4UN0C

Crystal structure of the human cdk12-cyclink complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
318
structure length
308
Chain Sequence
WGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CYCLIN-K
publication title Structures of the Cdk12/Cyck Complex with AMP-Pnp Reveal a Flexible C-Terminal Kinase Extension Important for ATP Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 308
sequence length 318
chains with identical sequence D
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4un0C02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4un0C01
1CSNA 1L3RE 2GS6A 1FINA 2ZYBA 5LVPA 2RFNA 4BIDA 4O0VA 4MBJA 3BHTA 3NIEA 5CXZA 2XMYA 3FMNA 4W8DA 4CD0A 1Q99A 3I7CA 3ZBXA 2IZRA 2X9FA 3F3TA 3FI8A 3AC5A 4USEA 3S00A 3OP5A 3GNIB 4ZEGA 3PIXA 3UIUA 1Q8WA 1B38A 2B9JA 3CXWA 4MF1A 5AUVA 1ZYSA 4KIKB 5H2UA 2CNUA 5B2KA 2J90A 3VWAA 2OFUA 1MQ4A 2WEIA 4FEWA 2VGOA 4O6LA 4YZDA 2E9UA 2W1ZA 5E92A 2IZTA 2X4FA 4XV9A 4MBLA 5ANEA 5ANDA 2G2IA 3L8VA 1OM1A 2BALA 2BRNA 2IJMA 5AP2A 2BTSA 4QP6A 3Q9YA 5K5XA 2Z7SA 3R7OA 4D2PA 3F3UA 3LMGA 4CGAA 5J9LA 4R78A 3FZRA 5EI2A 3OBGA 4UWCA 2BIYA 5CVFA 4XLVA 2VTJA 2C3JA 4HGEA 3TIZA 2WU6A 5GNKA 2Z8CA 3WARA 4RSSA 4RJ6A 4FICA 3IS5A 3FL4A 5M4IA 2WO6A 4HVGA 2GNHA 4FT7A 1JLUE 3DB6A 3DU8A 3KREA 4G9RA 3F2RA 4BZOA 3PG3A 4O1PA 5L2WA 5AV0A 3P08A 3GEQA 2WQMA 4FV5A 3ZRLA 4EOLA 1BI7A 2ETRA 3FY0A 3ANQA 5D9HA 3H4JA 2R0UA 4YMJA 1JBPE 5CEIA 2HOGA 3RAHA 4BCGA 3QTWA 3OWLA 4X2JA 4O96A 2ITZA 3ANRA 2UVYA 3P9JA 4CVAA 3O8PA 4TXCA 2HAKA 4JX7A 2GSFA 4BBMA 4YO4A 1URCA 3C4FA 3E93A 4RGJA 4CMUA 2Z7RA 4AZVA 4WBBB 4QNAA 1YHSA 1H0WA 3BHUA 3I5ZA 2VX3A 2V7OA 4L3PA 2IVUA 4QYGA 4WSQA 3VS3A 5A6NA 5AX9A 5J9YA 5JZJA 3NAXA 3E62A 4ANBA 3G5DA 4UV0A 5FDPA 2JAMA 4QMMA 4S31A 3SRVB 5J5TA 5F9EA 1NT2A 3E87A 4J99A 1MRYA 4RLKA 4F9AA 3KFAA 1AQ1A 2C5OA 4Y5HA 3BYUA 3PJCA 4PL3A 4IJPA 2XEYA 1BYGA 3EFLA 1STCE 5KMJA 4BB4A 3JVRA 2XK7A 5AAGA 2EVAA 4DGMA 2BDWA 2QURA 2VTHA 3ZC6A 3UQCA 1K3AA 2JDSA 4WIHA 2ONLC 4FOBA 4XP3A 2R3MA 1XHAA 3M1SA 4RQKA 3LFSA 3PJ2A 4K8AA 1ZXEA 3N4UA 3KXHA 2WHBA 1H26A 3PY1A 4I3ZA 2YEXA 4DCAA 4CZYB 3G51A 2HY0A 5DT0A 5A4EA 2ERZE 3R7EA 1G8SA 1OKWA 3W2OA 3VS0A 3W16A 4DT8A 4FL1A 4HYUA 3OCSA 4FL3A 5E8TA 4CT2A 4G5JA 1YQJA 2FO0A 4ZTLA 3C4WA 2A19B 2PE1A 2YDIA 3QXOA 5BVEA 3EQRA 1PYEA 3BIZA 2VWWA 5CF6A 3NPCA 4CKRA 1XR1A 3E63A 4FKOA 3F7WA 4EQUA 4RVMA 4U43A 3VUIA 4ZTHA 3PPJA 3DOGA 5IA0A 2YAKA 3VBXA 5CALA 3F6XA 4O7YA 3MY0A 2O3PA 4ZJIA 3SD0A 5L6OA 3I60A 1OMWA 1YXTA 4IACA 5E9EA 5HTIA 1V0OA 2XS0A 5L3AA 4FTKA 3DKFA 4FV8A 4LMUA 2GNGA 1NA7A 5FXSA 5M07A 5FEDA 4YTIA 4QP7A 3QC9A 1OPJA 4C34A 4OTQA 1QCFA 4BKJA 3CY3A 1EH4A 3FMKA 3QRIA 3W2RA 4GT3A 4PQNA 4CSVA 3TDWA 5FG8A 4TL0A 3AGLA 3FHRA 3ZDUA 4AA5A 2Y8OA 2J0KA 3EQHA 3NX8A 5A4CA 3QZFA 4X2FA 3HGKA 5TOZA 1I44A 4QP1A 1YXXA 5AV2A 1Q8UA 3COHA 3PXYA 4IAIA 1KWPA 2G01A 5CF5A 2OWBA 2F9GA 4H3QA 4BCKA 3RZBA 4OT5A 3GC7A 3VF8A 3BWFA 4C61A 4GFOA 3EN6A 3MFUA 2JAVA 4D55A 3WI6A 3ENMA 2VO6A 2YWPA 2WPAA 3KKVA 4FC0A 4Y83A 5DR6A 1SVEA 1K9AA 2XKDA 4G1WA 1BLXA 3IK3A 2AC3A 3IPHA 3Q53A 3I0OA 4BTKA 5IUHA 1IAHA 3H0YA 4LG4A 3A99A 2F57A 3EQGA 3FSFA 4LYNA 2ITOA 4ZTSA 4GKIA 5AEPA 2H6DA 2UW5A 3LCTA 3OWPA 4C0TA 4M0ZA 5C01A 3L9MA 3ODZX 3ORZA 3I0QA 4R3PA 1Y8GA 3WIKA 4HW7A 3IW4A 4PMSA 1KV1A 1XH8A 5AX3A 1RQQA 2CNQA 4OTFA 3NVKI 3NAYA 1WVWA 4EC8A 3HRFA 2I6LA 5CF4A 3V51A 3TACA 4QMQA 1H08A 1WBWA 5IMEA 4UX9A 4RX9A 3HMMA 4K33A 3PJ1A 4XP2A 1YRPA 3LZBA 4G6NA 4TT7A 5LOHA 1B6CB 3C0GA 2C1BA 5A3XA 3HV5A 2YCSA 3PDTA 3LCDA 5ANKA 4E20A 4CMOA 3WZKA 3DBQA 2WD1A 3TXOA 1O6LA 2B9HA 2EXEA 5LARA 1FVRA 3UVQA 3KC3A 4I5CA 2WMRA 4NEUA 4C4HA 4DG3E 4O81A 3AC3A 4E4MA 2C6EA 2VO0A 1H4LA 4YU2A 3UGCA 3IW8A 2C6IA 3LVPA 3RPYA 4XG6A 5HD7A 5KKRB 3R28A 3L8PA 3SOAA 4EHGA 3G0FA 4IAZA 4TYIA 2LGCA 2WMXA 2JBPA 4V0GA 3WZUA 1DI8A 1PYXA 3NNUA 3PXQA 2YCQA 4R5SA 2WQNA 5HEZA 2QU5A 4OTWA 3DDQA 2VV9A 3Q5ZA 4RZWA 4XOYA 4EH6A 4CG9A 5IUGA 3FMJA 4NM7A 2J5EA 4RFMA 2F2UA 