA 1PXJA 3OTVA 4LL5A 5D11A 5FDXA 4NFNA 4EK5A 5CAOA 4L7FA 4EC9A 2VTIA 4F1OA 1XBAA 3SXFA 1VYZA 3FJQE 2OXDA 3Q04A 3V5PA 3QA0A 4G9RA 4CFXA 5ANJA 4BDIA 5BVNA 2Y6OA 3OC1A 4LUEA 1J7LA 4EH5A 4AZEA 3H0YA 3NNXA 2XJ0A 3EQGA 4IANA 3DDQA 3O8TA 5K3YA 4DEAA 4FT3A 4EORA 4QPSA 2OI4X 3FAAA 3KMWA 4F1TA 3BYUA 5E91A 3AC1A 3A7IA 2VGPA 4HYSA 4JQ7A 5AV0A 5ACBC 3RWQA 1V0BA 4AN3A 3AD4A 5CI6A 2QO7A 5LARA 1MQ4A 4JR7A 4WUNA 1M7QA 3D94A 1OUYA 4E5AX 1ZZLA 2PWLA 1VEBA 2R3GA 2WMAA 4IX3A 4A9UA 2UVZA 5JQ8A 4A9YA 4TYGA 4YTCA 1JSVA 3R6XA 1PRYA 1UU8A 1JBPE 4EEVA 1ZOHA 3BGPA 2X7FA 4WRGA 3S3IA 4IVBA 5KMKA 1FVRA 1Q8UA 3UOLA 1ZMUA 4FOBA 3MI9A 4RVKA 2WU6A 3OP5A 2BZJA 2YIQA 2XK9A 3ORZA 5DR6A 2RFDA 3TCPA 3KREA 4H3QA 3W33A 2YIXA 3IGGA 2JKOA 3HAVA 2W06A 3NLBA 5J5SA 3QC4A 4RWJA 1URCA 4PL5A 5EK7A 4BTMA 4YJQA 2G15A 4YHFA 5L8JA 2IVTA 3LM5A 2J5EA 3LOKA 1OM1A 3WZEA 4IWPA 3OT8A 4NSTA 2UW8A 2Y4IB 3CQWA 2QR8A 3Q9WA 5CF5A 2VTAA 3A8WA 5HI2A 3VUIA 2EB2A 4W9WA 4U8ZA 4D4RA 4Y8DA 3R73A 4ERKA 4EZ7A 3PZHA 4XNEA 3ZDUA 5F9EA 3EQPA 3RPSA 4WNMA 2PZPA 4JG8A 4EI4A 3GT8A 3Q5ZA 3KULB 4Y83A 1ZMVA 3KVWA 4YJPA 1UKHA 5HBEA 3UZTA 4IACA 1TQPA 3OMVA 3R8MA 4FSUA 4EOIA 3QLFA 5DT4A 1U46A 4IM3A 3FSFA 3NCZA 2VWXA 4QTEA 2OZOA 1WVXA 4E26A 5HIDA 3FKLA 4TWNA 2WKMA 3OWLA 5DVRA 2PTKA 2Q83A 4FVRA 1ZLTA 2QURA 1T46A 2BRGA 3OXIA 4HNIA 2J9MA 3QTIA 4YUQA 5L4QA 1Q97A 4BKZA 4MWHA 2LAVA 2EU9A 4O7TA 4LFIA 2DWBA 4C37A 4TY1A 1T45A 3LQ8A 4GUBA 5EM8A 4ZK5A 3VO3A 4BFMA 1GZ8A 1JKSA 3PJCA 4E5WA 4Z55A 1GIHA 4JRVA 3V8WA 4G31A 4NW6A 5CTPA 4F7JA 5HD4A 2E9OA 3KRXA 4UZDA 4DCAA 4U45A 5B7VA 4RA5A 3BE9A 4UBAA 4MQ2A 4HYIA 3T9TA 5BX0A 2V0DA 4YJRA 5EM7A 3ZMMA 1YI6A 4TRLA 3VBXA 3E3PA 5IQBA 4O81A 1PXLA 3MESA 1H27A 5LMKA 4IAKA 4O0VA 4F7LA 5HQ0A 5HCYA 1WCCA 2VTOA 3EQDA 4O1PA 4O91A 2O8YA 2VNWA 4FZ6A 3UPZA 2YDKA 5IUIA 3V5QA 3Q9YA 4ANBA 4FV8A 4NTSA 3WZUA 3C9WA 4NU1A 5T3QA 3EQHA 3FMHA 3F2AA 5IQIA 4JNWA 3GI3A 5LOHA 5KMMA 2PUIA 3NNUA 2Y9QA 4KNBA 4M0ZA 3UDBA 4G5JA 3RJCA 3EQIA 3O0GA 3RZBA 3W2PA 4L46A 4XG3A 2W1EA 4IAAA 4KIOA 3COIA 5J1WA 4L42A 4CFWA 4ORKA 1JWHA 5C4KA 1J1BA 3KF4A 4YC8A 2AYPA 3UQFA 5BVOA 5LVNA 4RJ4A 2WTJA 4RC4A 2YM3A 1MQBA 1NVSA 1V1KA 3H9RA 3C4ZA 3DJ7A 4R78A 3EKKA 4AZWA 2J6MA 1UU7A 3DY7A 3N51A 4G3EA 4RVMA 2WTIA 5C26A 5CSXA 3V6SA 4DAWA 4O7ZA 2QODA 2HELA 3TKHA 4BR3A 2J0IA 5CAUA 4S34A 5IQDA 4YJTA 3NUAA 2J7TA 5I5ZA 3FL4A 1PHKA 4EOLA 3ATTA 4GFOA 4CZYB 2WNTA 3WZDA 4TWOA 4J71A 4CKRA 1H26A 2J50A 2RGPA 3NVKI 3F2NA 2Y4PA 4L3LA 5JZNA 3U54A 3AC3A 1K3AA 4CRLA 2WELA 2CHLA 4U43A 4Y46A 5H9BA 4U81A 5HNGA 3Q4ZA 4FKIA 4JRNA 1LR4A 2HW7A 5EW3A 4M84A 3VNTA 2WMUA 5JFWA 1ZRZA 3TEIA 2C47A 3HDMA 3VBWA 3QQUA 2UZEA 3JUHA 5CLPA 2CPKE 3MV5A 4O0SA 4YNEA 3DKGA 3ODZX 4KABA 3MFUA 5BVKA 3DS6A 4U7ZA 3TIZA 4FTRA 4XG4A 1SZMA 5FLFA 4BC6A 4I93A 1GZKA 3RI1A 3KEXA 4EOSA 1IASA 3NEWA 1U5RA 1ZY5A 2ZVAA 4MNEB 1OKVA 4NCTC 1Y91A 5DA3A 4DTBA 3PG3A 4FSYA 2QQ7A 4R8QA 3UPXA 3FMKA 2I7QA 3WYXA 4C59A 2XCKA 4Q5EA 3U9CA 4QTDA 3ZU7A 3CCNA 4K2RA 5AV2A 3H3CA 4LYNA 4QYGA 1H0VA 3ORNA 1DAWA 3HP5A 3MSSA 5FTGA 1CKJA 4MEDA 2WU7A 3TKIA 1KE9A 5FWKK 3WE8A 3R9DA 3EN7A 4CMTA 3R9RA 4JBVA 4LL0A 4EOOA 5CEMA 1XO2B 3HECA 3NR9A 3DBFA 3K54A 4J8NA 4V01A 3MTFA 2QO2A 3KRLA 4FKWA 4ZSGA 3CTQA 3GVUA 4BCHA 3ORIA 4UALA 5K5NA 1E1XA 2BKZA 4AE6A 4DA5A 2OF4A 2BZIB 3CKXA 2IN6A 2BTRA 5AP0A 4IVDA 4ZJJA 4DH7A 3SVVA 1V0OA 3POOA 1ZYJA 3F3UA 1OIUA 1Q5KA 4JX3A 1GOLA 3U51A 4HCVA 3E87A 3TUBA 5FG8A 3PIZA 5EW8A 2PYWA 2NO3A 3DTWA 2ZM3A 2YAAA 4FKJA 3DKOA 3DJ5A 2IJMA 5AMNA 5L8LA 5M08A 2NPQA 3QTWA 4JDHA 2EUFB 4RMZA 3FUPA 2XF0A 3FL5A 4U0IA 4WSYA 4FMQA 4YSMA 2XM9A 2VTRA 2Y8OA 4MWIA 3HRCA 1GY3A 5ANEA 2EWAA 2JDOA 3O7LD 4O22A 2JIVA 3FWQA 4J1RA 3DTCA 4ZTRA 4E8AA 5IH6A 1HCLA 3NUUA 5I0BA 4HVSA 3EZRA 3E92A 4FTAA 1W83A 4CLIA 3N4UA 3A7FA 3ANQA 1ZYSA 3ZM4A 4KKGA 5AUVA 5HE0A 3ZOSA 3ZH8A 2BDWA 2YIYA 3PXRA 4M7IA 2OLCA 3KCKA 3GCPA 4YPDA 1U4DA 3F5PA 4A9RA 4DEIA 1IAHA 4CT2A 3BGZA 2YZLA 5CAPA 2VTTA 4QP1A 4YBKA 3P79A 3UG2A 3QQFA 4KRDA 1OIRA 4BCMA 2X6DA 4HPTE 5IA3A 5I9YA 4NM3A 4QMVA 1PMNA 3E63A 1IA9A 2VGOA 5EKNA 5C1QB 1AGWA 1LPUA 4CZUA 3F88A 2XK6A 3K2LA 3M11A 4OLIA 2R3LA 5AP1A 4BDBA 3G2FA 5IA1A 3TNWA 2CGWA 4QQ5A 3PP0A 4NT4A 4BKYA 5M07A 3ULIA 3R9OA 4ZEGA 4OUCA 3SW7A 4S33A 4O7LA 4M97A 2PUNA 4FKVA 5JGBA 4TYEA 4OGRA 5EDPA 2JAMA 1K2PA 2VO6A 2WMTA 2IW8A 3ZM9A 2ITZA 3OHTA 4X2GA 4YTHA 2OICA 3R04A 5LVLA 2CKQA 2B9JA 4FV2A 4E4LA 4R3RA 4EH7A 5IZFA 2WO6A 1FMOE 4IXPA 4L52A 2XKFA 2OH0E 3DZOA 2VTLA 2Z7RA 2VAGA 4TL0A 4IZAA 2I0EA 4I6BA 4R7IA 1Z9XA 2PVKA 3QKKA 4PDSA 4MF0A 5DRBA 5CU2A 3CQEA 4D28A 3DFAA 3HV6A 1P5EA 4C7TA 2CKOA 3LMIA 4B6LA 5IKWA 5JK3A 4PTCA 3MPAA 4FIIA 4QMUA 2XKCA 1R0EA 1OL6A 3EFLA 2YFXA 3Q4TA 4V0GA 4EH4A 5BYZA 2HAKA 2GQRA 3BGQA 5CS6A 1BL6A 4IB1A 2Z7LA 4GJ3A 3C4CA 4AZSA 1XQZA 2ZV9A 3NRMA 3BBTB 2PSQA 3UVQA 3ZLYA 4BCIA 2F7ZE 4BTFA 3KK8A 4X6QC 2PVFA 3R7YA 2O3PA 5CVHA 1JQHA 2C6MA 3OBGA 1UNHA 5CX9A 4ZY6A 3V8SA 4CYJA 5AR5A 1YDTE 5A9UA 5JH6A 1JPAA 5K9IA 4LUDA 3MFRA 2YJRA 3ZFXA 3H9OA 5M56A 