2Q0NA

Structure of human p21 activating kinase 4 (pak4) in complex with a consensus peptide
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
294
structure length
293
Chain Sequence
RVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PAK 4
publication title Structure of human p21 activating kinase 4 (PAK4) in complex with a consensus peptide.
rcsb
source organism Homo sapiens
total genus 95
structure length 293
sequence length 294
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2q0nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2q0nA01
2GDOA 2V55A 3LM0A 4NW6A 1IAHA 2XJ2A 5CT0A 3EKKA 4U43A 4BTKA 3ZHPC 3EQIA 4U9AA 2EUFB 3LLTA 4GK2A 3ZUVA 5CU6A 3QRUA 1XH7A 3MESA 3V5LA 1M2PA 2ZMCA 3VRZA 3POZA 5F9EA 3C0GA 4C2WA 4UV0A 3ZLYA 3VBQA 3ZONA 3UBDA 4G6NA 4GVJA 5HLWA 4ASDA 2QONA 4XV2A 4YHTA 5F4NA 5HBJA 3ACJA 4HGLA 1MP8A 4PX6A 2RFEA 3Q53A 4KIPA 5KNJA 4ZS4A 3LFFA 2PVKA 1FVTA 2HENA 5JFSA 1YRPA 3I81A 2XKCA 4UMUA 3UNJA 3AGMA 4KIKB 5C4LA 3FY0A 2ITVA 5HBEA 3BWFA 3K54A 4DBNA 4A4OA 4LMNA 2G2IA 3E93A 4DFNA 5CSPA 4NJ3A 4FV0A 3RPOA 2XP2A 2JBOA 3EN4A 2XIKA 1WCCA 2WQBA 3ZRKA 5JT2A 4BY9E 2B9HA 5EM8A 1P2AA 3WARA 2YWVA 3GQLA 2QU6A 4G2FA 2YJRA 2E9UA 5ETAA 3DK6A 3HDMA 2PUUA 3R22A 4JQEA 5CSHA 4F63A 3QTSA 3QHWA 2QOIA 3PIXA 4FVRA 2WQMA 5HO8A 5LMBA 4YJUA 4CLIA 5HO7A 3R8PA 3E8EA 4D2RA 4NUSA 4CG8A 4QMXA 4MBJA 4FSYA 4R3PA 4E4NA 4BRXA 4FTRA 4PQNA 1PW2A 4X7QA 3RNYA 2Y8OA 2JAVA 3FMDA 3ZM9A 5I9WA 2Z7SA 3GUBA 4EOOA 4TYHA 2B1PA 3GCPA 3FV8A 4ZSEA 3KGAA 4DTKA 4AAAA 4I22A 4ANMA 4C3FA 3R30A 4FV3A 5EFQA 3DBCA 2WMRA 5AUZA 3AC8A 1OBGA 2ZM3A 4Y85A 4FTCA 5FTOA 1FINA 4XRLA 1CM8A 3FLQA 2YCQA 2X9EA 2Z8CA 3PWYA 4O2PA 1MQ4A 2B54A 2VAGA 3BLQA 4BHZA 4F0FA 5IQDA 2Z2WA 3NNUA 4EQUA 1ZZ2A 3E8CA 3LFBA 1ZOEA 3ET7A 3M42A 4W8DA 1OITA 2XF0A 1Q24A 2XCKA 5A6NA 4IZ5A 3E3BX 4CZTA 3W2QA 3I0OA 3SW7A 3BYOA 3THBA 4BDIA 3TCPA 2HOGA 2REIA 3P0MA 2YIRA 3WIKA 4ALWA 2I7QA 3ALOA 2VWIA 3VW6A 4NJDA 3MY5A 1DS5A 2VUWA 4WNPA 1W8CA 4L00A 3R7OA 3UO5A 3F5UA 2WFYA 5IA2A 3WOWA 3GENA 2C5YA 1W83A 4APPA 2ZM1A 3ZO4A 3O7LB 5G1XA 5IQEA 3SHEA 4MTAA 4LG4A 1P4FA 4XX9A 4YC8A 4NU1A 3GU8A 4ANOA 4F1OA 2F2UA 2QI8A 2QOLA 3AT2A 1QCFA 3MY0A 4C4JA 2VTRA 2WMXA 3A7JA 1H26A 3KA0A 4D4VA 1GZ8A 4YP8A 4ZY5A 5LVLA 5HVJA 2J2IB 3JVRA 2E2BA 2WTKB 3MN3A 4XS2A 5AR2A 3ZZWA 4HPTE 4LMUA 2WMTA 3C0IA 3FY2A 2WPAA 1XR1A 5DOSA 1M2RA 3ZMMA 3ZTXA 3OTUA 1WVYA 2GTMA 2FSOX 2NPQA 4W4VA 2BTSA 4CRLA 2ITYA 4HCTA 3HAVA 3ZFXA 4ASZA 4GH2A 4BYIA 3R01A 5ETFA 3LQ8A 4GK4A 3CC6A 1OL2A 2OO8X 5E8SA 2W06A 3RTPA 3S95A 3KFAA 2XEYA 3PPZA 5LWMA 5C26A 4X3FA 2WEVA 1LEZA 1XBCA 4PP7A 4ONAA 4TRLA 2X8EA 4NH1A 5EK7A 3PSBA 3BV3A 2WD1A 1U54A 1JSVA 5E4HA 2HAKA 5AR8A 4QP8A 4M12A 2WMBA 2ZV7A 3R1QA 2UW7A 3CD3A 4G3GA 4YLLA 4D5KA 4J71A 2VO0A 1W0XC 4R1YA 1FOTA 2GQGA 4MHAA 5AUUA 3ULZA 5T68A 3CBLA 4H3BA 1T46A 4AQCA 5GHVA 2JIVA 3DTWA 4YZNA 5IQCA 4JG7A 1L3RE 1NXKA 1IA8A 2J0MB 3O0GA 4OT5A 4AS0A 5ACBC 4YTCA 4E1ZA 2WOTA 4HOKA 4LRKA 3HV3A 3ATTA 3F5PA 1UWHA 4L01A 3ZSHA 1ZRZA 3LQ5A 4J52A 4PPBA 2I1MA 2UZWE 5HNIX 4FNZA 4DA5A 4IAIA 3F82A 4RC4A 2UUEA 4HYSA 3MI9A 3PWDA 4AZVA 2QR7A 4G16A 4FEVA 2X7GA 4HNFA 1URCA 2GQRA 2BRMA 5IQGA 1R78A 4WSYA 2RG6A 4E8AA 2WHBA 3LXNA 3OWKA 4K11A 5AV3A 3T9IA 1MRVA 2JFLA 4IIRA 3F2RA 4S30A 2IW8A 2YAKA 4YO4A 4DINA 1O6KA 4FIEA 2C68A 5D12A 1PXOA 2ETMA 2XIYA 3R7UA 1Q8UA 4M7IA 4E5BA 3QTUA 3WF5A 5HU9A 5HTBA 4IAFA 4BI0A 5M08A 3IW5A 4IEBA 3A7HA 3IO7A 4BDBA 5KHXA 3NRMA 5FGKA 1H1QA 2VO3A 3AT4A 4MF1A 2RFDA 3DJ5A 4CTBA 4XV3A 5HCXA 1RW8A 2IZRA 3PY0A 3PXYA 4K8AA 4OTQA 2IW9A 4NYEA 3NX8A 3MVLA 4FKIA 4X0MA 3FE3A 3S1HA 3F9NA 4OR5A 4ZK5A 5FQDC 5K5XA 2JFMA 4RJ3A 5I3OA 4HW7A 3PP0A 2QOOA 2PUIA 4RWKA 4FYOA 5EG3A 2WMAA 1M14A 5BYYA 3F5GA 4I5PA 4U7ZA 3FKLA 4RIXA 4O7ZA 3KULB 3NYVA 4QNAA 4CVAA 3ZS5A 5HOAA 3Q04A 3F3WA 5CAOA 2PMNX 4LOQA 5A4LA 3BQCA 4X3JA 2ZDUA 3PTGA 5KMNA 5C8MA 3QXPA 4J99A 3DAJA 4BCMA 3BWJA 3FKNA 1LP4A 3OUKA 3LCKA 4GIHA 4KS7A 1Z9XA 2XKFA 3C4FA 3P79A 4ACGA 1OBDA 3G9LX 3MBLA 5HGIA 4QP3A 5JGAA 4UXQA 5ANKA 5I9YA 3PUPA 3UQFA 2H9VA 3D2IA 3ANQA 3PJ3A 4CMUA 1JKKA 4DHFA 4QPMA 5LVPA 1G8SA 2GHMA 4WUNA 3O8TA 4DEHA 5CENA 1Q8ZA 2EXCX 3OW4A 4YUQA 4YLJA 3UODA 3UYTA 2R3FA 5FXQA 4IFCA 4EOPA 2W5BA 4YZDA 4RSSA 4PTEA 5JKGA 3GEQA 3AD4A 4WOVA 4TT7A 4FSMA 4D2VA 3GU5A 4FBXA 4GJ2A 2C0TA 3MGYA 3QQLA 4HPUE 3QUPA 3QLGA 3IS5A 4MXXA 3SLSA 3KU2A 3ZRLA 3FI2A 4EUUA 3R83A 1OIQA 4BDEA 4KIOA 4IZ7A 4YZCA 4BBFA 3A8WA 4H1MA 4Q5HA 2CCIA 3TNIA 4N6ZA 4WT6A 4XV1A 3U51A 3L9LA 3ODYX 2VX3A 4O0VA 1PKDA 4FVQA 3EFJA 4JNWA 2UZOA 3GOKA 3LFSA 4IZAA 4TWNA 5D9HA 4F6UA 4Q9ZA 1EH4A 2BDJA 4O7NA 4I5MA 1VR2A 4UYNA 4O7RA 1YOLA 4CZUA 3I0QA 3A8XA 5EQYA 1GZOA 2VX0A 5EM5A 1UNHA 2C30A 1GAGA 4WSQA 3C4ZA 3R2YA 5A4TA 4H39A 3IOKA 3BBWA 2UZBA 3EIDA 4LOPA 5CVHA 5EI8A 3WZJA 4L53A 3R9NA 4CFNA 2GNHA 2XYNA 4FSWA 4JIAA 4M8TA 3UZRA 2W1FA 4BCHA 5AR7A 4YMJA 5AR3A 5A14A 5T3QA 3SXSA 3ORTA 4X2GA 2F7EE 2IVSA 2Y4PA 3PSCA 4IWPA 4IANA 4F64A 5LVMA 1M17A 5L2QA 3HZTA 4BDGA 4E3CA 3IGGA 4YBJA 2FYSA 4MXAA 4NFMA 3QD3A 4D4SA 3O2MA 1IG1A 1OL1A 2VWVA 5JGBA 2IW6A 2VU3A 2O5KA 3NIZA 3HMMA 