3VO3A 2PK9A 2ESMA 3R73A 4ANLA 5HHWA 2W4OA 3U51A 3MBLA 3R01A 4B99A 4DEIA 3BEGA 3B8QA 4TY1A 1B39A 4A4OA 5M4CA 3AMAA 3LPBA 2OH0E 3ALOA 1CDKA 3F7ZA 5IQDA 4XG7A 4LOQA 3EKKA 3MPAA 5CAUA 4XG9A 4FNZA 5DYJA 4YLJA 3V01A 3UDBA 2WQOA 4YJPA 3UODA 2JKOA 5LJJA 3MN3A 4ID7A 5KBRA 4FEUA 5L6PA 1SZMA 4FTUA 1SMHA 4DINA 2W9ZB 2PMIA 3DCVA 3KRWA 3OUKA 3QTQA 4I6HA 4LRJA 2V7AA 4U5JA 5EM7A 4F99A 5CSPA 2A4LA 1UKIA 2FUMA 4QMWA 2XKFA 2WMTA 3GGFA 3RZFA 5BQ0A 4MKCA 4E73A 4L45A 3TL8A 3AT3A 2VNWA 4DYMA 4PPCA 4ZSJA 3QKLA 3HRCA 1GIJA 3ZM4A 2PVNA 5G6VA 3UG2A 2C6MA 3FKLA 3CJGA 4MD7E 5JMSA 4CLIA 3O8TA 1PXNA 4D9UA 3R1NA 5BX0A 4OTRA 4Y95A 2BTRA 4P2KA 2R9SA 4ORKA 3BQCA 3EH9A 1A06A 4KBAA 4OTPA 5DFPA 3ACKA 4USDA 1XJDA 2B54A 3DBEA 3NW5A 3OY3A 4X2NA 4ANNA 4YHJA 3GENA 4XBUA 1IR3A 3MA6A 4YPSA 4I0SA 3EN4A 3G6GA 4IAFA 4O0UA 5LWMA 3ZM9A 3KL8A 4LQMA 4AAAA 4RRVA 4AXAA 2HWPA 3PXRA 1HCKA 1TVOA 5BMSA 5TKDA 3W32A 2GPHA 2A2AA 3MW1A 2C1AA 2DS1A 1YDRE 4IM3A 2PUNA 1JNKA 1OIQA 3OY1A 4XX9A 4I24A 3VJNA 4H39A 4NZWB 1ATPE 4ASXA 3RPSA 4AFEA 4AW1A 3O71A 5IF1A 4XUFA 5HX8A 4D28A 4BY9E 4JR3A 3DK6A 3ZO3A 4FODA 3AMBA 3L8SA 4EH3A 1S9JA 4HZSA 1OPLA 3A7GA 3CQUA 3KA0A 4QMUA 3Q4ZA 3BHHA 3KK8A 3I6UA 4CCUA 4QTEA 4IBMA 3WE4A 4KS7A 3W8QA 5M44A 4GVAA 3WBLA 4V05A 1Y57A 5LQFA 1FGKA 1OIRA 2Q0NA 3LXKA 1TKIA 2X7GA 2WTWA 4RIOA 3GUBA 3NUSA 5AP7A 3FDNA 4MNFA 5D11A 3QKKA 3PA4A 5CU2A 4CQGA 3TNPC 3VW8A 4HGTA 3GC0A 1YKRA 4PTEA 1VYZA 4IC7A 4I41A 2XRWA 2EUFB 5FEEA 3T9TA 2JITA 3OCBA 3UNKA 5IEYA 2XA4A 4DF3A 4NWMA 2EB3A 5HTCA 4BRXA 4M8TA 5GZ9A 3PRIA 4G34A 2WB8A 3HDNA 2YIYA 5EDPA 5JSMA 2HZ4A 3PE2A 4IMYA 4S30A 2RL5A 3LLTA 3DAJA 5HVKA 3R2YA 4JBVA 4WKQA 3WZDA 1YOJA 2Y9QA 4DEBA 2VWZA 2RKUA 2QOKA 3IDCA 4IZYA 2DQ7X 4FSZA 4C33A 5KMLA 3UYTA 4FTTA 4FTRA 4KWPA 5HNBA 2BZKB 1J1CA 1PHKA 2HZNA 2WZJA 5AR3A 3MI9A 2IW9A 2JEDA 1R0PA 3HA8A 3Q52A 3ZXZA 3TV7A 3C13A 2ITQA 4QMVA 4Y85A 3S3IA 3FLNC 3ZYAA 1GY3A 2UW4A 5AA9A 3ACJA 5F1ZA 2VNYA 4E6QA 3MH3A 3HVCA 2ZB1A 1MQBA 2W7XA 4RWJA 4O6EA 3NRMA 3C5UA 4CFNA 1OIYA 3FE3A 4UXLA 3BBTB 3KMUA 4M15A 4U42A 1XH5A 4DFXE 1FVVA 3DS6A 2QLQA 4R3CA 3TN8A 3TNWA 1H1SA 4DFBA 5FM2A 5JFWA 3EN7A 4IX5A 4UMUA 1G3NA 4HOKA 1Z5MA 4E5WA 4G3EA 4MD8E 2BR1A 2IG7A 2JD5A 4K18A 3Q6WA 3R0TA 5EKNA 5HZNA 4NL0A 2R3KA 2X2KA 4AF3A 3CPBA 2YABA 3FMHA 3NW6A 4YGAA 4LOPA 4LL5A 3U55A 3FYJX 3QTUA 2PE0A 4X6QC 4I5MA 4X2GA 4DAWA 4WNOA 4B6LA 3LFCA 4QNYA 2Z60A 3DK7A 3U8WA 4I21A 4EKKA 5IUIA 4FG9A 3U4WA 3MYGA 2C6KA 5EYMA 4M14A 3LAUA 3CEKA 5LXMA 2C5VA 3QCXA 5DWRA 3N4TA 4NW5A 3RCDA 3C4ZA 3QXPA 3S2PA 5HIBA 5AM7A 3IW7A 4E3CA 3TZ7A 3EQCA 3RAWA 5FWKK 4JG7A 4C57A 1UV5A 1WCCA 4RWIA 3KEXA 4JT3A 1M7NA 3GFWA 4FT0A 5IQIA 5KMMA 1YDSE 3HV4A 5FXRA 2HZ0A 3ZLXA 4QTCA 4D2TA 2UVZA 2OSCA 3JUHA 2W1DA 2A27A 1LP4A 4YC6A 3U9CA 2PVKA 5HCZA 2IW8A 2HWOA 3D7ZA 3DTCA 5DI1A 3CTQA 5HG7A 4BYIA 2GQSA 2QO9A 3DBFA 5BUIA 1OGUA 2X8DA 4ACDA 4EUTA 3C50A 3CGFA 2QR7A 4O21A 5AJQA 3WIGA 1PXKA 4FBXA 2JLDA 2B7AA 4R1VA 4KKGA 4EL9A 2BRHA 3FZPA 1NY3A 3DKGA 4UYNA 4YUQA 4I94A 3KVXA 2P2HA 4J97A 4BDGA 4CXAA 3EN5A 4PV0A 3HAVA 2XK8A 4RPVA 3OXZA 4B9DA 3I4BA 2VAGA 3VBVA 5E8SA 5B2MA 1XBAA 3VBTA 3PSDA 5CEKA 3VUGA 5I9UA 2V5QA 4EYMA 3RKBA 2GTMA 5EW8A 3ZEPA 5AUTA 1O6KA 4ZTMA 3PE1A 2J9MA 4BL1A 4QYYA 4UMRA 2UZVA 1IEPA 2W05A 3B2WA 3DJ5A 2YIRA 1UU8A 3QQUA 4Z9LA 3ZLWA 2XRUA 4J98A 4ANQA 5JK3A 5JRQA 1UU3A 5AM6A 4O0TA 4E5BA 3UYSA 4O91A 4CV8A 2UW9A 4AWIA 2X39A 4U6RA 1OITA 2ITPA 3EQFA 4E1ZA 2JGZA 2WMAA 1P14A 4U81A 3VF9A 5DT3A 3NYVA 4FL2A 2UZOA 3F2AA 4GK2A 3KF7A 2CLQA 3ORIA 1JPAA 2WTVA 2EU9A 4NT4A 5K5NA 4O7TA 2PZ5A 4IX4A 5L2IA 3ALNA 5IQHA 1REJA 2P55A 4XBRA 3EQIA 4RMZA 3MDYA 4ANMA 4J96A 5A4LA 5D7AA 3FI3A 3SXFA 5JFSA 3TUDA 2QVSE 2YACA 3QU0A 5C27A 4G31A 3DQWA 1KV2A 3BPRA 3DK3A 5M51A 4ZLZA 1F3MC 4O82A 2XKEA 3H3CA 5C26A 4FSNA 4IM0A 4QPSA 4R8QA 4UMTA 3LIJA 4ZS0A 4ONAA 3SDJA 1XKKA 3FZOA 4BDCA 2PUPA 2JDVA 5AAFA 1XWSA 3DA6A 3HRBA 3NLBA 3W10A 5ETCA 4FE2A 1FMKA 2XJ1A 3BYMA 5IU2A 4ZJVA 4J71A 