4WNOA 1YI4A 4PP7A 3GNIB 3MIAA 1R78A 2C0OA 4AGDA 4UXQA 3S4QA 4D2WA 4QQJA 2JIIA 2HCKA 5AUTA 1W98A 4DG0E 4C3RA 4EJ7A 3BEGA 1QMZA 3IDPA 5CQWA 2YDIA 2XRUA 4FTUA 3GC7A 3NS9A 4ZMFA 1YKRA 1F3MC 2QONA 2R3HA 3D15A 5HX6A 2HZ0A 5AR2A 3VF9A 5E8WA 3UIBA 5LWMA 4RQKA 3U4WA 4DH1A 1PKGA 4CKJA 1ND4A 1H1PA 4HZRA 4L8MA 1WBNA 2XS0A 4C57A 5DRDA 4EUUA 1X8BA 3SC1A 2C3JA 4DYMA 3Q32A 4YZNA 3SOAA 3FHIA 5JQ5A 3OXTA 4X3FC 1J7UA 3UP7A 4M8TA 2BFYA 5H8BA 3GFEA 3EMGA 4OBOA 5TT7A 2Z7QA 2JEDA 2C5NA 3HGKA 1IR3A 3KMUA 3OF0A 4GKHA 2HK5A 3R1QA 3BV3A 1JOWB 5KMNA 4YTFA 1E1VA 2BHHA 4MH7A 4QQTA 2E9VA 3DK6A 4Z7GA 4NH1A 4FI1A 4QP7A 3I6WA 2OH4A 1PXKA 3FHRA 3HVCA 3VUDA 4ANQA 4QP2A 3ORMA 5HLWA 4IC8A 2C6KA 3CEKA 5J95A 3KF7A 3QU0A 2CLQA 3UMWA 4FL2A 5E8XA 5AUWA 2CGVA 5JZJA 2XUUA 4X2JA 3NUNA 3R7GA 4GK3A 4AWIA 3TNHA 4C4HA 2R7BA 2BAQA 3C13A 4U42A 2GMXA 2HY0A 3GFWA 3BWJA 3MFSA 4AA0A 5DFPA 3UO6A 4HYUA 4CFUA 3FZOA 3HRFA 4XJ0A 4BDJA 4O7YA 2F4JA 3FKNA 5EH0A 3CP9A 2VO0A 3FZPA 3A60A 3MBLA 4CKIA 4AG8A 5E1EA 3SAYA 4FL1A 2YWPA 3SLSA 4XV1A 1Y8GA 4XUFA 2OK1A 5EFQA 1GNGA 4UZHA 5CEOA 1PXIA 1YHSA 3OBJA 4JX7A 5AUUA 3BYSA 3M1SA 2C6DA 1FVVA 4KSPA 3OW3A 4PPBA 1YXUA 5D7AA 5K4IA 5JN2A 4UMQA 3DKFA 4GL9A 4C02A 4QO9A 3RBWA 2VWZA 3CTJA 4N6ZA 1GZNA 3WIGA 2BZKB 3NIEA 5HNIX 3NW5A 4ZJVA 2P4IA 3UOHA 2CNUA 2RF9A 1H0WA 3GQLA 3RAHA 4BI1A 5ICPA 4S32A 5IUHA 2PPQA 3SG8A 5AIKA 4C35A 2R3OA 2VN9A 4G6OA 4U79A 1ATPE 2XIRA 3RTPA 4QP8A 4ERWA 2OZAA 3KY2A 4FYOA 2WQEA 4RIWA 1J91A 4CLJA 5AFVA 2ZB1A 4I20A 4L00A 1YDRE 5H8EA 2VWIA 3V04A 2XNNA 4IAFA 4C4FA 3C5IA 1M17A 2UV2A 2PZIA 2V7OA 3LQ5A 3QGYA 4FX3A 4GV1A 2YZAA 3OROA 4I5MA 3P5KA 4X3FB 5FXSA 2IVUA 4DFYA 3MVHA 4KS8A 3ALOA 2PVNA 5CU6A 4NM0A 4FZ7A 4TTHB 4EWQA 3W2SA 3L9MA 4FV9A 5AA9A 3MW1A 2WPAA 3MN3A 1WBPA 3K5UA 4IWOA 2W0JA 5D1JA 5BUJA 4JAJA 3MPMA 3NMUF 3Q6WA 4FEQA 1OL7A 3T8OA 5M51A 1NVRA 5K4JA 5KX8A 3MYGA 1FMKA 3KRJA 3HX4A 4MBIA 3R7VA 4EH6A 4O1OA 2BDJA 3ZRMA 3F66A 5IA5A 1BKXA 3ATSA 3AT2A 1O6YA 3W55A 3A4PA 3OOMA 1IA8A 2J2IB 3HMPA 3QCSA 4OW8A 3MH0A 4NIFB 5EG3A 2X8EA 2IZTA 5AEPA 3PA5A 1G3NA 2SRCA 3E7OA 3OOGA 1CTPE 4JG6A 4BHZA 5GZAA 3QQGA 4E4XA 5E8UA 5HO8A 2BCJA 3OS3A 3PA3A 3KXZA 3GU5A 4IAZA 3PXFA 4X3JA 5B0XA 3VW6A 3MGYA 2OWBA 2J51A 3TJDA 4X0MA 4BCKA 5M06A 5AA8A 4HCUA 1M2PA 1KE5A 1CM8A 4NM5A 4BGHA 4PMPA 4HVHA 2YM7A 3BHHA 3ZO4A 3WZKA 2YABA 2ETMA 4QT1A 4HGSA 4W4VA 4JT3A 4IMYA 4FIFA 4IADA 2VTSA 2AC5A 2FSMX 3KL8A 5HIBA 2YCFA 4XV9A 5JGAA 3OXZA 2G1TA 5BPYA 2X81A 4BCJA 5CSPA 3DU8A 3QX4A 5E4HA 4CNHA 2W1ZA 3GCSA 5LQFA 4UN0C 4NKAA 1R39A 2C6OA 3BYOA 4QRCA 4E6CA 3AGLA 2QOOA 3RP9A 4GT3A 3PXQA 4C58A 3SXSA 4PDYA 5AV3A 1H08A 2QKRA 3NW6A 2JFMA 3GOPA 4AN2A 3NUYA 1WAKA 3OUNB 1OL5A 3C4WA 3PUPA 4MX9A 5CNNA 3LFDA 4YJNA 3R7OA 3TJCA 3EL8A 4PQNA 4HW7A 1WBWA 4KBAA 3PJ3A 1BI7A 4EK3A 5KZIA 2G2IA 4U41A 3QRUA 4ACDA 4F70A 3VVHA 2C6EA 3FKOA 5DBXA 3V01A 5BVDA 5F94A 3DV3A 3DA6A 4FKTA 4YJOA 4DGOA 2ETKA 5HEZA 5J5TA 1YXVA 4KSQA 4DBNA 4ZTLA 2YDJA 2PUPA 5LMBA 3G9NA 1OPJA 3PFQA 4RIYA 4BCFA 5IQGA 4LOQA 4IVAA 4DGLC 5M4CA 3O8UA 1U54B 4IB0A 1O6LA 3K3IA 3UBDA 4KUJA 4C2WA 5FXRA 1CKPA 1ZY4A 4F99A 3FQEA 3CC6A 4Q2AA 4C34A 4CXAA 4D2VA 1S9JA 3LXLA 4YO6A 4ZLOA 5M09A 4G5PA 2A1AB 2HW6A 1KSWA 3EQBA 5FEQA 3VBTA 4YSJA 3BKBA 1PF8A 1XR1A 3GENA 4CG8A 2OFVA 5BUIA 4N70A 5EHYA 5TKDA 4KKHA 2WXVA 3I5NA 4CFVA 2VZ6A 3BLRA 4AOTA 3TZ8A 4O38A 5HX8A 2WMBA 2IZSA 3EKNA 4MVFA 4HGTA 3OCBA 4FV7A 4FKRA 5AP2A 3RKBA 1WBSA 2RFEA 4PY1A 4A4XA 2PHKA 3PSDA 4IH8A 2W96B 4FC0A 3RNYA 3V51A 4DHFA 3PVUA 3HZTA 4BTKA 3COHA 2C6LA 3RNIA 5HU3A 3D5XA 5IQEA 5I9WA 3GU8A 3R00A 4B99A 4GUEA 5AWMA 1DI9A 4B4LA 1RQQA 3HEGA 2C30A 3FLNC 3E64A 1NW1A 3HAMA 5LJJA 3R9HA 1R3CA 3OZ6A 3P7CA 4K77A 4M0YA 2FH9A 1NVQA 4FTQA 4S31A 1OBGA 4C36A 5LMKC 4J53A 4RJ7A 1OPLA 4L68A 4KS7A 5DEWA 4I5HA 2R3FA 4F1MA 3FEGA 4RJ5A 2VWYA 3R1NA 5DT0A 3W10A 3SRVA 2ZOQA 2I0VA 3KFAA 3PP1A 4F0GA 3UVPA 3TNPC 4RFZA 4FNYA 5HD7A 4FV3A 2VO3A 3UQCA 3QTQA 1YI3A 2XNBA 3E8DA 2RG6A 4XX9A 3VS7A 4EK8A 2OJFE 5GJGA 4CCBA 4MD9E 2X7GA 4YMJA 2ERKA 2G2FA 3EFJA 4D2PA 4ENXA 4FT9A 3VAPA 4A4OA 4D55A 3P78A 3E7VA 2VTNA 3JVSA 3BE2A 2OZAB 4JL9A 5M57A 3KRWA 3CGFA 4LGDA 1UNGA 4EQCA 5JRQA 4GCJA 2XNEA 4LMNA 4EZ3A 3E5AA 4J95A 3A2CA 2XNPA 2OJJA 2W1IA 3TUCA 4RX7A 3TUDA 4UYNA 2GHMA 4EC8A 5CF6A 5F20A 3WIKA 2WTWA 5M55A 5DI1A 1P4FA 4ONAA 4BZOA 2WD1A 5HICA 4I0RA 2X4FA 3IW5A 5AP3A 4R77A 4IBMA 4XOYA 4IZ7A 3R02A 4RZVA 3NYOA 2OXYA 5FQDC 3TTIA 2UZWE 5EHLA 4QPMA 3P7BA 3EB0A 4RPVA 4C3FA 5CENA 3OT3A 4FKPA 5C8KA 4N0SA 4ACCA 1OKZA 4QYHA 4JQEA 5H2UA 4LRKA 2WEIA 3IGOA 4O0UA 4I4FA 4LOOA 4BL1A 5DLSA 3ZC6A 2DUVA 5CAQA 1M52A 3FLWA 5DNRA 2WMXA 4RVTA 2QVSE 3CGOA 3HUCA 4NCTA 3NIZA 1Q3DA 3GC9A 3WARA 2IZUA 3LCOA 4AT5A 4AX8A 1WVYA 4ZLYA 1OIQA 2B9HA 4Q9SA 5IQAA 3NGAA 4ZY5A 1PXPA 5EQYA 3FLQA 4RLLA 3IOKA 3CY2A 3OCTA 1YXTA 3IW8A 5HE1A 3C5UA 2C68A 3O51A 5CSVA 2P2IA 3R2BA 4QYFA 3VS0A 3ANRA 1XKKA 4GJ2A 4EH8A 3FPMA 3R8LA 4JI9A 3UYTA 3U6IA 3QWJA 4EYMA 2P2HA 4ZSAA 4F6UA 5JEBA 3V5TA 3O17A 4KIKA 4QD6A 