4I5HA

Crystal structure of a double mutant rat erk2 complexed with a type ii quinazoline inhibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
335
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVADLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKILDFGLARVADPLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 1
publication title Sequence determinants of a specific inactive protein kinase conformation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 101
structure length 335
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i5hA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i5hA01
3QTIA 4IC7A 4NT4A 5AAEA 4F9YA 5KBRA 3GT8A 3UYSA 5DT3A 4C3RA 3FKLA 3UQGA 3WF8A 1AQ1A 1V0OA 2I1MA 2XRUA 4I4FA 5K9IA 4FT9A 3R8PA 1YHWA 3EQDA 1ZYJA 3F3WA 3S00A 3TNQB 3O2MA 5EDPA 1UU3A 4XCUA 1A48A 2ITXA 2Y4PA 4H36A 4L00A 4RC2A 3EQGA 2HWOA 4C0TA 2WEVA 3FLSA 1URCA 2WMBA 1WBSA 4U44A 3AMBA 4RPVA 1M52A 3H0ZA 4G9RA 4QTBA 4WO5A 3H9FA 3QX4A 3RAWA 4M66A 4F4PA 3PY0A 4MBJA 5JGDA 5C8MA 3HAVA 1PXIA 3QTXA 3GC0A 5BVNA 4DBXA 3L8XA 3OCGA 3DXQA 3PJ2A 5M56A 4A9UA 2ONLA 5M57A 5BVEA 3R8LA 1BMKA 5AP0A 2A2AA 4ITHA 3EFJA 4FKPA 5TR6A 5ICPA 3MVJA 2WGJA 3EJ1A 3R7OA 4JR3A 2R4BA 4BDKA 2X6EA 4C4IA 3FC1X 4E4XA 4AQCA 4Y95A 5AX9A 2BTSA 5FM2A 3GC9A 3QCSA 3VBQA 4PTEA 2G01A 3ZDUA 3TZ7A 4X0MA 4FV5A 4U79A 2PVMA 3HL7A 3H30A 2O2UA 2Z7QA 2WTDA 4IEBA 3ELJA 3E8DA 5K4JA 1FINA 5ANJA 4O7VA 5EW3A 2ZYBA 3OWLA 4O27B 4F0FA 1OL7A 3FI2A 2XNBA 3R2BA 5FEQA 2UZBA 5AV0A 3TT0A 3UPXA 4UXLA 2BDWA 2PZIA 3KY2A 3NZ0A 4MAOA 3MIAA 1QPEA 4JBOA 1KE9A 2GNLA 5HVYA 4BCJA 3R1QA 4NFMA 4BFMA 4YTFA 5I9XA 3PDTA 4BCNA 2B54A 4EHEA 4XLVA 4L3JA 3MN3A 3R7EA 2QKWB 4U80A 3REPA 2JIVA 3LFQA 4LGGA 3DTWA 3IQ7A 4WHZA 4AW5A 4DFZE 1R1WA 3OW4A 5IF1A 4YHTA 4FTMA 5AR2A 3UIBA 5C26A 5CF8A 3ALOA 3RHKA 3AT4A 3DU8A 3LCTA 3OMVA 3PYYA 4L6QA 3PP1A 4Q2AA 4FSYA 4S2ZA 3ZS5A 2E9VA 2C6DA 3ANQA 3EHAA 4EKLA 5E8XA 3RMFA 4ENXA 4H05A 2OF4A 5CQWA 3B8QA 4HPUE 2PSQA 1ZY5A 2JBOA 4JG6A 2OGVA 3ZLWA 2B52A 4HGSA 5IQHA 2H96A 4KS8A 5DLSA 2XK6A 3LVPA 4S34A 4RJ8A 1ATPE 4AZTA 3KMMA 2UZVA 4X3FC 1OI9A 2JDSA 4AWIA 5HORA 2BKKA 2CMWA 2CGWA 3CTHA 4MD9E 1PXMA 2XA4A 5ETCA 4EK8A 5FP5A 2XH5A 1YXSA 1YI6A 4S30A 1PKDA 5A6OA 1H1PA 4KBCA 2VO0A 4JS8A 4OTDA 4RJ7A 5C4LA 2J4ZA 5D12A 3ZBXA 5JGBA 2JEDA 4Z16A 2RFNA 4ZS4A 3K5VA 3OCTA 4NL0A 3C5UA 1YXUA 3ZO4A 2W1EA 2P4IA 4AZWA 2IN6A 3OWPA 5IEYA 3PXQA 2O3PA 4K8AA 4DEDA 2O8YA 1OL5A 5B2LA 4LRMA 3BU6A 2XK9A 4C4FA 4QTCA 4XMOA 4QMYA 2J0IA 3RAHA 5G1XA 4EHGA 1MP8A 2BAQA 4YC3A 2XJ0A 4D1XA 2A0CX 4QYYA 4QMTA 3JY0A 1U54B 4I0TA 3HEGA 4WBBB 2XYUA 4FTRA 1NA7A 3KRRA 4C4JA 2QOQA 3ZRKA 3I0QA 3LMIA 3V8SA 4RBLA 3A8WA 2WOTA 4UYAA 4I20A 3MH3A 5HNGA 2VTJA 3EQBA 4XOYA 3PRFA 3DY7A 2R3JA 4X7QA 5HVJA 4TPTA 3UG2A 3PLAE 3D5VA 5CF6A 4XHKB 2R0IA 5A4CA 4AZVA 2JKOA 2X39A 2CJMA 4L01A 3PTGA 4CYJA 4ZOGA 4JI9A 4U6RA 4CFXA 4DEBA 3ANRA 4AZEA 3E93A 4RT7A 5M4FA 5EHLA 4OBOA 1M7NA 3EQCA 4TZRA 5CEOA 3AT3A 1AD5A 4ALVA 5CANA 3OP5A 4R8QA 3WZEA 4YNEA 3V8WA 2WMTA 2R3HA 3VRZA 4R7BA 4D0XA 2X7FA 1Y6BA 4HYIA 1OIYA 3TV6A 3R63A 3FE3A 4O82A 2VWWA 4TRLA 5GZ8A 3QZHA 4YSMA 3S95A 1YXVA 4C2VA 5IQCA 4FKOA 2C0OA 5DR9A 3MB7A 3R7GA 3R83A 3DBDA 2WHBA 2ITZA 4AA0A 4YO4A 4U5JA 2YEXA 3ORXA 4YTIA 2CNQA 2WTKC 4PPCA 1NVRA 1X8BA 1V0BA 5L8KA 4UX9A 3UOLA 1U5QA 3KQ7A 3IECA 2LAVA 2QODA 1OPJA 4PMTA 5DRDA 1FGIA 4P4CA 2Y6MA 2OO8X 3R0TA 2Z02A 2WMSA 3DZOA 3ZLYA 1YI3A 2Y0AA 3DQWA 4NSTA 4O81A 1W82A 2C68A 4RQVA 3DKGA 4TNBA 4K1BA 2P2IA 4R5YA 3E3PA 2VTIA 5A4TA 3HMIA 3VRYA 4RSSA 4BCMA 3HLLA 4FV6A 2XK7A 3U6IA 4FBXA 4FK6A 4QNYA 4FSZA 1JPAA 3MVLA 4JIAA 3CD8A 1ZY4A 3QCQA 3C7QA 4NTSA 3R8UA 4CFUA 2BRNA 2CLXA 4L9IA 5CNNA 5EI6A 3TG1A 4I5CA 2VGOA 2WQNA 2YDIA 4BTKA 1CM8A 5D41A 3SVVA 3OF0A 3ULIA 3VQHA 2WU6A 5BNJA 3ATTA 2H8HA 2KTYA 3M11A 5EQPA 5IA0A 2JKMA 3SXRA 2QOHA 2J0MB 4BWKA 4H1JA 1RJBA 1CKPA 4FICA 4EC8A 4MF1A 3PJ3A 2FB8A 2OJIA 5D7AA 1VJYA 2I40A 4TWOA 2VUWA 4QMLA 3FI4A 2OG8A 4H3QA 4FGBA 2BALA 3RNIA 4EK5A 4ZY6A 5A46A 5EI8A 4BR3A 3P08A 3G90X 1SVHA 4K2RA 3LPBA 4BDFA 2WMRA 2WB8A 1TQIA 3FLZA 3DS6A 1B39A 2BFYA 4IB5A 3A7IA 5CT7A 3TZMA 3IGGA 2W9FB 4LUDA 4XUFA 4YJNA 4AS0A 4DH8A 1LEZA 3PA4A 3CS9A 3NNUA 3ZONA 4BDAA 3DBFA 3D7ZA 2O63A 5EYKA 4B4LA 4APCA 3ZDIA 2HW7A 5DVRA 2X0GA 1FOTA 2GNGA 3V6RA 4AGWA 3JUHA 1JSUA 2HZ4A 2HK5A 3D5UA 2XRWA 4F0GA 4CMOA 3F2RA 2UZWE 3ENMA 5TO8A 4D4SA 4ONAA 4D9TA 4L3PA 2QURA 3UZPA 2X8DA 3N9XA 4I6HA 3DFCB 4C3PA 2XB7A 5EYCA 3TNPC 2PL0A 3QCYA 3AQVA 1TKIA 2C3LA 2F9GA 4Z55A 3KXGA 4FG7A 2OF2A 3QRTA 3A61A 3EL7A 1BKXA 4ACMA 4G2FA 3PE2A 4KIKB 3D7TA 3SD0A 3KMUA 3AD6A 3ZXTA 4X2GA 3ALNA 2R0UA 5IUIA 1PJKA 2JIUA 2PUUA 2AUHA 2FA2A 5D1JA 5C03A 2PMLX 3HX4A 4G17A 2J6MA 1ZZLA 4KA3A 5HKMA 3AD5A 2QCSA 1YDRE 2YAKA 3NYOA 4CSVA 4E7WA 2Y7JA 4FEVA 2R5TA 3G9NA 3I6WA 2W1FA 2WQMA 1BUHA 3UOJA 2X2KA 5CI6A 4C59A 4BZDA 3HAMA 2UW5A 3BRBA 2QO7A 3E8CA 3UJGA 4B9DA 4IC8A 5CEKA 2YN8A 5HCZA 3PPKA 5EM5A 3WI6A 2R3GA 3R6XA 1OKYA 2AC3A 2QO2A 4A06A 1J91A 5CF5A 5HO7A 5TOZA 1WAKA 3BKBA 4UY9A 3VUGA 4E4LA 5J87A 3UZTA 4UMPA 3M2WA 4R77A 3MB6A 4FNYA 3EFWA 3C9WA 