2X2MA 5M57A 4I23A 4L9IA 4IW0A 1GJOA 2UUEA 5ITAA 4N70A 2X8IA 4FSQA 2WFYA 3IW6A 4O0XA 3KXMA 5FTOA 5TT7A 3BQRA 3S4QA 4GJ2A 5BVWA 4NTSA 5EM6A 4BDEA 2OFVA 4B8LA 5EQYA 4IFCA 5CSVA 2CKPA 2JBOA 3QTRA 2BAQA 3QTIA 3G0EA 2O64A 1CKPA 3Q5IA 3EN9A 4Q5EA 1YWNA 5CQWA 5BVFA 2PVFA 5BVOA 2ZM4A 2WMSA 3GI3A 5HO8A 1Q8YA 3JY0A 5F20A 4F6SA 5I5ZA 4WNPA 1RE8A 1YOLA 4EH9A 3VBQA 2O5KA 4Y8DA 3PSBA 3ZUTA 3A2CA 1L8TA 5A54A 3P78A 5K3YA 4ZZNA 3NZ0A 3TIYA 1FGIA 4QP2A 4EOSA 5E1EA 2CMWA 4J1RA 5KHXA 5HD4A 5JZNA 4V0GB 4BCMA 2ZJWA 5L6WL 4U40A 2XNOA 4EBVA 4A07A 4G2FA 5E91A 3HV6A 2PWLA 3HUCA 3DFCB 5AAEA 3LXPA 5CVHA 2JKQA 3SOCA 4FNYA 3PJ3A 5AR8A 4JX3A 1IAJA 3Q04A 4FSUA 1OB3A 2UZNA 4FTQA 3KN6A 4BBEA 3L1SA 2EWAA 2YERA 3QA8A 2CLXA 3A7JA 1GZOA 3DAKA 4FUYA 3DJ6A 4TWNA 3T8OA 3LFFA 2G9XA 1Q3WA 3EZVA 4BN1A 2XNMA 1XH6A 4KKHA 4YTFA 1F0QA 1QPEA 4ZJJA 4YBJA 3W8LA 5E8YA 4YURA 3EB0A 4QYFA 4DHFA 2ZMCA 3OROA 4J53A 5EKOA 1KUTA 3RNYA 3DZQA 1Y8YA 2R3LA 2WQBA 4M13A 4R7IA 5FQDC 5HE2A 4AOJA 4F0GA 4BDDA 2C68A 1XO2B 3CJFA 2Y0AA 2C30A 2GS7A 5ACKA 4M97A 4Y73A 5EW9A 4W9WA 4CYIA 4AGUA 4EOJA 3O7LD 4G5PA 2CGVA 3OBJA 3CCNA 3NEWA 4NU1A 3LMIA 5AV1A 2GQRA 3ZS5A 1JQHA 2R7BA 3TM0A 2BILB 4ENXA 2O63A 3OF0A 4Z55A 2W0JA 4LL0A 4NK9A 4Z7HA 4DE4A 3BV3A 4RIYA 2OI4X 5IQFA 4X0MA 3PWDA 4FNXA 4GG5A 3IGOA 5T68A 3W1FA 4EOQA 3DNEA 3LFQA 2DYLA 4QYHA 4TPTA 3TZ8A 4A06A 3CKWA 3BZ3A 3CIKA 4KSQA 1Z9XA 2IW6A 4YJOA 4YHFA 3PUPA 2VZ6A 3ZFMA 4XCUA 4HNIA 2QKWB 3OFMA 3PVWA 3UMWA 2E9OA 2R7IA 3R8MA 2R3HA 4GYIA 3RPVA 5HU9A 2OW3A 3ZONA 3MFTA 3MWUA 3R7IA 3D5VA 4KB8A 4E4XA 3EWHA 3B8RA 2FYSA 3JPVA 4BHZA 3OCTA 4ZXTA 3LQ3A 3Q4CA 5B0XA 4CG8A 4FR4A 3KULA 3NR9A 4G9CA 3RGFA 4EONA 4U41A 2VTRA 3R6XA 4TYGA 3G6HA 1X8BA 3BEAA 3GU6A 1RJBA 1PXMA 2C3IB 5HG9A 3RAKA 3UOLA 4AOTA 3K3IA 2WGJA 3EMGA 4KIPA 3PVBA 3MY1A 5L8KA 1Z57A 5CSHA 5IMXA 2BKZA 4OBPA 1BI8A 4BDHA 2WTDA 5A4TA 5ANGA 2HW6A 2ZOQA 4NIFA 5CYIA 4EI4A 2WEVA 1FVTA 1UA2A 1Q61A 1WBTA 2YM6A 4FT3A 2FSLX 4GK4A 4HGSA 4QP9A 5AR4A 5AUWA 3LMHA 3HV3A 2OICA 2V62A 4YO6A 4CFVA 3LM0A 2J0MB 4C4EA 3UQFA 1JOWB 4AP7A 2B55A 3AT2A 4AFJA 4L00A 2O0UA 4DBNA 1JSVA 1PXJA 4L01A 4MTAA 4TRLA 2F7ZE 3KXNA 3OG7A 3ZHPC 4IEBA 4IB0A 5CVGA 3JVSA 3PTGA 5HESA 3UZPA 5L2SA 3PVUA 5E90A 4O7RA 3M2WA 2GQGA 4C4IA 2C6DA 4IH8A 4QTBA 4YNOA 4RIXA 4CZUA 4EOPA 2YM4A 3QZIA 1ZYLA 5AP5A 1W0XC 2HIWA 3R1YA 1SNUA 2YDJA 1Q41A 4XV2A 5DRBA 2G1TA 2XM9A 3O50A 4ACGA 4EKLA 3FYKX 2CN8A 4NKSA 3WF6A 1YOMA 2EXCX 4JIAA 3WF7A 1MUOA 4BDKA 4CNHA 5AUZA 3D2IA 4OLIA 4P5ZA 5FDXA 3KRJA 3IOPA 4BCHA 3QUDA 3BYSA 2YJRA 3E7OA 3CP9A 1Q4LA 5KO1A 1S9IA 3AD6A 4D0XA 5BVDA 3GQIA 2W1EA 3COMA 3LJ1A 3QX4A 1E9HA 3OXIA 3P5KA 4EOKA 3NWWA 3SX9A 4CFUA 4V04A 1M7QA 2GFSA 4ITIA 2CGUA 3QCYA 4RWKA 1U5QA 4ITJA 3SHEA 4AW2A 2R5TA 5FBOA 4CTBA 4E4NA 4C3RA 3ZMMA 5I3RA 3LCKA 4GT4A 5JGAA 2CKEA 3ID6C 4AN9A 5M06A 4HGLA 4I6QA 5M09A 4F65A 4DLJA 3SXRA 5ETFA 3EQPA 4FZDB 2IWIA 3OS3A 3P79A 3TKUA 3W55A 1H0VA 2BZHB 4QRCA 3WZEA 2C3LA 5JN2A 2DWBA 2X4ZA 1AGWA 3P4KA 5IH6A 5DT4A 5M4UA 4G3GA 2R2PA 4KBCA 3RTPA 1CTPE 4HPTE 4BI1A 2OF2A 2I7QA 4M66A 4L3JA 2VWVA 4TKSA 3BRBA 1IASA 4WD5A 4IIRA 3Q2JA 4C4FA 4RVKA 4IWOA 4DGLC 4BGGA 5L4QA 2WMVA 2J0JA 3O2MA 3V8SA 2A0CX 2E2BA 3R30A 2QOCA 2OJ9A 2VN9A 5EHOA 3VN9A 5AP6A 4X21A 3PY3A 2W9FB 2RG6A 5D10A 2FB8A 2J5FA 3POOA 4G3CA 3TNQB 4AGCA 5HNIX 4DGGA 2HZIA 2VU3A 3E3PA 4FK3A 4IADA 4ACCA 4AOIA 5AADA 2XIYA 5CU0A 1PY5A 4O38A 1APME 4FKVA 4X7QA 2I0HA 4FKUA 4MWIA 5AIRA 5FGKA 4PDYA 4S2ZA 5IQEA 5HORA 2PVLA 3MIAA 4LMNA 4IVAA 4FTOA 3UBDA 5CZHA 3A7FA 4HCUA 2R64A 3DT1A 4IHPA 4DH5A 3VS5A 5TF9A 4HVIA 5HE0A 2B0QA 4ZP5A 2PVHA 2VD5A 4MCVA 4J8NA 5AV3A 4GKHA 3OW4A 1HCLA 4FZFB 4BCNA 4H3BA 5LVOA 2BFYA 4BWKA 2WOUA 5L8LA 4ZS4A 3R9NA 3C4CA 2HY81 2OZOA 2V55A 2X7OA 3BGZA 4MYGA 4NJDA 4YJSA 5I9VA 1PMEA 5EM5A 4OAUC 3RINA 1SNXA 4H1MA 5HGIA 5D7VA 3VBWA 3FSKA 2CPKE 3KXZA 4YLKA 4ZY4A 4C8BA 1YI3A 4FKWA 4B7TA 3SLSA 4F0IA 2WELA 5DPVA 1GAGA 2PZPA 3QTZA 3RM6A 4E7WA 4EOOA 3JR1A 2BROA 3D2KA 