2B9FA 3CPBA 4LV8A 4CG9A 1U59A 2VTMA 4ZTSA 2B0QA 3BCEA 4D0XA 2GPHA 4NYEA 4EHVA 4XH6A 4D1SA 1APME 1KWPA 3T3UA 4D5HA 3M42A 1YOMA 2BPMA 2J0JA 2R9SA 4AT4A 4O0TA 2X6EA 4FG9A 2GTNA 3C51A 4BZDA 4FKSA 4YHTA 4MXYA 4RIYB 4E73A 4C33A 2VWBA 4DFUA 4FKOA 5DEYA 4AS0A 5L2SA 1STCE 4K18A 3HRBA 1SM2A 3HUBA 4MXZA 5H8GA 4YZ9A 1O9UA 2XNMA 3TTJA 5DWRA 3VHEA 4PL4A 2JDVA 3AMYA 2HXQA 2PMIA 1ZOEA 3MFTA 1JSUA 2KTYA 4OTHA 4ZZNA 1OGUA 3ZYAA 4YJSA 2C69A 3AGMA 4XG8A 3OFMA 4O84A 2XK3A 1LUFA 2YLEA 5J1VA 3P23A 2VWUA 4TNBA 3QBNA 3O23A 3U8WA 4JG7A 3VUKA 3LMGA 1ZARA 2WTVA 4R3CA 3KK9A 3AC2A 1CDKA 1H4LA 1RJBA 5IH4A 3HMIA 2ACXA 4CFNA 1LP4A 1J1CA 5EYKA 4EBVA 1YHVA 1G8SA 2XRWA 2WQMA 4IHPA 4F4PA 5K0XA 5CU3A 2R3MA 4E4NA 1P4OA 2ZJWA 4AOJA 1KE7A 3FE3A 3C4EA 3FY2A 3MPTA 4GH2A 3V5JA 3QXOA 3VUGA 2OJ9A 4Y95A 1G5SA 1ZMWA 4G2FA 4OBQA 4FNWA 5CNOA 2BIKB 3FYKX 4ALWA 5AM7A 3E62A 1RW8A 3IW4A 3OTUA 3QD3A 3R0TA 4LRMA 3RINA 5LCJA 4RG0A 5E8VA 3ZTXA 4CFMA 3OW4A 4YC3A 5LXMA 4G1WA 5EOLA 4AZTA 4E4MA 3UZPA 3II5A 3WF5A 2R3QA 4RA4A 3EH9A 2R3JA 2V62A 3K3JA 4J97A 5L2WA 4OTRA 4UY9A 4X2FA 5HVJA 2WIHA 2C6TA 4C0TA 1PXMA 3ORXA 4EHEA 2FUMA 2YEXA 4JBPA 2A4LA 5J9YA 1Q4LA 3R28A 4MBJA 4TW9A 3HA8A 3SRVB 4USFA 3T3VA 2VWVA 3WF9A 4YGAA 3ZSGA 1PW2A 4PL3A 4YC6A 5CF4A 3ELJA 3F3ZA 2VV9A 4WG5A 4K11A 3U6JA 4GK2A 1OL1A 4DT8A 1XHAA 2YIRA 3ENMA 1YWNA 5HORA 4RGJA 4PNKA 1GAGA 1YWVA 3QGWA 4CCUA 4YU2A 5FBOA 4FG7A 4XG7A 3GOKA 4AW2A 4G9CA 5DIAA 2W17A 4C3PA 2B53A 3ZO2A 4ZLZA 2XYUA 2BRBA 4PTEA 5CVFA 2YLFA 2X2LA 4PMTA 5CQUA 4ITJA 2HENA 3DKCA 4L7SA 4ANMA 1XJDA 2JKQA 1JAMA 3VS1A 1H01A 3W2RA 3JR1A 2VTPA 4PDOA 4TYHB 1DAYA 1OZ1A 3A7GA 3ZLSA 2OF2A 3U6HA 4ZAUA 4FTNA 3BHYA 5M44A 3MJ1A 4D1XA 2PUUA 3AG9A 3QKLA 2YA9A 5E8YA 4W9XA 5ACKA 4RIXB 2YITA 4RVLA 4GEOA 2F2UA 5I3RA 1YDSE 4CZTA 3I1AA 5GZ9A 3ZFYA 3CD8A 3MA3A 3UQGA 3QCYA 1H1WA 3QAME 5CXHA 4QMOA 2ZDTA 2XM8A 2A27A 2Q0NA 4ITIA 3EHAA 3DBQA 2JBPA 3FDNA 4TXCA 2GNLA 5H3QA 2XIKA 4H39A 4O2ZA 2ETRA 2PE1A 4QMQA 2B1PA 2BUJA 1JLUE 2FSTX 3TL8A 5E92A 2P3GX 4QMZA 4ZY4A 5IA0A 2BRMA 3HV7A 3UE4A 4QNAA 3ET7A 3ZBFA 4APPA 3S0OA 5BYLA 3D5UA 3LJ2A 4YURA 3MH1A 2UW9A 4F6SA 3FI3A 5DR9A 1LEZA 1YXSA 2GFCA 4WUAA 1B6CB 3DNDA 1PYEA 1EH4A 2WTKC 3LZBA 4PMSA 2CCHA 4JBOA 4O27B 4B8MA 3GUBA 5JFXA 5KO1A 4X7QA 1QCFA 3I0QA 5C4LA 2HXLA 2V7AA 3NX8A 3W2CA 4D5KA 4EH9A 4NW5A 1YRPA 4MAOA 3L8SA 4QTBA 4X3FA 3F3VA 2QG7A 5CU4A 3QTUA 4P5ZA 5LWNA 4TYIA 4KAOA 4DG3E 2HYYA 3LFEA 1Y6BA 4RFYA 2GFSA 3EFWA 4UWCA 3NYXA 1P2AA 2C1BA 1SMHA 4MD7E 2QU6A 4MNFA 2O5KA 4AE9A 4DFXE 4I5PA 3CKWA 3W32A 3CBLA 2BVAA 4ANSA 2UZDA 2W7XA 4XLIA 4YLJA 5EDQA 3LM0A 2W1GA 2YWVA 4IEBA 4AN9A 3F3TA 4I41A 5LVOA 2XJ1A 3PXYA 3ZLWA 3VULA 3VRZA 4FSRA 4AW0A 4JXFA 4HCTA 3R9NA 4BY9E 3L9NA 5IMEA 4QMXA 4O96A 3E8CA 1SYKA 3NYNA 3OWPA 4I6QA 4FIHA 4UMPA 1H28A 3TN8A 3TV6A 2A19B 5KKRC 4CVAA 4DT9A 4HPUE 4BZNA 3DLSA 4H36A 3GCVA 2PVLA 4QYYA 3VF8A 4ANNA 4B8LA 4PP9A 5TF9A 5E90A 5L6OA 3LLAA 3ZSHA 4KIKB 4GYIA 2PZRA 3LCSA 1M2QA 2FYSA 4OT5A 5BNJA 3OEZA 3FC1X 2VX0A 5DOSA 3ZLXA 4Q5HA 4F7SA 4JLCA 3I0OA 2BRNA 2QOFA 3Q60A 3IO7A 4FSZA 4MNEA 4EOJA 1Q41A 3TT0A 3IDCA 3RALA 3NVMB 4FIEA 4QPAA 1VYWA 2J0KA 3H9FA 3NAYA 4FV1A 3SHEA 4P4CA 4QMPA 4UB7A 3OCGA 4QP6A 3I60A 2XA4A 2BMCA 5D9HA 4EOQA 2VO7A 3QC9A 5AR7A 2R0UA 5AR4A 5FUTA 4JJRA 3G0FA 4KIPA 1REJA 5CEQA 4CRSA 3DLZA 4BIEA 3F6XA 4XOZA 3Q96A 4MCVA 2ESMA 3ENHA 2UZOA 4GK4A 2JLDA 4H1MA 5KCVA 1OVEA 2P33A 3B2WA 3NCGA 4YJVA 4O86A 2QOCA 4HVIA 4WT6A 4ASEA 3PIYA 3VS6A 3E8NA 3N4VA 2X9EA 5ANDA 5EYCA 3VS4A 3PG1A 3D14A 4CSVA 2XMYA 4OTIA 4QP3A 2ITVA 4MTAA 2W4JA 5HE3A 3UOKA 4GVAA 3FXXA 3TNQB 2W1FA 4B9DA 4ANOA 3GGFA 1WVWA 2FO0A 3C0GA 1ZAOA 4FTOA 3PY0A 3ROYA 4OAUC 3PPJA 4XRLA 4C62A 5E8TA 3WF7A 2ZB0A 3QQJA 5HCXA 4EKKA 3QL8A 3D7ZA 4ZS4A 2EVAA 3ITZA 2WAJA 1MP8A 4BDKA 2BILB 3LPBA 4YHJA 1UWHA 3R71A 5JKGA 5IQFA 1F5QA 3PVGA 4WBOA 2UW3A 4LGHA 1B39A 2O2UA 3GU7A 2WQBA 1Q8ZA 4FV4A 3PZEA 4RJ3A 3SQQA 5TE0A 4PRJA 3OG7A 4ARKA 5B2KA 3UNKA 2IVVA 4G3GA 4V04A 4L9IA 2ITTA 3BU6A 4A9SA 2WTDA 1U54A 2CNQA 5EOBA 3RPRA 5HVKA 2F49A 4DE4A 4U44A 4IX5A 3D83A 4L3JA 4K1BA 3NWWA 5HGIA 3SD0A 3SW4A 4EK4A 1XH9A 5HOAA 3QZIA 5GHVA 3TKUA 2R64A 2XIXA 4WBBB 2PULA 3FZSA 4NL0A 3MIYA 1SVHA 2UW4A 3PIXA 4O7VA 2JAVA 4BDAA 4WHZA 4QMTA 4MXCA 3FC2A 3UIXA 2WIPA 3UNJA 1FINA 1RDQE 2NP8A 5HU9A 4DFNA 3JYAA 3C0HA 3QTXA 5M4IA 3BX5A 1KUTA 2ZM1A 3DJ6A 2JKMA 1MRYA 3FSKA 3EN9A 3R01A 5A14A 5BVFA 2NRUA 5I3OA 3KXXA 4IC7A 3PSCA 4FSMA 2GNGA 4IAYA 4A06A 3K5VA 3QQKA 4AGUA 3Q52A 3TDVA 3TWJA 1PXNA 2VD5A 3AMBA 4O6LA 3C4FA 4C61A 2F7EE 4KINA 3VS3A 2CGUA 1H07A 2LGCA 3PJ2A 3PXKA 4GG5A 2X2MA 1YQJA 4D58A 3Q5IA 3QXPA 3R7UA 4CV8A 4ZMEA 4KKEA 4RWLA 3LFNA 3QRTA 3A62A 4DF3A 2VTJA 4QMWA 4CD0A 3VQUA 4IZYA 1I44A 2XYNA 4L53A 3EWHA 3BQCA 3FMDA 4XP3A 3QYZA 2CGXA 3EZVA 3P0MA 4JOAA 5AR3A 5HTCA 2J90A 2QCSA 4O2PA 2QHMA 3EFKA 2J5FA 1BUHA 3AT4A 4M14A 4XRJA 2QR7A 1Q8WA 4UXLA 4WSQA 5G6VA 2R3KA 5ETIA 2GTMA 2WTCA 4HNFA 4UMTA 4AZVA 3BYMA 5AM6A 4D4SA 5L2IA 2YHVA 3AD6A 3I5ZA 4RZWA 1IG1A 2W4KA 