2Q0NA

Structure of human p21 activating kinase 4 (pak4) in complex with a consensus peptide
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
294
structure length
293
Chain Sequence
b'RVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title Structure of human p21 activating kinase 4 (PAK4) in complex with a consensus peptide.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 293
sequence length 294
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2q0nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2q0nA01
4BDJA 4MF1A 2WMTA 1UA2A 4R77A 4IANA 2FUMA 4E3CA 2REIA 4NM7A 3T3UA 4JNWA 2OU7A 4GG7A 5ACKA 1ZOHA 5AP6A 3VHEA 4Q9ZA 3D5VA 1WZYA 2C3KA 2PWLA 1XQZA 3U4UA 4IJPA 2X7GA 3KF7A 5D7VA 2PE2A 4D55A 4UMQA 4MQ1A 4Z55A 1W0XC 4ASZA 4P5QA 3DJ6A 3F9NA 4G5PA 1ZZ2A 4D2PA 4BDKA 3PA4A 4DT9A 3DTCA 4FSZA 3F5PA 3QZHA 5ANEA 3AG9A 3RAKA 3DBCA 5J1VA 5J1WA 4FV3A 3FI8A 4DF3A 3OTVA 4A9UA 3OP5A 4YO4A 2XA4A 4HW7A 3N4TA 4DCAA 4I0TA 2UW5A 4GIIA 4LI5A 2HY0A 3D15A 1K2PA 3QHWA 2B55A 2X81A 4BZDA 1OI9A 1DI9A 2ITUA 4QMXA 4J53A 4BWPA 1XKKA 1WMKA 2ACXA 1H1RA 2ZV2A 3WF8A 2YHVA 2OJIA 4ENXA 1SZMA 1PW2A 2BKKA 1CDKA 3ULIA 4DH3A 4DH5A 2BROA 3QCXA 4AT5A 4F9YA 4RVMA 2XIZA 3FMDA 4JIKA 3FMLA 4XG4A 1Z9XA 4Z9LA 1M2QA 5HG5A 3W16A 4GEOA 3Q6WA 4S33A 2BAQA 2BCJA 1W83A 4RC3A 2W1CA 2GNFA 5C01A 2HELA 3L9NA 2W1HA 5L2TA 2LGCA 4MNEA 3ZS5A 3T3VA 3KL8A 3QCYA 3F3UA 3A61A 2A0CX 4QYGA 3BLQA 3VJOA 2AYPA 4CZYB 2QKRA 2JAVA 4JDHA 3QX4A 1T45A 4AZWA 1RJBA 2YDJA 2J0KA 3MVLA 3K5VA 4F63A 3R01A 5AV1A 4EORA 2WPAA 1CM8A 3KCKA 5BX0A 3TUCA 3CEKA 4O2PA 4CFFA 4RWJA 4OT6A 2JDSA 3P7BA 5G1XA 2XRUA 3TXOA 4NUSA 5BVNA 4U9AA 3FXXA 2ITWA 5L2QA 4C38A 4PPBA 4DEDA 1P14A 3ETAA 2YIYA 4KSPA 4OTHA 5HVJA 4FIIA 5J9ZA 3MH2A 3WIGA 4HVHA 4O7VA 3LFNA 2O65A 4EK5A 3QGWA 2X8IA 4MWIA 2GCDA 3CTJA 2YABA 3F7ZA 4PL3A 1E9HA 2OH4A 3EQRA 3UQGA 3COKA 4LGHA 4CYIA 3R6XA 4GMYA 3C9WA 3TJCA 3I5NA 4PRJA 4H58A 4WNMA 4BDCA 5LVOA 4FV2A 2I0YA 4U6RA 4YZBA 5ITAA 2G9XA 4B4LA 5IEXA 5D9HA 4IM3A 1R0PA 4ONAA 2Y4IB 3OCBA 2XZSA 4AZVA 4BDFA 5LMBA 3HUCA 4O27B 3E63A 4DG2E 4FKUA 1G3NA 3DNEA 3MSSA 4O2ZA 3QGYA 3IW6A 1NT2A 3H0ZA 2BRNA 4J7BA 4J52A 3A8XA 3QTUA 5CEPA 2ZYBA 3WE4A 4F09A 1A48A 2QG7A 3GQIA 3NSZA 2OSCA 3LLAA 1OECA 4DA5A 4E6DA 5GNKA 2HENA 5C1QB 3HGKA 3OOMA 1YXTA 3TDVA 3OOGA 5AAFA 3R9DA 3RM6A 2E9OA 3QL8A 4PQNA 2P0CA 2JAMA 3CPBA 3NRMA 1Y8GA 4WKQA 5DR2A 5JRSA 4RX8A 5LARA 3ZUVA 1FBNA 4C58A 3PRIA 3AT4A 2J6MA 3KEXA 1TQIA 3UIUA 1BYGA 3TIZA 4CFUA 4TN6A 3AMYA 4IADA 4XG2A 3FLSA 3DKFA 3C7QA 3P1AA 4IFCA 2RSVA 4WO5A 4DEBA 1L3RE 1NVQA 3IGOA 3KRRA 2BILB 5EHOA 4CFNA 3ZRLA 3R1QA 3BWFA 1H00A 4EUTA 2VTQA 3BEAA 5IQGA 5ANKA 1GNGA 3FLWA 3PRFA 5KMMA 2NPQA 2ZM3A 3PXKA 4R5YA 3LMGA 3UOKA 1J1CA 1EH4A 3VS4A 1Q8WA 1JKLA 3OBJA 3PIXA 3LIJA 4BCMA 4YC6A 3UNJA 3UC3A 4IHPA 3ROCA 3R8MA 1LEWA 4QNYA 5IEVA 3U51A 3O17A 5IA4A 4DFYA 4QOXA 2JFLA 5AP1A 2QHNA 2C6OA 3WZJA 3P5KA 2VD5A 5CTPA 4CRLA 1P5EA 2R3KA 3UIXA 4F9CA 2G2IA 3QCSA 5JFWA 2GFCA 2HAKA 3OEZA 5JGBA 3MB7A 3VS5A 2G01A 4OT5A 4UX9A 3SHEA 4APPA 4ZZOA 4KNBA 3WZDA 4DGGA 4AOIA 5DIAA 5BVOA 2UZWE 4BBFA 3NYXA 2EXMA 4BTKA 4PX6A 5C9CA 2AUHA 4YJUA 5L8LA 1OB3A 5GINE 4TYHA 3D7TA 3TDWA 2QG5A 1M17A 2VTLA 3CC6A 4M84A 5CU2A 4ANOA 3S95A 3BYSA 4QT1A 4G31A 4UB7A 5EG3A 4JRVA 3PJ2A 3PVUA 3IKAA 4P2KA 4E7WA 3SAYA 5CI6A 4KRDA 3HX4A 2O64A 4QYFA 2X4FA 2R3NA 5LMKC 3R2YA 3VNTA 4L3JA 3MI9A 5CXHA 2DUVA 1JKKA 4YJQA 3JY9A 3OF0A 2QR7A 2VTSA 3QRIA 4C0TA 5AADA 4U97A 5CSXA 2Q0NA 2XVDA 5FXRA 1XH7A 4FEXA 4DT8A 5JN2A 1G8SA 3PDTA 1PMEA 4RPVA 4MXZA 4ASXA 2V7OA 5DEWA 5AR5A 5BQ0A 2H9VA 5EYDA 2HCKA 5AWMA 4RVTA 4FV8A 4CFXA 5JQ8A 1H07A 4I21A 4FL3A 3DXNA 3OUKA 2WEIA 3R21A 4F1MA 2J0MB 4TYHB 1VJYA 3QTZA 5IA5A 4G3FA 4LGDA 2C3JA 3OMVA 4TYGA 4N57A 3D14A 1W98A 4QP6A 4Y46A 3KRLA 4BFMA 4K77A 2VWZA 4I24A 3OG7A 2C1AA 2OJGA 2UZEA 4CFWA 3ZONA 4L45A 5FD2A 5J9LA 5HORA 1JSTA 4ALVA 4MXOA 3DY7A 3LFSA 2R4BA 2WMBA 4F70A 2ETKA 3TNIA 4DGMA 5EH0A 3R1SA 2WFYA 3CQEA 3TKHA 5CU4A 5HG9A 3OS3A 4E5BA 4DG0E 2JBOA 2ZJWA 5JRQA 2XNOA 5AA8A 5KMLA 5KBQA 2B54A 3BU6A 4MXAA 2WU7A 4ZTSA 4YLJA 4A06A 3WZKA 4XBUA 5CAOA 2YIRA 3R9OA 2QO2A 1JKTA 2RG5A 4M8TA 2X4ZA 4O91A 5CT7A 3UJGA 3PE1A 4O81A 1KV2A 4AW1A 3DXPA 3GU7A 4Q5EA 2VZ6A 3EQDA 2ITPA 2J0LA 3C4XA 3TNWA 4DFZE 4EEVA 2YERA 5K5NA 1WBTA 4ANNA 3G33A 2PVLA 3D2KA 3DLSA 1LUFA 3O23A 4AS0A 2WXVA 2PHKA 4U81A 5HI2A 3SXSA 1LP4A 4TYJA 5IUHA 2WIPA 3A4OX 3K5UA 4FODA 4FEQA 4O0VA 2CMWA 5CEQA 2UW7A 2QOLA 2X2LA 4AZFA 4OTGA 2QU6A 5E7RA 1ZMVA 2WTIA 2Z7SA 3MFTA 5M08A 4E5WA 4YHTA 5EDRA 4DH7A 2WMXA 1JNKA 3R8UA 3VS6A 4IFGA 4X2JA 1ZYJA 1P4OA 4DC2A 4F6SA 2G15A 4GT3A 4BCHA 2IW9A 5CS6A 3UOJA 4ZY5A 3UIBA 2YIXA 4FSUA 5GJDA 1RDQE 1YDTE 1YXXA 1ZMWA 4NFNA 4FUXA 2X2KA 2XJ2A 1GIIA 1B6CB 2CN8A 3FY2A 3R9NA 3DLZA 4OUCA 5HLWA 2VTOA 3LMIA 1PMVA 2WQMA 4O83A 4G5JA 2GNJA 4QTEA 5DI1A 4FKGA 5CF5A 4NJDA 4ENYA 3AGLA 3DCVA 3VIDA 3KXNA 5M55A 4JQ7A 1UKIA 4MD9E 4RGJA 3QRKA 4GYIA 4X3JA 4Y73A 2BDWA 3RZFA 4ZSAA 1JPAA 3UZTA 3QD3A 3AD5A 3PVWA 1JSVA 3ZZEA 3R8ZA 5FGKA 4X2NA 1I09A 3BRBA 5AIKA 2VNWA 3ALNA 3GU4A 4F64A 1Z5MA 2YCRA 2ZV7A 