4XHKB 3C0IA 4K77A 1H25A 2OU7A 4AZWA 2UZEA 4AX8A 4RVLA 2XYNA 3D4QA 3QCSA 4Y72A 4EOMA 2PMNX 3CBLA 2CCHA 1XH9A 5C03A 4CV9A 5IQCA 4UEUA 2OZAA 4AW5A 4EZ7A 4F1MA 3TNIA 4HVHA 2VWXA 4N0SA 5E8XA 5FTGA 4GCJA 5JQ5A 1R0EA 1YW2A 4W4VA 2VTSA 3VBYA 4JBQA 3R7VA 2W96B 5BYZA 3MVJA 4GH2A 3LE6A 2BHHA 5HG5A 4C4GA 4GRBA 1BX6A 2OBJA 4AE6A 3MH2A 3NNVA 4A7CA 3ZLYA 2BMCA 3FZSA 3UOHA 3QGYA 2OLCA 3TKIA 2VTMA 4MVFA 1OL2A 4YZ9A 2CNVA 4FTIA 4L6QA 3F66A 2WTJA 3TEIA 4ZSGA 3GU4A 3JYAA 2Y4IC 3LFBA 3EFJA 3BWJA 3NUAA 3PSCA 4FV4A 3ORNA 2VTAA 2YDKA 3AC4A 2ZV7A 3Q6UA 1YXSA 2YM8A 1YHVA 3KRRA 5KHWA 5KMNA 3QRUA 3LHJA 4UY9A 4MAOA 3K3JA 3ULZA 4OUCA 1ZARA 5DEYA 3BU5A 4FSMA 3MPTA 5L2TA 4JJRA 2B53A 2C6OA 2ZM3A 4BCQA 2VTPA 5J5SA 2HYYA 4H58A 3G33A 2XK6A 4TTHB 4TWPA 5CU4A 4AACA 5JQ8A 1ZRZA 3DLZA 3QD3A 4WUAA 4KSPA 1YI4A 1UNGA 5CEPA 5GJDA 4NW6A 4PDSA 3F69A 4YHTA 3QALE 3HYHA 4H36A 5J1WA 1Q62A 4XV3A 3QC4A 4Z16A 4FKPA 2PTKA 1Y6AA 5BUEA 4WHZA 1U4DA 3DZOA 5EI8A 5LVMA 2YCRA 4FIIA 3V04A 4QMTA 2WMWA 3W33A 4EUUA 4U9AA 4DEGA 3DXQA 4EZ3A 2VTOA 4YJVA 4DITA 4EH7A 3U87A 5JH6A 4O1OA 4R3RA 2BRGA 3R9DA 3QYWA 5E1SA 4D1ZA 1ZYCA 2OG8A 3KF4A 2RFEA 2FSMX 3EZRA 4ASEA 3V3VA 4GVJA 1UU9A 4YZCA 4L7SA 1BL7A 4APCA 2E9PA 4PP7A 3EYGA 2Q83A 5TE0A 4JG6A 3I7BA 4BZNA 3FLSA 1PXLA 4FVQA 4Y46A 4D9TA 2PL0A 4JLCA 4U0IA 3H9FA 1OIUA 3R02A 3DDPA 4NFNA 5I9ZA 3QQLA 4AG8A 2GNLA 2C3KA 1J3HA 3CGOA 4P90A 3SGCA 1Q24A 4RX5A 2CHLA 3RPOA 1ZYDA 2VWYA 2XK9A 2YM3A 3TTIA 2J50A 4FTJA 4IWQA 3EQBA 3R9HA 4AZTA 1WAKA 2QCSA 5DH3A 3RM7A 4J95A 4IE9A 4WG5A 5B2LA 3HX4A 3L8XA 3RCJA 4FIGA 4F4PA 2PUUA 4G6OA 4H05A 1PMUA 2UZWE 4DTAA 3C1XA 2F49A 4IQ6A 4CZTA 5HLNA 4O7ZA 5LMBA 4WSYA 5D12A 5D41A 3UQGA 4BTFA 2JDOA 4U79A 1XH7A 2W4JA 4F0FA 2NPQA 3IDPA 4ERWA 4YJUA 4I92A 3WOWA 4EYJA 3WF5A 3Q60A 3U9NA 4IB3A 5IPJA 2PZYA 1G8AA 1U54B 3KCKA 4KIKA 4PTGA 2JIUA 4F7NA 1NVRA 5CXHA 2CGXA 4Z7GA 5IA5A 3ZTXA 2PVJA 4JBOA 3NUNA 4XOZA 2JDTA 4OAVB 1O6YA 2I40A 5FP5A 5JGDA 4CRLA 4QMZA 3NVMB 4EH8A 2OJIA 4DG2E 4C62A 2I0EA 3EJ1A 5FXQA 4YP8A 4QOXA 1H1WA 3E8CA 3RVGA 3DBCA 3QGWA 4IWDA 4QPMA 3HEGA 4TWCA 3A7IA 5CS6A 2P33A 2V0DA 3PY0A 4HYHA 3ORKA 5M55A 4B0GA 4NM5A 4ITHA 4KRDA 2XNNA 4F7LA 1BKXA 3AC2A 4RA5A 4DH1A 3R8VA 4JXFA 5EW3A 3HZTA 2X81A 5IA4A 4JI9A 5E8VA 5AP3A 4F6WA 4MH7A 3F5GA 5J8IA 2QONA 4EK3A 4R5YA 5CEOA 5FP6A 2XYUA 2XKCA 3JS2A 3FAAA 4LFIA 5KZ0A 3UNZA 4E6CA 3EFWA 4FV0A 5GJFA 1VJYA 2WTKB 4Z3VA 3NUUA 4G16A 3SAYA 4A4XA 4ERKA 4AZFA 2AC5A 3QTXA 4E8AA 5CQUA 1FQ1B 3E8EA 1WBSA 5JKGA 5CANA 3BGQA 4MX9A 1Q5KA 5HI2A 4TYJA 4HVSA 1ZZLA 2XB7A 2XP2A 4QMSA 4PPAA 4EK6A 1IRKA 2O65A 2OJJA 3MY5A 3JXWA 5HNGA 4NYEA 2PUIA 4YNEA 1U5RA 4C4JA 2X0GA 4XG8A 3BHYA 2WXVA 3BLQA 3MA3A 2BFXA 2B9IA 3QRKA 5HOAA 4PPBA 5HX6A 4JDKA 4NIFB 3QLFA 5AR2A 3TV4A 1GOLA 4DLIA 3FL5A 1QPCA 4TZRA 2IN6A 3MTFA 4MK0A 3SW7A 2NNWB 5ICPA 4GSBA 5M4FA 4XLIA 3IOKA 4FT9A 1OL6A 4O84A 3OT3A 4YZNA 4F9BA 4ZZOA 3UO5A 1ZOGA 4GW8A 3NGAA 4A9YA 4JDJA 4X2KA 2XBAA 3ZO2A 3D5UA 3GCVA 3NUYA 4UB7A 4I4FA 4UALA 1R3CA 4UYAA 4CMTA 3QBNA 1YXUA 4JVGA 2VWUA 1VR2A 3PYYA 5AR5A 3GOKA 3ZO1A 2I0VA 4WNKA 1SVHA 3R22A 1W84A 3AD5A 4QMOA 5C4LA 4DEAA 3VRZA 4F6UA 5CX9A 5TR6A 1ZY4A 3AXWA 3PXFA 4NM3A 4DFYA 2PY3A 1NVSA 5C4KA 5I0BA 2JIIA 2HK5A 2WMUA 4MEDA 3SV0A 4BHNA 4DH8A 5KMIA 5HKMA 4AT4A 4BC6A 1P4FA 2R3FA 2ETKA 3P7BA 3RMFA 4FSRA 4F7JA 4TNBA 3ENHA 4F63A 5FUTA 3VUHA 4EHZA 3ZXTA 5HICA 3SW4A 1IA9A 3W2QA 2R3JA 5BVKA 3POZA 5T6KA 2FSTX 4G6LA 2H96A 1T46A 3P86A 2VTNA 4APPA 3BE9A 4D0WA 3FC1X 2OXDA 5KUPA 2GHMA 4RJ4A 3NCGA 4MXAA 4J7BA 4FSYA 4PDPA 3R8PA 1QMZA 4E26A 5HE1A 1JKKA 2YITA 3RK5A 4RZVA 4K9YA 5F95A 3OWKA 1MP8A 2QLUA 4MQ1A 2J0LA 2PZIA 3OTUA 4I4EA 2QO2A 1KE9A 5HBHA 3D9VA 3PXKA 3R2BA 4MQ2A 2ZB0A 4GU6A 2PU8A 4FG7A 4KS8A 3ZSGA 2W5HA 3FC2A 1Y6BA 3GBZA 3ORLA 3GU5A 4G17A 5EDQA 5BMMA 4EHVA 1CM8A 3IKAA 5LMKA 1W8CA 2B4SB 3G2FA 4ASDA 2WU7A 3ZSIA 2PHKA 4UXQA 3DBDA 3I5NA 4BI0A 1OKVA 1IG1A 3CTHA 1ZLTA 4OBQA 1PW2A 3C9WA 2W17A 3IDBA 3LFAA 4ZY6A 1OI9A 5KX8A 