4PX6A 3NAXA 5L2WA 4IX3A 5J7BA 3BX5A 3GCVA 2OSCA 2IZRA 4ACCA 4F09A 4MD7E 4DH7A 4F1TA 3HMMA 3VIDA 4AOJA 1JKLA 1QPCA 4O38A 5HIBA 5J79A 2WZJA 4IJ9A 3U9NA 4ZMEA 4O7SA 3QD4A 3LFNA 4FV9A 5K0KA 5IA3A 3ULZA 3NW6A 3QU0A 3NW7A 4WNMA 3QXPA 1G5SA 4EYJA 4NM5A 3RM6A 3R7IA 2R3IA 4FOCA 2QOFA 4HJOA 3VHEA 5AUUA 1DI8A 4OGRA 5AX3A 3WF6A 1GZKA 3QTWA 1ZYLA 3QA0A 5FLFA 4CFWA 2GU8A 1CTPE 4O1PA 5GJDA 1OPLA 3GI3A 2ACXA 3D9VA 4RX8A 4TTHB 4HVHA 1SMHA 3C0GA 4L45A 3VS4A 5K5XA 3H3CA 4C37A 3QRJA 1STCE 2QOKA 3GBZA 3FY2A 3QQHA 3QWJA 4AN3A 2CKOA 4DTAA 2C3JA 2VX3A 4D0WA 4D4VA 5CAQA 4WKQA 5CY3A 4AW2A 2UW7A 2W4KA 1K2PA 1WBPA 1ZOHA 2IJMA 4BCKA 5F4NA 3VJOA 4E3CA 2UZLA 4XV9A 4UALA 1F5QA 4RZWA 2HCKA 4N57A 4BI1A 2PZRA 4IZ5A 3F88A 1GZ8A 3THBA 2W7XA 5TKDA 3R9HA 3CR0A 5CU4A 4C36A 2BRBA 2FSOX 4I92A 5IU2A 5CAUA 2GHLA 3L8SA 3TKUA 4R7HA 1TQPA 4IX6A 4IFCA 3LFFA 3W32A 3LCKA 4XBRA 1Z9XA 4L42A 5BVKA 5HE1A 5BVDA 4YBJA 3VWAA 2CN5A 2RG6A 4IE9A 3GC7A 3MSSA 4F6UA 2YCSA 1XH4A 3MFTA 4FT3A 4NU1A 4U3YA 4YPDA 4FT7A 5FTQA 3C4EA 4R3PA 3Q32A 2B4SB 5JN2A 4ERWA 4OAUC 2YIWA 5I0BA 3SOAA 2QO9A 1Q8ZA 2C3KA 2PMNX 3O0GA 3F5PA 2UVZA 4G5JA 2XK4A 4FV4A 1ERKA 3OXTA 3PWYA 4QTDA 2A27A 2VAGA 4BKZA 2V0DA 4IAAA 4KBKA 3R28A 1QMZA 4MQ2A 4R1YA 3QYWA 1GOLA 5CEPA 3FLWA 5IZFA 2OI4X 3SXSA 4ZMFA 4O7ZA 3ACJA 5KKRB 3COMA 3ROYA 5ACBC 5J9ZA 3PJ1A 4EYMA 3HA6A 3GGFA 3IDBA 3DBQA 3MDYA 4Y8DA 4JNWA 2G15A 3FYKX 4D28A 3DT1A 1Y8GA 2BKZA 2IZTA 1S9JA 3G33A 4RJ6A 2ZJWA 2CKEA 1H1SA 2RF9A 3DLSA 2UVXA 5JMSA 3ZH8A 3TUCA 2QOBA 4J71A 1L3RE 4LYNA 4H39A 3K54A 5BVFA 3C0IA 2GFSA 4G3FA 4G6NA 4YZ9A 4XOZA 4FKTA 3ZUUA 4DG2E 3P7AA 1J1CA 5A6NA 3NVMB 4NCTA 4AN2A 4AUAA 1Q3WA 4FEQA 2JDOA 4KIPA 5AIKA 3D0EA 5I9YA 2W9ZB 3LQ5A 2YM5A 5HCYA 4CFVA 3CEKA 4EUUA 5CF4A 1ZZ2A 2OLCA 3G9LX 4LV5A 2CN8A 5IG1A 3NCGA 5D10A 1JOWB 4M69B 3SOCA 2IZUA 2WEIA 3FMMA 3MTLA 3KC3A 4FR4A 2E9UA 3R04A 2BAJA 2BR1A 4G16A 4J8MA 4AT4A 5AEPA 4YP8A 3V5WA 1A9UA 1G3NA 3OHTA 2OU7A 2I0EA 4U43A 5HGIA 3JS2A 2ZB1A 3WZUA 3O51A 3RAIA 4FIGA 5FDPA 2ONLC 3G6GA 5E8UA 3VQUA 2CKPA 2ERKA 5G6VA 4O86A 4FTTA 5AP3A 2W1GA 4X21A 4XG9A 4ACDA 3LMHA 4JOAA 4HGTA 5E8VA 4RX5A 3FQEA 3V5JA 2CDZA 5IQEA 2R3LA 3BYMA 4Z9LA 3B2WA 2VTNA 1SVEA 3PXFA 3F3UA 2J5EA 2BZJA 4FTCA 3DNDA 3LFAA 1HOWA 4RWIA 1UU8A 4BCFA 4E93A 5C1QB 4KKEA 4N4SA 4G31A 3TTIA 4BC6A 3P86A 4D2VA 4J98A 2WTIA 5EM8A 1NVQA 4UMQA 5CS6A 4OAVB 2OH4A 5H2UA 4BYIA 2I0VA 3UP7A 3HRFA 3L8VA 4QYHA 1MUOA 2C6KA 3ZU7A 5K4IA 4U8ZA 2R2PA 4ZAUA 2F49A 2Z8CA 1J1BA 2C6TA 1H0VA 3EB0A 2YM4A 4X6QC 4KBAA 3BV3A 2UVYA 2IWIA 3MWUA 3PPZA 4FZAB 5BQ0A 2Z7LA 2WIPA 5LVMA 4YPSA 2YJRA 4ENYA 2FUMA 4GUEA 4NKSA 3VUHA 1WBWA 3PSBA 4E73A 3QZFA 1UU7A 3MH0A 3OWKA 4BY9E 2BTRA 4NEUA 3TJDA 3BU5A 3WIGA 4WG3A 3UMXA 2UZTA 4OW8A 4HVIA 1JSVA 2YM3A 4OTRA 4NJDA 2CNVA 3PVBA 5T3QA 4JRNA 4CGAA 4F7JA 2PMOX 5IH4A 3BYVA 5AUWA 3W18A 2ZOQA 3OVVA 2X2LA 3EN5A 1M2QA 1PMEA 3IGOA 2JAMA 3FUPA 2ZV9A 1IAHA 1H01A 1NT2A 1LR4A 4RX7A 1UV5A 3QZGA 3PPJA 4HOKA 3GENA 3QRUA 4JR7A 3PG1A 4L44A 4F7LA 4I24A 2R3OA 2VX0A 3LCSA 5BYLA 5HEZA 3TN8A 3FL4A 5CNOA 2HIWA 2HOGA 3JVRA 3OT8A 2OBJA 3OXZA 3WBLA 1LPUA 4M97A 4EEVA 4EKKA 2YWPA 4R3RA 5HU3A 5E7RA 3D2KA 3DBCA 4CZYB 4G3GA 3AG9A 4U97A 4DG0E 2G2HA 1H26A 3UODA 4ZLYA 2Z7SA 3ZOSA 4RIOA 4DGLC 3NMUF 3QQGA 4GV1A 4YC6A 3GUBA 3H9OA 4L53A 4AZFA 4MH7A 4BDCA 3JYAA 3VBYA 3GFWA 4IVAA 4BIBA 5IISA 4YZNA 4ZJVA 3JVSA 1IA8A 4BDHA 5AV2A 2IZSA 3B8RA 3R8VA 3Q9XA 3P4KA 4PL3A 3LFCA 1WCCA 2XCKA 4EOSA 3DAJA 3NRMA 3ODZX 2I6LA 5DRBA 5HCXA 4XRJA 2QOLA 4JDJA 3Q5IA 1XQZA 3H4JA 5HTCA 5JQ8A 5L8LA 1K3AA 1M17A 4XNEA 3PA5A 5AV4A 3DB6A 5IMEA 5HTIA 5M07A 1W98A 5D11A 2Y4IC 4FTNA 3C5IA 3E7OA 1JNKA 4JBPA 1W8CA 4DAWA 5IA2A 3VULA 2YIXA 5E90A 4IVDA 5FUTA 5AAGA 5M09A 1Q61A 2GS2A 5H3QA 2QHMA 3CE3A 5HLNA 2OZAB 2BCJA 3CGFA 3VUDA 4YO6A 1G8AA 3L9NA 2V7AA 2YCRA 2C5YA 3BHHA 4BCHA 4IMYA 3CTJA 3MY5A 4QP1A 4USFA 3FV8A 3VUMA 4AA4A 2C0IA 3W1FA 4PTCA 4P2KA 3GU7A 4BL1A 2DWBA 5A4LA 5M4IA 5CWZA 3SLSA 2QLUA 3CJFA 3WOWA 4YURA 4M8TA 1PF8A 1YVJA 3F3TA 4HCTA 4GK4A 1XBBA 4LI5A 2J2IB 4CXAA 3Q60A 1ZYCA 4DFXE 3F9NA 4GCJA 3R9DA 1Y8YA 4MXOA 3MPMA 4FTIA 5AP4A 3ZLXA 5ANKA 3AC1A 3O8UA 4EI4A 3HKOA 1OIUA 1B38A 3DOGA 3TIZA 3FZSA 4G3DA 4WRSA 3EWHA 3S1HA 4GU9A 5L6PA 4D4YA 4ITJA 4GS6A 2QD9A 3TTJA 4BBEA 5FTGA 5E92A 4P5ZA 3ZO3A 5ITAA 4Y85A 1L8TA 3HA8A 3NW5A 3WF5A 4CTCA 3VN9A 3V5TA 3KULA 1QCFA 4UB7A 5KMIA 2RG5A 2HZNA 5JQ5A 5M44A 3FMJA 4X3JA 1ZAOA 4PL4A 4PDSA 3RNYA 4AGUA 4D5HA 5LWMA 2RFSA 3W2RA 4JJRA 4FK3A 4LMNA 1KE6A 4DGOA 3VF8A 3Q4ZA 1XO2B 3BZ3A 4OT6A 5GIOE 4CQGA 3R22A 4ALUA 1WBNA 5BUJA 3RPOA 3RI1A 4FIIA 5J5TA 3LFSA 4A9TA 2F7ZE 4QMXA 5BVOA 3HECA 1WBTA 2GNFA 2VD5A 2W5HA 5CVHA 5BUEA 3OOGA 3SV0A 1CMKE 1YQJA 2NRUA 4FNZA 4FKJA 4XG8A 2J7TA 4GH2A 5AV3A 5A54A 5DYJA 2UZEA 2C0TA 4S32A 3CXWA 5GZ9A 4C3FA 2ZM3A 4AN9A 4OTPA 1RE8A 1VYWA 2Z60A 4NM0A 3ATSA 3LQ8A 5E8ZA 5EKNA 3UNKA 2PY3A 1XH7A 4JG8A 4IWDA 5B0XA 3GU4A 4AP7A 3C51A 3BHTA 4X3FB 5HG8A 4IWQA 3KXMA 1ZARA 5E8TA 1OKZA 3VS6A 3LM5A 5HG7A 1ZXEA 1JKKA 2HWPA 3HUCA 1W0XC 3HV7A 4CNHA 3CIKA 2VO7A 2O0UA 3LJ0A 3BWFA 5CXHA 3WYYA 3ZZEA 3TNWA 5LCKA 4Q9ZA 4PTGA 