3C5IA 5E4HA 4IBMA 4MBLA 5HBEA 3ZFMA 3GC8A 3CIKA 1PKGA 4F6UA 3MIYA 4EKLA 2ZDUA 3PPZA 4IAYA 1Q8TA 2ITQA 4PMSA 5H8BA 3FMMA 2FSLX 3QLFA 3U4WA 2EU9A 3COMA 2YM5A 3QLGA 4I0SA 5EW8A 4Z16A 4FIHA 5EQEA 1FVVA 4FZFB 4YJPA 3OCSA 4B0GA 5K0XA 3ZO1A 3I6UA 4EWHA 3FC1X 4BDEA 3GUBA 1K3AA 4OBQA 3M42A 2DQ7X 4FIGA 1MRUA 1V0BA 1QL6A 5M56A 3QXPA 2FSTX 4OGRA 5E8YA 4O86A 2X6DA 3Q9YA 4CNHA 2JITA 2HIWA 2Z7RA 3OFMA 4QQJA 3FZSA 3LE6A 4J8NA 4QMUA 4RQVA 2WHBA 3QTQA 3LCSA 3BGPA 4FNYA 5F4NA 3ZDIA 5I9ZA 3JS2A 4GW8A 3EN9A 1JKSA 3E7VA 3TN8A 1NY3A 3U6IA 4D4SA 3KQ7A 4RC2A 4FI1A 4EBVA 2ZB0A 3NPCA 4HNIA 4QP7A 2R3GA 3AOXA 4TYEA 5KHWA 3LQ8A 1I44A 3EQCA 3DKCA 4AU8A 3JR1A 3E93A 4K2RA 1E1VA 4IM0A 3SGCA 3ZC6A 3L1SA 4A9SA 4MXCA 4BBEA 4L01A 4PUZA 4Z7GA 4QNAA 3RNYA 2XEZA 3JYAA 4FVRA 5IU2A 5AUYA 3TNHA 5AV3A 2E9UA 3OW4A 5KE0A 3BU5A 4BIDA 2VO6A 1XH9A 5DLSA 3BIZA 2YM3A 5EW9A 4DE4A 5CZIA 1XWSA 3DS6A 1VEBA 2OW3A 3F61A 4M0YA 4YC3A 1GIHA 4XNEA 5KMNA 4FT5A 3W2OA 5A9UA 4CCUA 4J99A 5F94A 3MWUA 1UU9A 3AT2A 5CZHA 2LAVA 3DKOA 1ZOEA 3QA8A 4F0GA 4PF4A 3NUPA 4AOTA 5JKGA 2GS6A 5DG5A 1PMUA 3MV5A 2X9FA 4GS6A 1UNGA 5HG8A 3PVBA 4GUEA 3DBEA 3C4ZA 1WBNA 4ZP5A 4ZK5A 3RCDA 2OLCA 3FLZA 1OPLA 4BKYA 1XH4A 2QKWB 3OROA 4R3PA 4GIHA 2B1PA 4O0WA 4RRVA 2XJ1A 5GZAA 3KCFA 3R7IA 4RWKA 2PK9A 3T9TA 3KRWA 2XKDA 3LCOA 5EK7A 5TT7A 3ROYA 3TKIA 3VW8A 3FZOA 3VS0A 4BI0A 3LFAA 4ZTMA 2PE0A 3IW8A 4BKZA 3DDPA 3GI3A 1BI7A 3PIZA 3UPXA 3QKKA 2UW4A 3BGZA 5T3QA 3IO7A 1IA9A 4KIKB 1VZOA 2C6TA 4IB1A 3ODYX 3PY1A 3LCKA 2C6MA 3H10A 2NRUA 2P2HA 4XP0A 3V51A 3A99A 3Q32A 4CKRA 2IG7A 3DV3A 4GFGA 4R6VA 5BYZA 3IDBA 4X6QC 5CSVA 2CGUA 2XNNA 3LXKA 3F3ZA 2YJRA 3IQ7A 3NIZA 4L00A 5FBOA 3FHRA 3JPVA 4F9AA 5HD7A 2GQRA 3U55A 5HOAA 2CKPA 4PPAA 2VNYA 4CKIA 2UZVA 4U45A 4BCOA 2UZLA 1CMKE 3KRJA 2J2IB 3QHRA 2BZIB 3OY3A 4XBRA 5I9UA 5HZNA 5I9WA 3LW0A 4GKIA 1H4LA 4E6CA 4NYEA 2Z8CA 2EB2A 2BAJA 2XNEA 3D0EA 3I0QA 5ETCA 4EONA 3CD8A 4IAFA 1UKHA 4CTBA 3V3VA 3QQGA 4IB0A 1Q97A 4ZAUA 3HL7A 2JDOA 3NZ0A 4X2KA 4ZXTA 4M0ZA 3KXGA 4ZLYA 4I93A 4MVFA 4MF0A 5EM6A 1GZNA 3THBA 4GL9A 4ACGA 3IGGA 2WOUA 3WF9A 4O6EA 4HPUE 3H9OA 2Z7LA 4G1WA 4FZAB 2YM6A 5CQWA 4TL0A 2P4IA 4IDVA 4WUNA 4J71A 1Q8YA 3OXZA 5HGIA 4XMOA 1WAKA 4Y5QA 4B8MA 4FZDB 5IA3A 3IW7A 3F2RA 4FGRA 2F49A 1DI8A 1OIRA 1YXVA 5TF9A 4CTCA 2F7ZE 4USEA 3ZRMA 3FKLA 3PSCA 2XIKA 5HICA 4BHZA 2O2UA 5HKMA 3VF8A 4QD6A 4ITJA 4WRSA 4CXAA 3MVMA 2JEDA 4U79A 3ZU7A 5IDNA 2JDVA 5C03A 2ITXA 2XP2A 3ZXTA 5H2UA 3QWJA 4I92A 1YWNA 3Q4TA 4GJ2A 3Q2JA 4FF8A 4FC0A 4AT4A 3QALE 4K0YA 3OTUA 5BMMA 4R7IA 4FYOA 3PE2A 3W55A 1NA7A 2X7OA 3BE2A 3DFAA 4FICA 4JBOA 4TT7A 3RVGA 1Q3DA 3B8RA 3NCZA 3A7FA 4CV8A 3P23A 1X8BA 3Q4ZA 4LGGA 4XLVA 3S4QA 3UE4A 3NUYA 4E4LA 2BRBA 5AP2A 3A7JA 4D9TA 2RFEA 3SX9A 4K18A 4O6LA 5E8VA 5KHXA 4MXYA 1REKA 4M7IA 5D12A 3OWJA 1UV5A 3BYOA 2VTJA 4EOPA 4BKJA 2WMWA 3OWLA 1UWJA 4MK0A 2ITZA 3W1FA 3BYMA 1H27A 3TNQB 5E1EA 3ZLSA 3TIYA 4CKJA 5L3AA 3PUPA 2O63A 3DFCB 5CVHA 5LJJA 4USFA 4DBXA 2VWIA 5DRDA 4FA2A 2R3PA 4Y95A 4C36A 4FKSA 4E20A 4EQMA 1PYEA 3GQLA 3I4BA 2OWBA 3FY0A 3AT3A 1WBOA 4D2SA 4EHGA 2PTKA 3NEWA 3O7LB 2VN9A 5IQIA 1YW2A 4YC8A 3R7UA 1ZXEA 2WMRA 4MXXA 5FEEA 3PY0A 4RG0A 3RK5A 3VRYA 3SXRA 4TWNA 3FJQE 2W7XA 3WF5A 2CPKE 4UWCA 4D2VA 3LVPA 5BVWA 4UEUA 4DEEA 3UZRA 2VGPA 4QMMA 1UU7A 4O21A 3UO4A 3RK9A 1J7LA 3FMHA 2VWBA 4JAJA 3CPCA 4EHZA 2I0VA 2V22A 2XF0A 3EQBA 4O0XA 2OGVA 2OIDA 3K2LA 3F82A 3AD4A 2C3LA 3UO6A 1RE8A 2PPQA 3GCVA 1KSWA 3NNVA 4N0SA 3ZC5A 4AAAA 4NM5A 4XLIA 3TT0A 4ACDA 1JBPE 4YZNA 4GK4A 4YZ9A 1OUYA 3UMWA 2UZDA 3OXIA 2ETMA 3KF4A 4BBMA 4A4XA 2XJ0A 4YJRA 4FNWA 5KMJA 5DT0A 1R39A 3SXFA 4WA9A 2R0UA 2YISA 2QC6A 3DK6A 5DR6A 3RK7A 3WARA 3VBXA 5HNBA 1PXLA 3FV8A 3BZ3A 1FMOE 4D0WA 2F2UA 4CT2A 3OZ6A 4AG8A 3WI6A 4L3PA 5GHVA 4FKVA 4DN5A 3VUTA 5IQEA 2OO8X 4LUEA 4B99A 4FKIA 3UDBA 1ND4A 5DR9A 4QPSA 3FI4A 3A60A 4D1XA 3JXWA 1KOAA 3R1YA 4JVGA 3SLSA 3UG2A 4D4VA 3NYNA 5KKRC 3IOPA 1MP8A 2PVNA 2XK7A 4U7ZA 5DE2A 2AC5A 3EOCA 4F9BA 3LFDA 3PLSA 4FYNA 5C4KA 1XO2B 3JUHA 4XS2A 3W18A 3O96A 4YHFA 3IPHA 3HNGA 4O0RA 4N6ZA 3UYTA 2BVAA 4CFVA 1YKRA 4EOOA 2CKQA 1JOWB 1YI6A 2Y4PA 4HYSA 4CMUA 5JGAA 5BUJA 3I81A 5AFVA 4NL0A 2A4LA 2VWWA 1R0EA 3R04A 4JDKA 2XK3A 4OTFA 5K4IA 1B38A 2BRMA 2YACA 4YBJA 1S9IA 5HIDA 4O84A 1URWA 1KE5A 2BALA 1JVPP 3U6JA 4PTGA 2C30A 5KBRA 3DJ5A 2VTPA 3GU8A 3EKKA 3MA6A 3KFAA 3QKLA 2WZJA 4ID7A 4MTAA 3OVVA 1H24A 2W06A 3H4JA 2H8HA 2UW0A 3JY0A 4TY1A 3BHTA 5M4CA 3OWPA 3GB2A 4LRJA 4M14A 5E91A 2WTJA 4UBAA 2XYNA 4WG5A 4K8AA 4F0IA 5JZJA 3MN3A 3COIA 2WIHA 4AACA 2PSQA 2HXLA 2V0DA 1H1SA 2XKEA 3MGYA 3PXQA 5I4NA 4JI9A 4GK2A 4EOKA 3D2IA 5FDXA 4WBBB 3HEGA 3OCGA 2QODA 4I41A 4U41A 2CLXA 5I3RA 1OL2A 2VWYA 4E6QA 3ZSIA 5AP5A 5BVFA 5DYJA 2PUPA 4JX3A 4CVAA 3V5JA 2YITA 3DK3A 4O38A 5JGDA 1BKXA 1YOLA 2XIRA 2E2BA 4D5KA 2XMYA 1IA8A 4BYJA 3LFBA 4AE6A 4NIFB 4AZTA 4C62A 5M06A 4FUYA 3RPSA 5AUWA 3FYJX 3P7AA 4PDOA 3E3PA 3SD0A 4PMPA 5L6OA 4KUJA 5C4LA 3ZXZA 5CANA 2BAKA 2VTAA 2UZBA 4L52A 5CF4A 3QC4A 3PA3A 4V0GB 5AV0A 4WOVA 3FLQA 3V8SA 4F0FA 4EZ5A 2HZNA 4J8MA 4GG5A 3MA3A 4FTNA 4ZLOA 3PA5A 4W4XA 3A7IA 3UP7A 3MW1A 3PTGA 