2QHMA 4U44A 4PUZA 3GCQA 3FPMA 4DN5A 2R3GA 3ET7A 3VS6A 4KA3A 4IVCA 3RBWA 4IC8A 3UZRA 4XG2A 4R7HA 2YM7A 2QOOA 4JBPA 4O0SA 4S33A 3DAEA 1P4OA 3KGAA 3M11A 4YSMA 3QHWA 4F64A 4RFZA 3ZZWA 3R9OA 1H24A 3I6WA 1H07A 1QPDA 2XJ0A 2GS2A 3PP0A 4TYHA 3LKMA 3P23A 4YJTA 2P4IA 3UE4A 4IX3A 1SYKA 2KULA 4FNWA 5KBQA 3KQ7A 2X8EA 2F2CB 4AA0A 4QYEA 4BDIA 3NW7A 4QP4A 1OPKA 4D2SA 2R3QA 3C4XA 3VS2A 3ZRKA 4KABA 1QL6A 4LGHA 1V1KA 5LVLA 4FKRA 1DS5A 3EKNA 1GIHA 1XBCA 3EIDA 3FQEA 4X6RA 3O96A 5AMNA 4FYOA 4GJ3A 3DNDA 5DBXA 4X3FC 3PA3A 4EH4A 2GMXA 4LRKA 3E8DA 2OXYA 3TTJA 5M56A 3VS1A 2G2FA 2UW0A 2XM8A 3FMMA 3FLWA 3QL8A 3QQKA 3TG1A 1GIIA 4ALUA 4QP8A 1M52A 3TJCA 1XQZA 1J91A 5JGBA 3ZFXA 3QD2B 2OKRA 4ZZMA 3ZEWA 4L68A 4C3PA 3L9PA 5DG5A 4WT6A 3UP2A 1PMVA 2NRYA 4YC3A 3TNHA 4IANA 2OGVA 4I1ZA 4JNWA 3Q4UA 3QZGA 5EYDA 3THBA 5BYLA 4HVDA 2X7FA 2PZRA 1WMKA 4KKEA 3BCEA 5IEXA 2C69A 3MFRA 4O86A 3UC4A 3PG1A 4BDBA 3VAPA 2C0OA 3MB6A 2REIA 4K6ZA 5B7VA 3ODYX 2QOHA 5EH0A 3AGMA 1WFCA 3SVVA 2QHNA 3R63A 4RJ8A 4B4LA 2YIXA 5HIEA 3EOCA 3E5AA 3UO4A 3FZTA 4OTHA 3BHVA 4S34A 4U7ZA 4M12A 4PTCA 4DBXA 5F4NA 5D1JA 4CRSA 2VGPA 3H0ZA 3F3WA 4GG7A 1KOAA 3KCFA 2BCJA 4EJNA 1ERKA 3CLYA 4FK6A 3DKOA 3BBWA 4XP0A 5T3QA 3BGPA 2AUHA 1H1QA 3LQ5A 4R6VA 3QRTA 4NCTC 2UW3A 3G9LX 4E93A 5CSXA 4P4CA 3W2PA 5I9XA 4GV1A 2BZIB 2VTIA 3L9NA 4KRCA 4MXCA 2GHGA 3RALA 4V01A 4FVPA 3FEGA 5HVYA 3COKA 2BKKA 5AP0A 1YVJA 2PMOX 2XIRA 4I6FA 4EWQA 5EQPA 1E1XA 2I1MA 3FKNA 3OW3A 2XCHA 3OCGA 1LUFA 1P2AA 4FIEA 4RVTA 4W4YA 4DA5A 4HJOA 2YHVA 4RJ7A 3QD4A 5ANJA 4C3FA 3VRYA 4BCOA 2J6MA 3MVHA 2YIWA 1O9UA 3O0GA 3OOGA 3QWJA 5DOSA 3R21A 3UP7A 2XJ2A 4L46A 5CLPA 2XIKA 4BYJA 1LPUA 4E6DA 4HYIA 4MHAA 2O2UA 3RK9A 1LEWA 4FKIA 4CFWA 4RIWA 3BELA 1IA8A 4FVRA 3R8ZA 4XG4A 4S32A 3VJOA 4N57A 2Z2WA 5IA1A 5AIKA 4WRGA 4AZSA 3OVVA 4FI1A 4E4LA 3S1HA 4IX6A 3DV3A 5E7RA 1TQPA 2LAVA 3KB7A 5CNOA 1PXOA 4NM0A 4GIHA 4IJ9A 3TZ9A 3VULA 4GK3A 4GMYA 4F1OA 4FT5A 4FKSA 2X6EA 3AOXA 2VUWA 4U80A 2JFLA 5HU3A 3MESA 3ATTA 4E6AA 5AP1A 4D5HA 1KE5A 2UZLA 5CTPA 4EBWA 3PIZA 3V5JA 4RX8A 2VRXA 5EYCA 2WMQA 4FG8A 5DHJA 2WIPA 1KE7A 2YM5A 1T45A 3D14A 2H9VA 3C4EA 1GNGA 3AC1A 3MVMA 4LRMA 4MF0A 2YN8A 5K0KA 4EK5A 3MGYA 4O0YA 5JFVA 5F94A 3EL7A 5DIAA 4JRVA 3SG9A 3D83A 4K1BA 3ZZEA 5GINE 3ERKA 5CAPA 4MWHA 4PL4A 4C02A 5CENA 4TWOA 3TKHA 3E92A 3RWQA 2IVVA 4IDTA 4QMXA 4GL9A 4Q5HA 3ZUVA 1UKHA 4FTLA 4LI5A 2J4ZA 4X3FA 3FXZA 4YJNA 3RJCA 3U6IA 4XRJA 3WF8A 3GFEA 1RDQE 5EOLA 4ENYA 5DEWA 4PMMA 2ZMDA 4QQ5A 3Q3BA 1U46A 3A60A 3R7UA 2DUVA 5FD2A 3W18A 3VUMA 3U6JA 1VYWA 2OIQA 2ZVAA 4HYSA 3OTVA 5KNJA 2B52A 3OXTA 5IZFA 3IG7A 3OWJA 4DEDA 5L8JA 4USFA 3GB2A 3ORPA 1XH4A 4UWBA 2QU6A 4L8MA 4NFMA 3II5A 2VWIA 4GIIA 4C38A 4QD6A 5H3QA 3CPCA 4EQCA 1R39A 3LXNA 4MNEA 4JG8A 1ND4A 2GTNA 4FEQA 5A4QA 3O23A 3QRJA 4FKLA 4QPAA 5ACBC 4A9TA 1YDTE 4JRNA 4CYJA 3CQWA 5K0XA 3BYOA 5IH4A 4BGQA 3BLHA 5HG8A 3C0HA 2Y4IB 3FPQA 4RQVA 5A6OA 3I1AA 4BWPA 2W4KA 1LEZA 2XNPA 4EQMA 5C8KA 3KY2A 3UJGA 3KK9A 4D1XA 5LCJA 5HE3A 3T3VA 3SQQA 5C8NA 1HOWA 1JWHA 1V0PA 1F5QA 2YA9A 4YZMA 5FBNC 3PJ8A 4CT1A 2YJSA 2R3PA 3BU6A 2J7TA 3PLSA 3QF9A 4NCTA 3PWYA 4OTDA 4YPDA 5K4JA 3E88A 3TDVA 2Z7QA 4XJ0A 5CEMA 4EK4A 4QTAA 1QPJA 1OKYA 5AWMA 3I81A 1H1RA 3GC8A 2SRCA 1R1WA 3EFKA 1JVPP 1R78A 5DGZA 4Q9SA 5BNJA 4MBIA 1VEBA 3ZSHA 2OJGA 4BGHA 2CKOA 5IQBA 2BVAA 4BWXA 4BKZA 1OECA 2OF4A 5CT7A 5HO6A 3VUKA 4EH5A 5DR2A 3TI1A 2XH5A 3A4OX 1Q8TA 4O0RA 3S0OA 1GZ8A 2F7XE 3FI2A 1BMKA 3BLRA 3D7TA 4M68A 5LWNA 4AT3A 3OEFX 5GZAA 3A7HA 4ZMEA 3G15A 3VHEA 1FMOE 2W06A 3NIZA 1PXPA 3F3VA 2KTYA 3RNIA 2QOQA 4ANSA 1OVEA 2HENA 4ZTRA 4P7EA 3VHKA 3NCZA 4L67A 3NYOA 4BICA 5EI6A 2VTLA 3AQVA 4FEXA 4XV1A 5KE0A 1WBOA 3MH1A 4I6BA 5EOBA 4ZY5A 3Q32A 5HCYA 3HUBA 2QG5A 4IWPA 4JQEA 4JQ8A 2BAKA 2ZM1A 3LOKA 4PL5A 4PNIA 2GHLA 3ITZA 2UVXA 4R77A 3KMMA 2W99B 5CT0A 4R7BA 3LFEA 2ZDTA 3PXZA 1M2PA 2I0YA 2IPXA 4ZLOA 2OH4A 1ZMWA 5A46A 5HBEA 4UZHA 5C1QB 1URWA 3Q2MA 4QQCA 2C6TA 1YI6A 1H8FA 4U3ZA 4WG3A 4ZSEA 1PRYA 