1CKJA 3F66A 4YLJA 1Q8YA 3IONA 3MFUA 3O7LB 4HPTE 3QGYA 3NUYA 1OUYA 3QLGA 4H3BA 4V0GA 3QRKA 4I6QA 4J7BA 2HENA 1YW2A 4QP3A 4WSYA 4E4NA 5M51A 4TYHA 4D9UA 5AUYA 3QTUA 3EYHA 3UQFA 4GFGA 4IX5A 1CDKA 5HO6A 4GK3A 3R21A 4WNKA 3FEGA 4O0UA 1GIHA 5IDPA 4GKIA 4I21A 2RGPA 2XNPA 4HGLA 3DK3A 3OXIA 1FMOE 5LOHA 3NWWA 3R7YA 5F95A 3Q2JA 2W5BA 5I9UA 3QD3A 4YSJA 3UO4A 1P2AA 2P55A 5CTPA 3W16A 1H27A 3KA0A 2F7EE 2ZVAA 3ZFXA 1ZMUA 4F63A 4DT8A 3OTUA 4XS2A 3OROA 3S2PA 1PMNA 1I09A 2QOOA 1OL6A 2XIXA 2YIRA 4BGQA 3PSDA 1K9AA 3GU6A 4BB4A 3D14A 2R3MA 4A4XA 4FV8A 2IVTA 4CQEA 2XKDA 2CGUA 3C1XA 4C02A 4DEEA 4FE2A 3WYXA 2CGVA 4C4EA 4A7CA 4QQTA 3O7LD 3II5A 3FKNA 4ZSJA 4ASXA 5KMNA 5HHWA 4FG9A 1F3MC 1E1VA 2JDRA 3LMGA 4I6FA 4PMSA 4KSPA 4DH3A 5JFXA 3LXKA 3O50A 1SM2A 4QP9A 4RIYB 3ZLSA 2AYPA 3SW7A 1WFCA 1YWRA 3HRBA 1VR2A 1OL1A 3I5ZA 4QMUA 4WT6A 4QMZA 4ZSLA 4GEOA 3VC4A 5DEWA 4XBUA 5KMJA 3QTQA 3LCOA 4RIXA 4Y73A 2PVYA 4PP7A 2ITTA 4Q9SA 4YJOA 3V5PA 4KNBA 4DA5A 2BZIB 4FF8A 3DDPA 1JSTA 3C4FA 1TQMA 4G3CA 2X8IA 5KMOA 4W9XA 2YCFA 4BDIA 5JRQA 3OCSA 4NYEA 3G0EA 3PVGA 4RRVA 4QP2A 2W1DA 3V5QA 4ZY5A 2WTKB 3S0OA 1F0QA 4GSBA 4IJPA 4NZWB 2IVSA 2RKUA 5DH3A 1H00A 4I5PA 2VU3A 3A4OX 4HGEA 4IM2A 4CFNA 1XH5A 5CSPA 5GNKA 4B99A 4DCAA 4ZXTA 5AUZA 4O91A 4CCBA 3DK7A 2VRXA 3S4QA 4KABA 3KRWA 3F2NA 3QQFA 4FUXA 5IA4A 4MNEB 4O21A 2ZB0A 1OMWA 4RA5A 3AXWA 2YIQA 2NP8A 4E6AA 5JFSA 2BZKB 2YFXA 3LHJA 1SZMA 3E7VA 5FEEA 3A7GA 3POOA 3V8TA 2ESMA 3TACA 4O2ZA 3TV4A 5M55A 3KXXA 5HIDA 3N4VA 2BAKA 2B0QA 2FSLX 3SXFA 2B7AA 1KWPA 3H0YA 3EQFA 3QXOA 3QKLA 2JKQA 3P23A 1I44A 3R00A 5A3XA 3RK7A 3C4XA 4BDGA 3UG1A 3PSCA 1E1XA 5FBNC 4DFUA 3PE1A 1R78A 1IG1A 3EOCA 4ZLOA 4FUYA 2WNTA 5HTBA 1DAYA 4L7SA 4FOBA 3FQSA 4F1OA 2VN9A 2Y6OA 4FI1A 2B9FA 3FJQE 2OH0E 1G8SA 5AP2A 3TUDA 4KWPA 3U8WA 4J53A 3WE4A 4CMUA 3VBWA 3CPBA 4R78A 3FAAA 3EL8A 4B6LA 3PXKA 3FMLA 1P14A 2PE2A 2Y8OA 4XG7A 3ZM4A 3D4QA 3CGOA 4V05A 4IFGA 4APPA 5LCJA 3NUAA 1UKIA 4O1OA 3KU2A 5KZIA 4GFMA 2HXQA 2ZV7A 5I4NA 4L3LA 2G2IA 3GOPA 3KB7A 3R1YA 3VNTA 4DBNA 4BHZA 3QUDA 2OIDA 4I5HA 3RINA 5KMLA 5H9BA 3UO5A 4KKHA 3MW1A 3LZBA 3EQHA 3KXNA 4YJUA 4O0RA 4D1ZA 3RKBA 1YDSE 4RZVA 3OCBA 2EXEA 2YERA 1GIJA 4NIFA 2BUJA 4EQMA 2QOCA 3C4WA 3NUUA 5BX0A 4HCUA 5LVLA 4ZTMA 1DAWA 3CKWA 2W96B 3AMAA 4JT3A 5EHYA 2XCHA 3BYOA 3C4CA 1M2PA 2VV9A 3KF7A 3ZEPA 4AA5A 5M4UA 4ZP5A 3EN7A 3R9NA 4MNFA 3IOPA 3HDNA 2RFEA 2BFXA 2VGPA 4OR5A 2GS6A 3TWJA 4BTMA 2VWXA 4BZNA 1A06A 1U46A 2ITNA 3T9TA 2Q0NA 2PULA 3FSFA 4PMMA 1RW8A 4M12A 4OTGA 4RGJA 2YA9A 2OKRA 1WVYA 1JBPE 1ZYSA 3ZMMA 4C34A 3E5AA 2AC5A 2B9JA 3DFAA 4IB1A 3RPRA 5CU3A 3UOKA 1R3CA 5FDXA 4C4HA 4CKIA 3TDWA 4BN1A 1H08A 4CG9A 1Q97A 3BIZA 4KRCA 3QKKA 5M4CA 1Q4LA 4DYMA 3G6HA 4ASDA 3RCJA 2GHGA 1IR3A 4NCTC 5HBEA 5AA9A 5FXQA 3VW6A 3QL8A 3I7CA 2OJGA 4KIOA 4OBPA 4UYNA 4A4LA 1VYZA 4FIEA 4ZJJA 4O22A 3ITZA 4MXXA 4FV7A 4DN5A 4PDYA 4R6VA 4RIWB 3A99A 3FWQA 3O8PA 4U41A 3AC8A 5JH6A 5FXSA 4EH3A 4QQJA 2UZUE 5J8IA 1FVTA 4LOPA 3VW8A 3F5XA 3RZFA 2YJSA 4EK4A 3EYGA 1M14A 1XJDA 4DFLA 2VO3A 4KRDA 4TYGA 5H8GA 3IPHA 4FVQA 4ANQA 2YAAA 2JFLA 4NM7A 5DN3A 4ZY4A 5AUTA 2GTMA 4FV3A 2J0JA 1MQ4A 3UE4A 4BWXA 4AGDA 4C58A 5EYDA 1JQHA 2IVUA 2ITWA 1NY3A 4QD6A 4QNAA 2DUVA 3BWJA 4KAOA 1YWVA 4EHZA 5LVPA 3NNXA 3LCDA 4NW5A 4H58A 2ZV2A 4O7WA 3C13A 4KKGA 4RX9A 5T6KA 3RCDA 4FIJA 4M67A 3R7UA 2IVVA 3KN6A 5ETIA 3LQ3A 2YDJA 3BGZA 2YM6A 3BHYA 3HMOA 3UIMA 1ZOGA 4FC0A 1H0WA 3KXHA 4IACA 5HBJA 3MBLA 4BI0A 4QQ5A 4QPMA 4YU2A 4GMYA 3U87A 4DGNA 5IQAA 2JBPA 4F9BA 5IMXA 4LL5A 2J0KA 3RPSA 3UQCA 1Q24A 2WQOA 4LGDA 4WOVA 4F1MA 3LXNA 1OKVA 4O0SA 5FBOA 4LM5A 4WUAA 4O7NA 1R0PA 4ZLZA 4PWNA 2J51A 2EUFB 2VTRA 4OTWA 2A4LA 1DS5A 1H1WA 2XIYA 4IANA 4LOQA 3P9JA 4II5A 4CYIA 4U45A 4ACGA 4XX9A 2OXYA 2ITVA 5FP6A 2NO3A 2DS1A 4FV1A 4Y5QA 5LMAA 3VF9A 1WVXA 4AGCA 4JX7A 4EQUA 4B7TA 4BICA 3WZKA 2GDOA 5ETAA 4TKSA 5AV1A 3I0OA 4D2PA 3DGKA 1U5RA 3QAME 3LLTA 5HG5A 4MQ1A 4JQEA 4QYGA 4L52A 3RALA 5AADA 2IW8A 3TKHA 2PVFA 4PNKA 5EOLA 5HE2A 1VZOA 4K6ZA 2XNEA 2WOUA 3PP0A 3ZTXA 4YUQA 3RJCA 1HCLA 2ITUA 3UVRA 5LMBA 4DEAA 3RAKA 4W8DA 2GSFA 4RQKA 3V51A 4FSNA 3IW6A 1U54A 2ZV8A 2JFMA 3ZO2A 4RLKA 4HNIA 4UXQA 5CENA 1OECA 5HVKA 4CG8A 4V04A 4TW9A 1Q8UA 3CY2A 4MBIA 4XP0A 3TNHA 3A8XA 2BPMA 4AFJA 4R1VA 4DGGA 3TDVA 3ZM9A 4FTOA 1UWJA 5GJFA 5HLPA 4CMTA 3F3VA 5CSWA 2QG7A 1MRYA 4FKLA 4L46A 3OZ6A 1REJA 3EZVA 2CKQA 2W1CA 4WUNA 1OVEA 4BDDA 4EHVA 2WAJA 3TEIA 2XKEA 4EOOA 3OC1A 2B53A 4YLLA 4Y5HA 5E8WA 5L2QA 4CTBA 1J3HA 1PKGA 2JLDA 3NPCA 4K33A 5E8SA 3OTVA 3SG9A 3LXLA 3W8LA 5GHVA 4YMJA 5C4KA 2VWUA 1Q8WA 3QALE 4NTTA 3BELA 3HNGA 4GU6A 4ACHA 1ZOEA 3SRVB 3A62A 5M53A 3BU3A 1H07A 3BCEA 3I4BA 4GW8A 3W33A 3Q3BA 2GPHA 3A2CA 3QTSA 5LXMA 4AW0A 1E9HA 2LGCA 4BF2A 4DFYA 4IM3A 1XKKA 2W1ZA 3AC4A 3NYXA 2R3PA 3PUPA 4M15A 2ZM1A 4G9CA 4OTFA 2VWBA 2ZMCA 3MYGA 2W05A 4DG3E 4EZ5A 2ZDTA 4DEGA 3KULB 2WMUA 1GAGA 1IASA 3BEGA 5HICA 3I60A 4A9YA 4L67A 1ZYDA 2R64A 5LQFA 3SDJA 5L2SA 4Q5HA 5KX8A 4FSRA 3MH2A 1CSNA 4EJNA 3PRIA 4I23A 3SRVA 2PZYA 5AFVA 3FXXA 4EH8A 4MWHA 5FTOA 5L6WL 1FBNA 4AOTA 4LUEA 3SHEA 4D55A 4DCEA 2CGXA 4ID7A 2VWIA 5FRIA 4QP6A 