4XP3A 3H30A 1XHAA 3ZSGA 3EQRA 2ETKA 4AT5A 3O7LD 4ZOGA 2Y4IC 1W7HA 5EI6A 4PDYA 1SNXA 3DBDA 1GIIA 3P4KA 3NAYA 4E7WA 5I9VA 3BELA 2NO3A 3LCSA 3QZFA 5AAEA 3DXQA 3C51A 3MB7A 5LCJA 4NTSA 4E20A 3OTVA 3OMVA 2JKMA 4IAAA 4IVDA 4QNYA 4BCQA 4PMPA 3ORLA 4EH6A 1DAWA 2A4LA 5AM7A 4EH2A 5BNJA 3O8UA 4PMTA 4AFEA 4DH3A 3TZ8A 5JZJA 1Q8YA 4YTFA 2OFUA 2EXEA 1B38A 2C5XA 3EQGA 5AP3A 4QP6A 4RLLA 3KRXA 5EYCA 3FMMA 5BVKA 5A3XA 1ZMUA 1XWSA 5IUHA 3HYHA 3P9JA 4OTFA 5HX8A 3EN6A 4YPSA 2VTMA 4FNWA 4BIDA 4DLIA 1KWPA 4R77A 1Q97A 3UOLA 3B2TA 4DGNA 2JGZA 4TKSA 4O1OA 4H58A 4BVUA 4S31A 5ETCA 2JDRA 3HX4A 5HG7A 4KBKA 3MFRA 4OTRA 4BZNA 4KBAA 3KC3A 3OVVA 3UYSA 5EW9A 5KMLA 2IG7A 4FKPA 3QXOA 5DEYA 1Q3DA 1IAJA 3OZ6A 3DS6A 4RIYA 4FT3A 5CI7A 4BHNA 3GFWA 4C3RA 5BYLA 4F0IA 2UW9A 2C5NA 3RK7A 4AT3A 1V0OA 5K4IA 2WZJA 4CZYB 4DFXE 5CSWA 1DAYA 2YISA 3LXKA 4BN1A 3AMBA 1NT2A 3QQHA 3N4UA 2FSLX 2BILB 2HK5A 3ZH8A 4C57A 3UOJA 4P4CA 4E26A 4QRCA 4JS8A 4NIFA 4D9UA 4J95A 3D5VA 4WA9A 4M97A 2JC6A 3HV4A 3C9WA 4BICA 3CE3A 3G6HA 3PA5A 5CZIA 2GHLA 3MB6A 3ORMA 4S2ZA 3O23A 4G9RA 4L46A 4GU6A 4NM3A 4NZWB 3GFEA 3ZFMA 3BHYA 3R0TA 5E8TA 3FAAA 4ZZMA 3TV7A 2UZUE 4A4LA 4G31A 2OF4A 1FPUA 4IM3A 5CX9A 3TWJA 3TUDA 4XMOA 2YABA 3VJNA 2W1EA 1JAMA 3RWQA 1PYXA 4C02A 4DYMA 4YSJA 5DR2A 2OZAA 4O7LA 3BHHA 1O6YA 2PL0A 2PVRA 2YERA 2JDOA 5HEZA 3OBJA 3W1FA 4E5AX 2R3JA 2VX1A 3EH9A 2QKWB 3MH1A 4QQ5A 4QOXA 3KY2A 3U6IA 1H28A 3QWJA 2C6EA 4KS8A 2FSTX 2X9FA 2XMYA 5IU2A 3F3TA 4PL5A 4CYJA 2ZV2A 3DQXA 5A4QA 3VNTA 2ERKA 1IASA 4NCTA 4M84A 4NEUA 3DCVA 2XRWA 2O3PA 3MJ2A 3TT0A 2OF2A 4ASEA 3ODZX 2CGUA 5AM6A 4MNFA 5AP1A 3COMA 3FXWA 2HW6A 2V0DA 3OCTA 1PXNA 3A7FA 3DXNA 2XNPA 4LV8A 4EOQA 4BCGA 4Z55A 5CF8A 3DKFA 4JX7A 5EI2A 2FB8A 3AD5A 3IW6A 5ETIA 3AD6A 5HNBA 4EH9A 1YW2A 3Q4CA 3MYGA 2B52A 3NR9A 4PNIA 3RPYA 2FGIA 4DGMA 4X3FB 1PHKA 1ZARA 3E3PA 3PJ2A 1R0PA 2E9OA 2OKRA 3GQIA 3LJ2A 2AC3A 3V01A 4FTNA 2BKZA 3DY7A 1H8FA 2OZOA 4GYIA 4UWCA 4E6DA 2X2LA 5HESA 4RIWA 4JBVA 3SXFA 4D2PA 2FH9A 3PVGA 2VTOA 2LGCA 4EWQA 4ZSLA 3D83A 4DF3A 1CSNA 2GNLA 4O83A 4MWHA 5KZ0A 2A0CX 3E62A 1YWRA 2XIRA 3GC9A 4UBAA 4AGDA 4EOSA 3NUXA 3G0EA 4JBPA 4C2VA 5E7RA 3G33A 5C01A 3U6JA 5J8IA 4M68A 4UMRA 2YM7A 4BGQA 3WZUA 1H0VA 4P5QA 4IAYA 5HQ0A 5KMIA 1H00A 3Q52A 3V8WA 5H8BA 1PJKA 3PXKA 4FTQA 5D11A 5AUVA 4C59A 2C0IA 5HO6A 4F6SA 4O7YA 4DN5A 5EHLA 3JY0A 4GG5A 3LQ3A 5FBNC 3C13A 4CLJA 4ANLA 4RZVA 3H10A 4OBPA 1CKPA 5FRIA 4CD0A 2YLFA 4ZY6A 1GY3A 4G6LA 4XH6A 2JKKA 3S4QA 3AC5A 3ZRMA 3UO4A 3VS6A 2VTSA 4C4EA 2AUHA 3KVXA 1OPLA 5BVNA 1Q41A 5KKRB 4U3ZA 2F49A 4AW1A 2YITA 2P55A 3WZEA 2CHLA 2YACA 4O38A 3FMJA 3QRKA 2E9VA 2BZHB 3MPMA 4WBOA 2BRHA 3EN9A 3I5ZA 3QQJA 3D0EA 4JBOA 5J1VA 4ITIA 4G3EA 2XCHA 3LCDA 3OWJA 3ERKA 4QTDA 1R39A 1SZMA 4BCPA 4DAWA 1RE8A 5F20A 1OPJA 4FKVA 3Q5IA 4U40A 3N4TA 3P86A 3MA3A 4QQJA 4AN2A 4F09A 3GP0A 4MQ1A 5AWMA 4I92A 3R9DA 2EVAA 2R7IA 1X8BA 4AN9A 4FNXA 4IZYA 4BDHA 4E73A 4F9AA 3OP5A 5HE1A 5BPYA 2Y0AA 2CPKE 2H8HA 3UVPA 4F99A 2Z02A 3ZLSA 4UMQA 3PIYA 4IH8A 5M4CA 2BDWA 3JYAA 4MH7A 5EQPA 3EMGA 3I5NA 5DA3A 3LMGA 2NP8A 3I6UA 2PVFA 4D4RA 3F3ZA 3QZGA 2C3IB 3NSZA 4DH7A 3FMEA 3SKCA 3OXZA 3QC9A 2QKRA 3CKXA 4EUTA 1LEWA 4F9BA 4OBQA 3CEKA 4CG9A 4QPSA 2WELA 5B2KA 5E8VA 3SA0A 3UIUA 2GS2A 4BZOA 4Z7GA 4M66A 2B4SB 2XH5A 5AV4A 1JWHA 3E5AA 3HV6A 3M11A 4YBKA 4R3RA 3ELJA 2R3IA 2W9FB 4FICA 3KF4A 5IQIA 5IG1A 3NYNA 1HOWA 5CF5A 5AX9A 2OJJA 3CXWA 2JKOA 1WVXA 3PDTA 4YJOA 1WBPA 4EZ3A 4I0TA 3VC4A 1KUTA 3OC1A 4QMSA 3UNKA 2QOFA 4J8NA 4GKIA 3R8UA 3FMHA 3KKVA 4W9XA 3MVHA 2XK3A 3OBGA 4L3LA 2O8YA 3IW8A 4OGRA 2W1GA 3N4VA 5A4CA 4KD1A 4PY1A 1WBTA 4X2FA 3GB2A 3PPKA 4CMOA 1E1XA 2A19B 4KKGA 5CSVA 4XG7A 5FM2A 5TOZA 3VBTA 4RFZA 4L6QA 4YJPA 2OW3A 5J9YA 4CYIA 5IZFA 4M14A 5FDPA 4QMNA 4FL2A 4GMYA 4P5ZA 2YIWA 3MTFA 2HZIA 4ZTLA 3OD6X 3GCSA 3EZRA 5HLPA 4O21A 1CDKA 4U5JA 5HE3A 3R00A 4X2JA 3GC8A 2JDTA 3PXFA 2WOUA 2Y9QA 5CVFA 4E4MA 2XKDA 3IG7A 3Q5ZA 4KB8A 3VHEA 4RJ5A 2YCFA 4LL5A 4YLKA 3R9HA 1P5EA 2GNIA 4K9YA 4WNOA 2PMIA 3CJGA 3FBVA 2EXMA 3W55A 4E93A 3K3JA 4O7TA 4LOOA 4WKQA 3HA8A 5IQAA 4OW8A 1Y57A 4V05A 4ZSAA 3FDNA 3D2KA 2R9SA 4FIHA 4IACA 4PDOA 4WUAA 4XOZA 1SNUA 2UVYA 4N6YA 3SVVA 4EYJA 4R7IA 4FL3A 1WAKA 1XO2B 1SVHA 5BVDA 2W1DA 2PVNA 4MX9A 3REPA 1Q5KA 3BE9A 3G0FA 4YHJA 3PXZA 1Y8YA 3HNGA 4HYIA 3WE4A 4C62A 3DKOA 4NKSA 3Q9YA 4S33A 3W18A 3NCZA 3SQQA 4FF8A 1TQPA 2I0EA 3A60A 4FSQA 2VWZA 2C1BA 1YXSA 2BALA 3VS1A 4DGGA 4KKEA 5J7HA 3D5UA 3UIBA 5M55A 4R7BA 2UZEA 2PZ5A 3Q4UA 4IDTA 3OHTA 3ZC5A 3OEFX 3HP5A 4JG6A 4CRSA 2CNVA 4U42A 3TNQB 4RA5A 2CN5A 4KIQA 1M2QA 5FDXA 4C8BA 3FEGA 4B8LA 3F3UA 2XK7A 5LMAA 4IJ9A 5AP0A 2BROA 4ZJIA 4GT4A 3V6SA 2W9ZB 3FL4A 1ZOHA 3TKHA 2YDIA 4G3CA 5D1JA 3FLZA 4TL0A 3D94A 4KNBA 4C38A 3R7EA 3DDQA 3E8DA 3R73A 1OGUA 4EZ5A 1FGIA 2J0LA 3UPZA 2PYWA 4MKCA 2QCSA 2C6IA 1UKIA 2G1TA 3DZOA 2UW0A 1TQMA 3IDPA 5CTPA 2XYUA 4RJ7A 1OIUA 1ZZLA 4ENYA 1JLUE 1KE6A 1QPDA 2AC5A 4AP7A 4IAKA 4KA3A 5CEQA 5LWNA 3OXIA 2OWBA 3NS9A 5E8UA 4FTTA 2PE0A 2QLQA 5HG9A 5L2WA 5IMEA 3RZFA 4LQMA 3AG9A 4A9SA 2PWLA 3ORZA 4Z9LA 3L8VA 4M69B 3TZ7A 3RINA 3KK8A 3BKBA 1WMKA 1U5RA 2X2KA 5JZNA 4ERWA 