3GP0A 3CKXA 3VUTA 4CQEA 4KIOA 4EZ5A 4AN2A 2NP8A 3AT4A 4TW9A 3NNXA 4BTJA 4YTHA 5M08A 3U4UA 4FX3A 1OUKA 3ETAA 4DC2A 2ITNA 4FKJA 3BV2A 5GZ8A 2YLEA 5EG3A 4O7LA 3UNJA 3VS4A 2XNEA 3NUXA 4TN6A 1OBGA 3HMNA 2ZAZA 2C0TA 5DE2A 1E1VA 4FA2A 4XG3A 4DH7A 2PULA 2HCKA 2WTIA 3O7LB 2W1FA 4EOIA 3H9OA 3RAIA 3IGGA 3PIYA 4LGDA 4JDHA 3V5WA 4C2VA 3UOJA 3HDMA 5AUYA 5AFVA 1DAWA 1AD5A 2C6LA 5E8ZA 5JFXA 2XCKA 5CAOA 4FTAA 3P1AA 3KU2A 4ACMA 3IONA 3WILA 5J7BA 4I20A 1M2QA 5CU6A 5CEQA 4RLLA 4MXYA 1UU7A 4DCEA 4BIBA 1UVRA 2BPMA 2IZSA 2ETMA 2W5AA 4YTCA 1GZNA 1OL5A 2HW7A 1REKA 2CSNA 3QWKA 2YLFA 3HL7A 3BU3A 5IG1A 3O17A 4XS2A 3V5LA 4L44A 3GU8A 4E5AX 3K5VA 1YXVA 5IKWA 2GNIA 4GFGA 3DTWA 4L7FA 3V5QA 3AG9A 4EWHA 5J9ZA 1PJKA 2UW8A 5IDPA 2B9FA 3EQDA 4D58A 4IB1A 3COIA 4P5QA 3NDMA 4IAKA 4YSJA 4IVDA 5EHLA 4EK8A 2O8YA 4BDAA 4JDIA 1UWHA 3ULIA 4D4RA 3LM5A 4CLJA 2V22A 3F88A 4RC4A 3R7YA 3RWPA 2PVMA 3UG1A 5LVNA 4W4WA 3DLSA 4U45A 4D2VA 2BRMA 2F7EE 4FEVA 5CAQA 2BIKB 5HLPA 2QOIA 4ANOA 3ZCLA 3HP5A 2GCDA 3DXNA 3TT0A 4F08A 2F4JA 2RFSA 3A8WA 5CI6A 2VO7A 3REPA 1J7LA 4Q2AA 4FIJA 4RC3A 4QMPA 5I4NA 2G2HA 2CKQA 4ZOGA 5JRSA 3MSSA 1W82A 1BL6A 3FJQE 4IFGA 4QQJA 2WNTA 2ITVA 4TYHB 2BAJA 3RI1A 1MRVA 1WBNA 3TUCA 3BE2A 3HP2A 4NSTA 3D0EA 4NKAA 3QX2A 5KCVA 3PFQA 5H9BA 3UPXA 4AN3A 5IDNA 2PMLX 2RGPA 3DKCA 4LOOA 3D15A 2X1NA 3OHTA 3F3ZA 5HIDA 2R4BA 3DPKA 3K54A 4WUNA 5I3OA 4AZEA 2RF9A 2QQ7A 4GUBA 1NXKA 4PMTA 2W5BA 5K9IA 4QMLA 1U59A 3DGKA 3GCPA 4DEEA 3NYNA 2BDFA 4BCJA 5AUXA 3VQUA 2J2IB 2NO3A 3DQXA 3HMPA 3QKMA 4BR3A 2ONLA 2WIHA 2UZUE 4YR8A 3SA0A 3PVGA 4OBOA 4EH2A 3HLLA 4LV5A 4F9YA 5IA2A 4EJ7A 3K5UA 4MXXA 2FSOX 4G3FA 4RFYA 1ZMUA 4FTMA 4I0TA 2HXLA 2CN5A 2WOTA 3FMDA 1FOTA 3MH0A 4LUDA 4M69A 3S95A 4IXPA 4QMNA 4DT9A 1ZOEA 4WO5A 5EFQA 4FZ7A 2QI8A 1SM2A 4LM5A 3QUEA 4O27B 1ZZ2A 3ROCA 5HBJA 1DM2A 3ZU7A 4XRLA 3HAMA 3GXLA 2Y6OA 1MRUA 4FKGA 2C0IA 1DAYA 5KZIA 2OJFE 3OD6X 3GU7A 3UIMA 2C5XA 3IW5A 5CZIA 1WZYA 4I93A 4FV1A 4O0WA 4GU9A 4QT1A 2WQEA 1ZYJA 3D94A 1UNHA 5IISA 1JSTA 3PZEA 2JFMA 2HXQA 4NJ3A 3SC1A 1WVYA 2XUUA 1ZWSA 3OZ6A 3QLGA 1P5EA 3UIBA 4DG0E 3KXGA 4KD1A 4JL9A 2JC6A 5M53A 3P0MA 4FV7A 3FLYA 1OL1A 1OUYA 1KE6A 3FWQA 3KRXA 5FTQA 2PPQA 3CSVA 4DGNA 3FKOA 5CSWA 4WOVA 3DY7A 3ZFYA 4DEHA 1FPUA 3PLAE 1A48A 2Y6MA 4HZRA 4GS6A 4AU8A 4L43A 4FV3A 3R7GA 4H1JA 2X9EA 4PX6A 3SG8A 4B8MA 1H01A 3PZHA 5IA3A 3BKBA 4DTKA 2WTCA 4G3DA 1Q3DA 4RX7A 3VQHA 3W2CA 1JKSA 3CS9A 5ANIA 5GHVA 2WKMA 1H00A 2Y7JA 2NRUA 3BYVA 2Z7LA 4I5PA 3V5PA 5IQAA 1PXIA 2EB2A 2H34A 5CWZA 4ZSLA 2IVSA 4PMPA 3FUPA 4OW8A 2BDJA 3UZTA 2VX0A 2XNGA 4M7IA 5FM3A 4F9CA 4AGDA 5J7HA 3KVWA 3CD8A 4FZAB 5IH5A 2W1GA 3LJ0A 3TZMA 5AR7A 2R0IA 4PF4A 4ZK5A 5IQGA 3FLQA 1GZKA 2XZSA 3HV7A 2VX1A 5K4IA 3IO7A 3LXLA 2ZV8A 3CR0A 4PWNA 4RJ5A 1KOBA 4RIWB 4BI2A 1Q97A 3ZO4A 3FXXA 4KIQA 4O22A 4FGRA 4UWYA 4M0YA 4W4XA 4BKYA 4ZIMA 3EL8A 4D1SA 4O7VA 3W2SA 4R1YA 3CY2A 2X6DA 2G15A 3MVLA 5DLSA 2H8HA 3D5WA 3IQ7A 4JAJA 3ZC5A 4UZDA 4FTNA 4EEVA 4LV8A 4ALWA 3BX5A 2UZTA 4K0YA 5LMKC 4RWLA 3ZOSA 4RIYB 3VC4A 3NSZA 3MS9A 4D4VA 5AUUA 5J79A 5GIPE 4C37A 4MD9E 3T9IA 3UO6A 3LW0A 2EXMA 1PKDA 4Q9ZA 4DTBA 4ZMFA 3OC1A 4I0RA 2YFXA 1M17A 5H8BA 3FMLA 4EORA 4FGBA 3WZJA 4FZ6A 4NH1A 1VZOA 2YIQA 4N6YA 4FMQA 4FKQA 3SXSA 2XIXA 1TQIA 2QNJA 3R8UA 1BUHA 4BFMA 4F70A 1UNLA 1H28A 3Q9WA 4I22A 4PY1A 5L2QA 1V0BA 4BCFA 3PA5A 3U6HA 5EHYA 1NVQA 3GCUA 4BF2A 4HPUE 2J51A 4N4SA 2R3OA 2XK3A 4AT5A 3C7QA 4X3FB 4A4LA 1OL7A 3RPRA 3KULB 2AYPA 2BZJA 2W1IA 2IZUA 4BCIA 3NYXA 3FHIA 2W1HA 4YLLA 3G9NA 2QKRA 5TO8A 3SRVA 3JY9A 2C47A 4CFMA 2CCIA 2CDZA 3I79A 4CFXA 2OIBA 4O2ZA 3WF9A 2P2IA 4C59A 3UC3A 4W8EA 3VVHA 4WA9A 4KINA 3UVRA 3ZBFA 1Y91A 1W98A 4K2RA 1A9UA 2XF0A 3QUPA 4KBKA 3VUDA 5DVRA 5CF8A 3VNTA 2QG7A 4MNEB 3CQEA 4FYNA 5KKRC 4KUJA 4F9WA 3FXWA 2BHEA 4DH3A 4NUSA 4C35A 3PPKA 4L42A 5KMKA 3R71A 4GUEA 4J52A 1OZ1A 3L9LA 2GU8A 3LLAA 3E8NA 2PE2A 4YJRA 3P7AA 3LFNA 4II5A 4O2PA 3R04A 3MV5A 2A1AB 4EC9A 5HLWA 2FGIA 3VS7A 2ERKA 4IM2A 4U97A 3Q96A 