4C35A 4C57A 1OUKA 4X2FA 4QRCA 4IH8A 4FKRA 2CPKE 3DNEA 2XBAA 1T45A 2WD1A 5F1ZA 3PLSA 3R71A 4RVMA 4BIEA 4WNPA 3PZHA 4TWCA 2VNYA 1XWSA 3CD3A 4QMWA 3VJNA 3MFSA 5HU9A 4AX8A 4ZZOA 2X7OA 4FNXA 4MCVA 5EW9A 3ZYAA 3L9PA 2YLEA 5CAOA 3P0MA 3DJ5A 3KVXA 3F7WA 5FD2A 2YITA 4TT7A 5AWMA 4H1MA 5C8KA 4RMZA 4NJ3A 5DR2A 4QTEA 5TT7A 5EM7A 3WF9A 2PYWA 1OM1A 3BV2A 3D5WA 1FVVA 3K2LA 3CQWA 3QC4A 3BLQA 4UMTA 4EOLA 5CLPA 4GFOA 1PYXA 3E8NA 3C0HA 3EQIA 3QFVA 4PF4A 4YLKA 4TL0A 2BILB 2E2BA 3RWQA 3F69A 4EZ7A 3RK9A 5I9VA 5KZ0A 1JWHA 4F9CA 3LFDA 3BQCA 3U6JA 3EN4A 3LJ1A 3PIYA 2HAKA 2VWVA 2W0JA 4EOJA 3N4UA 4FGRA 3A7HA 5IKWA 5CZIA 4C38A 4LRKA 4N6ZA 3GP0A 4P90A 1IRKA 4Y46A 4ZS0A 4EBWA 5HX6A 2B1PA 3EIDA 1YRPA 4LGHA 3OT3A 2XM9A 4RWKA 3PG3A 2BIKB 3NUNA 4L43A 4RJ5A 4IBMA 4X2KA 4ZTSA 5I3OA 5BUIA 2WMVA 1OKWA 1ZRZA 4WD5A 3W8QA 2DQ7X 4HZRA 1MQBA 4QMOA 3V3VA 4FA2A 4FTJA 5A14A 3KVWA 2VTLA 5KCVA 2FYSA 4KINA 3RGFA 4GYIA 4MD8E 3FL5A 1APME 3BGPA 1PW2A 3K3JA 4WRGA 3GC8A 4KUJA 5J1VA 3WARA 5JZNA 3ZRMA 3BLRA 4L7FA 3SX9A 4IADA 4FL2A 4GT5A 4I94A 4JBQA 3UVPA 2PHKA 3UTOA 5IUHA 3R9OA 3VS3A 4GVJA 3OY3A 4TXCA 3TKIA 5H8EA 5LMKA 3DKOA 3U55A 2BRHA 3EQPA 4YJSA 3DTCA 3ODYX 5DNRA 3LFEA 5J1WA 2WU7A 2BRMA 2QR8A 3IS5A 4MYGA 1GZNA 3UBDA 4DE4A 3FZOA 4QOXA 3HRCA 5CVFA 1WBVA 3GCUA 5L8JA 2GQRA 2GQSA 1KUTA 2XP2A 3LLAA 3CLYA 5I9ZA 5KUPA 3ACKA 2XVDA 4IIRA 4MHAA 3F5UA 5BYZA 4BCIA 2FSMX 3GFEA 4PMPA 4RJ4A 1PMUA 2WELA 2A19B 1BL6A 4GK2A 4XH6A 4YJRA 3FY0A 3NUSA 5IDNA 3ORPA 3N51A 2PVJA 4GIHA 4GJ2A 4W4XA 1YXTA 3KCKA 3NSZA 3ZHPC 3I5NA 5C8NA 4IVBA 4E5AX 4NM3A 4EL9A 4MBLA 2GS7A 4WG5A 4UMUA 2Y4IB 2PPQA 3FLNC 3FZPA 2W4OA 1V1KA 4FYNA 4O6LA 2R3QA 3BYSA 5HE0A 3WIKA 4M13A 5CEQA 3QWKA 1CKIA 2VWYA 3VHKA 2BIYA 4BKJA 1Q62A 4FT5A 2VTSA 3C4ZA 3LM0A 4AF3A 3DJ7A 3ORNA 3ZFMA 5HD7A 3IW8A 3JPVA 2GHMA 3VS0A 4HZSA 4JRVA 5L2IA 4FL3A 5ANIA 2VTPA 4FSQA 4BRXA 4UEUA 1ZMWA 4EH2A 3AC5A 3GB2A 4EH5A 5EOBA 5EYMA 3IW5A 3G51A 2WQBA 4C61A 2RFDA 3KRJA 4YC8A 4OT5A 3CCNA 3DB8A 4IAFA 3PXZA 4ERKA 4FTLA 3Q9WA 3HP2A 1PXLA 2YM8A 5AP1A 5HBHA 2Q83A 4ZSGA 4DHFA 1UA2A 2A1AB 3EKNA 3DKFA 1Y57A 2GFCA 3MV5A 4E4MA 3T8OA 3E8EA 3AD4A 3LXPA 3O71A 5DT4A 5EM6A 5JKGA 4ZTQA 5EQYA 3UOHA 3CKXA 3NDMA 2C47A 3PA3A 3T3VA 4FKQA 2VWZA 1GNGA 4EOMA 2OXXA 3FHIA 3ORZA 4EH9A 4FZ7A 3QHRA 2DYLA 1SYKA 2QLQA 5CU0A 4WA9A 4EJ7A 3U4UA 1ZWSA 3DV3A 3Q5ZA 5AA8A 4EORA 3TI1A 1LP4A 2GMXA 4M68A 3QD0A 1PYEA 1W7HA 4MF0A 3UO6A 3CY3A 2PVHA 3OW3A 2XNNA 4NW6A 4V01A 5HESA 4RLLA 3TV7A 1NVSA 5IQIA 3AMYA 2VTQA 3R02A 5DR6A 5FG8A 3DJ6A 5B2MA 4B8MA 2JDTA 4X2JA 4ANBA 3ENHA 1REKA 3TJCA 4FEXA 4CKJA 2XS0A 3HVCA 4FKVA 4NWMA 2IG7A 1FPUA 2NNWB 2ETRA 2C1BA 3GQIA 2YM7A 1BL7A 1DM2A 3BHUA 1M7QA 1Z57A 1W84A 2FVDA 3Q9YA 4FYOA 1U59A 2JIIA 2VTAA 5J9LA 2OW3A 2PUIA 2GNJA 3GCSA 1OB3A 3FZTA 3SG8A 3QUPA 5EI2A 4IW0A 3Q52A 4U3ZA 4AAAA 3L9MA 4CZUA 4YNOA 4FNWA 4YBKA 3FXZA 4O7YA 2QKRA 4B8LA 5AUXA 4G6OA 4W4YA 4O0WA 4TWNA 3FYJX 4U9AA 3PZEA 3ZBFA 1O6YA 3NNWA 1KE8A 2J90A 4F6SA 4DITA 5LWNA 4QMVA 4UN0C 1XHAA 2XUUA 5M08A 3G5DA 5AP6A 5ETFA 5EH0A 4EH6A 3I6UA 3NLBA 4NKAA 1JVPP 4OTIA 4QMMA 3D15A 4BZOA 2GTNA 2EXMA 1BYGA 4U40A 2O64A 1LUFA 4ANNA 5AIRA 4QQCA 3RHXA 4N0SA 1URWA 4BVUA 2WMXA 4E6CA 2H6DA 3DCVA 3OBJA 4TYJA 3MVHA 3QTRA 5HNBA 3FPMA 2XZSA 3DXPA 3HV4A 2OJJA 4Z7GA 3TM0A 5KHXA 3TNIA 4BDBA 5A4QA 3QHWA 4L8MA 3LIJA 2O5KA 3CQUA 4YHFA 4PL5A 4MWIA 4GYGA 4O0VA 1J7UA 4XG2A 4BTJA 2IPXA 4XEYA 4W8EA 2WXVA 3KKVA 3R2YA 4KS7A 2QG5A 4YZDA 5IA1A 4HVSA 3CQEA 3JR1A 2UW0A 4JQ7A 3MPTA 3R8MA 2XF0A 3IW7A 4BKYA 2H34A 4FIFA 5IQGA 2XNMA 5I9WA 2C6OA 2F2CB 4M69A 2X4ZA 3CPCA 3T3UA 3UPZA 3AGMA 4GT3A 1NW1A 4CV9A 3VBXA 1J7LA 1OBGA 3NNVA 2PWLA 4YTHA 4CCUA 2EB2A 3D7TB 4HNFA 4QMPA 2X8EA 5KNJA 2PE1A 4IHPA 5E9EA 5EHOA 4F65A 3NYVA 4A07A 3LKMA 3WZJA 3KK8A 4CEGA 4F7NA 5CSVA 3ZZWA 1FGKA 5AR3A 1KOAA 3RK5A 4D4RA 2C6IA 3P79A 5CSHA 1XBAA 2C6MA 4AE9A 4HVGA 2BRGA 4ZK5A 5AR4A 5IQFA 2WMAA 1PHKA 4BCQA 4MXZA 4LG4A 4CZTA 2ZDUA 4C7TA 4UWYA 4YR8A 2IW6A 2OICA 1YOLA 3OFMA 1LEWA 5EFQA 4D2WA 1H25A 2BDFA 4A9SA 3MY1A 3BLHA 5FM3A 3FI8A 5TE0A 4HYHA 3NS9A 1O6KA 2ETKA 5ANEA 4BBFA 3LE6A 3W2OA 2RSVA 2CCHA 2PMIA 4J8NA 5KE0A 1QL6A 3UGCA 3ROCA 2ZAZA 3VUKA 3GOKA 4WG4A 1IAJA 4J96A 3G15A 4Y83A 5AM7A 1JLUE 3DAEA 5K5NA 4TNDA 2UW3A 5JT2A 4JG7A 5DOSA 4DH1A 3DXNA 3F82A 2BVAA 3CC6A 2WTWA 3R8ZA 1KV2A 3Q53A 1UNLA 4FIHA 2XJ1A 4GT4A 2UW6A 5CEMA 3ETAA 1YKRA 3JXWA 2YLFA 2B9IA 3E92A 3NVKI 2YWVA 3SC1A 4L68A 3LAUA 4TYIA 5HG9A 4I4EA 5A4EA 4DLJA 4BCPA 4QPSA 5JK3A 4EUTA 3L8PA 3MY0A 3R1NA 4X2NA 4BTFA 4GRBA 1KE7A 3IG7A 4M14A 2V62A 1BLXA 5ANOA 4CLJA 2VO6A 3QRIA 1RQQA 3HMPA 5B7VA 2XM8A 1RDQE 4D1SA 3FZRA 2UW9A 2XNOA 4O84A 3TL8A 3VS2A 1QPJA 3F5GA 3NAYA 4CRSA 2R9SA 3I79A 4G5PA 3COHA 3HUBA 2SRCA 3CTQA 3MVMA 5AMNA 3ZRLA 3PY1A 4KSQA 3QZIA 5HIEA 2JAVA 3Q9ZA 4FT0A 4DEIA 4ZSAA 3R1SA 2YISA 4G34A 1Q99A 4RC4A 2WTCA 3RBWA 4JBVA 2HY0A 2J9MA 3COIA 1ZLTA 4FG8A 4M0YA 5DBXA 2C4GA 2X1NA 4FSUA 5EW8A 2BZHB 5LVNA 4ZZMA 5K3YA 3U9CA 4S33A 4BDJA 4C2WA 5DPVA 4XG3A 3BPRA 3Q6WA 2QOIA 4FKSA 2UW4A 1B6CB 4LOOA 3Q96A 2BMCA 1JKSA 1YOMA 3MA3A 4HYSA 1WVWA 4RJ3A 4TN6A 3VAPA 4AG8A 