5GZ8A 2W1CA 3NUSA 4BGGA 4QQTA 3KREA 3JPVA 4IADA 3AXWA 3BYSA 3VUHA 5I0BA 5AR5A 4E4LA 1JNKA 4GU9A 1ZMWA 2OZAB 5KHWA 2W1ZA 4QMVA 2ITZA 3IPHA 1JSTA 4F7LA 2I40A 5KX8A 2ZAZA 1OI9A 5K5NA 4ID7A 3CR0A 3RZBA 3PY1A 4APCA 1H1PA 3DLZA 5FUTA 3ZO1A 1CKIA 3BRBA 1IRKA 4J96A 2WU7A 1ZY4A 3CCNA 4X21A 5HG8A 4LUDA 2WMQA 3QRJA 1P14A 4UXLA 4XRJA 5ANJA 2Z7RA 5JFVA 3CJFA 3ACKA 3G51A 3UC3A 4YURA 4GKHA 4AU8A 5DG5A 3PJ1A 4ANNA 5J5SA 2WQNA 1YDRE 4S32A 4QYEA 4D1ZA 2WTDA 5F95A 1W82A 1DI9A 2JEDA 4GW8A 4H1JA 4JI9A 3UVRA 3VUMA 4UWBA 1KE7A 3KRWA 1PMEA 5IKWA 3V04A 3HRCA 3ORPA 2XM8A 4K77A 5HZNA 5KCVA 3C5UA 5GJDA 4OTDA 5FD2A 5IUGA 3QTZA 3VS4A 4O22A 2OSCA 4H3PA 4II5A 4UWYA 3LIJA 3FMNA 4O0WA 2CGVA 4QYGA 4CFMA 3DNEA 1PKGA 4GT3A 4RIWB 4WG3A 2XNNA 3D5WA 3S2PA 2CKOA 1OB3A 2C6KA 3VRYA 2VTPA 4C4IA 4F65A 1MRYA 2P2HA 1B6CB 2X7OA 2XRUA 2W4JA 4W4WA 3SX9A 4F1MA 3QCXA 4O7WA 5M4UA 3BYUA 5C27A 4EHEA 5IQBA 2BFYA 2ETRA 3G9NA 5J9ZA 2HWPA 2XJ1A 2C6MA 3FZTA 3LPBA 4Y95A 3V8TA 3R7YA 4IB5A 3V5QA 2JBPA 3AOXA 3HMNA 4V0GB 4DLJA 2DWBA 3ZXTA 3BLHA 4C0TA 4XG8A 4Q9SA 4L7FA 5H2UA 4C34A 4XLIA 1JVPP 4GYGA 5CZHA 2IN6A 2GU8A 3WZKA 1PMUA 5BMMA 4LI5A 2ITXA 3E64A 3BU3A 5HIBA 3ZC6A 5A6OA 4FSNA 3U87A 2GS7A 4QMLA 2C5VA 4CCUA 1GJOA 4R78A 4AZEA 3SGCA 5D10A 4MBIA 5K4JA 2J0JA 3COHA 4YTIA 3UDBA 3EQBA 3Q9ZA 2VTIA 4IQ6A 4ZSJA 3R2BA 2QOQA 3Q4ZA 3FPQA 3BHTA 3F7ZA 4M67A 3D7ZA 3RWPA 5AADA 5IA4A 1OM1A 2BFXA 3C4CA 2KTYA 5DWRA 5EH0A 3SC1A 5AV2A 2IPXA 5IEXA 3DDPA 2CKEA 3MIYA 5EQEA 3WI6A 3R04A 4AACA 2WQEA 3D15A 4BIEA 3Q2JA 5D7VA 5DFPA 5EDQA 4BCJA 5IPJA 4QYHA 3Q6UA 4EBVA 4FEXA 4A9TA 2RSVA 1XBBA 2XNBA 3KF7A 4EI4A 2WMWA 4BTFA 5IH4A 4XOYA 2VWYA 3QZHA 1WBWA 4I23A 3ENMA 4MF0A 5M09A 3R1YA 3WF6A 2QU5A 4TYJA 2XKEA 4C33A 4JOAA 3UQGA 2W99B 4AT4A 2OJ9A 1Y6AA 2VN9A 3RM7A 2CKQA 2YHVA 4MXCA 4B99A 4HVSA 4J1RA 5DR9A 4TWPA 3R9OA 4DT8A 3NMUF 2OJFE 4I4FA 3QD4A 1ZYSA 3HP2A 4C4FA 2OH4A 2W05A 4BKJA 4ZTMA 3NW7A 3RHXA 3CTQA 5B7VA 3GU7A 2FSMX 4TYIA 5M44A 3U55A 4I6BA 1BUHA 3LFDA 4HGEA 5TKDA 3SRVA 3QBNA 3DK7A 4WO5A 1YI4A 3DU8A 1JPAA 4I21A 1F5QA 2BZKB 1OKZA 4J97A 2H34A 3BGPA 3FI4A 5HVYA 4MYGA 3WBLA 3MDYA 4MD9E 4U81A 2HZ4A 3NAXA 4KWPA 3GU6A 1URWA 3RAKA 2W4KA 5BVEA 3UE4A 2RFSA 2OXXA 3QQKA 4FC0A 4I94A 5A46A 3UMXA 4M15A 4ACCA 3HMPA 1YVJA 4AZWA 5CEKA 3RNIA 2EB2A 3PLSA 3ZSIA 5ANEA 5GIPE 5EOLA 3TUBA 2WMVA 2Z7QA 3PE2A 3FLWA 4CKRA 5GZAA 3NEWA 4JG8A 3O8PA 3EQDA 4XBRA 4GFOA 2PVMA 1REKA 2R3RA 3QA0A 2X8DA 4IJPA 1QL6A 5CU4A 3RK5A 3NCGA 3FQSA 5ANOA 2X4ZA 1YWNA 5HLNA 1IEPA 1VZOA 3D14A 1ZYLA 2BHHA 3NYOA 4UN0C 4J8MA 3CQWA 4FV5A 5HKMA 4Y5HA 2X39A 2BAQA 2ITQA 3DB8A 3BGZA 1CKJA 2YDJA 1U59A 5AIKA 1B39A 2W1HA 4OBOA 5H9BA 3DK3A 3FL5A 3LMHA 3QTWA 4I4EA 3PY3A 1H08A 2B9FA 2J7TA 4FZ7A 2DS1A 5L6OA 2RGPA 5CQUA 2UZNA 2JKQA 2XB7A 5I4NA 4P2KA 3FZSA 4EK8A 4QTBA 4CXAA 3IDBA 5CEMA 5DNRA 5KKRC 2C0OA 4EJNA 3CQEA 3HDNA 2ZYBA 5FM3A 5DPVA 4UEUA 1FQ1B 5L6PA 3PZHA 4WBBB 3CP9A 1F3MC 3TJCA 5ITAA 2R7BA 3EQPA 4B4LA 3AT3A 5BUEA 4AZTA 2HZNA 3T8OA 3W2PA 2A27A 2J5EA 4G34A 4NW5A 4HVHA 3HRBA 2F4JA 3C4EA 2QC6A 3H4JA 3V6RA 2VV9A 3U4UA 5CWZA 1OZ1A 4FTKA 1U5QA 4CEGA 3TDVA 4F9WA 4RWLA 1JBPE 4FKJA 4KSPA 1VJYA 2E9NA 2OU7A 5FG8A 3VS5A 1GZNA 3V5JA 4KBCA 4LV5A 5CY3A 3TNHA 3NUUA 3C4WA 1AGWA 4EH3A 4W8EA 1F0QA 5HTCA 2GNFA 3WZDA 3MFUA 3FHRA 4TN6A 3QGWA 5CEOA 2OXYA 4CTCA 3ZBXA 2VTQA 3CSVA 3N51A 4DFBA 2CCHA 3P7CA 2C5OA 2G9XA 4FTOA 4L3PA 4ANQA 4AWIA 5AP5A 4ARKA 2R5TA 4D1XA 4Z7HA 3TZ9A 4O84A 3PYYA 4AOTA 4OTIA 4BIBA 2BIKB 1GNGA 4IVCA 4IWOA 4NKAA 4A9UA 5CF4A 4QTEA 3K2LA 2PTKA 2ZOQA 1YHVA 2OGVA 2ESMA 4FKUA 1QPEA 2Q0NA 4X2KA 4GVAA 4ZTNA 1R0EA 4BC6A 4ZLOA 4QMTA 2I0HA 3FWQA 4GK3A 4FV7A 5EM7A 1J1CA 2PZRA 3RP9A 2WO6A 1HCKA 1XH6A 3SOAA 3C50A 3R9RA 1FBNA 3HECA 4GL9A 4C37A 2YZLA 2YJSA 5TO8A 4FTMA 4AA5A 4IVAA 3ZLWA 5GINE 4LGDA 5EOBA 2CMWA 3VAPA 5JMSA 3OCSA 4UYAA 2W7XA 3LJ1A 3KN5A 2WMSA 4FODA 1BL7A 3P23A 3CD8A 3LFQA 4BTMA 4TYHB 3VUIA 3BV2A 4K6ZA 4DTAA 3TJDA 2YM8A 1IA9A 5FEDA 3CIKA 3U9NA 2F7XE 4FEQA 3PIZA 5H3QA 4L43A 3UOKA 3ORXA 4KIKA 3DBEA 3G90X 1OPKA 5E90A 3GBZA 3F2AA 2BR1A 4RBLA 4YJQA 4FV9A 1JQHA 4FL1A 2RIOA 3RVGA 5M4FA 1PF8A 5EKNA 3AGLA 5J95A 3HMIA 3QUDA 4IC7A 5C4KA 3LOKA 2IZTA 3WF8A 2C69A 1UV5A 4PDSA 3V3VA 5AV1A 4IC8A 4DEDA 4IWQA 1BL6A 3U6HA 2R3GA 4XCUA 2UZVA 4ZIMA 4DITA 2Q0BA 4CKJA 3H9FA 3BU5A 4I41A 5C9CA 1KOBA 5F1ZA 2ITPA 2OH0E 2O64A 5EW8A 5AMNA 4ZLYA 4XNEA 3TZMA 3TXOA 4HNIA 3HEGA 4BCNA 2KULA 3K3IA 5IUIA 3G6GA 4RJ6A 5KMMA 1YOMA 5DYJA 4ZTRA 5L3AA 1WZYA 4FYNA 2J5FA 2XK4A 2PZYA 4A06A 4ITHA 2ITWA 3LMIA 2HY81 4O81A 3F88A 3TTJA 1LPUA 2QD9A 3DJ7A 4P90A 4F9YA 3IQ7A 4NL0A 4YZBA 2W5HA 4RJ4A 4NM0A 3QYZA 5BUJA 2WU6A 3LW0A 4PF4A 3CPBA 4YTHA 2ZB1A 2CDZA 3HA6A 3P08A 2OBJA 3QTIA 3I7CA 5AP2A 5FTQA 5D41A 2E9PA 4FT7A 4L8MA 3PJ8A 3TV4A 4NM7A 3KEXA 2Q83A 1I09A 2Y7JA 2P0CA 3DBQA 4NTTA 4XG9A 4RIOA 4RT7A 2VNWA 4CQEA 2BKKA 2RG5A 3P5KA 5CU0A 3E63A 3I4BA 4K1BA 3QALE 1R1WA 4KABA 4BTJA 4UB7A 3AQVA 1GIHA 4YJVA 4YNEA 5DN3A 1JKTA 5CANA 4AW0A 1G3NA 2I0YA 2R3KA 3HL7A 3QHRA 4IE9A 2XJ0A 5EKOA 2W17A 3FSFA 5GJFA 3RAWA 1KSWA 3AC1A 5HICA 4AW2A 3CPCA 1UU9A 1XH9A 2PVJA 1U54B 2UW5A 