1JSTA 3KXGA 3THBA 2OSCA 2R5TA 1PYXA 3POZA 4ZIMA 5AADA 3ZUVA 1UNLA 2KULA 4IWQA 2I1MA 3QYWA 4OTQA 3RGFA 3NYVA 3HNGA 3LVPA 5CYIA 4WG3A 4L01A 5EKOA 3S95A 4TZRA 5IEXA 4BI0A 4LQMA 4D9UA 3F61A 3F7WA 3ZFMA 2O63A 2VX1A 3PPKA 3CR0A 5G1XA 4I6HA 3HMMA 3PXZA 2ONLC 3WI6A 1M7NA 3DNEA 4CMUA 1M2RA 2YIWA 4ANLA 3HP2A 3P4KA 3PTGA 2HZIA 1KE6A 4F63A 4FUXA 3UIMA 4I6FA 3IK3A 4EOPA 1YWRA 2W05A 3FYJX 2C0TA 4QP4A 4DCEA 3GQIA 4CEGA 5CEKA 2RIOA 4FTLA 5DR2A 3AC5A 3HA6A 1W0XC 3IS5A 4ZSJA 3ERKA 1O6KA 4D1ZA 4BN1A 4IX6A 2VX3A 4G3DA 4USEA 1A06A 4L67A 4NWMA 4QTCA 5FDPA 3GU6A 1HCKA 2GHGA 5FM3A 2WGJA 3R1YA 3CJGA 3NNWA 1XH7A 3ORPA 2XCHA 4FSNA 1KOAA 2C5XA 2HZNA 3FZRA 4RSSA 4ACMA 4G34A 4S30A 2EXCX 4FT7A 3ZUUA 3DB6A 4I24A 3L8PA 5DG5A 2OFUA 3C50A 4ZXTA 4EOMA 4XYFA 3DK3A 3ZCLA 4BWXA 1KOBA 4IQ6A 2BFXA 3COKA 4BDCA 4DH8A 3I4BA 3R83A 2C5VA 3OWJA 4GYGA 4E7WA 2Q0BA 3UO5A 5AUZA 4MXOA 4TNDA 1L8TA 4FICA 2W4OA 4BDFA 3LFFA 5CEPA 5B2MA 4I92A 4BWPA 4HVGA 4BICA 4YP8A 3JS2A 5KMJA 4XG9A 2QLUA 5AAGA 2CKPA 3QZGA 2X4ZA 5AP4A 5B2LA 1WBOA 1UA2A 3S00A 2GCDA 3GCUA 4K9YA 5HVYA 3VQHA 5EQPA 4KBCA 4D2TA 2FSLX 2NNWB 3BLHA 2PZYA 4BKJA 5CSWA 1DS5A 5HZNA 3HMOA 1GIJA 2UW0A 4CMOA 5IH5A 2QD9A 4LGGA 2OW3A 3ZO3A 3S1HA 4F9YA 5ANIA 3I81A 4FKLA 1YOLA 2B52A 1BYGA 2XKEA 4RWKA 3IKAA 4PUZA 4Z3VA 2QOKA 3PRFA 3H30A 3U55A 3W16A 5K0KA 5JFSA 1H25A 3L1SA 4KD1A 2C3IB 3P7AA 5A4QA 2BALA 4X21A 1Z5MA 1M14A 3FI4A 5I9VA 2RFNA 2EXMA 5F4NA 4IAIA 2Z7SA 4N4SA 4YPSA 2W1DA 3UODA 3VRYA 2O65A 2H96A 2HY81 4UEUA 5IA2A 3TV7A 1R1WA 4FSTA 2UUEA 5HNBA 3U9NA 3V5WA 5D41A 4A7CA 5ETFA 4J8MA 3KGAA 3DXNA 2HIWA 2WMVA 3UIUA 4QMMA 3OY1A 3ORTA 2RKUA 2DYLA 2UZUE 4XS2A 2FA2A 1NXKA 4RJ8A 3CE3A 3EQCA 1SNUA 4TPTA 5HKMA 2REIA 5FTQA 5D10A 4C2VA 3FLZA 1IAJA 4I3ZA 5J9ZA 3RZFA 3GEQA 3OY3A 3O8PA 4F64A 3KC3A 1H24A 4WRSA 1BX6A 4U40A 2WMWA 2ZAZA 4F0FA 3D0EA 3DB8A 4G6LA 5F1ZA 3OD6X 4DH5A 2G01A 4TYHA 2YM5A 5C03A 5J8IA 3TIYA 4DLIA 4EONA 4M15A 3NDMA 3CJFA 2UZLA 2JC6A 4OT6A 1OKWA 2ZV8A 4DITA 2IVSA 4F09A 2YM4A 3TACA 2XVDA 4AACA 4K0YA 2YISA 2BAJA 3A99A 2PVJA 4E5BA 3UVRA 3P08A 3DBCA 4FVPA 1HOWA 4Y5QA 4LMUA 5HG9A 2JITA 4FT5A 1PKDA 3WE4A 2WZJA 4YLKA 4P5QA 4TN6A 2XJ2A 4S2ZA 2PMLX 2R3NA 3BEAA 2G9XA 2XH5A 4MD8E 4XLVA 5CZHA 3W1FA 4BDEA 4LM5A 3B8QA 4RT7A 3KXHA 4CTBA 5CI7A 1Q99A 5L3AA 4GIHA 3CQUA 5DN3A 3QFVA 5A54A 2QOIA 4UWYA 3G90X 3LAUA 1YW2A 4Y73A 4YZCA 1W7HA 3P9JA 3ZZWA 3G51A 1WMKA 3MY0A 4PPAA 3EOCA 2FB8A 3DFCB 2CLXA 3NZ0A 2EXEA 5BQ0A 3OUKA 2C5YA 5AP7A 4WD5A 4MHAA 3RM6A 4W4WA 2XKDA 3RAWA 4FTCA 3FI2A 5A6OA 3ZONA 1QPJA 3CLYA 4RX9A 5LCKA 5IEYA 4FTJA 4ZSEA 4O7NA 2ZMCA 5EYMA 5AAEA 1MUOA 3D2KA 3MVJA 4U3ZA 2OXXA 1XWSA 2JIUA 4WO5A 4FV5A 1U5QA 2XNOA 4K33A 5EI2A 2PVHA 1Y8YA 3PY3A 1QL6A 3SDJA 4PX6A 2ZDUA 4XP2A 4YBJA 2X9FA 3EQFA 3KXNA 2QHNA 4U9AA 3ZSIA 3QUDA 4EBWA 4J99A 1W84A 3V5LA 5IEVA 4FIJA 3BIZA 3TZMA 3ORLA 1FGIA 4AFEA 1QPEA 2Y0AA 4NZWB 3KQ7A 2A0CX 2B55A 4PDPA 2WB8A 3P86A 3WILA 5C8NA 3G33A 3ID6C 3PA4A 3QD0A 2O64A 4FZDB 1V0PA 3GCQA 5FBNC 5L8KA 3R8UA 3JY9A 3EYGA 4R1VA 4M68A 4FSWA 3UP2A 3CY3A 2IWIA 3MB6A 1JVPP 1ZYLA 4U5JA 4EQUA 2GSFA 4UV0A 4GU6A 4L44A 2ITUA 2BZHB 3SV0A 2JDRA 4WKQA 2YERA 4ID7A 4AQCA 4O7WA 1OB3A 2ZM4A 4NJDA 5DGZA 1ZYDA 3LFAA 4DEDA 4DTKA 3QCQA 2WHBA 5AIRA 3O2MA 2IW6A 3PWDA 4KWPA 3VN9A 3D7TA 1URWA 3RPVA 3G15A 3BI6A 2C1AA 4IB3A 4ZS0A 2QG5A 3QTRA 4YLLA 4PV0A 4F7NA 5A46A 1RE8A 2BRHA 4BWKA 1SVEA 1Q8YA 4BF2A 2V22A 4YJUA 4FOCA 3E3BX 3FQSA 3I6UA 5HG7A 4O7SA 3P1AA 3NUSA 3LCTA 2XEYA 3DBDA 4RRVA 5AP6A 4XV3A 3Q3BA 1PMEA 3VHKA 4FEXA 3RPYA 5DT3A 3V6RA 4H05A 3FXWA 4WNKA 4GT5A 3R8PA 2B7AA 4IB5A 4U97A 3PY1A 3R21A 4V0GB 4IWDA 2CN8A 3DOGA 2Z8CA 4G3CA 1WBVA 4OBPA 1VJYA 4IJ9A 3R63A 1OPKA 3W8LA 3HL7A 3B8RA 3FV8A 3VS2A 3SX9A 4GIIA 4I4EA 4O82A 2UVXA 3C0IA 2R7IA 3DCVA 4ZTMA 4AA4A 4BBEA 1KE8A 4Y72A 3FI8A 3MWUA 3R1SA 4DEGA 4AP7A 4II5A 3ZHPC 5E8ZA 4C4GA 2PVRA 5FP5A 4ASDA 3LHJA 4U6RA 4ACHA 1UKIA 2PL0A 3VBVA 1ZYCA 4JBQA 2PE2A 2OG8A 2X1NA 1P14A 3U4UA 2WFYA 3QRIA 5IF1A 4P2KA 2UW6A 3RMFA 1Q62A 3L9LA 4DLJA 3VIDA 4E6AA 3A7HA 2UVYA 4BYJA 1WZYA 2XEZA 4MK0A 4LRJA 3AXWA 3BHVA 4YZMA 5GNKA 5ETAA 4CFFA 2GU8A 4BTJA 3E8EA 1UVRA 4O83A 2Z60A 3MB7A 2R0IA 4FTMA 3UGCA 3DAEA 3LCDA 2JFLA 2GNJA 2QOBA 2YCSA 3LFBA 3MDYA 2W5HA 2XBJA 3LFCA 3VJNA 4DEHA 4EQMA 4IFGA 5KMLA 4FZAB 4G3FA 2OU7A 3FXZA 1B38A 5IA4A 2GHLA 4GG7A 3R22A 4ITHA 3IECA 3ZEPA 5CWZA 5L6WL 3GXLA 3L8VA 3MA6A 4GSBA 5EYDA 2WTKB 4I22A 4JIKA 1UWJA 2OKRA 2J0MB 3F7ZA 3HMNA 3L8XA 4FUYA 4GW8A 4HYHA 4TT7A 5GIOE 4FGBA 5HG5A 4RJ6A 4DTAA 3Q2MA 4ZTNA 4IIRA 1F0QA 3CPCA 3GP0A 5BUEA 2QNJA 3D4QA 4USDA 5IQCA 5CASA 1FVTA 3F5GA 4LI5A 4XEYA 4QYEA 5L2TA 2VU3A 2YCRA 1SNXA 4KA3A 2X7OA 2F9GA 4D4YA 5A4CA 2AC3A 4FT0A 5CU0A 3ALNA 4I23A 4NUSA 3O50A 2W9FB 4Q9ZA 5AX9A 2GS7A 3NAXA 3JY0A 3PRIA 5JSMA 4FKUA 2YACA 5DE2A 5FEDA 4BDDA 3RK7A 2UZTA 3MVLA 3M2WA 3ZXZA 4CGAA 2PE0A 3R8ZA 1CMKE 2ZV2A 2EB3A 3AD5A 5EHOA 3QQHA 2H8HA 5HO7A 5A4EA 1G8AA 4NIFA 3IONA 5BYYA 5I9ZA 4X2KA 3DQXA 2I6LA 1FQ1B 5CZIA 4LV5A 3QTZA 2R3RA 