1Q41A 3HV5A 5HOAA 2VTOA 3F61A 5CSXA 4M3QA 3UZRA 3MGYA 2YCQA 3QKMA 4EWQA 5FXRA 4QMQA 2C5NA 3ZUVA 4FKGA 3OS3A 5E8YA 3CSVA 4P5QA 4ARKA 4AFEA 5E91A 3GNIB 3E64A 4FTQA 2EWAA 3ERKA 3LOKA 4FV0A 4CFMA 4YZBA 3NIZA 3ORMA 1JKTA 2CHLA 4O0TA 4ZEGA 3TXOA 4DEHA 5M06A 5L4QA 1XH6A 5IH5A 2XIKA 4JDHA 5H8BA 4PP9A 5JGAA 3R7VA 4DGMA 3P1AA 2YZAA 4JIKA 3GCQA 3QGWA 4AZSA 4FZFB 2FH9A 3IKAA 1VEBA 4PDOA 5FWKK 4O7RA 4M84A 3IOKA 4NUSA 1IEPA 3GEQA 2OJFE 3HMNA 4K18A 2YZLA 3AC3A 3UDBA 1QPDA 2UV2A 2OZAA 4GJ3A 3UMWA 4MX9A 2PZPA 3GU5A 4FZ6A 4BCOA 1J7IA 4S31A 3ZCLA 4IM0A 2R7BA 4EOKA 3BBWA 4QT1A 1UWHA 5CI7A 4EH7A 1YI4A 3P5KA 4NH1A 1OITA 2GCDA 3CJGA 5J5SA 2QU6A 4YGAA 4OUCA 4RFYA 4BGHA 1S9IA 3NCZA 3FZ1A 3QQLA 2C1AA 3I1AA 2WTJA 2X81A 4GKHA 4FVRA 4I0RA 2PE0A 4NK9A 3ZC6A 5CASA 3TUBA 2EXCX 3ORKA 3QCXA 2C30A 3O96A 4IDVA 2J50A 3TIYA 4FVPA 5BPYA 3UP2A 2G2FA 4JDIA 1AGWA 3HGKA 3O17A 1PXOA 3QBNA 5CT0A 3KEXA 1UKHA 3VS5A 2XIRA 4I6BA 4ZJIA 3AOXA 4O0XA 4DH5A 4FV2A 3GQLA 4F70A 4JX3A 2VTHA 4ANOA 3FC2A 5CX9A 3TZ9A 5HD4A 4F9WA 3FHRA 3EQRA 2V55A 4J1RA 3KF4A 2ITYA 3I7BA 4RVKA 2QONA 2R3FA 3DQXA 2CCIA 3IDCA 5HE3A 3MESA 4XLIA 4MVFA 5KMMA 4ZTNA 1Z5MA 2X9FA 2V5QA 3K5UA 2PVKA 2QC6A 4PRJA 5DGZA 3WE8A 3WF7A 2YIYA 3P78A 3MIYA 3HDMA 3W10A 3EKKA 3A4PA 5IQBA 3WZDA 2QR7A 3Q4UA 2EVAA 2IW9A 4C33A 4U81A 4MKCA 3BE9A 3KCFA 3MH1A 2UZOA 1T46A 2XJ2A 4DT9A 5HQ0A 1NXKA 4UWBA 1YOJA 1FQ1B 1Q3DA 2OIQA 2V7OA 3GXLA 2PUNA 3QA8A 3SW4A 2E9NA 4CRLA 3W2CA 4FZDB 3A7JA 5ANDA 1KOBA 4MXCA 4EWHA 4DLIA 2WO6A 3KN5A 2J5FA 2HXLA 3AT2A 3GU8A 2WFYA 3KL8A 3PJ8A 5ANGA 4IQ6A 5HNIX 5JFVA 1Q5KA 1TVOA 4X3FA 2PTKA 2W17A 3W2PA 2UW8A 3FDNA 3HV3A 3M42A 3W2QA 2O65A 4AACA 2VTTA 4CLIA 3NR9A 3FXWA 5KMKA 2YHVA 5EG3A 4GIIA 3U6HA 3AC2A 5DIAA 4MTAA 3FSKA 1KV1A 2IO6A 2XKCA 4QMNA 4CKRA 4IAYA 5DE2A 3Q2MA 2J0LA 3M1SA 4UWCA 2W06A 4KIQA 5JFWA 5GIPE 3KRXA 2ETMA 4FTAA 4M7IA 3KXZA 2BROA 1BX6A 4IWPA 2E9OA 2W99B 4WIHA 1OBDA 3QQKA 5JEBA 3VVHA 4N70A 2XEZA 4QP8A 5FEDA 2HY81 4MXAA 2KULA 5F9EA 4A9RA 2C3IB 3DKCA 4HCVA 3SQQA 4DFBA 3FLQA 3ET7A 5GZAA 4USDA 2B55A 4AT3A 4XJ0A 3ORTA 2ZMDA 3BE2A 1YWNA 4G1WA 2OFVA 3T9IA 1V0PA 4IWOA 5L6OA 4I3ZA 1Q8TA 3NUXA 4BBMA 5I3RA 5GJGA 3V5LA 3G2FA 2WPAA 2Q0BA 4XG4A 2YABA 3MTFA 3PXYA 4JLCA 5L2TA 3OEZA 5LMKC 4JVGA 1XBCA 3F6XA 3G0FA 5DWRA 1PRYA 1OL2A 2XMYA 2JKKA 4WBOA 5HO8A 2UZNA 4Y72A 4PPBA 4F64A 5GINE 3P7CA 5DA3A 4O6EA 4RVLA 1WBOA 3EN9A 3GVUA 3EFLA 4EZ3A 4BWPA 3PVUA 2W5AA 4LL0A 3Q4TA 1PY5A 3DZQA 3OBGA 3VBTA 4EBVA 1Y91A 4FMQA 3V6SA 3RTPA 4D5KA 3IDPA 5CQUA 3KMWA 4E20A 4PPAA 4HVDA 4XRLA 4DC2A 5LVOA 4FEWA 2BHEA 2C5OA 4I5MA 2NRYA 3V01A 2XEYA 2H9VA 2I0HA 3Q4CA 3SKCA 4RIYA 2X4FA 4XP3A 3FLYA 4P7EA 3W2SA 3L1SA 4F0IA 1P4OA 3B2TA 4AU8A 4BYJA 3RP9A 3FMEA 3FMNA 5FQDC 2GNIA 2FO0A 4AE6A 2OJ9A 3QTZA 5DFPA 4QP7A 2OK1A 2XNGA 2FSTX 4EK3A 1FMKA 4Z3VA 4IX4A 3FI3A 3FMKA 4YZCA 2HZ0A 1SNXA 4ITIA 4EOIA 4FTKA 3UNZA 4EONA 3OY1A 5L3AA 2BDJA 2WTVA 4FKUA 4JAIA 5CVGA 3NIEA 3U51A 5DMZA 2PVLA 2OZOA 5A9UA 2XIZA 3N4TA 3BYUA 5HI2A 1WMKA 4C8BA 3FMDA 4ASEA 4R5SA 2ITOA 2P3GX 4D2RA 1PMVA 3F7ZA 1ND4A 4QPAA 2F7XE 2G1TA 4R7IA 3BEAA 4CT2A 2OFUA 2XYNA 5F20A 1KSWA 3QUEA 4M0ZA 4PDPA 3SA0A 3I81A 4PNIA 1HCKA 3DA6A 4Q5EA 4YJPA 3VS7A 4CD0A 5CU2A 3H9RA 2F2UA 3HV6A 5AJQA 4AT5A 5CXZA 4MNEA 2Z7RA 1PXKA 2QU5A 2X9EA 4OTQA 4GG7A 4F08A 3OD6X 3NYNA 4IAIA 4FL1A 1BI7A 1IA9A 1M2RA 3PFQA 5DT0A 2GQGA 3PWDA 3QLFA 5AR8A 3UNJA 3RZBA 1SVGA 3ZSGA 4DTKA 3RPYA 2BHHA 5LARA 5T68A 4U42A 4UZDA 3FPQA 2HYYA 5EDRA 5AP7A 4QO9A 2R3RA 4XP2A 4XYFA 3ORLA 2F57A 4E26A 3QQUA 5DG5A 4RVTA 5CAVA 4QYEA 1P5EA 4JQ8A 4ANSA 3KREA 2HZIA 3IW4A 4B0GA 4YJVA 3FQHA 4GL9A 4UV0A 3MFRA 3VBVA 4I22A 4D2SA 2ZM4A 4BCGA 5AR7A 4IZYA 3QYZA 5IUGA 4ANMA 4RWLA 5HX8A 1XH8A 4JL9A 5D7VA 3QX2A 3K3IA 4K0YA 2QI8A 4RWJA 3ZC5A 3ZO1A 5K0XA 1R0EA 3R01A 4QTAA 4O7TA 4MEDA 3UYTA 1YXXA 2HW6A 3MPAA 3C50A 5TF9A 4ZTHA 4N6YA 4TYEA 5E1EA 1UVRA 2CLQA 4EOPA 4FKIA 5JSMA 3ZFYA 4EQCA 2ITPA 4Z7HA 5J9YA 1OPKA 2OXDA 4NFNA 2W4JA 2I7QA 3UIXA 2QVSE 2VNWA 4K77A 5C27A 2X2MA 4K9YA 4RFMA 1O9UA 2EB3A 3ORIA 5J7HA 3LFBA 3A60A 2I0YA 4KD1A 2YACA 3IO7A 4QMSA 5CYIA 5IEVA 2VTMA 3BBTB 5CAPA 2WMWA 3D5XA 3UIUA 4I0SA 5KKRC 1UNHA 2ERZE 5BVWA 4V0GB 3HYHA 4O2PA 5DEYA 4CV8A 4F6WA 2R3NA 4ZZNA 3QF9A 5CZHA 3WILA 4IB0A 2OIBA 2JDVA 4TYHB 1P4FA 4FSMA 3NGAA 1JAMA 4FTUA 1R39A 3TCPA 3ZXZA 4GUBA 1SNUA 5AUVA 4HW7A 1EH4A 2NPQA 3KFAA 4FODA 4ANLA 4EOQA 4AXAA 1GY3A 1H1QA 2C5VA 3D94A 3HZTA 3KRLA 5AM6A 4PV0A 4O83A 3FMHA 3BQRA 3UC4A 3RWPA 4IDTA 4OTHA 4AOIA 5LJJA 3OUKA 4LMUA 4MXYA 4DFNA 3L9LA 5AP5A 2C69A 3DDQA 4LV8A 5DHJA 4A4OA 4O7LA 4EK6A 5IQDA 2X6DA 5EDQA 3ZEWA 5HLWA 2QQ7A 5IPJA 3MJ2A 3D83A 4WSQA 4IVCA 1PXNA 3KGAA 2PK9A 2FGIA 3DBEA 3EZRA 5F94A 4RIWA 4X6RA 2W1IA 3LJ2A 4I1ZA 3F2AA 5IA5A 4FX3A 2HELA 4TWPA 1H28A 2UZDA 3ZSHA 5J95A 1Y6AA 4UBAA 4CT1A 4E8AA 5CALA 2XK8A 5E4HA 4ALWA 2P33A 4LQMA 2W1HA 5DI1A 2G9XA 4UMRA 3LW0A 4FEUA 3V04A 4RFZA 4HYUA 4KIKA 4PY1A 3CBLA 4BGGA 2XK3A 2P2HA 4C62A 2V22A 3EN6A 1UU9A 4LFIA 4D58A 3DLZA 4G3EA 1BI8A 2E9PA 1GIIA 2PVRA 4H3PA 4YJQA 5CEIA 3H10A 1OGUA 5C01A 2PU8A 5EQEA 3MJ1A 3VUTA 3NEWA 3NX8A 3W55A 