3EYHA 1OKZA 4LGGA 1J1BA 4RG0A 4BDFA 3DJ7A 1Q8ZA 3F82A 4RC2A 4RIXB 1YWRA 4IZAA 4J8MA 3CD3A 4DFUA 2XK4A 1RW8A 2JKKA 1OBDA 3KN5A 4MXOA 4XEYA 4ZLYA 3MTLA 4NTTA 3E7VA 4QP3A 4QTDA 1K2PA 5G1XA 3QQJA 3R00A 5HVJA 4BTMA 2FH9A 4IVBA 3TJDA 4CEGA 2HELA 3FY2A 3HNGA 4U3YA 1DI9A 1JSUA 2OO8X 4HNFA 3E64A 3MPMA 3AMYA 2FVDA 4KNBA 2WMBA 4FF8A 4CTCA 2IVTA 2CJMA 4FIFA 3R1SA 2BRBA 3FV8A 4GEOA 3ZDIA 1PF8A 3R83A 4L53A 3O51A 4JQ7A 1WVXA 1YHWA 4M67A 3GC9A 5BUJA 4A9RA 4IB5A 4OT6A 4Y5QA 5BYYA 4L52A 5CASA 5EQEA 4W9XA 3C51A 1JKLA 2PVRA 3MIYA 1H1PA 3DB8A 4F09A 1M2RA 4ZAUA 5AV4A 4CKIA 5GJGA 2RFDA 3NS9A 2GNFA 3R9RA 3OUNB 5E8WA 4TYEA 3EHAA 2RG5A 2XIZA 3D7TB 3HECA 3QQGA 4PP9A 4AS0A 4C7TA 3GOPA 3QA0A 1W83A 2XNBA 5DR9A 5HQ0A 2P0CA 5DA3A 3Q9XA 4WBOA 2QODA 4GT5A 4ZSAA 4UN0C 1M14A 3FI4A 4FSTA 1JAMA 3NNWA 4CCBA 2VO3A 3FLZA 4WNMA 4FTCA 4O83A 3Q4TA 5I9YA 3MJ1A 5CI7A 4YJQA 4BBFA 4FV9A 2J0IA 2ITWA 5JEBA 4FKTA 2YCFA 3QQHA 4I5HA 5C8MA 3V6SA 2OXXA 3A8XA 4OR5A 3UPZA 4LUEA 4XH6A 3ZUUA 5DRDA 4AGWA 1JKTA 4ZTNA 2C5NA 3KRLA 4JR7A 3LFDA 2BUJA 3LCOA 3OEZA 1TQMA 4ZTQA 2R3NA 4JOAA 5CY3A 1FBNA 3M42A 3KXXA 4A9SA 3NMUF 2ZV2A 5DMZA 2R3IA 4IZ5A 2QC6A 3BI6A 4YZBA 2X2LA 5EK7A 3RHKA 3F5UA 4AQCA 5I9WA 3AC8A 4OGRA 2E9NA 3H9RA 3TUBA 4ACHA 3G90X 3QQFA 1CMKE 4XYFA 4CFFA 2UZBA 4FV2A 2Z02A 3QTSA 4QO9A 4IZ7A 2ZV9A 3RK7A 3A62A 4BZDA 4DFZE 2UW6A 2W1CA 3TV6A 4C36A 4DFLA 3UOKA 1WBVA 5HCXA 4BIEA 3B2TA 3HMOA 2QOLA 3GT8A 3GVUA 1LR4A 3KMWA 4OTIA 4C58A 1ZY5A 1I09A 4C2WA 2XEZA 4BVUA 4XMOA 3QAME 2IO6A 5C9CA 5AA8A 3P7CA 4WG4A 3UVPA 4M84A 5H8EA 4D4YA 2VTQA 2JKMA 1XBBA 3QD0A 3QYZA 3PRFA 4IAAA 3ZH8A 4D2RA 4DFNA 3OMVA 3DFAA 3OT8A 2QR8A 4HCVA 1J7IA 4KAOA 2OZAB 2WTKC 1PKGA 2C5YA 2OIDA 5LMAA 2YZLA 3GCSA 3F9NA 3WYYA 2P3GX 2WAJA 2ITXA 2QD9A 4JAIA 4F1TA 3UTOA 3MFSA 4WRSA 4N6ZA 4D2WA 4RBLA 5ETAA 3U54A 4H3PA 1KSWA 3VW6A 3E3BX 2OK1A 4YBKA 2ITUA 4A9UA 3CTJA 3V8TA 4PDOA 3QFVA 3TWJA 3LQ8A 4D4SA 3K2LA 3FQHA 5ANOA 3CE3A 1CKJA 1YWVA 4BDJA 4EHEA 4AUAA 1J7UA 2XBJA 2RSVA 2GFCA 2CGWA 5A14A 1WBPA 3NUPA 4L3LA 5CAVA 5EYKA 4F7SA 3O8UA 3PPZA 2JIVA 4UBAA 5FEQA 2JDRA 4PNKA 5KMOA 3ZLSA 5J95A 3IECA 4JS8A 3PP1A 5FRIA 4AW0A 3R8LA 3OOMA 3FQSA 2ACXA 4YC8A 1ZOHA 3ROYA 3A4PA 3ORTA 3RP9A 4ALVA 4IDVA 3RHXA 3QCQA 2PVYA 3N9XA 4RT7A 3DXPA 4D5KA 3V8WA 4DGOA 2ITTA 2FA2A 2YISA 5E8UA 3CC6A 2UV2A 2GNJA 5BPYA 4RJ3A 2ZDUA 4AE9A 2RIOA 3UMXA 3H30A 4U8ZA 2YZAA 1UWJA 4AA4A 3F5PA 2YWVA 5IEVA 4XNEA 4RA4A 3C5IA 3F61A 2C4GA 3ORXA 3VIDA 2VTTA 4ASZA 4QMYA 3MJ2A 1G5SA 4GFMA 5J87A 4MXZA 3N4VA 2PSQA 2UZDA 2UW7A 3ELJA 4GYGA 5LCKA 4K11A 5HO7A 5HTBA 4OTGA 1NW1A 1ZAOA 3LJ2A 4M69B 4X3JA 5FLFA 4IAYA 4FOCA 4HCTA 5CNNA 3FBVA 5ETIA 4CKJA 3ATSA 5DN3A 5H8GA 5BVNA 4BCPA 1SVGA 3MB7A 2E9VA 3TCPA 4PRJA 3N51A 2QOBA 1ZMVA 3WYXA 3AD4A 5A9UA 3D5XA 4ARKA 2B1PA 1CKIA 3FZ1A 1U54A 3QHRA 4O7SA 2QOFA 4FIHA 5DNRA 2ITYA 4TNDA 4JIKA 2PYWA 3SKCA 2XVDA 2Y4PA 4UMPA 3QZHA 5EDRA 3HA6A 3HMIA 3ORMA 3V5TA 4FUXA 1KE8A 2QO7A 4FV6A 4M3QA 3LCSA 2GDOA 5GIOE 3R1QA 3F5XA 3WE8A 3UIXA 2R3RA 2YAAA 5AP4A 1W7HA 4O7WA 3HKOA 4FSWA 4QQTA 5CU3A 5J1VA 3GQLA 3V6RA 3F2NA 1H27A 3T3UA 3A61A 4UMQA 3FMEA 5EM8A 1PMNA 4O7NA 3H10A 5E4HA 3Q9ZA 2VWBA 3ZRMA 2Q0BA 5JT2A
chains in the Genus database with same CATH superfamily
1CSNA 1L3RE 2GS6A 1FINA 2ZYBA 5LVPA 2RFNA 4BIDA 4O0VA 4MBJA 3BHTA 3NIEA 5CXZA 2XMYA 3FMNA 4W8DA 4CD0A 1Q99A 3I7CA 3ZBXA 2IZRA 2X9FA 3F3TA 3FI8A 3AC5A 4USEA 3S00A 3OP5A 3GNIB 4ZEGA 3PIXA 3UIUA 1Q8WA 1B38A 2B9JA 3CXWA 4MF1A 5AUVA 1ZYSA 4KIKB 5H2UA 2CNUA 5B2KA 2J90A 3VWAA 2OFUA 1MQ4A 3W0QA 2WEIA 4FEWA 2VGOA 4O6LA 4YZDA 2E9UA 2W1ZA 5E92A 2IZTA 2X4FA 4XV9A 4MBLA 5ANEA 5ANDA 2G2IA 3L8VA 1OM1A 2BALA 2BRNA 2IJMA 5AP2A 2BTSA 4QP6A 3Q9YA 5K5XA 2Z7SA 3R7OA 4D2PA 3F3UA 3LMGA 4CGAA 5J9LA 4R78A 3FZRA 5EI2A 3OBGA 4UWCA 2BIYA 5CVFA 4XLVA 2VTJA 2C3JA 4HGEA 3TIZA 2WU6A 5GNKA 2Z8CA 3WARA 4RSSA 4RJ6A 4FICA 3IS5A 3FL4A 5M4IA 2WO6A 4HVGA 2GNHA 4QDVA 4FT7A 1JLUE 3DB6A 3DU8A 3KREA 4G9RA 3F2RA 4BZOA 1G8JA 