1AGWA 3UO5A 5LMAA 2R3IA 5F95A 4ZTRA 4RWIA 4IC8A 2JIIA 3GCSA 4EOIA 4RSSA 2QU5A 1F5QA 1XR1A 3U8WA 4BGQA 3LQ3A 1WCCA 3Q9ZA 5EW3A 4G9CA 4HJOA 4ERWA 4PNIA 3ZLWA 4L68A 3UTOA 4TNDA 2B52A 2QLUA 2AC3A 5J5TA 4JLCA 1H1QA 2YWVA 3VBQA 1Q8ZA 3H9RA 3R8LA 4GU9A 3L9PA 2JKKA 3ZM9A 4U80A 2QOHA 1PXOA 2W17A 3NX8A 4ACCA 3EZVA 3GFEA 2XIYA 4NM3A 2XBJA 2YCSA 3I5ZA 3NWWA 4MCVA 2WOTA 4EKKA 5CXZA 2HOGA 3U6HA 2VRXA 1BL7A 2I1MA 3FQEA 4KD1A 3DXQA 1OM1A 4UXQA 4Z7HA 5FLFA 4KSQA 5AIRA 4FTUA 5AUVA 5CASA 3KULB 3AD6A 4MAOA 5CVFA 3QUDA 4FKTA 4OTIA 4I4EA 4U3ZA 3VF9A 3SOCA 5M44A 3DNDA 4IZYA 5ANGA 4GU6A 2X8EA 4YJSA 3QZGA 1LR4A 1OL6A 3L9MA 5CI7A 4YGAA 1OMWA 3EFWA 1PXIA 2PZYA 3R7VA 2BIKB 4MEDA 1MQBA 2OFUA 4GRBA 1ZAOA 3E92A 4P4CA 1LPUA 2B9FA 1ZYLA 2B53A 2BZKB 1Q3WA 2IWIA 3RCJA 2NO3A 5IISA 1OPJA 2UVXA 3TZMA 4IAAA 3SKCA 3WYXA 2BIYA 4FSMA 3RTPA 2O0UA 5HCYA 3OY1A 4QYEA 5D10A 3KKVA 5FP5A 3NLBA 3I7BA 4FIEA 5EOLA 4H05A 4BIEA 3SQQA 3H9FA 2X9EA 3VO3A 4FIFA 3G0EA 1PXKA 4J96A 4AGUA 2JKMA 4EK8A 3V5PA 4YNOA 5BVDA 2C5VA 4KIPA 4L46A 2VX1A 3D5XA 3KVXA 4A4LA 4C3PA 5FBNC 4CYJA 3DB6A 4NKAA 3UNZA 2O8YA 3D94A 3E8EA 5KZ0A 3VUIA 4E4MA 3F5GA 2ZVAA 3CY3A 4FZ7A 5HNGA 2VX3A 1FPUA 2J9MA 3ODZX 3RAHA 5JFXA 4BGGA 4TXCA 2UVZA 3GGFA 4F7JA 1XBBA 3ZM4A 4JAIA 3PG3A 3CJFA 4YJOA 2QNJA 2QOBA 1U54B 5LWMA 3EN6A 4DAWA 4CQGA 3PZHA 2EB3A 4DFXE 5E92A 4YP8A 3RI1A 2PU8A 4FKLA 5CEMA 3FZPA 4FKQA 4XEYA 4ANLA 3ANQA 3EN4A 1NVSA 4FV6A 4QMSA 3W2RA 5K5XA 5KCVA 5KMKA 3V8TA 4O7TA 2XK8A 4RJ8A 3TTJA 5FRIA 2XH5A 2PY3A 4FBXA 3ID6C 3SA0A 2QD9A 2PULA 3NNUA 4HOKA 4IZAA 5FTOA 4C34A 2GS2A 3PXFA 4EK6A 2FA2A 1WBSA 4EH9A 3UPZA 5IA1A 4I3ZA 3KU2A 4L67A 4WRGA 2ITYA 2Y4IC 3QRTA 4U42A 5BYLA 5HHWA 5D7AA 4FTKA 4H3PA 4RJ5A 2CGWA 3PSDA 5B0XA 3HMMA 5DHJA 4ACMA 1OZ1A 2OF4A 4JOAA 4YJTA 3RKBA 4UZDA 4RVLA 3ZSGA 2JDTA 4FT3A 5CALA 3BYUA 3BHVA 4Z3VA 5HIEA 4LM5A 5AAEA 2WQOA 2W5HA 4BDDA 3BQRA 4WSYA 3LAUA 4FT0A 3UGCA 4KBAA 2G2HA 5EKOA 3QZFA 4IWQA 4I1ZA 3ZBXA 4H1MA 3HYHA 2GNGA 4IZ5A 4R8QA 1OL5A 4AN3A 4FE2A 3HMPA 1H01A 3IOKA 2YCQA 1ZMUA 2G2FA 5HEZA 4ZMEA 2HWPA 3Q9XA 4M67A 3C13A 2YM8A 4R1VA 2QOIA 2YJSA 1O6YA 4F7LA 4V05A 4QMZA 1SYKA 4JQ8A 4O1PA 5L6PA 3QKMA 2GTNA 1WBVA 3KY2A 3R22A 4FOCA 4C7TA 4DTKA 5I5ZA 3ZZWA 1GZKA 1IG1A 3GU5A 1ZLTA 3Q4UA 4I6QA 4Q2AA 4X2GA 3TZ8A 4ANSA 3TJDA 4I0RA 1CKIA 1Y57A 4UV0A 4HVDA 5JSMA 5E1SA 3QQJA 3FMEA 1XHAA 2I6LA 3ZLXA 4QP8A 4X7QA 4JIAA 3WZEA 4EI4A 4JL9A 3C50A 4E5AX 3F2AA 3WOWA 1J91A 5JH6A 3HA6A 3KGAA 1DM2A 4FVQA 2WTCA 3NW5A 4K11A 4KIQA 4XG9A 5I9YA 5AJQA 4DEIA 4WG3A 4ZY6A 3VS7A 1GOLA 3A8WA 2VWVA 3GVUA 3Q4CA 4RIWB 3LHJA 3Q60A 2YIQA 3ACJA 4FSWA 3R9HA 4EH6A 4JQEA 2VAGA 4HYIA 5AUZA 4PPCA 4ACHA 3ORNA 2W1ZA 2B4SB 4XH6A 3AC1A 2YZLA 2XEYA 2CKEA 2IZUA 2XK9A 2UZUE 4BCNA 4QRCA 5CEIA 4MD8E 5LVLA 4FT9A 3LJ1A 3ORLA 2QOKA 3KXZA 2UW6A 1ZOGA 3DAJA 3LJ0A 4HZRA 3DBQA 3RALA 2QQ7A 4DFNA 5KX8A 5CAUA 4E26A 2VTHA 5JEBA 4O7RA 2C4GA 3BV2A 3ORTA 4S34A 1YOMA 4IVAA 5J87A 1Q5KA 2WMVA 3HUBA 3C0GA 4YHJA 5DWRA 5AM7A 3ZMMA 5IQHA 2BZJA 2V7AA 3K3JA 4YSJA 1FOTA 2PVMA 5HU9A 4CV9A 3BEGA 4BDHA 5HO7A 2J5FA 4RA5A 3OXTA 5IZFA 2CKOA 2Q0BA 4C2VA 2IZRA 2WU6A 4HGLA 4W4YA 5M4FA 3MB6A 3GOKA 3KXXA 4A9YA 4L3LA 3W10A 3KMMA 3KB7A 3LJ2A 4ZTNA 5HBHA 1M52A 4D4YA 1YVJA 3W2CA 3DBFA 3NUUA 3PSBA 3C4EA 2VO7A 4OW8A 4LG4A 2QOCA 3EFJA 4NW6A 2YDIA 3H30A 3VS1A 4CQEA 4G6OA 5AP7A 5AEPA 3UOLA 4EQCA 3BE9A 4X3FA 5DFPA 4O82A 3VBVA 4DGNA 2XM8A 3MVJA 3MS9A 5DN3A 5E90A 3HVCA 3LPBA 3EZRA 3MTFA 1OUKA 4PMTA 4AGDA 3A7GA 3GCQA 4TWCA 3OD6X 4YURA 2PMNX 2FSOX 3ERKA 4M13A 4I6FA 4R3CA 3SG9A 3FC2A 3SDJA 3QFVA 4NSTA 3RBWA 4D1SA 3LM5A 3KXMA 3F3VA 1S9JA 3PLAE 3CCNA 2OXXA 3FLNC 3IW5A 3RJCA 2WMSA 3OT8A 4L53A 2C6KA 2UV2A 4PY1A 4FTJA 3N4VA 1OPKA 3VBWA 4GUBA 5EYCA 3FI3A 4JR7A 2JC6A 2PZ5A 4KABA 5AP4A 1ATPE 3Q6UA 2UW9A 4QP4A 4LL0A 3KVWA 3EH9A 3DGKA 4DEAA 2JIUA 1M2RA 5ANJA 3FHIA 4FTMA 2CJMA 5ANOA 4C8BA 1SNXA 4BRXA 2GMXA 4X3FB 3HV6A 4IC7A 3RPOA 4FG9A 3G6HA 4CFMA 4XG8A 4IAIA 1PXNA 2PZRA 4XJ0A 2ERZE 2XNGA 4HYUA 4HVIA 1AQ1A 2UUEA 2OI4X 4NW5A 3ZRKA 4AA5A 5EM5A 3HLLA 3ORMA 2ITTA 1PXMA 3BHUA 4C4EA 1U4DA 4QO9A 5DEYA 4PWNA 4O7ZA 2WMUA 2QVSE 3R8VA 5HE2A 5EM8A 3VUKA 3PWYA 2GQGA 1HCLA 1FGIA 4BDGA 3MFRA 3HRFA 5DGZA 2JKOA 1YHWA 1Q24A 5HCXA 3BQCA 4A9RA 2FH9A 2YM7A 3UIMA 3RM7A 1QPJA 2R7IA 3RHXA 3K54A 3EWHA 3I6WA 3LXPA 2CGXA 3E64A 1Y8YA 3ORIA 4Q5HA 3V04A 3UNKA 4C59A 4DFUA 2FSMX 3PWDA 5CEKA 4QPAA 2BR1A 5I9XA 2HYYA 2O5KA 4QP3A 2JFMA 4S2ZA 4OTQA 4QP1A 5DT3A 4FSNA 4JRNA 1U5RA 2V5QA 2W05A 5HBJA 3R1NA 2PMLX 4BWXA 2BRHA 3VWAA 3AC3A 3S2PA 3QQLA 1Y6BA 1KUTA 4DG3E 1URCA 1FGKA 2RF9A 1ZYDA 2XBAA 3MTLA 4KIKA 2GS7A 4ZS4A 3TG1A 1GJOA 5M07A 2PMOX 4I23A 4Q9SA 4OTDA 1W82A 3TL8A 5A4EA 3S0OA 2WGJA 5HNIX 3QQKA 4XOYA 5L8KA 4R78A 3ULZA 2JKQA 4C33A 5L8JA 2YDKA 4HVSA 5DT4A 2DWBA 2Y8OA 3N51A 2EWAA 1PRYA 2C47A 2F57A 3FE3A 3CR0A 5CF6A 5GJGA 3FMJA 4IVDA 3BWJA 4BDIA 4QMQA 2W9FB 1OBGA 2QHMA 4G6LA 1FMKA 2ESMA 5FDPA 2RGPA 4GFMA 2IW6A 3VRZA 5C8NA 5L4QA 4ANBA 4D28A 3PP0A 3EQHA 4BI1A 4YPSA 2WELA 3HAVA 2G1TA 2WTWA 4UY9A 5A6OA 4FTTA 3TEIA 3W2QA 1L8TA 3ENHA 1Y6AA 3SV0A 3FYKX 2GTMA 1GZOA 4EH5A 