5D9HA 4E6QA 3E62A 4FSWA 5C9CA 3POZA 4UZHA 2CNUA 4RIXB 2VZ6A 4C4GA 3JY9A 4PQNA 4ASZA 3MA6A 4KB8A 4WNOA 3OWJA 4F9AA 1ZMVA 4OLIA 1U4DA 3OOMA 3D2IA 3EH9A 1GZOA 4RA4A 3GCPA 4LRJA 2WQEA 4IZAA 3RM7A 4BI2A 5BMSA 1H8FA 2ITQA 2OWBA 4U0IA 2PUPA 2RL5A 4R3CA 5CU6A 4USEA 5HZNA 1OIQA 5I5ZA 2P0CA 4IAKA 5KO1A 5BYYA 3Q04A 3KK9A 4U7ZA 3BHVA 3QC9A 4E5WA 3UVQA 4D2TA 3ZUTA 4CVAA 2R3KA 3PJCA 4ZSEA 3ZSIA 1GJOA 3BI6A 4GVAA 1XR1A 3A7FA 3FBVA 3OUNB 2QNJA 4TY1A 5E1SA 5AR5A 4AW1A 4XG6A 4RC3A 4ZTLA 3U4WA 2C5XA 3HP5A 3PIXA 1H4LA 3RPVA 4EH4A 4O0YA 1OIRA 3PXRA 3F3ZA 5EKOA 2WKMA 5BMMA 4FSTA 3VUIA 4MK0A 4DINA 4DF3A 2Z2WA 3OEFX 4F99A 3QD2B 2Y9QA 3VO3A 2JGZA 1OZ1A 3E87A 4IAZA 5IH6A 4FKWA 3S3IA 1PXPA 4ORKA 4IXPA 2C6LA 4XV1A 1UNGA 4QP4A 2REIA 3COKA 2VX1A 4E1ZA 2UUEA 3PIZA 3PY3A 3Q6UA 3MI9A 3TZ8A 1H24A 3NUPA 3E3BX 4YJTA 2PZ5A 1MRVA 2XKFA 3CP9A 2QHNA 4K11A 5AAFA 4XV2A 4CFFA 4IZ7A 5JZJA 1O6LA 4I93A 5B2KA 3VS1A 4BHNA 4YZMA 4DTBA 4G6LA 4J97A 5EK7A 4ZTRA 4BIDA 3AGLA 2X7GA 1MRUA 2C6EA 2R7IA 1YDTE 2XBJA 2YDKA 3BGQA 3E63A 4O96A 4RG0A 3UC3A 3E88A 2JD5A 3DK6A 4BDEA 1KE5A 2JITA 5KHWA 1YHSA 2JC6A 3EFKA 4PUZA 4E5BA 3R9RA 4W9WA 1YHVA 2F4JA 4JXFA 3EMGA 4IB3A 1FVRA 4J95A 4JAJA 5ACKA 2B9HA 3ID6C 4GG5A 1PXJA 2RIOA 4JDKA 4QYFA 3PVWA 4YTCA 3QQJA 4E6DA 3O23A 5JRSA 2GNHA 3OG7A 2CSNA 3FKOA 4EC9A 3O8TA 3SAYA 5IEXA 2PVNA 1WZYA 3DPKA 4W4VA 3R30A 3MS9A 1DI9A 3R73A 4I41A 2WMQA 2WIHA 3P7BA 4YHJA 3SGCA 1XH9A 4NIFB 4W4WA 3IK3A 1W83A 5KBQA 2EU9A 4OBQA 4J52A 5FGKA 3U54A 1H1RA 4XV3A 4ZIMA 4F7SA 3DAKA 4J99A 3RVGA
chains in the Genus database with same CATH superfamily
3QTIA 4IC7A 4NT4A 5AAEA 4F9YA 5KBRA 3GT8A 3UYSA 5DT3A 4C3RA 3FKLA 3UQGA 3WF8A 1AQ1A 1V0OA 2I1MA 2XRUA 4I4FA 5K9IA 4FT9A 3R8PA 1YHWA 3EQDA 1ZYJA 3F3WA 3S00A 3TNQB 3O2MA 5EDPA 1UU3A 4XCUA 1A48A 2ITXA 3UDZA 2Y4PA 4H36A 4L00A 4RC2A 3EQGA 2HWOA 4C0TA 2WEVA 3FLSA 1URCA 2WMBA 1WBSA 4U44A 3AMBA 4RPVA 1M52A 3H0ZA 4G9RA 4QTBA 4WO5A 3H9FA 3QX4A 3RAWA 4M66A 4F4PA 3PY0A 4MBJA 5JGDA 5C8MA 3HAVA 1PXIA 3QTXA 3GC0A 5BVNA 4DBXA 3L8XA 3OCGA 3DXQA 3PJ2A 5M56A 4A9UA 2ONLA 5M57A 5BVEA 3R8LA 1BMKA 5AP0A 2A2AA 4ITHA 3EFJA 4FKPA 5TR6A 5ICPA 3MVJA 2WGJA 3EJ1A 3R7OA 4JR3A 2R4BA 4BDKA 2X6EA 4C4IA 3FC1X 4E4XA 4AQCA 4Y95A 5AX9A 2BTSA 5FM2A 3GC9A 3QCSA 3VBQA 4PTEA 2G01A 3ZDUA 3TZ7A 4X0MA 4FV5A 4U79A 2PVMA 3HL7A 3H30A 2O2UA 2Z7QA 2WTDA 4IEBA 3ELJA 3E8DA 5K4JA 1FINA 5ANJA 4O7VA 5EW3A 2ZYBA 3OWLA 4O27B 4F0FA 1OL7A 3FI2A 2XNBA 3R2BA 5FEQA 2UZBA 5AV0A 3TT0A 3UPXA 4UXLA 2BDWA 2PZIA 3KY2A 3NZ0A 4MAOA 3MIAA 1QPEA 4JBOA 1KE9A 2GNLA 5HVYA 4BCJA 3R1QA 4NFMA 4BFMA 4YTFA 5I9XA 3PDTA 4BCNA 2B54A 4EHEA 4DHJA 4XLVA 4L3JA 3MN3A 3R7EA 2QKWB 4U80A 3REPA 2JIVA 3LFQA 4LGGA 3DTWA 3IQ7A 4WHZA 4AW5A 4DFZE 1R1WA 3OW4A 5IF1A 4YHTA 4FTMA 5AR2A 3UIBA 5C26A 5CF8A 3ALOA 3RHKA 3AT4A 3DU8A 3LCTA 3OMVA 3PYYA 4L6QA 3PP1A 4Q2AA 4FSYA 4S2ZA 3ZS5A 2E9VA 2C6DA 3ANQA 3EHAA 4EKLA 5E8XA 3RMFA 4ENXA 4H05A 2OF4A 5CQWA 3B8QA 4HPUE 2PSQA 1ZY5A 2JBOA 4JG6A 2OGVA 3ZLWA 2B52A 4HGSA 4AXDA 2H96A 5IQHA 4KS8A 5DLSA 2XK6A 3LVPA 4S34A 4RJ8A 1ATPE 4AZTA 3KMMA 2UZVA 4X3FC 1OI9A 2JDSA 4AWIA 5HORA 3VONA 2BKKA 2CMWA 2CGWA 3CTHA 4MD9E 1PXMA 2XA4A 5ETCA 4EK8A 5FP5A 2XH5A 1YXSA 1YI6A 4S30A 1PKDA 5A6OA 1H1PA 4KBCA 2VO0A 4JS8A 4OTDA 4RJ7A 5C4LA 2J4ZA 5D12A 3ZBXA 5JGBA 2JEDA 4Z16A 2RFNA 4ZS4A 3K5VA 3OCTA 4NL0A 3C5UA 1YXUA 3ZO4A 2W1EA 2P4IA 4AZWA 2IN6A 3OWPA 5IEYA 3PXQA 2O3PA 4K8AA 4DEDA 2O8YA 1OL5A 3W0PA 5B2LA 4LRMA 3BU6A 2XK9A 4C4FA 4BJJA 4QTCA 4XMOA 4QMYA 2J0IA 3RAHA 5G1XA 4EHGA 1MP8A 2BAQA 4YC3A 2XJ0A 4D1XA 2A0CX 4QYYA 4QMTA 3JY0A 1U54B 4I0TA 3HEGA 4WBBB 2XYUA 4FTRA 1NA7A 2IEWA 3KRRA 4C4JA 2QOQA 3ZRKA 3I0QA 3LMIA 3V8SA 3AKKA 4RBLA 4F78A 3A8WA 2WOTA 4UYAA 4I20A 3MH3A 5HNGA 2VTJA 3EQBA 4XOYA 3PRFA 3DY7A 2R3JA 4X7QA 1G8KA 5HVJA 4TPTA 3UG2A 3PLAE 3D5VA 5CF6A 4XHKB 2R0IA 5A4CA 4AZVA 2JKOA 2X39A 2CJMA 4L01A 3PTGA 4CYJA 4ZOGA 4JI9A 4U6RA 4CFXA 4DEBA 3ANRA 4AZEA 3E93A 4RT7A 5M4FA 5EHLA 4OBOA 1M7NA 3EQCA 4TZRA 5CEOA 3AT3A 1AD5A 4ALVA 5CANA 3OP5A 4R8QA 3WZEA 4YNEA 3V8WA 2WMTA 2R3HA 3VRZA 2IF8A 4R7BA 4D0XA 2X7FA 1Y6BA 4HYIA 1OIYA 3TV6A 3R63A 3FE3A 4O82A 2VWWA 4TRLA 5GZ8A 3QZHA 4YSMA 3S95A 3W0SA 1YXVA 4C2VA 5IQCA 4FKOA 2C0OA 5DR9A 3MB7A 3R7GA 3R83A 3W0MA 3DBDA 2WHBA 2ITZA 4AA0A 4YO4A 3ML1A 4U5JA 2YEXA 3ORXA 4YTIA 2CNQA 2WTKC 4PPCA 1NVRA 1X8BA 1V0BA 5L8KA 4UX9A 3UOLA 1U5QA 3KQ7A 3IECA 2LAVA 2QODA 1OPJA 4PMTA 5DRDA 1FGIA 4P4CA 2Y6MA 2OO8X 3R0TA 2Z02A 2WMSA 3DZOA 3ZLYA 1YI3A 2Y0AA 3DQWA 4NSTA 4O81A 1W82A 2C68A 4RQVA 3DKGA 4TNBA 4K1BA 2P2IA 4R5YA 3E3PA 2VTIA 5A4TA 3HMIA 3VRYA 4RSSA 4BCMA 3HLLA 4FV6A 2XK7A 3U6IA 4FBXA 4FK6A 4QNYA 4FSZA 1JPAA 3MVLA 4JIAA 3CD8A 1ZY4A 3QCQA 3C7QA 4NTSA 3R8UA 4CFUA 2BRNA 2CLXA 4L9IA 5CNNA 5EI6A 3TG1A 4I5CA 2VGOA 2WQNA 2YDIA 4BTKA 1CM8A 5D41A 3SVVA 3OF0A 3ULIA 3VQHA 2WU6A 5BNJA 3ATTA 2H8HA 2KTYA 3M11A 5EQPA 5IA0A 2JKMA 3SXRA 2QOHA 2J0MB 4BWKA 4H1JA 1RJBA 1CKPA 4FICA 4EC8A 4MF1A 3PJ3A 2FB8A 2OJIA 5D7AA 1VJYA 2I40A 4TWOA 2VUWA 4QMLA 3FI4A 2OG8A 4H3QA 4FGBA 2BALA 3RNIA 3KIOC 4EK5A 4ZY6A 5A46A 5EI8A 4BR3A 3P08A 3G90X 1SVHA 4K2RA 