4O0XA 4BBMA 4B7TA 2UVZA 4EC8A 1O6LA 4HZSA 1RDQE 3HMOA 3RPVA 1SMHA 3HRFA 2UW8A 3FI3A 3GGFA 4HGTA 4ZTQA 3W2CA 4BZDA 4RJ8A 4ALVA 3W2OA 4NM5A 3NUYA 2ERZE 1H1RA 1Y6BA 3B8RA 2HY0A 4FZDB 5KE0A 4JAIA 3VUKA 2QG5A 4NFNA 5L8LA 3E7OA 4HCVA 3VBYA 4FV1A 3H3CA 3MVMA 1NW1A 4FSRA 1UKHA 5J1WA 4EK6A 3QZIA 3Q9XA 2BRBA 3R7GA 3DV3A 2J0KA 3CKWA 3FZ1A 2VGOA 5KMKA 4R6VA 2PMLX 4RX9A 2X1NA 3BBTB 4IM0A 3RMFA 3IK3A 1OECA 1H27A 1UA2A 1Z57A 2OK1A 2XK6A 2C4GA 3MH0A 4C35A 4QP7A 3L9PA 3RHKA 1ZXEA 3LFEA 2HW7A 4QYFA 3HV7A 4I6HA 5JFXA 2JD5A 2R3QA 3R6XA 4FK6A 2CJMA 4FV2A 4N4SA 4QTCA 1H1SA 1H1WA 2WTJA 2X7FA 3LFAA 4DG2E 4ZAUA 2R3PA 4MXZA 4H3QA 5BX0A 5JRQA 1O9UA 1UVRA 4G3DA 3TACA 4D1SA 4PV0A 3S00A 3QX4A 1BYGA 3RCDA 4CFUA 4QP2A 4LRJA 5CQWA 3ZEWA 5KMOA 3KN6A 2PVLA 2WTVA 3OW3A 3SXRA 3GCUA 5J9LA 3QCSA 4OT6A 2JITA 2P4IA 3F3VA 3QTQA 2QOHA 4FKGA 4EHVA 2YM5A 3C0HA 3EB0A 2J51A 3V5TA 4YPDA 4O86A 3H9OA 4KINA 4GCJA 5HCYA 4DEEA 3FPMA 3R63A 5DBXA 4HCUA 3DLSA 3VS3A 3TIYA 5BVOA 4QMQA 3UIXA 4YZMA 5GIOE 2YM4A 4FZ6A 3S3IA 5TE0A 4ORKA 1GOLA 4HYHA 2QR8A 4J7BA 3TN8A 4QP4A 3IGOA 2G2FA 3A7IA 3PXQA 1NVRA 4NCTC 4RVKA 3UC4A 2PPQA 3WILA 4CGAA 3GT8A 3DT1A 2W96B 4RIXB 5E1EA 3FLYA 2PE1A 4FKQA 4KAOA 4FT5A 1ZLTA 4XJ0A 3I6WA 5CALA 3NNWA 3ORKA 5IA5A 4ACMA 5I9XA 2F57A 3Q96A 4EZ7A 4RPVA 5AAGA 3FZOA 1BLXA 3O50A 3SOCA 3UNZA 3NWWA 3PVWA 4GUBA 4AGCA 1ZY5A 1PXKA 2WTKC 2RKUA 3NUAA 2QO2A 3A7GA 2BUJA 2ZV9A 3B2WA 4MWIA 4JLCA 5EM6A 4BWKA 2YDKA 4YSMA 4L7SA 3RI1A 3QRIA 2WKMA 3KMMA 3QGYA 4UY9A 5LQFA 4RG0A 1OIYA 1T45A 2J0IA 4I24A 1WBSA 3MPTA 4JX3A 4TXCA 4EK5A 1K2PA 5IA0A 2OFVA 3KMWA 2J6MA 3E8NA 4G5PA 3TKIA 4U41A 2OICA 4AE6A 5AAFA 3OOGA 5E8ZA 2ONLC 4R8QA 1JKSA 4CV9A 3L8PA 4Q2AA 5CEIA 4AX8A 3CS9A 4RC2A 3KULA 2WTWA 4BCKA 5LOHA 5M56A 4GJ3A 2WIHA 3LXLA 1E9HA 2O2UA 5AP7A 3R7VA 3ETAA 3P7BA 3CY3A 1WBNA 3L8XA 4I0RA 4MNEA 4QT1A 3WYXA 1HCLA 1OKVA 2WIPA 4EOKA 2VD5A 1QMZA 4V04A 4CCBA 3FC2A 2CNQA 3UGCA 2GPHA 3M2WA 3AC2A 4FNYA 3PPJA 3L9NA 4FKRA 4FTIA 4QMYA 4WRSA 4EOIA 2BDFA 2R4BA 4FEUA 3NIEA 5HVKA 1KOAA 2BHEA 2GHGA 4PUZA 1R3CA 5K0XA 4IB1A 1W98A 1OIRA 4AOIA 1V0PA 3P7AA 2R0UA 3TIZA 4L44A 4QMPA 1XJDA 4QYYA 1YOJA 1J7IA 3G2FA 3OF0A 4WIHA 1ZYCA 3RM6A 3W32A 5EHOA 1SVGA 2WQOA 1ZYDA 1TKIA 1V1KA 4O0SA 4B8MA 3JS2A 4U80A 4WNMA 4ACDA 3OT8A 1A48A 3QQGA 4AE9A 3PA4A 5E8YA 4EBWA 3FXXA 2VTJA 3UP7A 3BX5A 4M0ZA 4AFJA 5CAQA 4F7NA 3EQFA 3MJ1A 2X6DA 2ZVAA 3ZCLA 3NUNA 1FMKA 4ACHA 5JH6A 3DQWA 4EJ7A 1STCE 4TYEA 3I60A 5GNKA 4BF2A 4RGJA 5CXZA 5DIAA 1E1VA 2R64A 2YM3A 4ALUA 4L45A 3COIA 2G15A 3F7WA 3DBFA 1Q99A 4O0RA 2IVVA 1CTPE 4XLVA 3VW8A 4USEA 3P1AA 4RVTA 4K0YA 4FZAB 4IDVA 2IVUA 4MQ2A 4C58A 2R3MA 4FIGA 3KXHA 3VIDA 5HCZA 5IF1A 1M7NA 2B9JA 3EL8A 3R8VA 4FKTA 1JOWB 1PXPA 3FUPA 1XH4A 5E8WA 4AA0A 3E88A 5AP6A 3VO3A 2XBAA 3CY2A 4QMMA 2GTNA 4U8ZA 3ID6C 1BMKA 5CU2A 1CMKE 4EH7A 1OKWA 2XNMA 3QU0A 4GFGA 4M13A 3MY1A 4XBUA 5L8JA 4JIKA 4EKLA 1WVWA 4EONA 3RJCA 4OUCA 4YGAA 5LJJA 1PY5A 2ITTA 4DG0E 4FGBA 5DMZA 2XVDA 4U97A 4F0GA 2XNGA 4OTWA 1RQQA 4TNDA 4B9DA 5B2MA 4FKOA 4XP2A 3LLAA 3DAKA 5JN2A 4L68A 2ITUA 2UW6A 1YWVA 3D7TA 4QP9A 4XG4A 5HG5A 3RPSA 2EU9A 2HWOA 4YU2A 5F94A 4MVFA 4JDJA 4P7EA 4IW0A 5TF9A 3TV6A 3TUCA 3OT3A 3KRJA 3TI1A 4W9WA 4EWHA 2XUUA 3LAUA 4ZZNA 4FEWA 1KE8A 3EFLA 2R0IA 3PXRA 4RIYB 4ZXTA 4BWXA 1WBVA 2GFCA 5HE2A 5BVWA 3C1XA 4LUEA 1YXXA 4BR3A 2YIYA 4PL4A 4BDCA 3GCQA 4QO9A 2J50A 2RL5A 1S9IA 4FZFB 5DT0A 3R8LA 3OS3A 3QRTA 4NIFB 1WFCA 5HBHA 4FTJA 4LRMA 2YCSA 3LCOA 3LFCA 2BIYA 3QLFA 1U46A 4PWNA 4AXAA 4D0XA 5J79A 3OCGA 1OUKA 1I44A 3GNIB 3Q3BA 4WHZA 2VO7A 4GRBA 5CSXA 5M06A 3ANRA 3TL8A 2PSQA 4TY1A 4DFYA 4YJRA 3W2RA 3E7VA 1H01A 2DYLA 4JDKA 3V5PA 3QKKA 3T3VA 1PXJA 3ZU7A 2Y6OA 4ITJA 3HAMA 4RA4A 1K9AA 2BRGA 3S0OA 2VTAA 3QQFA 2G01A 2XK8A 3H9RA 3VUDA 4B0GA 4O0YA 3O96A 5IH5A 4XG6A 2BAJA 5LMKC 3Q6WA 3H0ZA 2XIZA 3VS0A 5DGZA 1OUYA 2G2HA 1DI8A 4RWJA 5E8XA 3RGFA 2F7ZE 2OJGA 5I9UA 3T3UA 4O6LA 4YC3A 5AP4A 5ANGA 2HIWA 3BLRA 4WNKA 4FA2A 3MTLA 2RFNA 5CEPA 4DFZE 3MV5A 5FP5A 4PPCA 4WD5A 3VJOA 4X6RA 1KV2A 5AUWA 3SV0A 4BL1A 4MD8E 3UVQA 2QLUA 3GU4A 3V5WA 2XNEA 3FC1X 4G5JA 1YXVA 4AA4A 3ZDIA 3Q2MA 3RAHA 4A4XA 3QCQA 3CTHA 2BCJA 5DT4A 4L3JA 4Y46A 1YDSE 2QHNA 5CNOA 5L2IA 4IX6A 2J4ZA 3MPAA 4XYFA 3OG7A 3ZO2A 4Z16A 4ZTSA 3Q60A 3QTXA 3ZUTA 1OMWA 3DKGA 3V8SA 4HZRA 3R1NA 4U79A 4EK3A 5HTIA 3TTIA 4QMUA 5FTGA 5H8EA 4YJNA 2DUVA 5FLFA 3NUPA 1OKYA 1DM2A 4ZP5A 2UW4A 4PPAA 4I5CA 4WG4A 2B7AA 5LCKA 3I79A 5TT7A 3PVBA 3VHKA 2YM6A 5CNNA 5A54A 2CGXA 3DNDA 4W4YA 3VS2A 1LR4A 1QPJA 4J98A 4MEDA 4O0TA 4PTCA 3W33A 3ZO3A 5I9ZA 2VGPA 1XH8A 5IEYA 3AC3A 3K5VA 3E87A 3OY3A 3UPXA 3SW4A 2B53A 3OWPA 4UZDA 5FXRA 5M53A 4MXYA 3EN5A 2PHKA 3BI6A 3EFKA 3F6XA 3KQ7A 1YHWA 5DEWA 2WB8A 3VUTA 3PZEA 4DC2A 1FGKA 3HLLA 2PMOX 3UJGA 4IVBA 2YZAA 3OFMA 3QAME 4LFIA 4PL3A 2ZB0A 5IDPA 2AYPA 4EHZA 5DVRA 2QODA 3FMKA 4KRCA 2GS6A 3LE6A 5C8NA 1SVEA 1ZMVA 4BDFA 4HYUA 4QP1A 3U4WA 4F4PA 2XM9A 3OEZA 3R8ZA 3SG9A 2YFXA 4GSBA 3BPRA 5TR6A 5AEPA 3DXPA 3MH3A 4DE4A 4IM2A 3EQCA 5BVFA 4YC6A 3IDCA 5IMXA 5I5ZA 5KUPA 1J91A 3N9XA 3OUNB 3MH2A 4JRNA 4O91A 4YO6A 2HCKA 4XG2A 3BE2A 2RF9A 3PJCA 4FSUA 