1KE6A 2R3LA 2B0QA 2R64A 3I0OA 5FWKK 5TE0A 1OL7A 2H6DA 1O6KA 4Y85A 5IMXA 4FV9A 2IZSA 1XH8A 2IO6A 3NW6A 3N9XA 3FAAA 3QQUA 4M3QA 4RIOA 4YR8A 4QQCA 1RQQA 4RIYB 4D4RA 2PVRA 4QMVA 4CGAA 4OR5A 3IDPA 2OXDA 3CXWA 4YPDA 2XKFA 4FMQA 2XS0A 5LVNA 5JFVA 4MD7E 4AF3A 2WTVA 4G17A 4FV5A 1OKWA 2ZAZA 4NCTA 2PUIA 3POZA 4CCBA 1V1KA 3CTHA 3H0YA 3QTSA 3W2SA 4FEVA 2WO6A 3RP9A 1YXUA 3Q3BA 4IWOA 4ZJJA 3VHKA 1PYXA 4BCFA 4UMRA 4XX9A 3MY1A 3PZEA 3R83A 2R9SA 2RFSA 4HCTA 4RJ6A 3LM0A 4JS8A 4DTAA 3DOGA 2B9JA 4RIXB 3EQPA 4QTCA 4RQKA 2W5BA 4D2WA 2ONLA 3IECA 4JG8A 1O9UA 4O0SA 4FEWA 3P08A 1PHKA 4EJ7A 3VQHA 2CCIA 4OTWA 5FXSA 2QLQA 3NGAA 5DOSA 4M68A 3O51A 1MUOA 1UNHA 2PZPA 2GHLA 5FG8A 2C3IB 3G15A 1R3CA 4W8EA 2PYWA 2E9NA 4R7HA 3P7CA 2FO0A 4N4SA 5M09A 3O8TA 3B8QA 4F7NA 2PUUA 4YBKA 1GZ8A 3QX2A 1TKIA 3V5TA 3VBTA 4LMNA 3TV6A 3WYYA 4EH4A 1ZY4A 3CSVA 2E9PA 4O7SA 1H08A 2HW7A 4FT7A 2XYUA 4RJ4A 5CWZA 1SM2A 4GVJA 3R7YA 3D4QA 3UBDA 5K0KA 4B6LA 3QRJA 3HV3A 2C5YA 2P3GX 4QMLA 3R7EA 2IVVA 4P5ZA 3MH0A 2J4ZA 4RLLA 3EN7A 4AXAA 1H28A 1KOBA 4ZY4A 5A4TA 4KAOA 5F1ZA 4DCEA 1YRPA 5HQ0A 1A9UA 4LUDA 4GH2A 4GT4A 5HE3A 1V0OA 4QYHA 3ZLYA 4OAUC 3QA0A 3QYWA 2VTNA 4X6RA 4ZSLA 1A06A 3ET7A 2VTTA 3P79A 4I6BA 3CTQA 4NEUA 1PXJA 3BBWA 4YLLA 4JXFA 4AGWA 3TI1A 2Z2WA 1U5QA 4RZVA 3TV7A 3NR9A 4BR3A 4RC4A 3PJCA 4FTQA 3UZPA 4WSQA 4Y5HA 3M2WA 3O71A 4IQ6A 2OBJA 5TO8A 3ZO2A 4EK3A 3UYSA 4HGEA 4AGCA 3QXOA 4RFYA 4LRKA 4V04A 4G34A 3RAIA 4BTJA 4EWQA 2CLQA 3K3IA 4IEBA 4M69A 3ANRA 5E8TA 4QMWA 5TOZA 4BVUA 1VYZA 4IAZA 3VQUA 5FP6A 3WIKA 4AW2A 4B9DA 1SVHA 5K3YA 3QTWA 4RVKA 3T9IA 2HW6A 3COHA 3IONA 3PXRA 3BLHA 1G8AA 5M57A 3BCEA 1BI8A 2H96A 4LMUA 3VAPA 3ZO4A 2YLFA 3QTRA 3R28A 4WHZA 2B7AA 5IG1A 2CNUA 5BPYA 3Q52A 5KKRB 3EMGA 2X1NA 2XNPA 5AUTA 3QD0A 3AC5A 4YZDA 3Q9WA 4O0TA 5AX9A 3UODA 2XNMA 2HXQA 4PTCA 5DPVA 5DRBA 2Z60A 5ANIA 4CMTA 4BZOA 4CG9A 3C51A 2UVYA 1YI4A 1NXKA 3E8NA 4F6WA 2BFYA 4O22A 3UQFA 2P55A 3ORKA 4F99A 4X21A 5DBXA 1WVXA 5AR7A 1DAYA 3DU8A 4RFMA 3BYVA 3W8LA 3W32A 2BTSA 4EOJA 4C4FA 3KN6A 1V0PA 1U46A 3LZBA 4L8MA 5ETIA 4CD0A 1MRVA 4DH8A 3DAKA 3BHYA 4K9YA 4U0IA 3JVRA 3DZQA 4NT4A 2VO3A 5F9EA 5J7HA 4IB3A 2A2AA 2F7XE 2R3HA 2Z7QA 3QD2B 4M69B 4CZUA 4HCVA 3PJ3A 2ZV8A 4C3FA 5LXMA 2OF2A 2XB7A 2W1EA 4PTEA 2Y9QA 4HCUA 5JT2A 2BTRA 3FL4A 1OGUA 2WTKC 4PDSA 4G3DA 2IPXA 3MBLA 1J7UA 1H8FA 4IW0A 1E1XA 2FYSA 2E9VA 2QO9A 3FBVA 3FQSA 3GT8A 3POOA 4G3CA 4ZEGA 2GHMA 2OK1A 2XUUA 4P7EA 4IVBA 4AW0A 4BF2A 1JSUA 4O0YA 3ATSA 4ZSGA 2HZ4A 2C68A 4BGHA 2R3MA 3FZRA 3RWPA 4TKSA 2C6DA 4TTHB 4HZSA 4CRSA 3KK9A 2GU8A 3WBLA 1CSNA 3ZH8A 5L2IA 5JMSA 2WQNA 5DVRA 4FKOA 4UMPA 2UW3A 4I5PA 1OIQA 5EHYA 1W84A 3HP5A 3TNPC 3D9VA 4S31A 2X0GA 3C0IA 3C4CA 4Y72A 2W1FA 3DDQA 3W2PA 4RA4A 3U87A 5D11A 3VUHA 4C37A 5IA0A 5J95A 4L44A 4FSYA 3RHKA 3GOPA 3GU6A 4OAVB 4HVGA 1UWHA 3CP9A 3MPAA 3TV4A 4I22A 4KRCA 4TWPA 4XV3A 4NIFA 2WEVA 4AUAA 3M11A 3QTXA 3HAMA 3F6XA 3NYOA 4TWOA 3P4KA 4XP2A 4ZZMA 4LL5A 3W33A 4A07A 4MYGA 4BTMA 4H39A 5A54A 2WAJA 4EJNA 1OL1A 1KV1A 5CSWA 3NNXA 4XG3A 5CF8A 4V0GA 4OBPA 3O2MA 3CD3A 3NYVA 2RKUA 4CLIA 2Q83A 4H3BA 2WNTA 3SVVA 4U5JA 3NUSA 2J51A 2J90A 5JQ5A 3BU3A 3FDNA 4D2RA 1P2AA 4RX7A 1Q62A 3ORXA 2BKZA 5AR3A 4ZTLA 5BYYA 4GYGA 2I7QA 3G6GA 4TYIA 5BNJA 4IVCA 4QPMA 4D58A 3WZUA 4O7YA 1TQMA 3TKUA 2UZTA 4L42A 3OUNB 4DEHA 3NNWA 2J0JA 1OKYA 3DA6A 5EYKA 3FZTA 3BLRA 4E6AA 3ZFXA 2EVAA 5HO6A 2I40A 3HDNA 5B2MA 3R71A 2GNIA 1K9AA 2C6EA 3QCQA 5A4CA 3LMHA 1DAWA 3FSFA 4BDAA 5BVEA 5FEQA 4YU2A 2VUWA 2W96B 3ORZA 4CSVA 5GIPE 2VTMA 3LCTA 3UVPA 3TUBA 3SG8A 4PDPA 4XRLA 4WUAA 3RWQA 4F4PA 5GZ9A 4CEGA 2HZ0A 1YWRA 2BDJA 2YM4A 3H3CA 3FXWA 3D83A 3G0FA 3KULA 3P9JA 4Y83A 3QU0A 5J79A 4X0MA 2B9HA 3LXLA 1BL6A 3C5UA 4J1RA 4RFZA 2C0OA 3Q96A 4R3RA 3O8PA 1QMZA 1LEZA 4PMMA 4AN2A 3PPJA 1IASA 1BUHA 5LVPA 4TW9A 1GAGA 2BFXA 1HOWA 2YA9A 3TUDA 4AZEA 3M1SA 3QC9A 2Z02A 3A4PA 4NK9A 4F1OA 2C69A 5K9IA 4LYNA 5K4JA 4FV4A 3ITZA 1BLXA 4F9WA 4IDTA 2C5NA 1PXPA 1XJDA 1XBAA 5LCKA 4G3EA 2HY81 4RBLA 3ENMA 4MH7A 2IW8A 5FXQA 3DJ7A 1KWPA 3AMBA 4FSQA 1M2PA 1OKVA 2WQBA 4YNEA 2QR8A 4HGSA 3E8DA 4OTRA 3U54A 4W4VA 2JGZA 2A1AB 2VTIA 2CCHA 4IWDA 2PL0A 3F66A 4C4IA 2PUNA 4YLKA 4XRJA 3OW3A 1REJA 4FV1A 4G9RA 2X39A 3IS5A 4QQ5A 4GVAA 3BHHA 4XHKB 3CGFA 2BUJA 4ZJVA 5JFSA 4JG7A 5KZIA 5CEOA 5IUGA 4MWHA 4WBOA 1BX6A 4QMTA 1U54A 4FKJA 2SRCA 1Q61A 4IX5A 4S32A 4EH7A 5HE1A 2JBPA 4IAKA 4L7FA 1J1BA 5LMKA 5A4QA 2BDFA 3C0HA 3FMKA 4MKCA 4PDYA 4AW5A 4NWMA 4E73A 4TNBA 3L8PA 4BICA 3QD4A 2CGVA 3MH3A 2FVDA 1RW8A 4FTAA 4MNEB 5AV2A 5AV4A 3TM0A 2V62A 2R7BA 2KTYA 4FSRA 3MY0A 3CQUA 4KWPA 5E9EA 1QPCA 2W9ZB 5AX3A 3ZUUA 3I79A 3KN5A 1H26A 3LFQA 5I9VA 4ARKA 4LQMA 4FTCA 4RX5A 4JT3A 4MHAA 4XG7A 1UU8A 3ZBFA 3AGMA 1F3MC 4FTLA 4ALUA 1PJKA 1BMKA 3IW4A 3VW6A 1DS5A 5HE0A 4XCUA 1M14A 3G90X 3PXYA 3R00A 3UP2A 4BCIA 2QONA 4EOLA 3Q5ZA 3CS9A 1OKZA 2Y6MA 3CKWA 4G16A 3GC7A 4ZTHA 4YTIA 5LCJA 3QQFA 3GNIB 2X2MA 2OICA 3AXWA 5H8EA 3DZOA 2BRGA 4A7CA 2ZMCA 3KK8A 5HLPA 1Y91A 3QTIA 4W9WA 2VX0A 3QUEA 5KMIA 1WFCA 3O0GA 2CSNA 4XV9A 5EQYA 2W0JA 1YDSE 5EHLA 3MPMA 4ZZNA 5E8WA 5KMOA 5JK3A 2OKRA 4F7SA 1ERKA 4MNFA 3CBLA 