3B2TA 2H9VA 5K5XA 4XHKB 1W8CA 2WQNA 3L9PA 4G6NA 4ASZA 4AZFA 2C0IA 3WYYA 2VTQA 5C8MA 3DK7A 3TG1A 4BCPA 4D2SA 4XMOA 5CF8A 3FBVA 4RLKA 3BBWA 4RIWB 4ZTQA 5CAVA 1YXXA 4C4EA 2HWPA 5DMZA 4F08A 5DHJA 2OIDA 3V8TA 1J3HA 4XG2A 1WBTA 5D12A 4ACGA 4UMUA 4AW1A 4YO4A 1GZOA 1OKYA 3VW8A 5M4FA 4KRCA 3LXPA 4XBUA 3MTLA 4JIAA 3FZ1A 4AOIA 4PMMA 4TYJA 3ZUTA 5AV4A 3BV2A 3EIDA 3IG7A 3IOPA 2VTHA 2WOTA 2B9IA 2Y4IC 3AOXA 3OCSA 3OWKA 3QALE 2VWWA 1SVGA 3ORKA 2ITYA 3FZTA 3W2OA 1ZOGA 3RHXA 3H10A 3QX2A 4FYNA 4JS8A 4GFGA 4MF1A 3QQLA 3OEFX 2JKKA 3O96A 3Q53A 3NNVA 3UNZA 3BWFA 3OVVA 2UZBA 2XIZA 2QU5A 3Q9ZA 3UYSA 2JDSA 4FA2A 2IG7A 1Q8TA 3COMA 3MH2A 4R6VA 2W99B 4E93A 4MKCA 3KKVA 4V05A 3TZ9A 4M3QA 3C1XA 4XP0A 1FGKA 3SA0A 4R7BA 4H3PA 4O0RA 2RL5A 1H1QA 2BHEA 3HLLA 1KV1A 4FZFB 5HO6A 3ROCA 3WOWA 3ZEWA 4EHZA 2OIQA 4ALUA 4CQGA 4QMLA 3QZHA 3DBEA 4EYJA 4J98A 5AAFA 2ITWA 2B4SB 1E9HA 2PMNX 5FM2A 4BDHA 2W5BA 2YM8A 1Z57A 2ZYBA 4NKSA 1XBCA 4WA9A 3FPQA 5DPVA 4Z16A 4OTPA 3G6GA 5M4UA 3ZC5A 1WFCA 2IW9A 3PLAE 2R3PA 1W82A 3GU4A 5D7VA 2J4ZA 2E9NA 2J0LA 3WF8A 4OR5A 3FMLA 3MY5A 4DBXA 4FTTA 4X2NA 4BIBA 1REKA 3F5UA 2B54A 2NRYA 5HHWA 2PVYA 4DFBA 2ZMDA 3D9VA 3PJ8A 4HZSA 4N57A 3LMHA 4C4IA 2GQSA 3TXOA 2F2CB 3VBQA 4AGCA 3QKMA 4R3PA 3PE2A 1XH4A 4QOXA 3CTHA 4P90A 2PZ5A 5A3XA 2YM6A 4WNPA 4QTAA 4F6WA 4MYGA 5CANA 4C38A 4AAAA 3FMEA 5CVGA 3CS9A 3JVRA 3PYYA 3QHWA 3VUHA 2ZV7A 4C4JA 4DEBA 4DGNA 1MRVA 4ZP5A 2OBJA 3ZRLA 3DXPA 4H3BA 3KA0A 4HJOA 4IJPA 4A9TA 4GS6A 4EUTA 4BB4A 3FMJA 3QF9A 5KMOA 1Y57A 2DQ7X 2QO9A 5HESA 4UX9A 3BRBA 4YR8A 3SXRA 4ALVA 4TWPA 1JKLA 4IDTA 3C4XA 1VZOA 1ZWSA 1QPDA 4W8DA 2ITPA 1H1SA 4R7HA 4GU9A 4OTWA 4M69B 4AA5A 3HV4A 1JKKA 2XK8A 3HKOA 4L6QA 1XH5A 3RK9A 4DFLA 1ZZ2A 3KMMA 4IZ5A 3BHTA 4RC2A 4DGGA 5LVPA 4FTKA 5BVEA 5CT7A 3N4TA 3W8QA 1NY3A 5FTOA 3G9LX 4QMSA 3BHUA 5C9CA 5DYJA 1IRKA 2QI8A 4GT4A 5J87A 4DEEA 3LKMA 2WMRA 3NUXA 4X6RA 2UW7A 2HWOA 5A6NA 2W1CA 5BMMA 3RAKA 2CN5A 4XG6A 4BGGA 2CCIA 3R7IA 3ZZEA 3CSVA 2OO8X 3AC4A 3F9NA 3LCKA 1OIYA 4FKQA 2XK4A 4L43A 4FV6A 3ETAA 4OTGA 3PVBA 4EH3A 3F69A 5I9XA 3KN6A 3RAIA 4W8EA 4AXAA 5F95A 4F9AA 4BCGA 1OUKA 5GINE 4ASXA 4Y5HA 3A8XA 4PF4A 2RG5A 4UYAA 5EI8A 5T6KA 3ZS5A 5C27A 2I0HA 2R2PA 4E3CA 4CYIA 4F9WA 4FVQA 2JGZA 2ITNA 2Y6MA 4K8AA 5CSHA 5CXZA 5EM5A 2IZRA 3KN5A 2W9ZB 3NW7A 4RC3A 3E93A 1PXOA 4EH2A 5HTBA 2YJSA 2V5QA 4O0WA 3Q9XA 1Q24A 3UC3A 4JDKA 4IFCA 3MVMA 2DS1A 4YNOA 5C01A 3DQWA 3RHKA 3TNIA 3HV5A 5JT2A 4OTDA 2YAKA 4BVUA 2R3IA 3LIJA 3QD2B 3LFSA 4JDJA 5GJFA 5AV1A 2H34A 3IQ7A 2W5AA 4I21A 3ZO1A 5DH3A 4AT3A 5HBJA 4FGRA 4BDGA 1UU3A 2XP2A 4M67A 5BVWA 1YHWA 4EK6A 5EM6A 5E1SA 2X39A 5KZ0A 4JDIA 4FEWA 4CTCA 5A4TA 3VJOA 5IG1A 2BDFA 2E9PA 4JQ8A 1OBDA 4A07A 1BMKA 2OJGA 5AUYA 1YOJA 1OI9A 2ITQA 3DPKA 4RBLA 1OL2A 5I9UA 4F65A 2E2BA 4H58A 2HOGA 3RCDA 3AMAA 4M66A 3UZRA 2R4BA 4IM2A 3UTOA 5HBHA 3ULZA 4FEVA 2ONLA 1J7IA 1BLXA 4LOPA 5HLPA 2ERZE 5CT0A 4O7RA 3TV4A 4QNYA 1Q3WA 3BPRA 3F2RA 3AQVA 4L3PA 4PPCA 2I0YA 2WMSA 3QUEA 3GC0A 3RK5A 1H1RA 3RCJA 3G5DA 3Q2JA 1PJKA 3S2PA 3RM7A 1I09A 3BLQA 4E6QA 3CXWA 1OMWA 1AD5A 4IDVA 1IEPA 5A4LA 5KUPA 4BBMA 3ODYX 2Z2WA 4I0SA 4NK9A 4D2RA 5HTIA 4IVCA 3FMMA 5HE2A 5TO8A 4F9BA 1FBNA 4BCNA 3HDNA 2WOUA 3HV3A 4NTTA 2JD5A 5ANKA 5EDRA 4BHNA 3TDWA 4ZSLA 4AUAA 3R7EA 3HYHA 3D5WA 5GJDA 4B0GA 4PNIA 5IU2A 3FQHA 4JR3A 4W4XA 1CKIA 3KCFA 3REPA 4NEUA 5KBRA 2WQOA 4CQEA 1GJOA 2XB7A 3Q6UA 3ZXTA 3CIKA 2WMQA 4R5SA 2AUHA 3MJ2A 1PMUA 3RWPA 3FLSA 3Q4CA 3QWKA 4FL3A 4WG4A 3LXKA 5HG8A 3LW0A 2I40A 4I0TA 4AFJA 5IDPA 3TM0A 1L3RE 2BROA 1CSNA 2OGVA 3N9XA 4DN5A 2BTSA 4EL9A 2X0GA 2WEVA 3SOCA 3I7CA 4RFMA 2HZ4A 3FY0A 4I1ZA 2JDTA 3RVGA 2CJMA 3IW7A 4RQVA 3JXWA 5T68A 1NT2A 2GNIA 5M53A 4O6EA 1AQ1A 3O71A 3EN5A 4FIGA 2W1HA 1MRUA 4RX8A 5KHXA 3UC4A 5L2QA 4WIHA 3D5VA 4BBFA 1S9IA 4APCA 5HCZA 4Z9LA 4YTIA 2UW5A 3AC8A 5FP6A 4O21A 4U80A 2P55A 1H8FA 5ITAA 2BIYA 1JKTA 4OAVB 1UU9A 4E6DA 5HLNA 4XV2A 5ANOA 1DI8A 4AW5A 2CMWA 1XH6A 3MY1A 3KRRA 2CDZA 4MXXA 4DFZE 2QOQA 2FSOX 5AR8A 2PK9A 4EJNA 2CNVA 4J7BA 4DGMA 4C8BA 4ZTHA 4TKSA 4ZZOA 4W4YA 4DG2E 1LEWA 4CV9A 2H6DA 4D9TA 3V3VA 5FXQA 4O0XA 4YZDA 2FGIA 4M69A 4MXAA 4QP9A 4EOKA 3ZRKA 3R30A 3LXNA 4IW0A 3BELA 3BU3A 4E20A 5KMIA 3KVXA 5AP5A 3A7JA 4FSQA 2C3KA 3PJ1A 4DINA 3BYVA 1R0PA 5IMXA 3KU2A 3I79A 1TQIA 4FNZA 2JBOA 5ETCA 4F9CA 2Z02A 4HGEA 4FF8A 3D2IA 3H0ZA 2BR1A 5CALA 3VUTA 3GB2A 4P7EA 4UWBA 5FRIA 3D7TB 4ZOGA 3Q4UA 3PVWA 3LJ0A 2QC6A 3QA8A 4I5CA 3DAKA 4MQ1A 5FD2A 4BRXA 3LFQA 3LLTA 1A9UA 4HGLA 3R8VA 5KNJA 5IQHA 4FV0A 4EKLA 4JAIA 4EZ5A 3UOJA 3TI1A 5IDNA 2X8IA 4M12A 4FKGA 4B7TA 2QKWB 1ERKA 4K6ZA 3G6HA 4O0YA 3VUMA 3F3WA 4BCOA 4EWHA 1TVOA 2GS6A 3UMXA 1XBBA 2O0UA 1VR2A 3IDBA 2XBAA 3IW6A 3EQRA 1BL7A 2BAKA 3PSBA 2IO6A 3UO4A 3T9IA 3EN6A 3F82A 2XZSA 4PWNA 4NM7A 3SG9A 3G0EA 4KBKA 3TZ7A 4BYIA 4RWIA 5I4NA 4FR4A 4NJ3A 2C6IA 1Y6AA 3PLSA 3VWAA 4CT1A 3EYHA 4FTIA 3WF6A 4J52A 5J79A 3PPZA 3QRJA 2QOLA 3DZQA 3ACJA 2PMOX 2QLQA 1BI8A 2Y7JA 3KB7A 5BMSA 1OECA 4FG8A 4RIXA 5TR6A 3MS9A 2G2HA 1GIIA 4FK3A 3PE1A 