5J7BA 5KBRA 5KO1A 4ZMEA 4L9IA 3KRRA 5C03A 3KXGA 2WXVA 3EHAA 1OVEA 4U0IA 3DJ6A 4D2SA 2IWIA 4ERKA 4YHFA 2IZUA 3OCBA 5ANDA 5IQFA 4FIIA 4ZMFA 3KVWA 3OOMA 5M07A 2X0GA 4UALA 5IEVA 3ITZA 3PFQA 3I1AA 3Q9WA 4QMOA 4YJSA 4JDIA 3QCYA 3ZZEA 5M57A 4TTHB 2PUPA 5JRSA 1IR3A 3D4QA 4S34A 2PY3A 2C3JA 4O27B 4ZJVA 1U4DA 1PXLA 4KUJA 4RQKA 2JIUA 2FVDA 1APME 2QVSE 3BHUA 3KXNA 4O96A 5CYIA 2VWUA 3O17A 3TKUA 1PYEA 4D4YA 4DH8A 2CNUA 4X2NA 3NLBA 4BDKA 4ZEGA 2C3LA 1XBAA 3OWLA 5CU3A 2VTLA 3EOCA 3KMUA 4U45A 4AG8A 4CT1A 2ZJWA 1J7LA 3U9CA 2HXLA 2R2PA 4ASXA 3HUCA 4I93A 4EYMA 3G15A 2V7AA 3PG1A 4OAVB 4FT9A 1YQJA 5AV0A 3BGQA 4AN3A 4MCVA 3NZ0A 4FSTA 3DFAA 2PVYA 3BZ3A 2WEIA 3KK9A 5DR6A 3DKCA 2NRUA 4WG5A 4AF3A 3ZBFA 3LVPA 4ENXA 5L2TA 4FGRA 3MIAA 3OROA 4FSZA 4FVPA 4U44A 3JY9A 3MFSA 3FJQE 3MS9A 2R3LA 4X3FC 3UOHA 4BWPA 5C1QB 4IX5A 4G9CA 5DRBA 3U8WA 2QURA 4F9CA 4FG9A 3VVHA 1BI7A 2W1IA 4D28A 2CN8A 2XBJA 2BZIB 2P2IA 2QO9A 3A2CA 4E5WA 2IO6A 4U6RA 4BCIA 3ZLXA 4N70A 3KB7A 2QOBA 3A4OX 4Y5QA 1REJA 4J53A 5AX3A 5LARA 4EOMA 4O7SA 3BHVA 4MNEB 4FUYA 1KE9A 1MUOA 2VWBA 4JRVA 4I3ZA 3DFCB 3BU6A 4FV6A 5DI1A 5ICPA 1Q8WA 4JBQA 5IQHA 4AGWA 3PP1A 5T6KA 1SM2A 1L8TA 2QOCA 4YZ9A 2ZV8A 4GFMA 3RPRA 4EHGA 5HNGA 3AMAA 3WF9A 5A9UA 4JR7A 4JVGA 1XH5A 4BCFA 3RCJA 5CASA 5GZ9A 4Z3VA 5DH3A 1TVOA 4K18A 4LGHA 4EQMA 1XKKA 4IAZA 4PNKA 1J7UA 3FXZA 3CGOA 5L4QA 3QX2A 3F61A 5HE0A 3ZDUA 1ATPE 3R7IA 2YN8A 2UW3A 4O82A 3VN9A 1RJBA 2WAJA 4L42A 3A62A 4X6QC 2R3OA 4G3FA 2V62A 1NY3A 4NSTA 4YJTA 5E91A 4G17A 1W84A 3II5A 2OJIA 1M7QA 4BI1A 4RX8A 1Q62A 3IOPA 4ZSGA 2C6LA 4BBEA 5AFVA 2QG7A 3QFVA 3TM0A 4BYJA 2V7OA 5B0XA 2UV2A 1H07A 4BGHA 4RX5A 5L8KA 5CLPA 4F70A 5EYMA 5JFWA 3JVSA 3RALA 3V51A 4R7HA 4D5HA 5AIRA 2NRYA 2UZTA 4FE2A 3EWHA 1GIJA 3F2NA 4FT0A 4N0SA 3VUGA 3GC0A 1OL7A 4LGGA 4CNHA 1S9JA 1UU7A 3ROCA 4ZY4A 4W4XA 4IWDA 4DT9A 4RFMA 2P3GX 2WMUA 4IB0A 5JK3A 4O0UA 2OIQA 3BEGA 3UG1A 3R02A 4ANBA 4ZLZA 2SRCA 4F7JA 3TDWA 3ORNA 3QC4A 4Y8DA 3ZYAA 4Y72A 2PE2A 1AD5A 3NNXA 5I3RA 2VWXA 3G5DA 3EKNA 4C4HA 2F9GA 3FZPA 3R28A 1P4OA 2P33A 3L8SA 4C36A 3BQRA 4NWMA 4I6QA 4C7TA 4MD7E 5BUIA 5CAUA 5HX6A 2F2CB 2VTTA 3CGFA 2OG8A 3BYMA 3HUBA 5CI6A 5KBQA 1ND4A 3EN7A 4FV8A 3QYWA 5FEEA 3TEIA 1G5SA 4AUAA 1A06A 4R5YA 1BX6A 1YI6A 4EH8A 4KKHA 5HORA 3ZUUA 3D7TB 5EYKA 5IISA 4DFUA 1YXUA 4M0YA 3C4XA 4FX3A 5HD4A 3B8QA 2Y6MA 2ITOA 3U54A 5CVGA 4FTUA 3EZVA 3QD2B 5EYDA 4QMWA 3Q4TA 4A9RA 2VO6A 3VQUA 4OAUC 4R5SA 2IJMA 4EKKA 3NVKI 4JQ7A 2B9IA 5E1SA 3WYYA 4R3CA 4RLKA 4XG3A 3W2SA 4BDDA 2O0UA 4V01A 1H4LA 5JGDA 3QF9A 1Q4LA 4LM5A 2OIBA 3JXWA 2UVXA 3VQHA 2VRXA 3COKA 4DEBA 5AUYA 2FUMA 5JQ5A 4RX7A 4TW9A 4EH4A 2WGJA 4BKYA 5AA8A 5IA3A 2BMCA 3K5UA 2JDSA 1MQBA 1H24A 4NK9A 2I0VA 4WRGA 4CFWA 5JEBA 2XA4A 4FKSA 4EOJA 1Y91A 3BEAA 3FQHA 4O2ZA 4UX9A 2QNJA 2QQ7A 4MBLA 4Y83A 2GMXA 4KRDA 3VBVA 3BYVA 3SDJA 1PXMA 4D9TA 3PG3A 4IXPA 5IDNA 3ALNA 3IONA 4FKLA 3R8MA 5GJGA 3FZRA 3VBXA 5EDPA 2YEXA 2YWPA 3ULIA 2YLEA 1OL6A 2B0QA 4FK3A 5FP6A 5BQ0A 1ZWSA 3L1SA 3O51A 4JQ8A 1KV1A 3W8LA 2YAAA 3NW5A 3NW6A 5KMJA 4ZZOA 4DGLC 3HKOA 3E92A 5LXMA 4H36A 4FIFA 4D58A 3Q32A 4QD6A 4N57A 4K33A 1YI3A 2DQ7X 1PXIA 3ATSA 4FV4A 4U3YA 5DLSA 4E4XA 4HJOA 3GI3A 4RWIA 3GXLA 4FR4A 2R3HA 5HIDA 1Z5MA 2XIXA 3FYKX 2ZMDA 3R1SA 5EHYA 4ZTHA 2H6DA 5HHWA 5CXHA 3OY1A 4C4GA 2EWAA 4XP0A 4XHKB 3KXMA 4JDHA 3OXTA 5K9IA 4A7CA 3FMLA 1VYWA 3PRIA 2B55A 2C6DA 2X6EA 3FSKA 4AGUA 5HIEA 4B6LA 4CFXA 4CQGA 3PLAE 5HU3A 2A1AB 5LVOA 3UP2A 3IW7A 3DZQA 2NNWB 5A4EA 2UZLA 3QUEA 4M69A 4PMMA 2FA2A 2QO7A 4DG3E 3HV5A 2X81A 1KE5A 4O7VA 5FXSA 3UZTA 4QTAA 2GCDA 4TNBA 2QHMA 2X8IA 2LAVA 2JLDA 4QQCA 1VYZA 4FG8A 4DH1A 1Q61A 4E6CA 4GIIA 4FMQA 4BB4A 4FOCA 4EORA 4G6OA 2O63A 5E9EA 4RZWA 5AA9A 3GVUA 2YIQA 4IB3A 4JXFA 5L2SA 3KCKA 1ZAOA 3C7QA 5DE2A 4HVIA 4H05A 3UQCA 3UIMA 3KXXA 3ZEPA 5EW3A 2CLQA 4BI2A 3LFNA 3W10A 2PUNA 3JR1A 4M3QA 3AMYA 4PMSA 4AZSA 3WF7A 2PK9A 3DB6A 4D0WA 2A2AA 1QPCA 4I1ZA 4JL9A 4A07A 3RBWA 3WE8A 3UMWA 3PSDA 2UZDA 1LUFA 2PZPA 3DTCA 3MWUA 4TWCA 4JR3A 5K0KA 2VNYA 3FHIA 2BZJA 3W16A 5FWKK 2OI4X 3FLSA 1XQZA 2CSNA 3LCTA 4FUXA 2BPMA 5JQ8A 4RC3A 1J1BA 3UZPA 2J90A 3QWKA 4PRJA 3AC4A 2EB3A 3QKLA 1TQIA 4OTHA 4JJRA 4DCAA 3LHJA 4TZRA 2VZ6A 4AW5A 5JSMA 2PU8A 4IHPA 2I6LA 3JUHA 4AOJA 1YXTA 3GC7A 5D7AA 1PRYA 2W0JA 3PA3A 1Q3WA 2BTRA 2C6OA 2ZDTA 4OLIA 3NPCA 3T9TA 3WIGA 3EL7A 2ZM4A 3RK9A 3P78A 4QMZA 4E6QA 4EK4A 5K3YA 4BDJA 2BRNA 3W8QA 4BFMA 1Y8GA 4GEOA 4RVMA 4CKIA 2ONLA 1UWJA 3DAEA 1VEBA 4DH5A 5IH6A 4QPAA 1PMNA 3H0YA 3UO6A 2XEZA 5E92A 1BKXA 5ACKA 4RFYA 3IECA 1K3AA 2C1AA 1V0BA 4Y73A 3TNPC 4DTBA 3DA6A 5DRDA 4V0GA 3DGKA 3ZFYA 4IX3A 4C61A 1UNLA 4MK0A 3QQUA 3FLNC 5DT3A 2JIIA 4NT4A 5FEQA 4D2TA 4K2RA 4IBMA 3BCEA 3F66A 1G8AA 1ZOGA 3GCVA 4DBXA 1UNGA 2JAMA 3MSSA 2X4FA 2GFSA 5G6VA 4CFFA 5EDRA 4EH5A 3EYGA 4O6EA 3MA6A 2V5QA 1JKLA 4GUEA 4DCEA 2XS0A 4Q5EA 2XNOA 4A9YA 4C3PA 2GQSA 2XZSA 3IW4A 4GS6A 4I5HA 3MFTA 2YA9A 3QTRA 1A9UA 5C8KA 4F7SA 5CAPA 5BMSA 2WTIA 4PDPA 4R1VA 4USDA 1AQ1A 4EOLA 1ZYJA 4UMPA 3A4PA 3KRLA 4F08A 4YR8A 4I20A 5DHJA 3LKMA 5LVNA 4GV1A 3ZOSA 3FI8A 2R3NA 3PRFA 4L67A 4DEAA 3SRVB 4EEVA 3GOPA 4BDAA 3VBWA 3VWAA 