4D2TA 4IX6A 5HVYA 4IZ7A 3RINA 4A9TA 4YTHA 4B8LA 3EQIA 3HMOA 2W4KA 3QUPA 4J98A 1KE7A 5IUIA 5EI2A 2GNLA 3MH1A 1IAJA 2YIWA 2BZHB 4ORKA 3A2CA 5A14A 3NMUF 4FIJA 1PMNA 1GIJA 1JQHA 2BHEA 3G5DA 4BC6A 1FVRA 4QTAA 2CN5A 4I5MA 3HMNA 3RAWA 3HMIA 4BIBA 2W4OA 2EXEA 2GDOA 1H1WA 3HP2A 3VUDA 4UYAA 3HDMA 3BELA 4FR4A 5EDPA 2A19B 5H8GA 5BMSA 4ZMFA 1SVGA 1STCE 2F9GA 4DTBA 5HU3A 3V8WA 3MVHA 1YQJA 4LRMA 3I1AA 2WQEA 3OBGA 2C0TA 1Q4LA 3P86A 4JR3A 3UVQA 2XK4A 4DFLA 4JBPA 3GC9A 3F69A 3ORPA 3QWKA 5C26A 4BB4A 4ALWA 2C5OA 4ZSJA 4RIWA 5AP3A 4O0UA 2V55A 5HESA 4B7TA 2BPMA 4F1TA 2C6LA 1FINA 3EL7A 2PMIA 4DGOA 4DLJA 3EIDA 4BCGA 4DINA 4BCJA 3HV4A 4YJNA 4D5HA 2Y7JA 3LXNA 3PFQA 5A6NA 3Q04A 3R8PA 5KNJA 1ZZLA 4GCJA 4XUFA 3LLTA 1WBPA 3F2NA 3L8SA 3PIYA 4FL2A 4IB5A 5CQUA 3ZO3A 4GFOA 4ASDA 3HECA 5H3QA 2QOQA 5EYMA 5HG7A 4AOJA 1XH6A 4XV1A 3R73A 3BV3A 3HV7A 5DA3A 1W8CA 2CDZA 5CAQA 5J5SA 2J7TA 4L6QA 4ZIMA 1WVYA 4M97A 3S1HA 3KRXA 2GQSA 2RL5A 4UALA 4D9UA 2A27A 3Q53A 1QCFA 4R7BA 5ACBC 5ANDA 3V5QA 3BKBA 4K33A 3MFUA 3ZHPC 3RPRA 1WBWA 5IF1A 5HTBA 1PF8A 4RLKA 3HKOA 4DITA 2XKCA 1H0VA 4UZHA 3PJ1A 2RFNA 1UNLA 5EOBA 5BUIA 2EXCX 4MBIA 2VU3A 2OJFE 2P2IA 3PYYA 5HX8A 4KA3A 4M12A 1YI3A 5DH3A 1H25A 3ZCLA 3WF7A 3OWKA 4A4OA 4V01A 2NRYA 5D1JA 4FKRA 2R0IA 1J3HA 3Q5IA 2XCKA 4XP3A 5CU0A 2GHGA 2PVJA 2OJ9A 2W99B 3D7TB 4M15A 4RWLA 3LFFA 3NW7A 5CLPA 3TZ9A 4CG8A 3OCTA 3KMUA 1O6LA 3PG1A 3AMAA 4RT7A 4MX9A 1OVEA 1JAMA 3HRBA 4BN1A 4G6NA 3FXZA 1J7IA 2FB8A 3R63A 4JDJA 5M51A 3QYZA 4EBWA 4YMJA 1NW1A 4G2FA 5FEDA 4ERKA 4EHVA 5B2LA 1JLUE 3FPQA 1KE8A 2NP8A 2HK5A 3QF9A 3VVHA 3ZEWA 2J50A 2PVFA 4NZWB 3RZBA 1QPDA 4K6ZA 2DYLA 4QYYA 3IK3A 3V6SA 4CLJA 4AFJA 4ANMA 4H1JA 4GV1A 3V5WA 3DK7A 1JWHA 3I60A 3WE8A 3MFSA 4KB8A 5T68A 5IH6A 5TR6A 4OLIA 2OJJA 3RMFA 2ITNA 4O7NA 1XH5A 1H0WA 3TTIA 4BZNA 3ZEPA 3O7LD 4GJ3A 5AUUA 3BBTB 2OXYA 3SC1A 1ZYSA 3LFEA 3D5WA 2PVHA 4UYNA 4BDBA 4QMYA 2JD5A 4I5HA 5C8MA 4BCPA 2PVYA 3VUMA 5LQFA 3E3BX 4FGBA 5KUPA 3KREA 2BMCA 4PP9A 4AA0A 3GFWA 4PL4A 3MJ1A 3VUGA 1Q8UA 2YLEA 3WILA 5AMNA 4DH1A 3FKOA 5A46A 4C61A 5HTIA 4AX8A 5AM6A 2J5EA 5HD4A 2ITVA 5GIOE 4EHEA 4FTIA 4I94A 5CT0A 2DS1A 4YZCA 1WVWA 3FI2A 3C4FA 3KC3A 4WT6A 2ZM4A 3G51A 2C6IA 3RNIA 2GNHA 1PKDA 5CENA 4DEGA 1H1PA 3F5XA 3GCPA 3FL5A 4G3GA 5IH5A 3ELJA 2OFVA 4WNOA 4FEUA 3TCPA 4BI2A 4TZRA 3FZ1A 3AC8A 3F5UA 3G9LX 1Q99A 3C1XA 5GZ8A 3G2FA 4EZ7A 5FM3A 3CJGA 3D5UA 3GEQA 3QBNA 4JJRA 2QO7A 4WD5A 4CZTA 4E93A 4D0XA 3EQGA 4QMNA 3NAYA 4IJ9A 3S00A 3EYGA 3A7HA 5EI8A 3KMWA 3FWQA 4MBJA 1OBDA 3FEGA 5FTGA 3E5AA 3QQHA 2WB8A 5AR2A 4C2WA 5HX6A 3MPTA 5ETFA 3EKNA 2FGIA 4U40A 3V01A 5M4UA 3ZTXA 3SW4A 5CSPA 4UWYA 3AC2A 3PVGA 3NUNA 4W8DA 1XBCA 2QI8A 2O3PA 4J97A 3HZTA 5FM2A 4RMZA 4EK4A 4RJ3A 1YWVA 3V5LA 1UU3A 4R5SA 4AE9A 5J9YA 1IR3A 5CY3A 2Y0AA 2W1IA 3NUXA 3MDYA 5IQCA 4IACA 4ZSEA 2Y6OA 1IRKA 2YN8A 2RIOA 3DQXA 2GFSA 4ZTQA 4PNKA 3EB0A 5IA2A 4NTSA 4UWBA 4X2FA 4C4JA 2C1BA 5T6KA 4BYIA 1R1WA 3BGQA 4IH8A 3AQVA 2ERKA 1ZARA 3CY2A 3OT3A 4IX3A 4O96A 4AWIA 3DB8A 2H34A 3T8OA 3WF6A 4GKHA 1NVRA 5B7VA 4L43A 3TZ7A 3SRVA 3L9LA 3ZUTA 3B2WA 4KIOA 3O50A 4TPTA 4WNPA 4BY9E 4FK3A 4R1YA 4IMYA 4EH3A 4FL1A 3ZYAA 4BTFA 5ICPA 2R3RA 4IWPA 4LV8A 1PY5A 4ZOGA 5E8SA 3U9NA 2IZTA 4II5A 3REPA 3RGFA 3F7WA 3QZIA 2PE1A 3ZOSA 3F3TA 4P90A 5F20A 4QMOA 4F08A 2RG6A 4FTOA 5L2WA 1VR2A 3P0MA 5AP0A 5TKDA 4YTCA 3G9NA 3TWJA 5I0BA 4FSTA 3PJ8A 5AA9A 3P78A 2XNBA 3I7CA 2F4JA 3B2TA 3Q2MA 2GSFA 4WIHA 4RIYA 3GBZA 2WMQA 5C27A 3VN9A 4KS7A 4DHFA 4Y8DA 3ZDUA 3VULA 3II5A 3EYHA 3UVRA 3F88A 1UVRA 4HYHA 4FG7A 2VGOA 4FNXA 4C02A 4I6HA 3D7ZA 4S30A 4FNZA 4PP7A 4JBQA 4N6YA 2IVTA 2JIVA 3ACKA 4I5CA 2R5TA 4AQCA 4DLIA 2ETRA 4U3YA 4XV2A 2OIBA 2QOOA 5I3OA 5IDPA 2UZOA 4X3FC 3DAEA 3SRVB 5IEYA 2CNQA 3IG7A 4DYMA 3DT1A 5CX9A 4BCQA 3EFLA 4JX7A 3UC4A 1HCKA 2IVSA 1P4FA 5HO8A 4EYMA 5HLNA 4AZSA 3PPKA 4RIXA 3U9CA 4QQTA 3MESA 2X7FA 3UMXA 5M53A 1T46A 3MY5A 4YSMA 3BPRA 2X6EA 3A62A 3E88A 5LWNA 2QURA 4LOQA 1F0QA 2IN6A 3BI6A 4LFIA 5EKNA 2XIXA 3LOKA 4JBVA 3OHTA 5CU3A 5FTQA 5AR4A 3MYGA 1AD5A 3GCUA 2P33A 4PV0A 2ITOA 2ZB1A 2UW8A 2R3QA 3HV5A 1M7NA 3AC4A 1ZYCA 4NM0A 3NIEA 3MJ2A 4C4HA 1TQPA 4E4NA 4WG4A 4GSBA 3NAXA 4K1BA 4KKEA 5E8ZA 4IIRA 1SVEA 4OTPA 4KBCA 4ZS0A 3QAME 2EUFB 2WD1A 2XCHA 3NS9A 4O1OA 3ZFYA 2HWOA 2WMAA 2VV9A 3NCGA 3CQWA 5CNOA 4DGLC 5FQDC 1IEPA 3W8QA 3DKGA 5C8KA 3ZSHA 5CNNA 2OG8A 1W7HA 1GY3A 3GC0A 3R7GA 3NVMB 3OC1A 3L8XA 1ZY5A 4XG6A 4MQ2A 3PXZA 4FOBA 4J95A 5FUTA 3FKNA 4AA4A 4NJ3A 5A4LA 4O7LA 3QRUA 3ALOA 2XRWA 4AT3A 4QMPA 5IQBA 2ZOQA 4ZJIA 2J0IA 3E8CA 3LCDA 4FKPA 2JDRA 4N70A 4QTDA 2R3FA 4U43A 2B9IA 5EFQA 5CAPA 3R9RA 4W4WA 3GENA 4AN9A 2R2PA 1OITA 3EQFA 3VS2A 4BL1A 4OBOA 4EYJA 5IH4A 5IQDA 2UZNA 3MIAA 1ZWSA 3O8UA 3R7OA 4TRLA 4C3RA 4JG6A 5IQAA 1YDRE 3KXHA 5CYIA 3FPMA 5BVKA 2IJMA 4EQUA 2XM9A 3JVSA 5AAGA 3NUAA 2VTRA 5IQFA 4KKGA 1M7QA 4GT5A 3CGOA 4D1ZA 2YAAA 1CKJA 3DPKA 4FX3A 2OH0E 4M66A 2OZAA 1FVTA 1OIYA 3PP1A 4LOOA 4NU1A 1YOJA 4UXLA 3EN5A 4XYFA 5CSHA 3EJ1A 4EH2A 2ZV9A 4BCKA 1IAHA 2ZMDA 4I4FA 3RPVA 4ANQA 3SW7A 2YWPA 5EQPA 5JZNA 5HVKA 4NFMA 4HNFA 1YHVA 4W9XA 5E8UA 3OEFX 2I0EA 4KS8A 5D41A 3UOHA 