4BGQA 3ZDIA 4FODA 1PY5A 3ZBXA 3SGCA 2XNGA 3PWYA 1DM2A 3FLYA 4TWCA 3BQRA 1KV2A 4FNXA 3DGKA 4RIOA 4HOKA 1QPCA 4ENYA 4GMYA 4GRBA 4AF3A 4XCUA 2BKKA 3KULA 4QMYA 4AGWA 4KIQA 2C4GA 2V55A 2CSNA 4NFMA 2OIBA 3LE6A 2ITXA 4JVGA 2P0CA 5JGDA 5LVMA 5LMAA 2F57A 4FBXA 2QOHA 3EN4A 3RPOA 2UZVA 4N6YA 3SKCA 3NPCA 3QUPA 5JFVA 5FEEA 1H00A 3QZFA 4E1ZA 3A61A 3DDPA 3LQ3A 4IM0A 5KBQA 4LG4A 3PDTA 4I94A 1FOTA 4IE9A 4MBLA 4BI2A 4BIDA 3QRKA 4OTFA 1K9AA 4D0WA 2C3LA 2OJIA 3NUPA 2RSVA 2XK7A 4Y85A 4FE2A 3DT1A 2YCQA 1NA7A 5E9EA 1XH8A 2UZNA 3DAJA 3GBZA 1TKIA 2VRXA 1TQMA 3IPHA 3QHRA 3W2QA 4EHGA 4UMRA 5FGKA 4KB8A 3ACKA 4L45A 4XBRA 2CKEA 3NSZA 4H1JA 3E88A 4M13A 3UG1A 4BCQA 2VNYA 2F7XE 5E8SA 1JNKA 5EW9A 5KHWA 3LJ1A 3AT3A 1PMVA 5AX3A 4RX5A 2XIYA 1A48A 3QTSA 3MH3A 4FK6A 5IPJA 1UV5A 3A4OX 4HVDA 1YVJA 2X8DA 3W18A 3WZJA 4D4VA 3I7BA 2C5OA 4Z7HA 4WOVA 3VC4A 2ITOA 1FPUA 1ZXEA 2A2AA 4R5YA 5CY3A 5KKRB 3WBLA 3VBYA 2PU8A 4FEUA 5J9LA 5J7HA 3KXMA 5JMSA 5CEIA 2PVMA 4AU8A 5ANGA 5JRSA 5TOZA 4DH3A 5IISA 3CD3A 2RFSA 2GDOA 3O7LB 4IX4A 3EL7A 4A4LA 4ZJIA 4F0IA 2YN8A 5HIEA 3UJGA 4R1YA 5L6PA 4G16A 3EJ1A 1OITA 3F5XA 5E7RA 4GFMA 3VS5A 5EQEA 4U3YA 5KE0A 2PY3A 4GVJA 2FVDA 5IUGA 4QMNA 4GKIA 2VUWA 2E9UA 4J96A 5J7BA
chains in the Genus database with same CATH superfamily
3BU5A 3QLGA 4ZZMA 5GIPE 3R2YA 2GNFA 3C7QA 4G17A 4PTGA 3BZ3A 2GQGA 5AJQA 3DXQA 2X2KA 5EI6A 2GS2A 2GNHA 5AUXA 3H4JA 4YZBA 3JPVA 3GC8A 3QCXA 4DC2A 5GZ8A 1Q61A 4QQCA 3QD4A 3FMNA 3U87A 2IPXA 1PXJA 3OTVA 4LL5A 5D11A 5FDXA 4NFNA 4EK5A 5CAOA 4L7FA 4EC9A 2VTIA 4F1OA 1XBAA 4O4BB 1VYZA 3FJQE 3SXFA 2OXDA 3Q04A 3V5PA 3QA0A 4G9RA 4CFXA 5ANJA 4BDIA 5BVNA 2Y6OA 4AXCA 3OC1A 4LUEA 1J7LA 4EH5A 4AZEA 3H0YA 3NNXA 2XJ0A 3EQGA 4IANA 3DDQA 3O8TA 5K3YA 4DEAA 4FT3A 4EORA 4QPSA 2OI4X 3FAAA 3KMWA 4F1TA 3BYUA 5E91A 1W2FA 3AC1A 3A7IA 2VGPA 4HYSA 4JQ7A 5AV0A 5ACBC 3RWQA 1V0BA 4AN3A 3AD4A 5CI6A 2QO7A 5LARA 1MQ4A 4JR7A 4WUNA 1M7QA 3D94A 1OUYA 4E5AX 1ZZLA 2PWLA 1VEBA 2R3GA 2WMAA 4IX3A 4A9UA 2UVZA 5JQ8A 4A9YA 4TYGA 4YTCA 1JSVA 3R6XA 1PRYA 1UU8A 1JBPE 4EEVA 1ZOHA 3BGPA 2X7FA 4WRGA 3S3IA 4IVBA 5KMKA 1FVRA 1Q8UA 3UOLA 1ZMUA 4FOBA 3MI9A 4RVKA 2WU6A 3OP5A 2BZJA 2YIQA 2XK9A 3ORZA 5DR6A 2RFDA 3TCPA 3KREA 4H3QA 3W33A 2YIXA 3IGGA 2JKOA 1TFFA 3HAVA 2W06A 3NLBA 5J5SA 3QC4A 4RWJA 1URCA 4PL5A 5EK7A 4BTMA 4YJQA 2G15A 4YHFA 5L8JA 2IVTA 3LM5A 2J5EA 3LOKA 1OM1A 3WZEA 4IWPA 3OT8A 4NSTA 2UW8A 2Y4IB 3CQWA 2QR8A 3Q9WA 5CF5A 3AKJA 2VTAA 3A8WA 5HI2A 3VUIA 2EB2A 4W9WA 4U8ZA 4D4RA 4Y8DA 3R73A 4ERKA 4EZ7A 3PZHA 4XNEA 3ZDUA 5F9EA 3EQPA 3RPSA 4WNMA 2PZPA 4JG8A 4EI4A 3GT8A 3Q5ZA 3KULB 4Y83A 1ZMVA 3KVWA 4YJPA 1UKHA 5HBEA 3UZTA 4IACA 1TQPA 3OMVA 3R8MA 4FSUA 4EOIA 3QLFA 5DT4A 1U46A 4IM3A 3FSFA 3NCZA 2VWXA 4QTEA 2OZOA 1WVXA 4E26A 4DDGA 5HIDA 3FKLA 4TWNA 2WKMA 3OWLA 5DVRA 2PTKA 2Q83A 4FVRA 1ZLTA 2QURA 1T46A 2BRGA 3OXIA 4HNIA 2J9MA 3QTIA 4YUQA 5L4QA 3W0NA 1Q97A 4BKZA 3VONA 4MWHA 2LAVA 2EU9A 4O7TA 4LFIA 2DWBA 4C37A 4TY1A 1T45A 3LQ8A 4GUBA 2X0OA 5EM8A 4ZK5A 3VO3A 1GZ8A 1JKSA 3PJCA 4BFMA 4E5WA 1GIHA 4Z55A 4JRVA 3V8WA 4G31A 4NW6A 5CTPA 4F7JA 5HD4A 2E9OA 3KRXA 4UZDA 4DCAA 4U45A 5B7VA 4RA5A 3BE9A 4UBAA 4MQ2A 4HYIA 3T9TA 5BX0A 2V0DA 4YJRA 5EM7A 3ZMMA 1YI6A 4TRLA 3VBXA 3E3PA 5IQBA 4O81A 1PXLA 3MESA 1H27A 5LMKA 4IAKA 4O0VA 4F7LA 5HQ0A 5HCYA 1WCCA 2VTOA 3EQDA 4O1PA 4O91A 2O8YA 2VNWA 4FZ6A 3UPZA 2YDKA 5IUIA 3V5QA 3Q9YA 4ANBA 4FV8A 4NTSA 3WZUA 3C9WA 4NU1A 5T3QA 3EQHA 3FMHA 3F2AA 5IQIA 4JNWA 3GI3A 5LOHA 5KMMA 2PUIA 3NNUA 2Y9QA 4KNBA 4M0ZA 3UDBA 4G5JA 3RJCA 3EQIA 3O0GA 3RZBA 3W2PA 4L46A 4XG3A 2W1EA 4IAAA 4KIOA 3COIA 5J1WA 4L42A 4CFWA 4ORKA 1JWHA 5C4KA 1J1BA 3KF4A 4YC8A 2AYPA 3UQFA 5BVOA 5LVNA 4RJ4A 2WTJA 4RC4A 2YM3A 1MQBA 1NVSA 1V1KA 3H9RA 3C4ZA 3DJ7A 4R78A 3EKKA 4AZWA 2J6MA 1UU7A 3DY7A 3N51A 4G3EA 4RVMA 2WTIA 5C26A 2XANA 5CSXA 3V6SA 4DAWA 4O7ZA 2QODA 2HELA 3TKHA 4BR3A 2J0IA 5CAUA 4S34A 5IQDA 4YJTA 3NUAA 2J7TA 5I5ZA 3FL4A 1PHKA 4EOLA 3ATTA 4GFOA 4CZYB 2WNTA 3WZDA 4TWOA 4J71A 4CKRA 1H26A 2J50A 2RGPA 3NVKI 3F2NA 2Y4PA 4L3LA 5JZNA 3U54A 3AC3A 1K3AA 4CRLA 2WELA 2CHLA 4U43A 4Y46A 5H9BA 4U81A 5HNGA 3Q4ZA 4FKIA 4JRNA 1LR4A 2HW7A 5EW3A 4M84A 3VNTA 2WMUA 5JFWA 1ZRZA 3TEIA 2C47A 3HDMA 3VBWA 3QQUA 2UZEA 3JUHA 5CLPA 2CPKE 3MV5A 4O0SA 4YNEA 3DKGA 3ODZX 4KABA 3MFUA 5BVKA 3DS6A 4U7ZA 3TIZA 4FTRA 4XG4A 1SZMA 5FLFA 4BC6A 4I93A 1GZKA 3RI1A 3KEXA 4EOSA 1IASA 3NEWA 1U5RA 1ZY5A 2ZVAA 4MNEB 1OKVA 4NCTC 1Y91A 5DA3A 4DTBA 3PG3A 4FSYA 2QQ7A 4R8QA 3UPXA 3FMKA 2I7QA 3WYXA 4C59A 2XCKA 4Q5EA 3U9CA 4QTDA 3ZU7A 3CCNA 4K2RA 5AV2A 3H3CA 4LYNA 4QYGA 1H0VA 3ORNA 1DAWA 3HP5A 3MSSA 5FTGA 1CKJA 4MEDA 2WU7A 3TKIA 1KE9A 5FWKK 3WE8A 3R9DA 3EN7A 4CMTA 3R9RA 4JBVA 4LL0A 4EOOA 5CEMA 1XO2B 3HECA 3NR9A 3DBFA 3K54A 4J8NA 4V01A 3MTFA 2QO2A 3KRLA 4FKWA 4ZSGA 3CTQA 3GVUA 4BCHA 3ORIA 4UALA 5K5NA 1E1XA 2BKZA 4AE6A 4DA5A 2OF4A 2BZIB 3CKXA 2IN6A 2BTRA 5AP0A 4IVDA 4ZJJA 4DH7A 3SVVA 1V0OA 3POOA 1ZYJA 3F3UA 1OIUA 1Q5KA 4JX3A 1GOLA 3U51A 4HCVA 3E87A 3TUBA 5FG8A 3PIZA 5EW8A 2PYWA 