1BI8A 5BYZA 3NYXA 2OXDA 4IX4A 1YKRA 4DGOA 1H0WA 1NVQA 2H96A 4G1WA 4PTGA 4FIJA 1OL5A 2Y4IB 3SG8A 4CV8A 3A99A 4TWOA 2ITNA 2OIDA 4JT3A 4TYGA 3QA8A 4E6AA 5M51A 2PVHA 4HVDA 2GSFA 4BCOA 1J3HA 3VF8A 2HZ0A 4FG7A 2C6TA 1SYKA 4RVLA 1YHSA 2X2MA 4HVGA 4TPTA 4I6FA 2YCRA 4RQVA 3MW1A 1UU8A 2CGWA 4EL9A 4MXOA 5AUXA 3RKBA 5CAVA 3HVCA 2YIXA 3ENHA 3LJ0A 2HYYA 3UG2A 3UTOA 2FO0A 4HGSA 2IZSA 2GNGA 4XUFA 4OTPA 4FOBA 4JAJA 1FMOE 5ANIA 3A61A 4L52A 1WBOA 1FVRA 3D5XA 3F5XA 3PVUA 3TNWA 1GZKA 4D55A 4D2WA 4FTLA 3CLYA 5CT7A 3ZXZA 3L9MA 3O71A 2J9MA 4ANSA 4USFA 3ZM4A 2Z7LA 4RMZA 4FI1A 4AZFA 4EQCA 2BVAA 3FYJX 3EQHA 3I7BA 2Z60A 3KL8A 3NNVA 4LYNA 4OTGA 4YNOA 5HD7A 5KZIA 1FVVA 5AR4A 5CS6A 2V22A 2VTNA 3LXPA 4O1PA 3QKMA 5J87A 3M1SA 3QL8A 3EFWA 5J5TA 1PMVA 3SD0A 3TG1A 4XV9A 1MRUA 4LL0A 3ORIA 2PULA 3RAIA 3POOA 3DOGA 2CKPA 4UZHA 3KCFA 2O65A 4GT5A 2WTCA 3VF9A 3BIZA 1UU3A 4FTAA 2XK9A 1H25A 4IFGA 5H8GA 5L6WL 2W5AA 4CFVA 3NGAA 2IVTA 3PE1A 3VS7A 3VULA 3QD0A 1NA7A 1Q8TA 2VTHA 2OLCA 2C3KA 4CMTA 4DFLA 3C5IA 4RRVA 2VWWA 3D9VA 2C47A 4PP9A 4F1TA 3R71A 4CT2A 1NVSA 5IA1A 4XEYA 3LZBA 2JDVA 1JSUA 3EJ1A 5AJQA 2ACXA 2CLXA 2W4OA 3DPKA 3LM5A 4MAOA 3ROYA 4DEGA 4F6WA 3NDMA 3MVJA 4I0SA 3EYHA 3NVMB 3FKOA 4BKZA 1ERKA 3HGKA 4EC9A 2GNJA 1YDTE 5FBOA 4CSVA 2HELA 4ZJJA 2PZIA 4ZS0A 3F69A 4GG7A 4DEIA 3CQUA 2QOKA 3SAYA 5AUTA 2HXQA 4UMTA 3R21A 5CF6A 2WNTA 3CTJA 1M52A 2BAKA 4FKWA 5HI2A 3FQEA 5LMKA 3IKAA 4IMYA 4KSQA 5B2LA 5M4IA 3KXZA
chains in the Genus database with same CATH superfamily
2GDOA 2V55A 3LM0A 4NW6A 1IAHA 2XJ2A 5CT0A 3EKKA 4U43A 4BTKA 3ZHPC 3EQIA 4U9AA 2EUFB 3LLTA 4GK2A 3ZUVA 5CU6A 3QRUA 1XH7A 3MESA 3V5LA 1M2PA 2ZMCA 3VRZA 3POZA 5F9EA 3C0GA 4C2WA 4UV0A 3ZLYA 3VBQA 3ZONA 3UBDA 4G6NA 4GVJA 5HLWA 4ASDA 2QONA 4XV2A 4YHTA 5F4NA 5HBJA 3ACJA 4HGLA 1MP8A 4PX6A 2RFEA 3Q53A 4KIPA 5KNJA 4ZS4A 3LFFA 2PVKA 3AKLA 1FVTA 2HENA 5JFSA 1YRPA 3I81A 2XKCA 4UMUA 1ST4A 3UNJA 3AGMA 4KIKB 5C4LA 3FY0A 2ITVA 5HBEA 4QDEA 3BWFA 3K54A 4DBNA 4A4OA 4LMNA 2G2IA 2X0OA 3E93A 4DFNA 5CSPA 4NJ3A 4FV0A 3RPOA 2XP2A 2JBOA 3EN4A 2XIKA 1WCCA 2WQBA 3ZRKA 5JT2A 4BY9E 2B9HA 5EM8A 1P2AA 3WARA 2YWVA 3GQLA 2QU6A 4G2FA 2YJRA 2E9UA 5ETAA 3DK6A 3HDMA 2PUUA 3R22A 4JQEA 5CSHA 4F63A 3QTSA 3QHWA 2QOIA 3PIXA 4FVRA 2WQMA 5HO8A 5LMBA 4YJUA 4CLIA 5HO7A 3R8PA 3E8EA 4D2RA 4NUSA 4CG8A 4QMXA 4MBJA 4FSYA 4R3PA 4E4NA 4BRXA 4FTRA 4PQNA 1PW2A 4X7QA 3RNYA 2Y8OA 2JAVA 3FMDA 3ZM9A 5I9WA 2Z7SA 3GUBA 4EOOA 4TYHA 2B1PA 3GCPA 3FV8A 4ZSEA 3KGAA 4DTKA 4AAAA 4I22A 4ANMA 4C3FA 3R30A 4FV3A 5EFQA 3DBCA 2WMRA 5AUZA 3AC8A 1OBGA 2ZM3A 4Y85A 4FTCA 5FTOA 1FINA 4XRLA 1CM8A 3FLQA 2YCQA 2X9EA 2Z8CA 3PWYA 4O2PA 1MQ4A 2B54A 2VAGA 3BLQA 4BHZA 4F0FA 5IQDA 2Z2WA 3NNUA 4EQUA 1ZZ2A 3E8CA 3LFBA 1ZOEA 3ET7A 3M42A 4W8DA 1OITA 2XF0A 1Q24A 2XCKA 5A6NA 4IZ5A 3E3BX 4CZTA 3W2QA 3I0OA 3SW7A 3BYOA 3THBA 4BDIA 3TCPA 2HOGA 2REIA 3P0MA 2YIRA 3WIKA 4ALWA 3PUFC 2I7QA 3ALOA 2VWIA 3VW6A 4NJDA 3MY5A 1DS5A 2VUWA 4WNPA 1W8CA 4L00A 3R7OA 3UO5A 3F5UA 2WFYA 5IA2A 3WOWA 3GENA 2C5YA 1W83A 4APPA 2ZM1A 3ZO4A 3O7LB 5G1XA 5IQEA 3SHEA 4MTAA 4LG4A 1P4FA 4XX9A 4YC8A 4NU1A 3GU8A 4ANOA 4F1OA 2F2UA 2QI8A 2QOLA 3AT2A 1QCFA 3MY0A 4C4JA 2VTRA 2WMXA 3A7JA 1H26A 3KA0A 4D4VA 1GZ8A 4YP8A 4ZY5A 5LVLA 5HVJA 2J2IB 3JVRA 2E2BA 2WTKB 3MN3A 4XS2A 5AR2A 3ZZWA 4HPTE 4LMUA 2WMTA 3C0IA 3FY2A 2WPAA 1XR1A 5DOSA 1M2RA 3ZMMA 3ZTXA 3OTUA 1WVYA 2GTMA 2FSOX 2NPQA 4W4VA 2BTSA 4CRLA 2ITYA 4HCTA 3HAVA 3ZFXA 4ASZA 4GH2A 4BYIA 3R01A 5ETFA 3LQ8A 4GK4A 3CC6A 1OL2A 2OO8X 5E8SA 2W06A 3RTPA 3S95A 3KFAA 2XEYA 3PPZA 5LWMA 5C26A 4X3FA 2WEVA 1LEZA 1XBCA 4PP7A 4ONAA 4TRLA 2X8EA 4NH1A 1W2DA 5EK7A 3PSBA 3BV3A 2WD1A 1U54A 1JSVA 5E4HA 2HAKA 5AR8A 4QP8A 4M12A 4O4CA 2WMBA 2ZV7A 3R1QA 2UW7A 3CD3A 4G3GA 4YLLA 4D5KA 4J71A 2VO0A 1W0XC 4R1YA 1FOTA 2GQGA 4MHAA 5AUUA 3ULZA 5T68A 3CBLA 4H3BA 1T46A 3ML1A 4AQCA 5GHVA 2JIVA 3DTWA 4YZNA 5IQCA 4JG7A 1L3RE 1NXKA 1IA8A 2J0MB 3O0GA 4OT5A 4AS0A 5ACBC 4YTCA 4E1ZA 4DDGA 2WOTA 4HOKA 4LRKA 3HV3A 3ATTA 3F5PA 1UWHA 4L01A 3ZSHA 1ZRZA 3LQ5A 4J52A 4PPBA 2I1MA 2UZWE 5HNIX 4FNZA 4DA5A 4IAIA 3F82A 4RC4A 2UUEA 4HYSA 3MI9A 3PWDA 4AZVA 2QR7A 4G16A 4FEVA 2X7GA 4HNFA 1URCA 2GQRA 2BRMA 5IQGA 1R78A 4WSYA 2RG6A 4E8AA 3W0MA 2WHBA 3LXNA 3OWKA 4K11A 5AV3A 3T9IA 1MRVA 2JFLA 4IIRA 3F2RA 4S30A 2IW8A 2YAKA 4YO4A 4DINA 1O6KA 4FIEA 2C68A 5D12A 1PXOA 2ETMA 2XIYA 3R7UA 1Q8UA 4M7IA 4E5BA 3QTUA 3WF5A 5HU9A 5HTBA 4IAFA 4BI0A 5M08A 3IW5A 4IEBA 3A7HA 3IO7A 4BDBA 5KHXA 3NRMA 5FGKA 1H1QA 2VO3A 3AT4A 4MF1A 2RFDA 3DJ5A 4CTBA 4XV3A 5HCXA 1RW8A 2IZRA 3PY0A 3PXYA 4K8AA 4OTQA 2IW9A 4NYEA 3NX8A 3MVLA 4FKIA 4X0MA 3FE3A 3S1HA 3F9NA 4OR5A 4ZK5A 5FQDC 5K5XA 2JFMA 4RJ3A 5I3OA 4HW7A 3PP0A 2QOOA 2PUIA 4RWKA 4FYOA 5EG3A 2WMAA 1M14A 5BYYA 3F5GA 4I5PA 4U7ZA 3FKLA 4RIXA 4O7ZA 3KULB 3NYVA 4QNAA 4CVAA 3ZS5A 5HOAA 3Q04A 3F3WA 5CAOA 2PMNX 4LOQA 5A4LA 3BQCA 4X3JA 2ZDUA 3PTGA 5KMNA 5C8MA 3QXPA 4J99A 3DAJA 4BCMA 3BWJA 3FKNA 1LP4A 3OUKA 3LCKA 3KIOC 4GIHA 4KS7A 1Z9XA 2XKFA 3C4FA 3P79A 4ACGA 1OBDA 3G9LX 3MBLA 5HGIA 4QP3A 5JGAA 4UXQA 5ANKA 5I9YA 3PUPA 3UQFA 2H9VA 3D2IA 3ANQA 3PJ3A 4CMUA 1JKKA 4DHFA 4QPMA 