2W1DA 2F2CB 2YEXA 5AUXA 5CVGA 3F3WA 3FUPA 1R78A 4USDA 4DBNA 4IM2A 4EC9A 5L6WL 4EOQA 2C0IA 3EL8A 5BUEA 5CU6A 3FMNA 4NKSA 4FVPA 4EUUA 3E62A 4DFBA 4L9IA 2C5XA 2PVKA 2X8DA 4LV5A 2YFXA 2VWUA 4E1ZA 3LKMA 2QOFA 3BX5A 4L7SA 5ETAA 2PZIA 2IVUA 4EC8A 5J8IA 2YZAA 3LQ5A 2JLDA 4FZ6A 2RFDA 2OZAB 2YCFA 4NTTA 3VBYA 4UN0C 2I0HA 2WTKB 1MQ4A 4ITIA 4LOPA 1Z57A 4YO6A 2ZDTA 2GPHA 1ZRZA 3HRCA 3L8VA 4EL9A 2BHHA 1G5SA 2OZOA 1CKPA 3R0TA 4CMOA 3C4WA 3FLYA 3N4UA 3V6RA 2CHLA 2WKMA 3DBDA 4UMTA 5IKWA 3LFCA 4C4GA 4NCTC 1SMHA 3DQWA 3UG1A 4JDIA 5CAVA 5HIBA 4KKHA 4F65A 5HCZA 2W4JA 2W1GA 3GXLA 4QTBA 2R3JA 5H9BA 4RJ7A 4C57A 5DMZA 4EOMA 4PL5A 5AR8A 1KE9A 5E8XA 1VYWA 3FQHA 2VO0A 2XK6A 3DTWA 4U8ZA 2OIQA 4I20A 4ASEA 2R3OA 3R2BA 4IE9A 4UMUA 2ONLC 3RPYA 5G6VA 4IXPA 1MRYA 1CTPE 4QP9A 2YAKA 1B39A 5LVMA 3CLYA 5EM7A 4EH8A 4FG8A 5A3XA 1U59A 4BWKA 3ATTA 4WNKA 4YJVA 4KINA 4FTRA 4HPTE 3IDCA 4YUQA 4KBKA 4H36A 3E7OA 1YXSA 3EHAA 2VWXA 3NDMA 3VC4A 4AFEA 3R02A 4YTFA 2NNWB 3NVKI 4CT1A 4AP7A 2HZIA 4EOSA 4H3QA 2F7EE 4HGTA 3CKXA 2CNVA 5DNRA 4ITHA 4E8AA 1QPEA 5L2SA 3CE3A 5EI6A 5IPJA 5M4IA 2WTDA 5J7BA 1SNUA 3E87A 3R30A 4O7WA 5IMEA 4FV7A 1Q41A 3PY3A 4RZWA 5GJFA 4BHNA 5HTCA 4FK6A 3SOAA 3FSKA 4U44A 3VS3A 3KA0A 1FQ1B 4YZMA 4EZ3A 4E4XA 3VJNA 2KULA 5LOHA 4ZLZA 5KO1A 3HA8A 4IX4A 4APCA 1APME 4FV0A 5B2KA 4NH1A 4QP2A 2QCSA 4GK3A 1YHSA 2ZM1A 4FKWA 5EDQA 3S3IA 4C35A 3GP0A 1TVOA 2W5AA 3EFKA 3UQCA 4XOZA 4RX9A 3TACA 1OIUA
chains in the Genus database with same CATH superfamily
4BDJA 4MF1A 2WMTA 1UA2A 4R77A 4IANA 2FUMA 4E3CA 2REIA 4NM7A 3T3UA 4JNWA 2OU7A 4GG7A 5ACKA 1ZOHA 5AP6A 3VHEA 4Q9ZA 3D5VA 1WZYA 2C3KA 2PWLA 1XQZA 3U4UA 4IJPA 2X7GA 3KF7A 5D7VA 2PE2A 4D55A 4UMQA 4MQ1A 4Z55A 1W0XC 4ASZA 4P5QA 3DJ6A 3F9NA 2AEGA 4G5PA 1ZZ2A 4D2PA 4BDKA 3PA4A 4DT9A 3DTCA 4FSZA 3F5PA 3QZHA 5ANEA 3AG9A 3RAKA 3DBCA 5J1VA 5J1WA 4FV3A 3FI8A 4DF3A 3OTVA 4A9UA 3OP5A 4YO4A 2XA4A 4HW7A 3N4TA 4DCAA 4I0TA 2UW5A 4GIIA 4LI5A 2HY0A 3D15A 1K2PA 3QHWA 2B55A 2X81A 4BZDA 1OI9A 1DI9A 3BL7A 2ITUA 4QMXA 4J53A 4BWPA 1XKKA 1WMKA 2ACXA 1H1RA 2ZV2A 3WF8A 2YHVA 2OJIA 4ENXA 1SZMA 1PW2A 2BKKA 1CDKA 3ULIA 4DH3A 4DH5A 2BROA 3QCXA 4AT5A 4F9YA 4RVMA 2XIZA 3FMDA 4JIKA 3FMLA 4XG4A 1Z9XA 4Z9LA 1M2QA 5HG5A 3W16A 4GEOA 3Q6WA 4S33A 2BAQA 2BCJA 1W83A 4RC3A 2W1CA 2GNFA 5C01A 4I6LA 2HELA 2IEWA 2W1HA 3L9NA 2LGCA 4MNEA 5L2TA 3ZS5A 3T3VA 3KL8A 3QCYA 3F3UA 3A61A 2A0CX 4QYGA 3BLQA 3VJOA 2AYPA 4CZYB 4DHZA 2QKRA 2JAVA 4JDHA 3QX4A 1T45A 4AZWA 1RJBA 2YDJA 2J0KA 3MVLA 3K5VA 4F63A 3R01A 5AV1A 4EORA 2WPAA 1CM8A 3KCKA 5BX0A 3TUCA 3CEKA 4O2PA 4CFFA 4RWJA 4OT6A 2JDSA 3P7BA 5G1XA 2XRUA 3TXOA 4NUSA 5BVNA 4U9AA 3FXXA 2ITWA 5L2QA 4C38A 4PPBA 4DEDA 1P14A 3ETAA 2YIYA 4KSPA 4OTHA 5HVJA 4FIIA 5J9ZA 3MH2A 3WIGA 4HVHA 4O7VA 3LFNA 2O65A 4EK5A 3QGWA 2X8IA 4MWIA 2GCDA 3CTJA 2YABA 3F7ZA 4PL3A 1E9HA 2OH4A 3EQRA 3UQGA 3COKA 4LGHA 4CYIA 3R6XA 4GMYA 3C9WA 3TJCA 3I5NA 4PRJA 4H58A 4WNMA 4BDCA 5LVOA 4DHIB 4FV2A 2I0YA 4U6RA 4YZBA 5ITAA 2G9XA 4B4LA 5IEXA 5D9HA 4IM3A 1R0PA 4ONAA 2Y4IB 3OCBA 2XZSA 4AZVA 4BDFA 5LMBA 3HUCA 4O27B 3E63A 4DG2E 4FKUA 1G3NA 3DNEA 3MSSA 4O2ZA 3QGYA 3IW6A 1NT2A 3H0ZA 4DHJA 4O4EA 2BRNA 4J7BA 4J52A 3A8XA 3QTUA 5CEPA 2ZYBA 3WE4A 4F09A 1A48A 2QG7A 3GQIA 3NSZA 2OSCA 3LLAA 1OECA 4DA5A 4E6DA 5GNKA 2HENA 5C1QB 3HGKA 3OOMA 1YXTA 3TDVA 3OOGA 5AAFA 3R9DA 3RM6A 2E9OA 3QL8A 4PQNA 2P0CA 2JAMA 3CPBA 3NRMA 1Y8GA 4WKQA 5DR2A 5JRSA 4RX8A 5LARA 3ZUVA 1FBNA 4C58A 3PRIA 3AT4A 2ZFYA 2J6MA 3KEXA 1TQIA 3UIUA 1BYGA 3TIZA 4CFUA 4TN6A 3AMYA 4IADA 4XG2A 3FLSA 3DKFA 3C7QA 3P1AA 4IFCA 2RSVA 4WO5A 4DEBA 1L3RE 1NVQA 3IGOA 3KRRA 2BILB 5EHOA 4CFNA 3ZRLA 3R1QA 3BWFA 1H00A 4EUTA 2VTQA 3BEAA 5IQGA 5ANKA 1GNGA 3FLWA 3PRFA 5KMMA 2NPQA 2ZM3A 3PXKA 4R5YA 3LMGA 3UOKA 1J1CA 1EH4A 3VS4A 1Q8WA 1JKLA 3OBJA 3PIXA 3LIJA 4BCMA 4YC6A 3UNJA 3UC3A 4IHPA 3ROCA 3R8MA 1LEWA 4QNYA 5IEVA 3U51A 3O17A 5IA4A 4DFYA 4QOXA 2JFLA 5AP1A 2QHNA 2C6OA 3WZJA 3P5KA 3UDSA 2VD5A 5CTPA 4CRLA 1P5EA 2R3KA 3UIXA 4F9CA 2G2IA 3QCSA 5JFWA 2GFCA 2HAKA 3OEZA 5JGBA 3MB7A 3VS5A 2G01A 4OT5A 4UX9A 3SHEA 4APPA 4ZZOA 4KNBA 3WZDA 4DGGA 4AOIA 5DIAA 5BVOA 2UZWE 4BBFA 3NYXA 2EXMA 4BTKA 4PX6A 4DDIA 5C9CA 2AUHA 4YJUA 5L8LA 1OB3A 5GINE 4TYHA 3D7TA 3TDWA 2QG5A 1M17A 2VTLA 3CC6A 4M84A 5CU2A 4ANOA 3S95A 3BYSA 4QT1A 4G31A 4UB7A 5EG3A 4JRVA 3PJ2A 3PVUA 3IKAA 4P2KA 4E7WA 3SAYA 5CI6A 4KRDA 3HX4A 2O64A 4QYFA 2X4FA 2R3NA 5LMKC 3R2YA 3VNTA 4L3JA 3MI9A 5CXHA 2DUVA 1JKKA 4YJQA 3JY9A 3OF0A 2QR7A 2VTSA 3QRIA 4C0TA 5AADA 4U97A 5CSXA 2Q0NA 2XVDA 5FXRA 1ST0A 1XH7A 4FEXA 4DT8A 5JN2A 1G8SA 3PDTA 1PMEA 4RPVA 4MXZA 4ASXA 3AKJA 2V7OA 5DEWA 5AR5A 5BQ0A 2H9VA 5EYDA 2HCKA 5AWMA 4RVTA 4FV8A 4CFXA 5JQ8A 1H07A 4I21A 4FL3A 3DXNA 3OUKA 4LV7A 2WEIA 3R21A 4F1MA 2J0MB 4TYHB 1VJYA 3QTZA 5IA5A 4G3FA 4LGDA 2C3JA 3OMVA 4TYGA 4N57A 3D14A 1W98A 4QP6A 4Y46A 3KRLA 4BFMA 4K77A 2VWZA 4I24A 3OG7A 2C1AA 2OJGA 2UZEA 4CFWA 3ZONA 4L45A 5FD2A 5J9LA 5HORA 1JSTA 4ALVA 4MXOA 3DY7A 3LFSA 2R4BA 2WMBA 4F70A 2ETKA 3TNIA 4DGMA 5EH0A 4QEBA 3R1SA 2WFYA 3CQEA 3TKHA 5CU4A 5HG9A 3OS3A 4E5BA 4DG0E 2JBOA 2ZJWA 5JRQA 2XNOA 5AA8A 5KMLA 5KBQA 