3LPBA 4BDFA 2WMRA 2WB8A 1TQIA 3FLZA 3DS6A 1B39A 2BFYA 4IB5A 3A7IA 5CT7A 3TZMA 3IGGA 2W9FB 4LUDA 4XUFA 4YJNA 4AS0A 4DH8A 1LEZA 3PA4A 3BL9A 3CS9A 3NNUA 3ZONA 4BDAA 3DBFA 3D7ZA 2O63A 5EYKA 4B4LA 4APCA 3ZDIA 2HW7A 5DVRA 2X0GA 1FOTA 2GNGA 3V6RA 4AGWA 3JUHA 1JSUA 2HZ4A 2HK5A 3D5UA 2XRWA 4F0GA 4CMOA 3F2RA 2UZWE 3ENMA 5TO8A 4D4SA 4ONAA 4D9TA 4L3PA 2QURA 3UZPA 2X8DA 3N9XA 4I6HA 3DFCB 4C3PA 2XB7A 2A98A 5EYCA 3TNPC 2PL0A 3QCYA 3AQVA 1TKIA 2C3LA 2F9GA 4Z55A 3KXGA 4FG7A 2OF2A 3QRTA 3A61A 3EL7A 4FJVA 1BKXA 4ACMA 4G2FA 3PE2A 4KIKB 3D7TA 3SD0A 3KMUA 3AD6A 3ZXTA 4X2GA 3ALNA 2R0UA 5IUIA 1PJKA 2JIUA 2PUUA 2AUHA 2FA2A 5D1JA 5C03A 2PMLX 3HX4A 4G17A 2J6MA 1ZZLA 4KA3A 5HKMA 3AD5A 2QCSA 1YDRE 2YAKA 3NYOA 4CSVA 4E7WA 2Y7JA 4FEVA 2R5TA 3G9NA 3I6WA 2W1FA 2WQMA 1BUHA 3UOJA 2X2KA 5CI6A 4C59A 4BZDA 3HAMA 2UW5A 3BRBA 2QO7A 3E8CA 3UJGA 4B9DA 4IC8A 5CEKA 2YN8A 5HCZA 3PPKA 5EM5A 3WI6A 2R3GA 3R6XA 1OKYA 2AC3A 2QO2A 4A06A 1J91A 5CF5A 5HO7A 5TOZA 1WAKA 3BKBA 4UY9A 3VUGA 4E4LA 5J87A 3UZTA 4UMPA 3M2WA 4R77A 3MB6A 4FNYA 3EFWA 3C9WA 4PX6A 3NAXA 5L2WA 4IX3A 5J7BA 3BX5A 3GCVA 2OSCA 2IZRA 4ACCA 4F09A 4MD7E 4DH7A 4F1TA 3HMMA 3VIDA 4AOJA 1JKLA 1QPCA 4O38A 5HIBA 5J79A 2WZJA 4IJ9A 3U9NA 4ZMEA 4O7SA 3QD4A 3LFNA 4FV9A 5K0KA 5IA3A 3ULZA 3NW6A 3QU0A 3NW7A 4WNMA 3QXPA 1G5SA 4EYJA 4NM5A 3RM6A 3R7IA 2R3IA 4FOCA 2QOFA 4HJOA 3VHEA 5AUUA 1DI8A 4OGRA 5AX3A 3WF6A 1GZKA 3QTWA 1ZYLA 3QA0A 5FLFA 4CFWA 2GU8A 1CTPE 4O1PA 5GJDA 1OPLA 3GI3A 2ACXA 3D9VA 4RX8A 4TTHB 4HVHA 1SMHA 3C0GA 4L45A 3VS4A 5K5XA 3H3CA 4C37A 3QRJA 1STCE 2QOKA 3GBZA 3FY2A 3QQHA 3QWJA 4AN3A 2CKOA 4DTAA 2C3JA 2VX3A 4D0WA 4D4VA 5CAQA 4WKQA 5CY3A 4AW2A 2UW7A 2W4KA 1K2PA 1WBPA 1ZOHA 2IJMA 4BCKA 5F4NA 3VJOA 4E3CA 2UZLA 4XV9A 4UALA 1F5QA 4RZWA 2HCKA 4N57A 4BI1A 2PZRA 4IZ5A 3F88A 1GZ8A 3THBA 2W7XA 5TKDA 3R9HA 3CR0A 5CU4A 4C36A 2BRBA 3TMOA 2FSOX 4I92A 5IU2A 5CAUA 2GHLA 3L8SA 3TKUA 4R7HA 1TQPA 4IX6A 4IFCA 3LFFA 3W32A 3LCKA 4XBRA 1Z9XA 4L42A 5BVKA 5HE1A 5BVDA 4YBJA 3VWAA 2CN5A 2RG6A 4IE9A 3GC7A 3MSSA 4F6UA 2YCSA 1XH4A 3MFTA 4FT3A 4NU1A 4U3YA 4YPDA 4FT7A 5FTQA 3C4EA 4R3PA 3Q32A 2B4SB 5JN2A 4ERWA 4OAUC 2YIWA 5I0BA 3SOAA 2QO9A 1Q8ZA 2C3KA 2PMNX 3O0GA 3F5PA 2UVZA 4G5JA 2XK4A 4FV4A 1ERKA 3OXTA 3PWYA 4QTDA 2A27A 2VAGA 4BKZA 2V0DA 4IAAA 4KBKA 3R28A 1QMZA 4MQ2A 4R1YA 3QYWA 1GOLA 5CEPA 3FLWA 5IZFA 2OI4X 3SXSA 4ZMFA 4O7ZA 3ACJA 5KKRB 3COMA 3ROYA 5ACBC 5J9ZA 3PJ1A 4EYMA 3HA6A 3GGFA 3IDBA 3DBQA 3MDYA 4Y8DA 4JNWA 2G15A 3FYKX 4D28A 3DT1A 1Y8GA 2BKZA 2IZTA 1S9JA 3G33A 4RJ6A 2ZJWA 2CKEA 1H1SA 2RF9A 3DLSA 2UVXA 5JMSA 3ZH8A 3TUCA 2QOBA 4J71A 1L3RE 4LYNA 4H39A 3K54A 5BVFA 3C0IA 2GFSA 4G3FA 4G6NA 4YZ9A 4XOZA 4FKTA 3ZUUA 4DG2E 3P7AA 1J1CA 5A6NA 3NVMB 4NCTA 4AN2A 4AUAA 1Q3WA 4FEQA 2JDOA 4KIPA 5AIKA 3D0EA 5I9YA 2W9ZB 3LQ5A 2YM5A 5HCYA 4CFVA 3CEKA 4EUUA 5CF4A 1ZZ2A 2OLCA 3G9LX 4LV5A 2CN8A 5IG1A 3NCGA 5D10A 1JOWB 4M69B 3SOCA 2IZUA 2WEIA 3FMMA 3MTLA 3KC3A 4FR4A 2E9UA 3R04A 2BAJA 2BR1A 4G16A 4J8MA 4AT4A 5AEPA 4YP8A 3V5WA 1A9UA 1G3NA 3OHTA 2OU7A 2I0EA 4U43A 5HGIA 3JS2A 2ZB1A 3WZUA 3O51A 3RAIA 4FIGA 5FDPA 2ONLC 3G6GA 5E8UA 3VQUA 2CKPA 2ERKA 5G6VA 4O86A 4FTTA 5AP3A 2W1GA 4X21A 4XG9A 4ACDA 3LMHA 4JOAA 4HGTA 5E8VA 4RX5A 3FQEA 3V5JA 2CDZA 4O4EA 2R3LA 5IQEA 3BYMA 4Z9LA 3B2WA 2VTNA 1SVEA 3PXFA 3F3UA 2J5EA 2BZJA 4FTCA 3DNDA 3LFAA 1HOWA 4RWIA 1UU8A 4BCFA 4E93A 5C1QB 4KKEA 4N4SA 4G31A 4O4DA 3TTIA 4BC6A 3P86A 4D2VA 4J98A 2WTIA 5EM8A 1NVQA 4UMQA 5CS6A 4OAVB 2OH4A 5H2UA 4BYIA 2I0VA 3UP7A 3HRFA 3L8VA 4QYHA 1MUOA 2C6KA 3ZU7A 5K4IA 4U8ZA 2R2PA 4ZAUA 2F49A 2Z8CA 1J1BA 2C6TA 1H0VA 3EB0A 2YM4A 4X6QC 4KBAA 3BV3A 2UVYA 2IWIA 3MWUA 3PPZA 4FZAB 5BQ0A 2Z7LA 2WIPA 5LVMA 3TYKA 4YPSA 2YJRA 4ENYA 2FUMA 4GUEA 4NKSA 3VUHA 1WBWA 3PSBA 4E73A 3QZFA 1UU7A 3MH0A 3OWKA 4BY9E 2BTRA 4NEUA 3TJDA 3BU5A 3WIGA 4WG3A 3UMXA 2UZTA 4OW8A 4HVIA 1JSVA 2YM3A 4OTRA 4NJDA 2CNVA 3PVBA 5T3QA 4JRNA 4CGAA 4F7JA 2PMOX 5IH4A 3BYVA 5AUWA 3W18A 2ZOQA 3OVVA 2X2LA 3EN5A 1M2QA 1PMEA 3IGOA 2JAMA 3FUPA 2ZV9A 1IAHA 1H01A 1NT2A 1LR4A 4RX7A 1UV5A 3QZGA 3PPJA 4HOKA 3GENA 3QRUA 4JR7A 3PG1A 4L44A 4F7LA 4I24A 2R3OA 2VX0A 3LCSA 5BYLA 5HEZA 3TN8A 2XAOA 3FL4A 5CNOA 2HIWA 2HOGA 3JVRA 3OT8A 2OBJA 3OXZA 3WBLA 1LPUA 4M97A 4EEVA 4EKKA 2YWPA 4R3RA 5HU3A 5E7RA 3D2KA 3DBCA 4CZYB 4G3GA 3AG9A 4U97A 4DG0E 2G2HA 1H26A 3UODA 4ZLYA 2Z7SA 3ZOSA 4RIOA 4DGLC 3NMUF 3QQGA 4GV1A 4YC6A 3GUBA 3H9OA 4L53A 4AZFA 4MH7A 4BDCA 3JYAA 3VBYA 3GFWA 4IVAA 4BIBA 5IISA 4YZNA 4ZJVA 3JVSA 1IA8A 4BDHA 5AV2A 2IZSA 3B8RA 4FRFA 3R8VA 3Q9XA 3P4KA 4PL3A 3LFCA 1WCCA 2XCKA 4EOSA 3DAJA 3NRMA 3ODZX 2I6LA 5DRBA 5HCXA 4XRJA 2QOLA 4JDJA 3Q5IA 1XQZA 3H4JA 5HTCA 5JQ8A 5L8LA 1K3AA 1M17A 4XNEA 3PA5A 5AV4A 3DB6A 5IMEA 5HTIA 5M07A 1W98A 5D11A 2Y4IC 4FTNA 3C5IA 3E7OA 1JNKA 4JBPA 1W8CA 4DAWA 5IA2A 3VULA 2YIXA 5E90A 4IVDA 5FUTA 5AAGA 5M09A 1Q61A 2GS2A 5H3QA 2QHMA 3CE3A 5HLNA 2OZAB 2BCJA 3CGFA 3VUDA 4YO6A 1G8AA 3L9NA 2V7AA 2YCRA 2C5YA 3BHHA 4BCHA 4IMYA 3CTJA 3MY5A 4QP1A 4USFA 3FV8A 3VUMA 4AA4A 2C0IA 3W1FA 4PTCA 4P2KA 3GU7A 4BL1A 2DWBA 5A4LA 5M4IA 5CWZA 3SLSA 2QLUA 3CJFA 3WOWA 4YURA 4M8TA 1PF8A 1YVJA 