2NO3A 3DTWA 2ZM3A 2YAAA 4FKJA 3DKOA 3DJ5A 2IJMA 5AMNA 5L8LA 5M08A 2NPQA 3QTWA 4JDHA 2EUFB 4RMZA 3FUPA 2XF0A 3FL5A 4U0IA 4WSYA 4FMQA 4YSMA 2XM9A 2VTRA 2Y8OA 4MWIA 3HRCA 1GY3A 5ANEA 2EWAA 2JDOA 3O7LD 4O22A 2JIVA 3FWQA 4J1RA 3DTCA 4ZTRA 4E8AA 5IH6A 1HCLA 3NUUA 5I0BA 4HVSA 3EZRA 3E92A 4FTAA 1W83A 4CLIA 3N4UA 3A7FA 3ANQA 1ZYSA 3ZM4A 4KKGA 5AUVA 5HE0A 3ZOSA 3ZH8A 2BDWA 2YIYA 3PXRA 4M7IA 2OLCA 3KCKA 3GCPA 4YPDA 1U4DA 3F5PA 4A9RA 4DEIA 1IAHA 4CT2A 3BGZA 2YZLA 5CAPA 2VTTA 4QP1A 4YBKA 3P79A 3UG2A 3QQFA 4KRDA 1OIRA 4BCMA 2X6DA 4HPTE 5IA3A 5I9YA 4NM3A 4QMVA 1PMNA 3E63A 1IA9A 2VGOA 5EKNA 5C1QB 1AGWA 1LPUA 4CZUA 3F88A 2XK6A 3K2LA 3M11A 4OLIA 2R3LA 5AP1A 4BDBA 3G2FA 5IA1A 3AKLA 3TNWA 2CGWA 4QQ5A 3PP0A 4NT4A 4BKYA 3W0SA 5M07A 3ULIA 3R9OA 4ZEGA 4OUCA 3SW7A 4S33A 4O7LA 4M97A 2PUNA 4FKVA 5JGBA 4TYEA 4OGRA 5EDPA 2JAMA 1K2PA 2VO6A 2WMTA 2IW8A 3NFGB 3ZM9A 2ITZA 3OHTA 4X2GA 4YTHA 2OICA 3R04A 5LVLA 2CKQA 2AQXA 2B9JA 4FV2A 4R3RA 4E4LA 4EH7A 5IZFA 2WO6A 1FMOE 4IXPA 4L52A 2XKFA 2OH0E 3DZOA 2VTLA 2Z7RA 2VAGA 4TL0A 4IZAA 2I0EA 4I6BA 4R7IA 1Z9XA 2PVKA 3QKKA 4PDSA 4MF0A 5DRBA 5CU2A 3CQEA 4D28A 3UDSA 3DFAA 3HV6A 1P5EA 4C7TA 2CKOA 3LMIA 4B6LA 5IKWA 5JK3A 4PTCA 3MPAA 4FIIA 4QMUA 2XKCA 1R0EA 1OL6A 3EFLA 2YFXA 3Q4TA 4V0GA 4EH4A 5BYZA 2HAKA 2GQRA 3BGQA 5CS6A 1BL6A 4IB1A 2Z7LA 4GJ3A 3C4CA 4AZSA 1XQZA 2ZV9A 3NRMA 3BBTB 2PSQA 3UVQA 3ZLYA 4BCIA 2F7ZE 4BTFA 3KK8A 4X6QC 2PVFA 3R7YA 2O3PA 5CVHA 1JQHA 2C6MA 3OBGA 1UNHA 5CX9A 4ZY6A 3V8SA 4CYJA 5AR5A 4O4DA 1YDTE 5A9UA 5JH6A 1JPAA 5K9IA 4LUDA 3MFRA 2YJRA 3ZFXA 3H9OA 5M56A 4WNOA 1YI4A 4PP7A 3GNIB 3MIAA 1R78A 2C0OA 4AGDA 4UXQA 3S4QA 4D2WA 4QQJA 2JIIA 2HCKA 5AUTA 1W98A 4DG0E 4C3RA 4EJ7A 3BEGA 1QMZA 3IDPA 5CQWA 4MUQA 2YDIA 2XRUA 4FTUA 3GC7A 3NS9A 4ZMFA 1YKRA 1F3MC 2QONA 2R3HA 3D15A 5HX6A 2HZ0A 5AR2A 3VF9A 5E8WA 3UIBA 5LWMA 4RQKA 3U4WA 4DH1A 1PKGA 4CKJA 1ND4A 1H1PA 4HZRA 4L8MA 1WBNA 2XS0A 4C57A 5DRDA 4EUUA 1X8BA 3SC1A 2C3JA 4DYMA 3Q32A 4YZNA 3SOAA 3FHIA 5JQ5A 3OXTA 4X3FC 1J7UA 3UP7A 4M8TA 2BFYA 5H8BA 3GFEA 3EMGA 4OBOA 5TT7A 2Z7QA 2JEDA 2C5NA 3HGKA 1IR3A 3KMUA 3OF0A 4GKHA 2HK5A 3R1QA 3BV3A 4DHIB 1JOWB 5KMNA 4YTFA 1E1VA 2BHHA 4MH7A 4QQTA 2E9VA 3DK6A 4Z7GA 4NH1A 4FI1A 4QP7A 3I6WA 2OH4A 1PXKA 3FHRA 3HVCA 3VUDA 4ANQA 4QP2A 3ORMA 5HLWA 4IC8A 2C6KA 3CEKA 5J95A 3KF7A 3QU0A 4BJJA 2CLQA 3UMWA 2IF8A 4FL2A 5E8XA 5AUWA 2CGVA 5JZJA 2XUUA 4X2JA 3NUNA 3R7GA 4GK3A 4AWIA 3TNHA 4C4HA 2R7BA 4FJVA 2BAQA 3C13A 4U42A 2GMXA 2HY0A 3GFWA 3BWJA 3MFSA 4AA0A 5DFPA 3UO6A 4HYUA 4CFUA 3FZOA 3HRFA 4XJ0A 4BDJA 4O7YA 2F4JA 3FKNA 5EH0A 3CP9A 2VO0A 3FZPA 3A60A 3MBLA 4CKIA 4AG8A 5E1EA 3SAYA 4FL1A 2YWPA 3SLSA 4XV1A 1Y8GA 4XUFA 2OK1A 5EFQA 1GNGA 4UZHA 5CEOA 1PXIA 1YHSA 3OBJA 4JX7A 5AUUA 3BYSA 3M1SA 2C6DA 1FVVA 4KSPA 3OW3A 4PPBA 1YXUA 5D7AA 1VLRA 5K4IA 5JN2A 4UMQA 3DKFA 4GL9A 4C02A 4QO9A 3RBWA 2VWZA 3CTJA 4N6ZA 1GZNA 3WIGA 2BZKB 3NIEA 5HNIX 3NW5A 4ZJVA 2P4IA 3UOHA 2CNUA 2RF9A 1H0WA 3GQLA 3RAHA 4BI1A 5ICPA 4S32A 5IUHA 2PPQA 3SG8A 5AIKA 4C35A 2R3OA 2VN9A 4G6OA 4U79A 1ATPE 2XIRA 3RTPA 4QP8A 4ERWA 2OZAA 3KY2A 4FYOA 2WQEA 4RIWA 1J91A 4CLJA 5AFVA 2ZB1A 4I20A 4L00A 1YDRE 1ST4A 5H8EA 2VWIA 3V04A 2XNNA 4IAFA 4C4FA 3C5IA 1M17A 2UV2A 2PZIA 2V7OA 3LQ5A 3QGYA 4FX3A 4GV1A 2YZAA 3OROA 4I5MA 3P5KA 4X3FB 5FXSA 2IVUA 4DFYA 3MVHA 4KS8A 3ALOA 2PVNA 5CU6A 4NM0A 4FZ7A 4TTHB 4EWQA 3W2SA 3L9MA 4FV9A 5AA9A 3MW1A 2WPAA 3MN3A 1WBPA 3K5UA 4IWOA 2W0JA 5D1JA 5BUJA 4JAJA 3MPMA 3NMUF 3Q6WA 4FEQA 1OL7A 3T8OA 5M51A 1NVRA 5K4JA 5KX8A 3MYGA 1FMKA 3KRJA 3HX4A 4MBIA 3R7VA 4EH6A 4O1OA 2BDJA 3ZRMA 3F66A 5IA5A 1BKXA 3ATSA 3AT2A 1O6YA 3W55A 3A4PA 3OOMA 1IA8A 2J2IB 3HMPA 3QCSA 4OW8A 3MH0A 4NIFB 5EG3A 2X8EA 2IZTA 5AEPA 3PA5A 1G3NA 2SRCA 3E7OA 3OOGA 1CTPE 4JG6A 4BHZA 5GZAA 3QQGA 4E4XA 5E8UA 5HO8A 2BCJA 3OS3A 3PA3A 1XMMA 3KXZA 3GU5A 4IAZA 3PXFA 4X3JA 5B0XA 3VW6A 3MGYA 2OWBA 2J51A 3TJDA 4X0MA 4BCKA 5M06A 5AA8A 4HCUA 1M2PA 1KE5A 1CM8A 4NM5A 4BGHA 4PMPA 4HVHA 2YM7A 3BHHA 3ZO4A 3WZKA 2YABA 2ETMA 4QT1A 4HGSA 4W4VA 4JT3A 4IMYA 4FIFA 4IADA 2VTSA 2AC5A 2FSMX 3KL8A 5HIBA 2YCFA 4XV9A 5JGAA 3OXZA 2G1TA 5BPYA 2X81A 4BCJA 5CSPA 3DU8A 3QX4A 5E4HA 4CNHA 2W1ZA 3GCSA 5LQFA 4UN0C 4NKAA 1R39A 2C6OA 3BYOA 4QRCA 4E6CA 3AGLA 2QOOA 3RP9A 4GT3A 3PXQA 4C58A 3SXSA 4PDYA 5AV3A 1H08A 2QKRA 3NW6A 2JFMA 3GOPA 4AN2A 3NUYA 1WAKA 3OUNB 1OL5A 3C4WA 3PUPA 4MX9A 5CNNA 3LFDA 4YJNA 3R7OA 3TJCA 3EL8A 4PQNA 4HW7A 1WBWA 4KBAA 3PJ3A 1BI7A 4EK3A 5KZIA 2G2IA 4U41A 3QRUA 4ACDA 4F70A 3VVHA 2C6EA 3FKOA 2XALA 5DBXA 3V01A 5BVDA 5F94A 3DV3A 3DA6A 4FKTA 4YJOA 4DGOA 2ETKA 5HEZA 5J5TA 1YXVA 4KSQA 4DBNA 4ZTLA 2YDJA 2PUPA 3AKKA 5LMBA 3G9NA 1OPJA 3PFQA 4RIYA 4BCFA 5IQGA 4LOQA 4IVAA 4DGLC 5M4CA 3O8UA 1U54B 4IB0A 1O6LA 3K3IA 3UBDA 4KUJA 4C2WA 5FXRA 1CKPA 1ZY4A 4F99A 3FQEA 3CC6A 4Q2AA 4C34A 4CXAA 4D2VA 1S9JA 3LXLA 4YO6A 4ZLOA 5M09A 4G5PA 2A1AB 2HW6A 1KSWA 3EQBA 5FEQA 3VBTA 4YSJA 3BKBA 1PF8A 1XR1A 3GENA 4CG8A 2OFVA 5BUIA 4N70A 5EHYA 5TKDA 4KKHA 2WXVA 3I5NA 4CFVA 2VZ6A 3BLRA 4AOTA 3TZ8A 