2B54A 3BU6A 4MXAA 2WU7A 4ZTSA 4YLJA 4A06A 3WZKA 4XBUA 5CAOA 2YIRA 3R9OA 2QO2A 1JKTA 2RG5A 4M8TA 2X4ZA 4O91A 5CT7A 3UJGA 3PE1A 4O81A 1KV2A 4AW1A 3DXPA 3GU7A 4Q5EA 2VZ6A 3EQDA 2ITPA 2J0LA 3C4XA 3TNWA 4DFZE 4EEVA 2YERA 5K5NA 1WBTA 4ANNA 3G33A 2PVLA 3D2KA 3DLSA 1LUFA 3O23A 4AS0A 2WXVA 2PHKA 4U81A 5HI2A 3SXSA 1LP4A 4TYJA 5IUHA 2WIPA 3A4OX 3K5UA 4FODA 4FEQA 4O0VA 2CMWA 5CEQA 2UW7A 2QOLA 4QDEA 2X2LA 5BV3A 4AZFA 4OTGA 2QU6A 5E7RA 1ZMVA 2WTIA 2Z7SA 3MFTA 4DDGA 5M08A 4E5WA 4YHTA 5EDRA 4DH7A 2WMXA 1JNKA 3R8UA 3VS6A 4IFGA 4X2JA 1ZYJA 1P4OA 4DC2A 4F6SA 2G15A 4GT3A 4BCHA 2IW9A 5CS6A 3UOJA 4ZY5A 3UIBA 2YIXA 4FSUA 5GJDA 1RDQE 1YDTE 1YXXA 1ZMWA 4NFNA 4FUXA 2X2KA 2XJ2A 1GIIA 1B6CB 2CN8A 3FY2A 3R9NA 3DLZA 4OUCA 5HLWA 2VTOA 3LMIA 1PMVA 2WQMA 4O83A 4G5JA 2GNJA 4QTEA 5DI1A 4FKGA 5CF5A 4NJDA 4ENYA 3AGLA 3DCVA 3VIDA 3KXNA 5M55A 4JQ7A 1UKIA 4MD9E 4RGJA 3QRKA 4GYIA 4X3JA 4Y73A 2BDWA 3RZFA 4ZSAA 1JPAA 3UZTA 3QD3A 1OGYA 3AD5A 3PVWA 1JSVA 3ZZEA 3R8ZA 5FGKA 4X2NA 1I09A 3BRBA 5AIKA 2VNWA 3ALNA 3GU4A 4F64A 1Z5MA 2YCRA 2ZV7A 3C5IA 5E4HA 4IBMA 4MBLA 5HBEA 3ZFMA 3GC8A 3CIKA 1PKGA 4F6UA 3MIYA 4EKLA 2ZDUA 3PPZA 4IAYA 1Q8TA 2ITQA 4PMSA 4F78A 5H8BA 3FMMA 2FSLX 3QLFA 3U4WA 2EU9A 3COMA 2YM5A 3QLGA 4I0SA 5EW8A 4Z16A 4FIHA 5EQEA 1FVVA 4FZFB 4YJPA 3OCSA 4B0GA 5K0XA 3ZO1A 3I6UA 4EWHA 3FC1X 4BDEA 3GUBA 1K3AA 4OBQA 3M42A 2DQ7X 4FIGA 1MRUA 1V0BA 1QL6A 5M56A 3QXPA 2FSTX 4OGRA 5E8YA 4O86A 2X6DA 3Q9YA 4CNHA 2JITA 2HIWA 2Z7RA 3OFMA 4QQJA 3FZSA 3LE6A 4J8NA 4QMUA 4RQVA 2WHBA 3QTQA 3LCSA 3BGPA 4FNYA 5F4NA 3ZDIA 5I9ZA 3JS2A 4GW8A 3EN9A 1JKSA 3E7VA 3TN8A 1NY3A 3W0MA 3U6IA 4D4SA 3KQ7A 4RC2A 4FI1A 4EBVA 2ZB0A 3NPCA 4HNIA 4QP7A 2R3GA 3AOXA 4TYEA 5KHWA 4JMQA 3LQ8A 1I44A 3EQCA 3DKCA 4AU8A 3JR1A 3E93A 4K2RA 1E1VA 4IM0A 3SGCA 3ZC6A 3L1SA 4A9SA 4MXCA 4BBEA 4L01A 4PUZA 4Z7GA 4QNAA 3RNYA 4AXFA 2XEZA 3JYAA 4FVRA 5IU2A 5AUYA 3TNHA 5AV3A 2E9UA 3OW4A 5KE0A 4QDVA 3BU5A 4BIDA 2VO6A 1XH9A 5DLSA 3BIZA 2YM3A 5EW9A 4DE4A 5CZIA 1XWSA 3DS6A 1VEBA 2OW3A 3F61A 4M0YA 4YC3A 1GIHA 4XNEA 3AKKA 5KMNA 4FT5A 3W2OA 5A9UA 4CCUA 4J99A 5F94A 3MWUA 1UU9A 3AT2A 5CZHA 2LAVA 3DKOA 1ZOEA 3QA8A 4F0GA 4PF4A 3NUPA 4AOTA 5JKGA 2GS6A 5DG5A 1PMUA 3MV5A 2X9FA 4GS6A 1UNGA 5HG8A 3PVBA 4GUEA 3DBEA 3C4ZA 1WBNA 4ZP5A 4ZK5A 3RCDA 2OLCA 3FLZA 1OPLA 4BKYA 1XH4A 2QKWB 3OROA 4R3PA 4GIHA 2B1PA 4O0WA 4RRVA 2XJ1A 5GZAA 3KCFA 3R7IA 4RWKA 2PK9A 3T9TA 3KRWA 2XKDA 3LCOA 5EK7A 5TT7A 3ROYA 3TKIA 3VW8A 3O5AA 3FZOA 3VS0A 4BI0A 3LFAA 4ZTMA 2PE0A 3IW8A 4BKZA 3DDPA 3GI3A 1BI7A 1W2DA 3PIZA 3UPXA 3QKKA 2UW4A 3BGZA 5T3QA 3IO7A 1IA9A 4KIKB 1VZOA 2C6TA 4IB1A 3ODYX 3PY1A 3LCKA 2C6MA 3H10A 2NRUA 2P2HA 4XP0A 3V51A 3A99A 3Q32A 4CKRA 2IG7A 3DV3A 4GFGA 4R6VA 5BYZA 3IDBA 4X6QC 5CSVA 2CGUA 2XNNA 3LXKA 3F3ZA 2YJRA 3IQ7A 3NIZA 4L00A 5FBOA 3FHRA 3JPVA 4F9AA 5HD7A 2GQRA 3U55A 5HOAA 2CKPA 4PPAA 2VNYA 4CKIA 2UZVA 4U45A 4BCOA 2UZLA 1CMKE 3KRJA 2J2IB 3QHRA 2BZIB 3OY3A 4XBRA 5I9UA 5HZNA 5I9WA 3LW0A 4GKIA 1H4LA 4E6CA 4NYEA 2Z8CA 2EB2A 2BAJA 2XNEA 3D0EA 3I0QA 5ETCA 4EONA 3CD8A 4IAFA 1UKHA 4CTBA 3V3VA 3QQGA 4IB0A 1Q97A 4ZAUA 3HL7A 2JDOA 3NZ0A 4X2KA 4ZXTA 4M0ZA 3KXGA 4ZLYA 4I93A 4MVFA 4MF0A 5EM6A 1GZNA 3THBA 4GL9A 4ACGA 3IGGA 2WOUA 3ML1A 3WF9A 4O6EA 4O4CA 4HPUE 3H9OA 2Z7LA 4G1WA 4MUQA 4FZAB 2YM6A 5CQWA 4TL0A 2P4IA 4IDVA 4WUNA 4J71A 2X0PA 1Q8YA 3OXZA 5HGIA 4XMOA 1WAKA 4Y5QA 4B8MA 4FZDB 5IA3A 3IW7A 3F2RA 4FGRA 2F49A 1DI8A 1OIRA 1YXVA 5TF9A 2XANA 4CTCA 2F7ZE 4USEA 3ZRMA 3FKLA 3PSCA 2XIKA 5HICA 4BHZA 2O2UA 5HKMA 2XAMA 3VF8A 4QD6A 4ITJA 4WRSA 4CXAA 3MVMA 2JEDA 4U79A 3ZU7A 5IDNA 2JDVA 5C03A 3BL9A 2ITXA 2XP2A 3ZXTA 5H2UA 3QWJA 4I92A 1YWNA 3Q4TA 4GJ2A 3Q2JA 4FF8A 4FC0A 4AT4A 3QALE 4K0YA 3OTUA 5BMMA 4R7IA 4FYOA 3PE2A 3W55A 1NA7A 2X7OA 3BE2A 3DFAA 4FICA 4JBOA 4TT7A 3RVGA 1Q3DA 3B8RA 3NCZA 3A7FA 4CV8A 3P23A 1X8BA 3Q4ZA 4LGGA 4XLVA 3S4QA 3UE4A 3NUYA 4E4LA 2BRBA 5AP2A 3A7JA 4D9TA 2RFEA 3SX9A 4K18A 4O6LA 5E8VA 5KHXA 1W2FA 4MXYA 1REKA 4M7IA 5D12A 3OWJA 1UV5A 3BYOA 2VTJA 4AXDA 4EOPA 4BKJA 2WMWA 3OWLA 1UWJA 4MK0A 2ITZA 3W1FA 3BYMA 1H27A 3TNQB 5E1EA 3ZLSA 3TIYA 4CKJA 5L3AA 3PUPA 2O63A 3DFCB 5CVHA 5LJJA 4USFA 4DBXA 2VWIA 5DRDA 4FA2A 2R3PA 4Y95A 4C36A 4FKSA 4AXCA 4E20A 4EQMA 1PYEA 3GQLA 3I4BA 2OWBA 3FY0A 3AT3A 1WBOA 4D2SA 4EHGA 2PTKA 3NEWA 3O7LB 2VN9A 5IQIA 1YW2A 4YC8A 3R7UA 1ZXEA 2WMRA 4MXXA 5FEEA 3PY0A 4RG0A 3RK5A 3VRYA 3SXRA 4TWNA 3FJQE 2W7XA 3WF5A 2CPKE 4FRFA 4UWCA 4D2VA 3LVPA 5BVWA 4UEUA 4DEEA 3UZRA 2VGPA 4QMMA 1UU7A 4O21A 3UO4A 3RK9A 1J7LA 3FMHA 2VWBA 4JAJA 3CPCA 4EHZA 2I0VA 2V22A 2XF0A 3EQBA 4O0XA 2OGVA 2OIDA 3K2LA 3NFGB 3F82A 3AD4A 2C3LA 3UO6A 1RE8A 2PPQA 3GCVA 1KSWA 3NNVA 4N0SA 3ZC5A 4AAAA 4NM5A 4XLIA 3TT0A 4ACDA 1JBPE 4YZNA 4GK4A 4YZ9A 1OUYA 3UMWA 2UZDA 3OXIA 2ETMA 3KF4A 4BBMA 4A4XA 2XJ0A 4YJRA 4FNWA 5KMJA 5DT0A 1R39A 3SXFA 4WA9A 2R0UA 2YISA 2QC6A 3DK6A 5DR6A 3RK7A 3WARA 3VBXA 5HNBA 1PXLA 3FV8A 3BZ3A 1FMOE 4D0WA 2F2UA 4CT2A 3OZ6A 4AG8A 3WI6A 4L3PA 5GHVA 4FKVA 4DN5A 3VUTA 5IQEA 2OO8X 4LUEA 4B99A 4FKIA 3UDBA 1ND4A 5DR9A 4QPSA 3FI4A 3A60A 4D1XA 3JXWA 1KOAA 3R1YA 4JVGA 3SLSA 3UG2A 4D4VA 3NYNA 5KKRC 