3F3TA 4HCTA 4GK4A 1XBBA 4LI5A 2J2IB 4CXAA 3Q60A 1ZYCA 4DFXE 3F9NA 4GCJA 3R9DA 1Y8YA 4MXOA 3MPMA 4FTIA 5AP4A 3ZLXA 5ANKA 3AC1A 3O8UA 4EI4A 3HKOA 1OIUA 1B38A 3DOGA 3TIZA 3FZSA 4G3DA 4WRSA 3EWHA 3S1HA 4GU9A 5L6PA 4D4YA 4ITJA 4GS6A 2QD9A 3TTJA 4BBEA 5FTGA 5E92A 4P5ZA 3ZO3A 5ITAA 4Y85A 1L8TA 3HA8A 3NW5A 3WF5A 4CTCA 3VN9A 3V5TA 3KULA 1QCFA 4UB7A 5KMIA 2AQXA 2RG5A 2HZNA 5JQ5A 5M44A 3FMJA 4X3JA 1ZAOA 4PL4A 4PDSA 3RNYA 4AGUA 4D5HA 5LWMA 2RFSA 3W2RA 4JJRA 4FK3A 4LMNA 1KE6A 4DGOA 3VF8A 3Q4ZA 1XO2B 3BZ3A 4OT6A 5GIOE 4CQGA 3R22A 4ALUA 4LDTA 1WBNA 5BUJA 3RPOA 3RI1A 4FIIA 5J5TA 4DHZA 3LFSA 4A9TA 2F7ZE 4QMXA 5BVOA 3HECA 1WBTA 2GNFA 2VD5A 2W5HA 5CVHA 5BUEA 3OOGA 3SV0A 1CMKE 1YQJA 2NRUA 4FNZA 4FKJA 4XG8A 2J7TA 4GH2A 5AV3A 5A54A 5DYJA 2UZEA 2C0TA 4S32A 3CXWA 5GZ9A 4C3FA 2ZM3A 4AN9A 4OTPA 1RE8A 1VYWA 2Z60A 4NM0A 3ATSA 3LQ8A 5E8ZA 5EKNA 3UNKA 2PY3A 1XH7A 4JG8A 4IWDA 5B0XA 3GU4A 4AP7A 3C51A 3BHTA 4X3FB 5HG8A 4IWQA 3KXMA 1ZARA 5E8TA 1OKZA 3VS6A 3LM5A 5HG7A 1ZXEA 1JKKA 2HWPA 3HUCA 1W0XC 3HV7A 4CNHA 3CIKA 2VO7A 2O0UA 3LJ0A 3BWFA 5CXHA 3WYYA 3ZZEA 3TNWA 5LCKA 4Q9ZA 4PTGA 1CKJA 3F66A 4YLJA 1Q8YA 3IONA 3MFUA 3O7LB 4HPTE 3QGYA 3NUYA 1OUYA 3QLGA 4H3BA 4V0GA 3QRKA 4I6QA 4J7BA 2HENA 1YW2A 4QP3A 4WSYA 4E4NA 3W0RA 5M51A 4TYHA 4D9UA 5AUYA 3QTUA 3EYHA 3UQFA 4GFGA 4IX5A 1CDKA 5HO6A 1W2FA 3R21A 4GK3A 4WNKA 4O0UA 3FEGA 1GIHA 5IDPA 4GKIA 4AXEA 3PFYA 4I21A 2RGPA 2XNPA 4HGLA 1VLRA 3DK3A 3OXIA 1FMOE 5LOHA 3NWWA 3R7YA 5F95A 3Q2JA 2W5BA 5I9UA 3QD3A 4YSJA 3UO4A 1P2AA 2P55A 5CTPA 3W16A 1H27A 3KA0A 2F7EE 2ZVAA 3ZFXA 1ZMUA 4F63A 4DT8A 3OTUA 4XS2A 3OROA 3S2PA 1PMNA 1I09A 2QOOA 1OL6A 2XIXA 2YIRA 4BGQA 3PSDA 2ZFYA 1K9AA 3GU6A 4BB4A 3D14A 2R3MA 4A4XA 4FV8A 2IVTA 4CQEA 2XKDA 2CGUA 3C1XA 4C02A 4DEEA 4FE2A 3WYXA 2CGVA 4C4EA 4A7CA 4QQTA 3O7LD 3II5A 3FKNA 4ZSJA 4ASXA 5KMNA 5HHWA 4FG9A 1F3MC 1E1VA 2JDRA 3LMGA 4I6FA 4PMSA 4KSPA 4DH3A 5JFXA 3LXKA 3O50A 1SM2A 4QP9A 4RIYB 3ZLSA 2AYPA 3SW7A 1WFCA 1YWRA 3HRBA 1VR2A 1OL1A 3I5ZA 4QMUA 4WT6A 4QMZA 4ZSLA 4GEOA 3VC4A 5DEWA 4XBUA 5KMJA 3QTQA 3LCOA 4RIXA 4Y73A 2PVYA 4PP7A 2ITTA 4Q9SA 4YJOA 3V5PA 4KNBA 4DA5A 2BZIB 4FF8A 3DDPA 1JSTA 1XMMA 3C4FA 1TQMA 4G3CA 2X8IA 5KMOA 4W9XA 2YCFA 4BDIA 5JRQA 3OCSA 4NYEA 3G0EA 3PVGA 4RRVA 4QP2A 2W1DA 3V5QA 4ZY5A 2WTKB 3S0OA 1F0QA 4GSBA 4IJPA 4NZWB 2IVSA 2RKUA 5DH3A 1H00A 4I5PA 2VU3A 3A4OX 4HGEA 4IM2A 4CFNA 1XH5A 5CSPA 5GNKA 4B99A 4DCAA 4ZXTA 5AUZA 4O91A 4CCBA 3DK7A 2VRXA 3S4QA 4KABA 3KRWA 3F2NA 3QQFA 4FUXA 5IA4A 4MNEB 4O21A 2ZB0A 1OMWA 4RA5A 3AXWA 2YIQA 2NP8A 4E6AA 5JFSA 2BZKB 2YFXA 3LHJA 1SZMA 3E7VA 5FEEA 3A7GA 3POOA 3V8TA 2ESMA 3TACA 4O2ZA 3TV4A 5M55A 3KXXA 5HIDA 3N4VA 2BAKA 2B0QA 2FSLX 3SXFA 2B7AA 1KWPA 3H0YA 3EQFA 3QXOA 3QKLA 2JKQA 3P23A 1I44A 3R00A 5A3XA 3RK7A 3C4XA 4BDGA 3UG1A 3PSCA 1E1XA 5FBNC 4DFUA 3PE1A 1R78A 1IG1A 3EOCA 4ZLOA 4FUYA 2WNTA 5HTBA 1DAYA 4L7SA 4FOBA 3FQSA 4F1OA 2VN9A 2Y6OA 4FI1A 2B9FA 3FJQE 2OH0E 1G8SA 5AP2A 3TUDA 4KWPA 3U8WA 4J53A 3WE4A 4CMUA 3VBWA 3CPBA 4R78A 3FAAA 3EL8A 4B6LA 3PXKA 3FMLA 1P14A 2PE2A 2Y8OA 4XG7A 3ZM4A 3D4QA 3CGOA 4V05A 4IFGA 4APPA 5LCJA 3NUAA 1UKIA 4O1OA 3KU2A 5KZIA 4GFMA 2HXQA 2ZV7A 5I4NA 4L3LA 2G2IA 3GOPA 3KB7A 3R1YA 3VNTA 4DBNA 4BHZA 3QUDA 2OIDA 4I5HA 3RINA 5KMLA 5H9BA 3UO5A 4KKHA 3MW1A 3LZBA 3EQHA 3KXNA 4YJUA 4O0RA 4D1ZA 3RKBA 1YDSE 4RZVA 3OCBA 2EXEA 2YERA 1GIJA 4NIFA 2BUJA 4EQMA 2QOCA 3C4WA 3NUUA 5BX0A 4HCUA 5LVLA 4ZTMA 1DAWA 3CKWA 2W96B 3AMAA 4JT3A 5EHYA 2XCHA 3BYOA 3C4CA 1M2PA 2VV9A 3KF7A 3ZEPA 4AA5A 5M4UA 4ZP5A 3EN7A 3R9NA 4MNFA 3IOPA 3HDNA 2RFEA 2BFXA 2VGPA 4OR5A 2GS6A 3TWJA 4BTMA 2VWXA 4BZNA 1A06A 1U46A 2ITNA 3T9TA 2Q0NA 2PULA 3FSFA 4PMMA 1RW8A 4M12A 4OTGA 4RGJA 4AQKA 2YA9A 2OKRA 1WVYA 1JBPE 1ZYSA 3ZMMA 4C34A 3E5AA 2AC5A 2B9JA 3DFAA 4IB1A 3RPRA 5CU3A 3UOKA 1R3CA 5FDXA 4C4HA 4CKIA 3TDWA 3UDTA 4BN1A 1H08A 4CG9A 1Q97A 3BIZA 4KRCA 3QKKA 5M4CA 1Q4LA 4DYMA 3G6HA 4ASDA 3RCJA 2GHGA 1IR3A 4NCTC 5HBEA 5AA9A 5FXQA 3VW6A 3QL8A 3I7CA 2OJGA 4KIOA 4OBPA 4UYNA 4A4LA 1VYZA 4FIEA 4ZJJA 4O22A 3ITZA 4MXXA 4FV7A 4DN5A 4PDYA 4R6VA 4RIWB 3A99A 3FWQA 3O8PA 4U41A 3AC8A 5JH6A 5FXSA 4EH3A 4QQJA 2UZUE 5J8IA 1FVTA 4LOPA 3VW8A 3F5XA 3RZFA 2YJSA 4EK4A 3EYGA 1M14A 1XJDA 4DFLA 2VO3A 4KRDA 4TYGA 5H8GA 3IPHA 4FVQA 4ANQA 2YAAA 2JFLA 4NM7A 5DN3A 4ZY4A 5AUTA 2GTMA 4FV3A 2J0JA 1MQ4A 3UE4A 4BWXA 4AGDA 4C58A 5EYDA 1JQHA 2IVUA 2ITWA 1NY3A 4QD6A 4QNAA 2DUVA 3BWJA 4KAOA 1YWVA 4EHZA 5LVPA 3NNXA 3LCDA 4NW5A 4H58A 2ZV2A 4O7WA 3C13A 4KKGA 4RX9A 5T6KA 3RCDA 4FIJA 4M67A 3R7UA 2IVVA 3KN6A 5ETIA 3LQ3A 2YDJA 3BGZA 2YM6A 3BHYA 3HMOA 3UIMA 1ZOGA 4FC0A 1H0WA 3KXHA 4IACA 5HBJA 3O5AA 3MBLA 4BI0A 4QQ5A 4QPMA 4YU2A 4GMYA 3U87A 4DGNA 5IQAA 2JBPA 4F9BA 5IMXA 4LL5A 2J0KA 3RPSA 3UQCA 1Q24A 2WQOA 4LGDA 4WOVA 4F1MA 3LXNA 1OKVA 4O0SA 5FBOA 4LM5A 4WUAA 4O7NA 1R0PA 4ZLZA 4PWNA 2J51A 2EUFB 2VTRA 4OTWA 2A4LA 1DS5A 1H1WA 2XIYA 4IANA 4LOQA 3P9JA 4II5A 4CYIA 4U45A 4ACGA 4XX9A 2OXYA 2ITVA 5FP6A 2NO3A 2DS1A 4FV1A 4Y5QA 5LMAA 3VF9A 1WVXA 4AGCA 4JX7A 4EQUA 4B7TA 4BICA 3WZKA 2GDOA 5ETAA 4TKSA 5AV1A 3I0OA 4D2PA 3DGKA 1U5RA 3QAME 3LLTA 5HG5A 4MQ1A 4JQEA