4O38A 5HX8A 2WMBA 2IZSA 3EKNA 4MVFA 4HGTA 3BL7A 3OCBA 4FV7A 4FKRA 5AP2A 3RKBA 1WBSA 2RFEA 4PY1A 4A4XA 2PHKA 3PSDA 4IH8A 2W96B 4FC0A 3RNYA 3V51A 4DHFA 3PVUA 3HZTA 4BTKA 3COHA 2C6LA 3RNIA 5HU3A 3D5XA 5IQEA 5I9WA 3GU8A 3R00A 4B99A 4GUEA 5AWMA 1DI9A 4B4LA 1RQQA 3HEGA 2C30A 3FLNC 3E64A 1NW1A 3HAMA 5LJJA 3R9HA 1R3CA 3OZ6A 3P7CA 4K77A 4M0YA 2FH9A 1NVQA 4FTQA 4S31A 3TYKA 1OBGA 4C36A 5LMKC 4J53A 4RJ7A 1OPLA 4L68A 4KS7A 5DEWA 4I5HA 2R3FA 4F1MA 3FEGA 4RJ5A 2VWYA 3R1NA 5DT0A 3W10A 3SRVA 2ZOQA 2I0VA 3KFAA 3PP1A 4F0GA 3UVPA 3TNPC 4RFZA 4FNYA 5HD7A 3W0OA 4FV3A 2VO3A 3UQCA 3QTQA 1YI3A 2XNBA 3E8DA 2RG6A 4XX9A 3VS7A 4EK8A 2OJFE 5GJGA 4CCBA 4DHJA 4MD9E 2X7GA 4YMJA 2ERKA 2G2FA 3EFJA 3ML1A 4D2PA 4ENXA 4FT9A 3VAPA 4A4OA 4D55A 3P78A 3E7VA 2VTNA 3JVSA 3BE2A 2OZAB 4JL9A 5M57A 3KRWA 3CGFA 4LGDA 1UNGA 4EQCA 5JRQA 4GCJA 2XNEA 4LMNA 4EZ3A 3E5AA 4J95A 3A2CA 2XNPA 2OJJA 2W1IA 3TUCA 4RX7A 3TUDA 3BLAA 4UYNA 2GHMA 4EC8A 5CF6A 5F20A 4AXDA 3WIKA 2WTWA 5M55A 5DI1A 1P4FA 4ONAA 4BZOA 2WD1A 5HICA 4I0RA 2X4FA 3IW5A 5AP3A 4R77A 4IBMA 4XOYA 4IZ7A 3R02A 4RZVA 3NYOA 2OXYA 5FQDC 3TTIA 2UZWE 5EHLA 4QPMA 3P7BA 3EB0A 4RPVA 4C3FA 5CENA 3OT3A 4FKPA 5C8KA 4N0SA 4ACCA 1OKZA 4QYHA 4JQEA 5H2UA 4LRKA 2WEIA 3IGOA 4O0UA 4I4FA 4LOOA 4BL1A 5DLSA 3ZC6A 2DUVA 5CAQA 1M52A 3FLWA 5DNRA 2WMXA 4RVTA 2QVSE 3CGOA 3HUCA 4NCTA 3NIZA 1Q3DA 3GC9A 3WARA 2ZFYA 2IZUA 3LCOA 4AT5A 4AX8A 1WVYA 4ZLYA 1OIQA 5BV3A 2B9HA 4Q9SA 5IQAA 3NGAA 4ZY5A 1PXPA 5EQYA 3FLQA 4RLLA 3IOKA 3CY2A 3OCTA 1YXTA 3IW8A 5HE1A 3C5UA 2C68A 3O51A 5CSVA 2P2IA 1G8JA 3R2BA 4QYFA 3VS0A 3ANRA 1XKKA 4GJ2A 4EH8A 3FPMA 3R8LA 4JI9A 3UYTA 3U6IA 3QWJA 4EYMA 2P2HA 4ZSAA 4F6UA 5JEBA 3V5TA 3O17A 4KIKA 4QD6A 2B9FA 3CPBA 4LV8A 4CG9A 1U59A 2VTMA 4ZTSA 2B0QA 3BCEA 4D0XA 2GPHA 4NYEA 4EHVA 4XH6A 4D1SA 1APME 1KWPA 3T3UA 4D5HA 3M42A 1YOMA 2BPMA 2J0JA 2R9SA 4AT4A 4O0TA 2X6EA 4FG9A 2GTNA 3C51A 4BZDA 4FKSA 4YHTA 4MXYA 4RIYB 4E73A 4C33A 2VWBA 4AAYA 4DFUA 4FKOA 5DEYA 4AS0A 5L2SA 1STCE 4K18A 3HRBA 1SM2A 3HUBA 4MXZA 5H8GA 4YZ9A 1O9UA 2XNMA 3TTJA 5DWRA 3VHEA 4PL4A 2JDVA 3AMYA 2HXQA 2PMIA 1ZOEA 3MFTA 1JSUA 2KTYA 4OTHA 4ZZNA 1OGUA 3ZYAA 4YJSA 2C69A 3AGMA 4XG8A 3OFMA 4O84A 2XK3A 1LUFA 2YLEA 5J1VA 3P23A 2VWUA 4TNBA 3QBNA 3O23A 3U8WA 4JG7A 3VUKA 3LMGA 1ZARA 2WTVA 4R3CA 3KK9A 3AC2A 1CDKA 1H4LA 1RJBA 5IH4A 3NFFB 3HMIA 2ACXA 4CFNA 1LP4A 1J1CA 5EYKA 4EBVA 1YHVA 1G8SA 2XRWA 2WQMA 4IHPA 4F4PA 5K0XA 5CU3A 2R3MA 4E4NA 1P4OA 1OGYA 2ZJWA 4AOJA 1KE7A 3FE3A 3C4EA 3FY2A 3MPTA 4GH2A 3V5JA 3QXOA 3VUGA 2OJ9A 4Y95A 1G5SA 1ZMWA 4G2FA 4OBQA 4FNWA 5CNOA 2BIKB 3FYKX 4ALWA 5AM7A 3E62A 1RW8A 3IW4A 3OTUA 3QD3A 3R0TA 4LRMA 3RINA 5LCJA 4RG0A 5E8VA 3ZTXA 4CFMA 3OW4A 4YC3A 5LXMA 4G1WA 5EOLA 4AZTA 4E4MA 3UZPA 3II5A 3WF5A 2R3QA 4RA4A 3EH9A 2R3JA 2V62A 3K3JA 4J97A 5L2WA 4OTRA 4UY9A 4X2FA 5HVJA 2WIHA 2C6TA 4C0TA 1PXMA 3ORXA 4EHEA 4I6LA 2FUMA 2YEXA 4JBPA 2A4LA 5J9YA 1Q4LA 3R28A 4MBJA 4TW9A 3HA8A 3SRVB 4USFA 3W0MA 3T3VA 2VWVA 3WF9A 4YGAA 3ZSGA 1PW2A 4PL3A 4YC6A 5CF4A 3ELJA 3F3ZA 2VV9A 4WG5A 4K11A 3U6JA 4GK2A 1OL1A 4DT8A 1XHAA 2YIRA 3ENMA 1YWNA 5HORA 4RGJA 4PNKA 1GAGA 1YWVA 3QGWA 4CCUA 4YU2A 5FBOA 4FG7A 4XG7A 3GOKA 4AW2A 4G9CA 5DIAA 2W17A 4C3PA 2B53A 3ZO2A 4ZLZA 2XYUA 2BRBA 4PTEA 5CVFA 2YLFA 2X2LA 4PMTA 5CQUA 4ITJA 2HENA 3DKCA 4L7SA 4ANMA 1XJDA 2JKQA 1JAMA 3VS1A 1H01A 3W2RA 3JR1A 2VTPA 4PDOA 4TYHB 1DAYA 1OZ1A 3A7GA 3ZLSA 2OF2A 3U6HA 4ZAUA 4FTNA 3BHYA 5M44A 3MJ1A 4D1XA 2PUUA 3AG9A 3QKLA 2YA9A 5E8YA 4W9XA 5ACKA 4RIXB 2YITA 4RVLA 4GEOA 2F2UA 5I3RA 2X0QA 1YDSE 4CZTA 3I1AA 5GZ9A 3ZFYA 3CD8A 3MA3A 3UQGA 3QCYA 1H1WA 3QAME 5CXHA 4QMOA 2ZDTA 2XM8A 2A27A 2Q0NA 4ITIA 3EHAA 3DBQA 2JBPA 3FDNA 4TXCA 2GNLA 5H3QA 2XIKA 4H39A 4O2ZA 2ETRA 2PE1A 4QMQA 2B1PA 2BUJA 1JLUE 2FSTX 3TL8A 5E92A 2P3GX 4QMZA 4ZY4A 5IA0A 2BRMA 1ST0A 3HV7A 3UE4A 4QNAA 3ET7A 3ZBFA 4APPA 3S0OA 5BYLA 3D5UA 3LJ2A 4YURA 3MH1A 2UW9A 4F6SA 3FI3A 5DR9A 1LEZA 1YXSA 2GFCA 4WUAA 1B6CB 3DNDA 1PYEA 1EH4A 2WTKC 3LZBA 4PMSA 2CCHA 4JBOA 4O27B 4B8MA 3GUBA 5JFXA 5KO1A 2AEGA 4X7QA 1QCFA 3I0QA 5C4LA 2HXLA 2V7AA 3NX8A 3W2CA 4D5KA 4EH9A 4NW5A 1YRPA 4MAOA 3L8SA 4QTBA 4X3FA 3F3VA 2QG7A 5CU4A 3QTUA 4P5ZA 5LWNA 4TYIA 4KAOA 4DG3E 2HYYA 3LFEA 1Y6BA 4RFYA 2GFSA 3EFWA 4UWCA 3NYXA 1P2AA 2C1BA 1SMHA 4MD7E 2QU6A 4MNFA 2O5KA 4AE9A 4DFXE 4I5PA 3CKWA 3W32A 3CBLA 2BVAA 4ANSA 2UZDA 2W7XA 4XLIA 4YLJA 5EDQA 3LM0A 2W1GA 2YWVA 4IEBA 4AN9A 3F3TA 4I41A 5LVOA 2XJ1A 3PXYA 3ZLWA 3VULA 3VRZA 4FSRA 4AW0A 4JXFA 4HCTA 3R9NA 4BY9E 3L9NA 5IMEA 4QMXA 4O96A 3E8CA 1SYKA 3NYNA 3OWPA 4I6QA 4FIHA 4UMPA 1H28A 3TN8A 3TV6A 2A19B 5KKRC 4CVAA 4DT9A 4HPUE 4BZNA 3DLSA 4H36A 3GCVA 2PVLA 4QYYA 3VF8A 4ANNA 4B8LA 2NYAA 4AXEA 4PP9A 5TF9A 5E90A 5L6OA 3LLAA 3ZSHA 4KIKB 4GYIA 2PZRA 3LCSA 1M2QA 2FYSA 4OT5A 5BNJA 3OEZA 3FC1X 2VX0A 5DOSA 3ZLXA 4Q5HA 4F7SA 4JLCA 3I0OA 2BRNA 2QOFA 3Q60A 3IO7A 4FSZA 4MNEA 4EOJA 1Q41A 3TT0A 3IDCA 3RALA 3NVMB 4FIEA 4QPAA 1VYWA 2J0KA 3H9FA 3NAYA 4FV1A 3SHEA 4P4CA 4QMPA 4UB7A 3OCGA 4QP6A 3I60A 2XA4A 2BMCA