3IOPA 1MP8A 2PVNA 2XK7A 4U7ZA 5DE2A 2AC5A 3EOCA 4F9BA 3LFDA 3PLSA 4FYNA 5C4KA 1XO2B 3JUHA 4XS2A 3W18A 1VLRA 3O96A 4YHFA 3IPHA 3HNGA 4O0RA 4N6ZA 3UYTA 2BVAA 4CFVA 1YKRA 1W2CA 4EOOA 1JOWB 1YI6A 2CKQA 2Y4PA 4HYSA 4CMUA 5JGAA 5BUJA 3UDTA 3I81A 5AFVA 4NL0A 2A4LA 2VWWA 1R0EA 3R04A 4JDKA 2XK3A 4OTFA 5K4IA 4AQKA 1B38A 2BRMA 2YACA 4YBJA 1S9IA 5HIDA 4O84A 1URWA 1KE5A 2BALA 1JVPP 3U6JA 4PTGA 2C30A 5KBRA 3DJ5A 2VTPA 3GU8A 3EKKA 3MA6A 3KFAA 3QKLA 2WZJA 4ID7A 4MTAA 3OVVA 1H24A 2W06A 3H4JA 2H8HA 2UW0A 3JY0A 4TY1A 3BHTA 5M4CA 3OWPA 3GB2A 4LRJA 4M14A 5E91A 2WTJA 4UBAA 2XYNA 4WG5A 4K8AA 4F0IA 5JZJA 3MN3A 3COIA 2WIHA 4AACA 2PSQA 2HXLA 2V0DA 1H1SA 2XKEA 3MGYA 3PXQA 5I4NA 4JI9A 4GK2A 4EOKA 3D2IA 5FDXA 4WBBB 3HEGA 3OCGA 2QODA 4I41A 4U41A 2CLXA 5I3RA 1OL2A 2VWYA 4E6QA 3BLAA 3ZSIA 5AP5A 5BVFA 5DYJA 2PUPA 4JX3A 4CVAA 3V5JA 2YITA 3DK3A 4O38A 2XALA 5JGDA 1BKXA 1YOLA 2XIRA 2E2BA 4D5KA 2XMYA 1IA8A 4BYJA 3LFBA 4AE6A 4NIFB 4AZTA 4C62A 5M06A 4FUYA 3RPSA 5AUWA 3FYJX 3P7AA 4PDOA 3E3PA 3SD0A 4PMPA 5L6OA 4KUJA 5C4LA 3ZXZA 5CANA 2BAKA 2VTAA 2UZBA 4L52A 5CF4A 3QC4A 3PA3A 4V0GB 5AV0A 4WOVA 3FLQA 3V8SA 4F0FA 4EZ5A 2HZNA 4J8MA 4GG5A 3MA3A 4FTNA 4ZLOA 3PA5A 4W4XA 3A7IA 3UP7A 3MW1A 3PTGA 1AGWA 3UO5A 5LMAA 2R3IA 5F95A 4ZTRA 4RWIA 4IC8A 2JIIA 3GCSA 4EOIA 4RSSA 2QU5A 1F5QA 1XR1A 3U8WA 4BGQA 3LQ3A 1WCCA 3Q9ZA 5EW3A 4G9CA 4HJOA 4ERWA 4PNIA 3ZLWA 4L68A 3UTOA 4TNDA 2B52A 2QLUA 2AC3A 5J5TA 4JLCA 1H1QA 2YWVA 3VBQA 1Q8ZA 3H9RA 3R8LA 4GU9A 3L9PA 2JKKA 3ZM9A 4U80A 2QOHA 1PXOA 2W17A 3NX8A 4ACCA 3EZVA 3GFEA 2XIYA 4NM3A 2XBJA 2YCSA 3I5ZA 3NWWA 4MCVA 2WOTA 4EKKA 5CXZA 2HOGA 3U6HA 2VRXA 1BL7A 2I1MA 3FQEA 4KD1A 3DXQA 1OM1A 4UXQA 4Z7HA 5FLFA 4KSQA 5AIRA 4FTUA 5AUVA 5CASA 3KULB 3AD6A 4MAOA 5CVFA 3QUDA 4FKTA 4OTIA 4I4EA 4U3ZA 3VF9A 3SOCA 5M44A 3DNDA 4IZYA 5ANGA 4GU6A 2X8EA 4YJSA 3QZGA 1LR4A 1OL6A 3L9MA 5CI7A 4YGAA 1OMWA 3EFWA 1PXIA 2PZYA 3R7VA 2BIKB 4MEDA 1MQBA 2OFUA 4GRBA 1ZAOA 3E92A 4P4CA 1LPUA 2B9FA 1ZYLA 2B53A 2BZKB 1Q3WA 2IWIA 3RCJA 2NO3A 5IISA 1OPJA 2UVXA 3TZMA 4IAAA 3SKCA 3WYXA 2BIYA 4FSMA 3RTPA 2O0UA 5HCYA 3OY1A 4QYEA 5D10A 3KKVA 5FP5A 3NLBA 3I7BA 4FIEA 5EOLA 4H05A 4BIEA 3SQQA 3H9FA 2X9EA 3VO3A 4FIFA 3G0EA 1PXKA 4J96A 4AGUA 2JKMA 4EK8A 3V5PA 4YNOA 5BVDA 2C5VA 4KIPA 4L46A 2VX1A 3D5XA 3KVXA 4A4LA 4C3PA 5FBNC 4CYJA 3DB6A 4NKAA 3UNZA 2O8YA 3D94A 3E8EA 5KZ0A 3VUIA 4E4MA 3F5GA 2ZVAA 3CY3A 4FZ7A 5HNGA 2VX3A 1FPUA 2J9MA 3ODZX 3RAHA 5JFXA 4BGGA 4TXCA 2UVZA 3GGFA 4F7JA 1XBBA 3ZM4A 4JAIA 3PG3A 3CJFA 4YJOA 2QNJA 2QOBA 1U54B 5LWMA 3EN6A 4DAWA 4CQGA 3PZHA 2EB3A 4DFXE 5E92A 4YP8A 1TZDA 3RI1A 4FKLA 5CEMA 2PU8A 3FZPA 4FKQA 4XEYA 4ANLA 3ANQA 3EN4A 1NVSA 4FV6A 4QMSA 3W2RA 5K5XA 5KCVA 5KMKA 2XARA 3V8TA 4O7TA 2XK8A 4RJ8A 3TTJA 5FRIA 2XH5A 2PY3A 4FBXA 3ID6C 3SA0A 2QD9A 2PULA 3NNUA 4HOKA 4IZAA 5FTOA 4C34A 2GS2A 3PXFA 4EK6A 2FA2A 1WBSA 4EH9A 3UPZA 5IA1A 4I3ZA 3KU2A 4L67A 4WRGA 2ITYA 2Y4IC 3QRTA 2IF8A 4U42A 5HHWA 5D7AA 5BYLA 4FTKA 4H3PA 3AKLA 4RJ5A 2CGWA 3PSDA 5B0XA 3HMMA 5DHJA 4ACMA 1OZ1A 2OF4A 4JOAA 4YJTA 3RKBA 4UZDA 4RVLA 3ZSGA 2JDTA 4FT3A 5CALA 3BYUA 3BHVA 4Z3VA 5HIEA 4LM5A 5AAEA 2WQOA 2W5HA 4BDDA 3BQRA 4WSYA 3LAUA 4FT0A 3UGCA 4KBAA 2G2HA 5EKOA 3QZFA 4IWQA 4I1ZA 3ZBXA 4H1MA 3HYHA 3W0QA 2GNGA 4IZ5A 4R8QA 1OL5A 4AN3A 4FE2A 3HMPA 1H01A 3IOKA 2YCQA 1ZMUA 2G2FA 5HEZA 4ZMEA 2HWPA 3Q9XA 4M67A 3C13A 2YM8A 4R1VA 2QOIA 2YJSA 1O6YA 4F7LA 4V05A 4QMZA 1SYKA 4JQ8A 4O1PA 5L6PA 3QKMA 2GTNA 1WBVA 3KY2A 3R22A 4FOCA 4C7TA 4DTKA 5I5ZA 3ZZWA 1GZKA 1IG1A 3GU5A 1ZLTA 3Q4UA 4I6QA 4Q2AA 4X2GA 3TZ8A 4ANSA 3TJDA 4I0RA 1CKIA 1Y57A 4UV0A 4HVDA 5JSMA 3TMOA 5E1SA 3QQJA 3FMEA 1XHAA 2I6LA 3ZLXA 4QP8A 4X7QA 4JIAA 3WZEA 4EI4A 4JL9A 3C50A 4E5AX 3F2AA 3WOWA 1J91A 5JH6A 3HA6A 3KGAA 1DM2A 4FVQA 2WTCA 3NW5A 4K11A 4KIQA 4XG9A 5I9YA 5AJQA 4DEIA 4WG3A 4ZY6A 3VS7A 3A8WA 1GOLA 2VWVA 3GVUA 3Q4CA 4RIWB 3LHJA 3Q60A 2YIQA 3ACJA 4FSWA 3R9HA 4EH6A 4JQEA 2VAGA 4HYIA 5AUZA 4PPCA 4ACHA 3ORNA 2W1ZA 2B4SB 4XH6A 3AC1A 2YZLA 2XEYA 2CKEA 2IZUA 2XK9A 2UZUE 4BCNA 4QRCA 5CEIA 4MD8E 5LVLA 4FT9A 3LJ1A 3ORLA 2QOKA 3KXZA 2UW6A 1ZOGA 3DAJA 3LJ0A 4HZRA 3DBQA 3RALA 2QQ7A 4DFNA 5KX8A 5CAUA 4E26A 2VTHA 5JEBA 4O7RA 2C4GA 3BV2A 3ORTA 4S34A 1YOMA 4IVAA 5J87A 1Q5KA 2WMVA 3HUBA 3C0GA 4YHJA 5DWRA 5AM7A 3ZMMA 1G8JA 2BZJA 2V7AA 3K3JA 4YSJA 1FOTA 2PVMA 5HU9A 4CV9A 3BEGA 4BDHA 5HO7A 2J5FA 4RA5A 3OXTA 5IZFA 2CKOA 2Q0BA 4C2VA 2IZRA 2WU6A 4HGLA 4W4YA 5M4FA 3MB6A 3GOKA 3KXXA 4A9YA 4L3LA 3W10A 3KMMA 3KB7A 3LJ2A 4ZTNA 5HBHA 1M52A 4D4YA 1YVJA 3W2CA 3DBFA 3NUUA 3PSBA 3C4EA 2VO7A 4OW8A 4LG4A 2QOCA 3EFJA 4NW6A 2YDIA 3H30A 3VS1A 4CQEA 4G6OA 5AP7A 5AEPA 3UOLA 4EQCA 3BE9A 3W0NA 4X3FA 5DFPA 4O82A 3VBVA 4DGNA 2XM8A 3MVJA 3MS9A 5DN3A 5E90A 3HVCA 3LPBA 3EZRA 3MTFA 1OUKA 4PMTA 4AGDA 3A7GA 3GCQA 4TWCA 3OD6X 4YURA 2PMNX 2FSOX 3ERKA 4M13A 4I6FA 4R3CA 3SG9A 3FC2A 3SDJA 3QFVA 4NSTA 3RBWA 4D1SA 3LM5A 3KXMA 3F3VA 1S9JA 3PLAE 3CCNA 2OXXA 3FLNC 3IW5A 3RJCA 2WMSA 3OT8A 4L53A 2C6KA 2UV2A 4PY1A 4FTJA 3N4VA 1OPKA 3VBWA 4GUBA 5EYCA 3FI3A 4JR7A 2JC6A 2PZ5A 4KABA 5AP4A 1ATPE 3Q6UA 2UW9A 4QP4A 4LL0A 3KVWA 3EH9A 3DGKA 4DEAA 2J