5LVPA 1G8SA 2GHMA 4WUNA 3O8TA 4DEHA 5CENA 1Q8ZA 2EXCX 3OW4A 4YUQA 4YLJA 3UODA 3UYTA 2R3FA 5FXQA 4IFCA 4EOPA 2W5BA 4YZDA 4RSSA 4PTEA 5JKGA 3GEQA 3AD4A 4WOVA 4TT7A 4FSMA 4D2VA 3GU5A 4FBXA 4GJ2A 2C0TA 3MGYA 3QQLA 4HPUE 3QUPA 3QLGA 3IS5A 4MXXA 3SLSA 3KU2A 3ZRLA 3FI2A 4EUUA 3R83A 1OIQA 4BDEA 4KIOA 4IZ7A 4LDTA 4YZCA 4BBFA 3A8WA 4H1MA 2XANA 4Q5HA 2CCIA 3TNIA 4N6ZA 4WT6A 4XV1A 3U51A 3L9LA 3ODYX 2VX3A 4O0VA 1PKDA 4FVQA 3EFJA 4JNWA 2UZOA 3GOKA 3LFSA 4IZAA 4TWNA 5D9HA 4F6UA 4Q9ZA 1EH4A 2BDJA 4O7NA 4I5MA 1VR2A 4UYNA 4O7RA 1YOLA 4CZUA 3I0QA 3A8XA 5EQYA 1GZOA 2VX0A 5EM5A 1UNHA 2C30A 1GAGA 4WSQA 3C4ZA 3R2YA 5A4TA 4H39A 3IOKA 3BBWA 2UZBA 3EIDA 4LOPA 5CVHA 5EI8A 3WZJA 4L53A 3R9NA 4CFNA 2GNHA 2XYNA 4FSWA 4JIAA 4M8TA 3UZRA 2W1FA 4BCHA 5AR7A 4YMJA 5AR3A 5A14A 5T3QA 3SXSA 3ORTA 4X2GA 2F7EE 2IVSA 2Y4PA 3PSCA 4IWPA 4IANA 4F64A 5LVMA 1M17A 5L2QA 3HZTA 4BDGA 4E3CA 3IGGA 4YBJA 2FYSA 4MXAA 4NFMA 1OGYA 3QD3A 4D4SA 3O2MA 1IG1A 1OL1A 2VWVA 5JGBA 2IW6A 2VU3A 2O5KA 3NIZA 3HMMA 4XP3A 3H30A 1XHAA 3ZSGA 3EQRA 2ETKA 4AT5A 3O7LD 4ZOGA 2Y4IC 1W7HA 5EI6A 4PDYA 1SNXA 3DBDA 1GIIA 3P4KA 3NAYA 4E7WA 5I9VA 3BELA 2NO3A 3LCSA 3QZFA 5AAEA 3DXQA 3C51A 3MB7A 5LCJA 4NTSA 4E20A 3OTVA 3OMVA 2JKMA 4IAAA 4IVDA 4QNYA 4BCQA 4PMPA 3ORLA 4EH6A 1DAWA 2A4LA 5AM7A 4EH2A 5BNJA 3O8UA 4PMTA 4AFEA 4DH3A 3TZ8A 5JZJA 1Q8YA 4YTFA 2OFUA 2EXEA 1B38A 2C5XA 3EQGA 5AP3A 4QP6A 4RLLA 3KRXA 5EYCA 3FMMA 5BVKA 5A3XA 1ZMUA 1W2FA 1XWSA 5IUHA 3HYHA 3P9JA 4OTFA 5HX8A 3EN6A 4YPSA 2VTMA 4FNWA 4BIDA 4DLIA 1KWPA 4R77A 1Q97A 3UOLA 3B2TA 4DGNA 2JGZA 4TKSA 4O1OA 4H58A 4BVUA 4S31A 5ETCA 3W0RA 2JDRA 3HX4A 5HG7A 4KBKA 3MFRA 4OTRA 1ST0A 4BZNA 4KBAA 3KC3A 3OVVA 3UYSA 5EW9A 5KMLA 2IG7A 4FKPA 3QXOA 5DEYA 4AQKA 1Q3DA 1IAJA 3OZ6A 3DS6A 4RIYA 4FT3A 5CI7A 4BHNA 3GFWA 4C3RA 5BYLA 4F0IA 2UW9A 2C5NA 3RK7A 4AT3A 1V0OA 5K4IA 2WZJA 4CZYB 4DFXE 5CSWA 1DAYA 2YISA 3LXKA 4BN1A 3AMBA 1NT2A 3QQHA 3N4UA 2FSLX 2BILB 2HK5A 3ZH8A 4C57A 3UOJA 4P4CA 4E26A 4QRCA 4JS8A 4NIFA 4D9UA 4J95A 3D5VA 4WA9A 4M97A 2JC6A 3HV4A 3C9WA 4BICA 3CE3A 3G6HA 3PA5A 5CZIA 2GHLA 3MB6A 3ORMA 4S2ZA 3O23A 4G9RA 4L46A 4GU6A 4NM3A 4NZWB 3GFEA 3ZFMA 3BHYA 3R0TA 5E8TA 3FAAA 4ZZMA 3TV7A 2UZUE 4A4LA 4G31A 2OF4A 1FPUA 4IM3A 5CX9A 3TWJA 3TUDA 4XMOA 2YABA 3VJNA 2W1EA 1JAMA 3RWQA 1PYXA 4C02A 4DYMA 4YSJA 5DR2A 2OZAA 4O7LA 4MUQA 3BHHA 1O6YA 2PL0A 2PVRA 2YERA 2JDOA 5HEZA 3OBJA 3W1FA 4E5AX 2R3JA 2VX1A 3EH9A 2QKWB 3MH1A 4QQ5A 4QOXA 3KY2A 3U6IA 1H28A 4AXDA 3QWJA 2C6EA 4KS8A 2FSTX 2X9FA 2XMYA 5IU2A 3F3TA 4PL5A 4CYJA 2ZV2A 3DQXA 5A4QA 3VNTA 2ERKA 1IASA 4NCTA 4M84A 4NEUA 3DCVA 2XRWA 2O3PA 3MJ2A 3TT0A 2OF2A 4ASEA 3ODZX 2CGUA 5AM6A 4MNFA 5AP1A 3COMA 3FXWA 2HW6A 2V0DA 3OCTA 1PXNA 3A7FA 3DXNA 2XNPA 4LV8A 4EOQA 4BCGA 4Z55A 5CF8A 3DKFA 4JX7A 5EI2A 4DHJA 2FB8A 3AD5A 3IW6A 5ETIA 3AD6A 5HNBA 4EH9A 1YW2A 3Q4CA 3MYGA 2B52A 3NR9A 4PNIA 3RPYA 2FGIA 4DGMA 4X3FB 1PHKA 1ZARA 3E3PA 3PJ2A 1R0PA 2E9OA 2OKRA 3GQIA 3LJ2A 2AC3A 3V01A 4FTNA 2BKZA 3DY7A 1H8FA 2OZOA 4GYIA 4UWCA 4E6DA 2X2LA 5HESA 4RIWA 4JBVA 3SXFA 4D2PA 2FH9A 3PVGA 2VTOA 2LGCA 4EWQA 4ZSLA 3D83A 4DHIB 4DF3A 1CSNA 2GNLA 4O83A 4MWHA 4O4FA 5KZ0A 2A0CX 3E62A 1YWRA 2XIRA 3GC9A 4UBAA 4AGDA 4EOSA 3NUXA 3G0EA 4JBPA 4C2VA 5E7RA 3G33A 5C01A 3U6JA 5J8IA 4M68A 4UMRA 2YM7A 4BGQA 3WZUA 1H0VA 4P5QA 4IAYA 5HQ0A 5KMIA 1H00A 3Q52A 3V8WA 5H8BA 1PJKA 3PXKA 4FTQA 5D11A 5AUVA 4C59A 2C0IA 5HO6A 4F6SA 4O7YA 4DN5A 5EHLA 3JY0A 4GG5A 3LQ3A 4AAYA 5FBNC 3C13A 4CLJA 4ANLA 2AEGA 4RZVA 3H10A 4OBPA 1CKPA 5FRIA 4CD0A 2YLFA 4ZY6A 1GY3A 4G6LA 4XH6A 2JKKA 3S4QA 3AC5A 3ZRMA 3UO4A 3VS6A 2VTSA 4C4EA 2AUHA 1W2CA 3KVXA 1OPLA 5BVNA 1Q41A 5KKRB 4U3ZA 2F49A 4AW1A 2YITA 2P55A 3WZEA 2CHLA 2YACA 4O38A 3FMJA 3QRKA 2E9VA 2BZHB 3MPMA 4WBOA 2BRHA 3EN9A 3I5ZA 3QQJA 3D0EA 4JBOA 5J1VA 4ITIA 4G3EA 2XCHA 3LCDA 3OWJA 3ERKA 4QTDA 1R39A 1SZMA 4BCPA 4DAWA 1RE8A 5F20A 1OPJA 4FKVA 3Q5IA 4U40A 3N4TA 3P86A 3MA3A 4QQJA 4AN2A 4F09A 3GP0A 4MQ1A 5AWMA 4I92A 3R9DA 2EVAA 2R7IA 1X8BA 4AN9A 4FNXA 4IZYA 4BDHA 4E73A 4F9AA 3OP5A 5HE1A 5BPYA 2Y0AA 2CPKE 2H8HA 3UVPA 4F99A 2Z02A 3ZLSA 4UMQA 3PIYA 4IH8A 5M4CA 2BDWA 3JYAA 4MH7A 5EQPA 3EMGA 3I5NA 5DA3A 3LMGA 2NP8A 3I6UA 2PVFA 4D4RA 3F3ZA 3QZGA 2C3IB 3NSZA 4DH7A 3FMEA 3SKCA 3OXZA 3QC9A 2QKRA 3CKXA 4EUTA 1LEWA 4F9BA 4OBQA 3CEKA 4CG9A 4QPSA 2WELA 5B2KA 4QDVA 5E8VA 3SA0A 3UIUA 2GS2A 4BZOA 4Z7GA 4M66A 2B4SB 2XH5A 5AV4A 1JWHA 3E5AA 3HV6A 3M11A 4YBKA 4R3RA 3ELJA 2R3IA 2W9FB 4FICA 2ZFYA 2X0QA 3KF4A 5IQIA 5IG1A 3NYNA 1HOWA 5CF5A 5AX9A 2OJJA 3CXWA 2JKOA 1WVXA 3PDTA 4YJOA 1WBPA 4EZ3A 4I0TA 3VC4A 1KUTA 3OC1A 4QMSA 3UNKA 2QOFA 4J8NA 4GKIA 3R8UA 3FMHA 3KKVA 4W9XA 3MVHA 2XK3A 3OBGA 4L3LA 2O8YA 3IW8A 4OGRA 2W1GA 3N4VA 5A4CA 4JMQA 4KD1A 4PY1A 1WBTA 4X2FA 3GB2A 3PPKA 4CMOA 1E1XA 2A19B 4KKGA 5CSVA 4XG7A 5FM2A 5TOZA 3VBTA 4RFZA 4L6QA 4YJPA 2OW3A 5J9YA 4CYIA 5IZFA 4M14A 5FDPA 4QMNA 4FL2A 4GMYA 4P5ZA 2YIWA 3MTFA 2HZIA 4ZTLA 3OD6X 5M53A 3GCSA 3EZRA 5HLPA 4O21A 1CDKA 4U5JA 5HE3A 3R00A 4X2JA 3GC8A 2JDTA 3PXFA 2WOUA 2Y9QA 5CVFA 4E4MA 2XKDA 3IG7A 3Q5ZA 4KB8A 3VHEA 4RJ5A 2YCFA 4LL5A 2X0PA 4YLKA 1P5EA 2GNIA 4K9YA 4WNOA 3R9HA 2PMIA 3CJGA 3FBVA 2EXMA 3W55A 4E93A 3K3JA 4O7TA 4LOOA 4WKQA 3HA8A 5IQAA 4OW8A 1Y57A 4V05A 4ZSAA 3FDNA 3D2KA 3NFFB 2R9SA 4FIHA 4IACA 4PDOA 4WUAA 4XOZA 1SNUA 2UVYA 4N6YA 3SVVA 4EYJA 4R7IA 4FL3A 1WAKA 1XO2B 1SVHA 5BVDA 2W1DA 2PVNA 4MX9A 3REPA 1Q5KA 3BE9A 3G0FA 4YHJA 3PXZA 1Y8YA 3HNGA 4HYIA 3WE4A 4C62A 3DKOA 4NKSA 3Q9YA 4S33A 3W18A 3NCZA 3SQQA 4FF8A 1TQPA 2I0EA 3A60A 4FSQA 2VWZA 2C1BA 1YXSA 2BALA 3VS1A 4DGGA 4KKEA 5J7HA 3D5UA 3UIBA 5M55A 4R7BA 2UZEA 2PZ5A 3Q4UA 4IDTA 3OHTA 3ZC5A 3OEFX 3HP5A 4JG6A 4CRSA 2CNVA 4U42A 3TNQB 4RA5A 2CN5A 4KIQA 1M2QA 5FDXA 4C8BA 3FEGA 1TZDA 4B8LA 3F3UA 2XK7A 5LMAA 4IJ9A 5AP0A 2BROA 4ZJIA 4GT4A 3V6SA 2W9ZB 3FL4A 1ZOHA 3TKHA 2YDIA 4G3CA 5D1JA 3FLZA 4TL0A 3D94A 4KNBA 4C38A 3R7EA 3DDQA 3E8DA 3R73A 1OGUA 4EZ5A 1FGIA 2J0LA 3UPZA 2PYWA 4MKCA 2QCSA 2C6IA 1UKIA 2G1TA 3DZOA 2UW0A 1TQMA 3IDPA 5CTPA 2XYUA 4RJ7A 1OIUA 1ZZLA 4ENYA 1JLUE 1KE6A 1QPDA 2AC5A 4AP7A 4IAKA 4KA3A 5CEQA 5LWNA 3OXIA 2OWBA 3NS9A 5E8UA 4FTTA 2PE0A 2QLQA 5HG9A 5L2WA 5IMEA 3RZFA 4LQMA 3AG9A 4A9SA 2PWLA 3ORZA 4Z9LA 3L8VA 4M69B 3TZ7A 3RINA 3KK8A 2XAMA 3BKBA 1WMKA 1U5RA 2X2KA 5JZNA 4ERWA 5GZ8A 2W1CA 3NUSA 4BGGA 4QQTA 3KREA 3JPVA 4IADA 3AXWA 3BYSA 3VUHA 5I0BA 5AR5A 4E4LA 1JNKA 4GU9A 3VONA 1ZMWA 2OZAB 5KHWA 2W1ZA 4QMVA 2ITZA 3IPHA 1JSTA 4F7LA 2I40A 5KX8A 2ZAZA 1OI9A 5K5NA 4ID7A 3CR0A 3RZBA 3PY1A 4APCA 1H1PA 3DLZA 5FUTA 3ZO1A 1CKIA 3BRBA 1IRKA 4J96A 2WU7A 1ZY4A 3CCNA 4X21A 5HG8A 4LUDA 2WMQA 3QRJA 1P14A 4UXLA 4XRJA 5ANJA 2Z7RA 5JFVA 3CJFA 3ACKA 3G51A 3UC3A 4YURA 4GKHA 4AU8A 5DG5A 3PJ1A 4ANNA 5J5SA 2WQNA 1YDRE 4S32A 4QYEA 4D1ZA 2WTDA 5F95A 1W82A 1DI9A 2JEDA 4GW8A 4H1JA 4JI9A 3UVRA 3VUMA 4UWBA 1KE7A 3KRWA 1PMEA 5IKWA 3V04A 3HRCA 3ORPA 2XM8A 4K77A 5HZNA 5KCVA 3C5UA 5GJDA 4OTDA 5FD2A 5IUGA 3QTZA 3VS4A 4O22A 2OSCA 4H3PA 4II5A 4UWYA 3LIJA 3FMNA 4O0WA 2CGVA 4QYGA 4CFMA 3DNEA 1PKGA 4GT3A 4RIWB 4WG3A 2XNNA 3D5WA 3S2PA 2CKOA 1OB3A 2C6KA 3VRYA 2VTPA 4C4IA 4F65A 1MRYA 2P2HA 1B6CB 2X7OA 2XRUA 2W4JA 4W4WA 3SX9A 4F1MA 3QCXA 4O7WA 5M4UA 3BYUA 5C27A 4EHEA 5IQBA 2BFYA 2ETRA 3G9NA 5J9ZA 2HWPA 2XJ1A 2C6MA 3FZTA 3LPBA 4Y95A 3V8TA 3R7YA 4IB5A 3V5QA 2JBPA 3AOXA 3HMNA 4V0GB 4DLJA 2DWBA 3ZXTA 3BLHA 4C0TA 4XG8A 4Q9SA 4L7FA 5H2UA 1G8KA 4C34A 4XLIA 1JVPP 4GYGA 5CZHA 2IN6A 2GU8A 3WZKA 1PMUA 5BMMA 4LI5A 2ITXA 3E64A 3BU3A 5HIBA 3AKKA 3ZC6A 5A6OA 4FSNA 3U87A 2GS7A 4QMLA 2C5VA 4CCUA 1GJOA 4R78A 4AZEA 3SGCA 5D10A 4MBIA 5K4JA 2J0JA 3COHA 4YTIA 3UDBA 3EQBA 3Q9ZA 2VTIA 4IQ6A 4ZSJA 3R2BA 2QOQA 3Q4ZA 3FPQA 3BHTA 3F7ZA 4M67A 3D7ZA 3RWPA 5AADA 5IA4A 1OM1A 2BFXA 3C4CA 2KTYA 5DWRA 5EH0A 3SC1A 5AV2A 1VLRA 2IPXA 5IEXA 3DDPA 2CKEA 3MIYA 5EQEA 3WI6A 3R04A 4AACA 2WQEA 3D15A 4BIEA 3Q2JA 5D7VA 5DFPA 5EDQA 4BCJA 5IPJA 3UDZA 4QYHA 3Q6UA 4EBVA 4FEXA 4A9TA 2RSVA 1XBBA 2XNBA 3KF7A 4EI4A 2WMWA 4BTFA 5IH4A 4XOYA 2VWYA 3QZHA 1WBWA 4I23A 3ENMA 4MF0A 5M09A 3R1YA 3WF6A 2QU5A 4TYJA 2XKEA 4C33A 4JOAA 3UQGA 2W99B 4AT4A 2OJ9A 1Y6AA 2VN9A 3RM7A 2CKQA 2YHVA 4MXCA 4B99A 4HVSA 4J1RA 5DR9A 4TWPA 3R9OA 2XARA 4DT8A 2OJFE 4I4FA 3NMUF 3QD4A 1ZYSA 3HP2A 4C4FA 2OH4A 2W05A 4BKJA 4ZTMA 3NW7A 3RHXA 3CTQA 2XAOA 5B7VA 3GU7A 2FSMX 4TYIA 5M44A 3U55A 4I6BA 1BUHA 3LFDA 4HGEA 5TKDA 3SRVA 3QBNA 3DK7A 4WO5A 1YI4A 3DU8A 1JPAA 4I21A 1F5QA 2BZKB 1OKZA 4J97A 2H34A 3BGPA 3FI4A 5HVYA 4MYGA 3WBLA 3MDYA 4MD9E 4U81A 2HZ4A 3NAXA 4KWPA 3GU6A 1URWA 3RAKA 2W4KA 5BVEA 3UE4A 3W0NA 2RFSA 2OXXA 3QQKA 4FC0A 4I94A 5A46A 3UMXA 4M15A 4ACCA 4O4EA 3HMPA 1YVJA 4AZWA 5CEKA 3RNIA 2EB2A 3PLSA 3ZSIA 5ANEA 5GIPE 5EOLA 3TUBA 2WMVA 2Z7QA 3PE2A 3FLWA 4CKRA 5GZAA 3NEWA 4JG8A 3O8PA 3EQDA 4XBRA 4GFOA 2PVMA 1REKA 2R3RA 3QA0A 2X8DA 4IJPA 1QL6A 5CU4A 3RK5A 3NCGA 3FQSA 5ANOA 2X4ZA 1YWNA 5HLNA 1IEPA 1VZOA 3D14A 1ZYLA 2BHHA 3NYOA 4UN0C 4J8MA 3CQWA 4FV5A 5HKMA 4Y5HA 2X39A 2BAQA 2ITQA 3DB8A 3BGZA 1CKJA 2YDJA 4F78A 1U59A 5AIKA 1B39A 1G8JA 2W1HA 4OBOA 5H9BA 3DK3A 3FL5A 3LMHA 3QTWA 4I4EA 3PY3A 1H08A 2B9FA 2J7TA 4FZ7A 2DS1A 5L6OA 2RGPA 5CQUA 2UZNA 2JKQA 2XB7A 5I4NA 4P2KA 3FZSA 4EK8A 3AKJA 4QTBA 4CXAA 3IDBA 5CEMA 5DNRA 5KKRC 2C0OA 4EJNA 3CQEA 3HDNA 2ZYBA 5FM3A 5DPVA 4UEUA 1FQ1B 5L6PA 3PZHA 4WBBB 3CP9A 1F3MC 3TJCA 5ITAA 2R7BA 3EQPA 4B4LA 3AT3A 5BUEA 4AZTA 2HZNA 3T8OA 3W2PA 2A27A 2J5EA 4G34A 4NW5A 4HVHA 3HRBA 4FJVA 2F4JA 3C4EA 2QC6A 3H4JA 3V6RA 2VV9A 3U4UA 5CWZA 1OZ1A 4FTKA 1U5QA 4CEGA 3TDVA 4F9WA 4RWLA 1JBPE 4FKJA 4KSPA 1VJYA 2E9NA 2OU7A 5FG8A 3VS5A 1GZNA 3V5JA 4KBCA 4LV5A 5CY3A 3TNHA 3NUUA 3C4WA 1AGWA 4EH3A 4W8EA 1F0QA 5HTCA 2GNFA 3WZDA 3MFUA 3FHRA 4TN6A 3QGWA 5CEOA 2OXYA 4CTCA 3ZBXA 2VTQA 3CSVA 3N51A 4DFBA 2CCHA 3P7CA 2C5OA 2G9XA 4FTOA 4L3PA 4ANQA 4AWIA 5AP5A 4ARKA 2R5TA 4D1XA 4Z7HA 3TZ9A 4O84A 3PYYA 4AOTA 4OTIA 4BIBA 2BIKB 1GNGA 4IVCA 4IWOA 4NKAA 4A9UA 5CF4A 4QTEA 3K2LA 2PTKA 2ZOQA 1YHVA 2OGVA 2ESMA 4FKUA 1QPEA 2Q0NA 4X2KA 4GVAA 4ZTNA 1R0EA 4BC6A 4ZLOA 4QMTA 2I0HA 3FWQA 4GK3A 4FV7A 5EM7A 1J1CA 2PZRA 3RP9A 2WO6A 1HCKA 1XH6A 3SOAA 3C50A 3R9RA 1FBNA 3HECA 4GL9A 4C37A 2YZLA 2YJSA 5TO8A 4FTMA 4AA5A 4IVAA 3ZLWA 5GINE 4LGDA 5EOBA 2CMWA 3VAPA 5JMSA 3OCSA 4UYAA 2W7XA 3LJ1A 3KN5A 2WMSA 4FODA 1BL7A 3P23A <