3PG3A 4O1PA 5L2WA 5AV0A 3P08A 3GEQA 2WQMA 4FV5A 3ZRLA 4EOLA 1BI7A 2ETRA 3FY0A 3ANQA 5D9HA 3H4JA 2R0UA 3ML1A 4YMJA 1JBPE 5CEIA 2HOGA 3RAHA 4BCGA 3QTWA 3OWLA 4X2JA 4O96A 2ITZA 3ANRA 2UVYA 3P9JA 4CVAA 3O8PA 4TXCA 2HAKA 4JX7A 2GSFA 4BBMA 4YO4A 1URCA 3C4FA 3E93A 4RGJA 4CMUA 2Z7RA 4AZVA 4WBBB 4QNAA 1YHSA 1H0WA 3BHUA 3I5ZA 2VX3A 2V7OA 4L3PA 2IVUA 4QYGA 4WSQA 3VS3A 5A6NA 5AX9A 5J9YA 5JZJA 3NAXA 3E62A 4ANBA 3G5DA 4UV0A 5FDPA 2JAMA 4QMMA 4S31A 3SRVB 5J5TA 5F9EA 1NT2A 3E87A 4J99A 1MRYA 4RLKA 4F9AA 3KFAA 1AQ1A 2C5OA 4Y5HA 3BYUA 3PJCA 4PL3A 4IJPA 2XEYA 1BYGA 3EFLA 1STCE 5KMJA 4BB4A 3JVRA 3TYKA 2XK7A 5AAGA 2EVAA 4DGMA 2BDWA 2QURA 2VTHA 3W0MA 3ZC6A 3UQCA 1K3AA 2JDSA 4WIHA 2ONLC 4FOBA 4XP3A 2R3MA 1XHAA 3M1SA 4RQKA 3LFSA 3PJ2A 4K8AA 1ZXEA 3N4UA 3KXHA 2WHBA 1H26A 3PY1A 4I3ZA 2YEXA 4DCAA 4CZYB 3G51A 2HY0A 5DT0A 5A4EA 2ERZE 3R7EA 1G8SA 1OKWA 3W2OA 3VS0A 3W16A 4DT8A 4FL1A 4HYUA 3OCSA 4FL3A 5E8TA 4CT2A 4G5JA 1YQJA 2FO0A 4ZTLA 3C4WA 2A19B 2PE1A 2YDIA 3QXOA 5BVEA 3EQRA 1PYEA 2NYAA 4FJVA 4AAYA 3BIZA 2VWWA 5CF6A 3NPCA 2A98A 4CKRA 1XR1A 3E63A 4FKOA 3F7WA 4EQUA 4RVMA 4U43A 3VUIA 4ZTHA 3PPJA 3DOGA 5IA0A 2YAKA 3VBXA 5CALA 3F6XA 4O7YA 3MY0A 2O3PA 4ZJIA 3SD0A 5L6OA 3I60A 1OMWA 1YXTA 4IACA 5E9EA 5HTIA 1V0OA 2XS0A 5L3AA 4FTKA 3DKFA 4FV8A 4LMUA 2GNGA 1NA7A 5FXSA 5M07A 5FEDA 4YTIA 4QP7A 3QC9A 1OPJA 4C34A 4OTQA 1QCFA 4BKJA 3CY3A 1EH4A 3FMKA 3QRIA 3W2RA 4GT3A 4PQNA 4CSVA 3TDWA 5FG8A 4TL0A 3AGLA 3FHRA 3ZDUA 4AA5A 2Y8OA 2J0KA 3EQHA 3NX8A 5A4CA 3QZFA 4X2FA 3HGKA 5TOZA 1I44A 4QP1A 1YXXA 5AV2A 1Q8UA 3COHA 3PXYA 4IAIA 1KWPA 2G01A 5CF5A 2OWBA 2F9GA 4H3QA 4BCKA 3RZBA 4OT5A 3GC7A 3VF8A 3BWFA 4C61A 4GFOA 3EN6A 3MFUA 2JAVA 4D55A 3WI6A 3ENMA 2VO6A 2YWPA 2WPAA 3KKVA 4FC0A 4Y83A 5DR6A 1SVEA 1K9AA 2XKDA 4G1WA 1BLXA 4LDTA 3IK3A 2AC3A 3IPHA 3Q53A 3I0OA 4BTKA 5IUHA 1IAHA 3H0YA 4LG4A 3A99A 2F57A 3EQGA 3FSFA 4LYNA 2ITOA 4ZTSA 4GKIA 5AEPA 2H6DA 2UW5A 3LCTA 3OWPA 4C0TA 4M0ZA 5C01A 3L9MA 3ODZX 3ORZA 3I0QA 4R3PA 1Y8GA 3WIKA 4HW7A 3IW4A 4PMSA 1KV1A 1XH8A 5AX3A 1RQQA 2CNQA 4OTFA 3NVKI 3NAYA 1WVWA 4EC8A 3HRFA 2I6LA 5CF4A 3V51A 3TACA 4QMQA 1H08A 1WBWA 5IMEA 4UX9A 4RX9A 3HMMA 4K33A 3PJ1A 4XP2A 1YRPA 3LZBA 4G6NA 4TT7A 5LOHA 1B6CB 3C0GA 2C1BA 5A3XA 3HV5A 2YCSA 3PDTA 3LCDA 5ANKA 4E20A 4CMOA 3WZKA 3DBQA 2WD1A 3TXOA 1O6LA 2B9HA 2EXEA 5LARA 1FVRA 3UVQA 3KC3A 4I5CA 2WMRA 4NEUA 4C4HA 4DG3E 4O81A 3AC3A 4E4MA 2C6EA 2VO0A 1H4LA 4YU2A 3UGCA 3IW8A 2C6IA 3LVPA 3RPYA 4XG6A 5HD7A 5KKRB 3R28A 3L8PA 3SOAA 4EHGA 3G0FA 4IAZA 4TYIA 2LGCA 2WMXA 2JBPA 4V0GA 3WZUA 1DI8A 1PYXA 3NNUA 3PXQA 2YCQA 4R5SA 2WQNA 5HEZA 2QU5A 4OTWA 3DDQA 2VV9A 3Q5ZA 4RZWA 4XOYA 4EH6A 4CG9A 5IUGA 3FMJA 4NM7A 2J5EA 4RFMA 2F2UA 3VO3A 2PK9A 2ESMA 3R73A 4ANLA 5HHWA 2W4OA 3U51A 3MBLA 3R01A 4B99A 4DEIA 3BEGA 3B8QA 4TY1A 1B39A 4A4OA 5M4CA 3AMAA 3LPBA 2OH0E 3ALOA 1CDKA 3F7ZA 5IQDA 4XG7A 4LOQA 3EKKA 3MPAA 5CAUA 4XG9A 4FNZA 5DYJA 4YLJA 3V01A 3UDBA 2WQOA 4YJPA 3UODA 2JKOA 5LJJA 3MN3A 4ID7A 5KBRA 4FEUA 5L6PA 1SZMA 4FTUA 1SMHA 4DINA 2W9ZB 2PMIA 3DCVA 3KRWA 3OUKA 3QTQA 4I6HA 4LRJA 2V7AA 4U5JA 5EM7A 4F99A 5CSPA 2A4LA 1UKIA 2FUMA 4QMWA 2XKFA 2WMTA 3GGFA 3RZFA 5BQ0A 4MKCA 4E73A 4L45A 3TL8A 3AT3A 2VNWA 4DYMA 4PPCA 4ZSJA 3QKLA 3HRCA 4DHZA 1GIJA 3ZM4A 2PVNA 5G6VA 3UG2A 2C6MA 3FKLA 3CJGA 4MD7E 5JMSA 4CLIA 3O8TA 1PXNA 4D9UA 3R1NA 5BX0A 4OTRA 4Y95A 2BTRA 4P2KA 2R9SA 4ORKA 3BQCA 3EH9A 1A06A 4KBAA 4OTPA 5DFPA 3ACKA 4USDA 1XJDA 2B54A 3DBEA 3NW5A 3OY3A 4X2NA 4ANNA 4DHJA 4YHJA 3GENA 4XBUA 1IR3A 3MA6A 4YPSA 4I0SA 3EN4A 3G6GA 4IAFA 4O0UA 5LWMA 2XANA 3ZM9A 3KL8A 4LQMA 4AAAA 4RRVA 4AXAA 2HWPA 3PXRA 1HCKA 1TVOA 5BMSA 5TKDA 3W32A 2GPHA 2A2AA 3MW1A 2C1AA 2DS1A 1YDRE 4IM3A 2PUNA 1JNKA 1OIQA 3OY1A 4XX9A 4I24A 3VJNA 4H39A 4NZWB 1ATPE 4ASXA 3RPSA 4AFEA 4AW1A 3O71A 5IF1A 4XUFA 5HX8A 4D28A 4BY9E 4JR3A 3DK6A 3ZO3A 4FODA 3BL7A 3AMBA 3L8SA 4EH3A 1S9JA 4HZSA 1OPLA 3A7GA 3CQUA 3KA0A 4QMUA 3Q4ZA 3BHHA 3KK8A 3I6UA 4CCUA 4QTEA 4IBMA 3WE4A 4KS7A 3W8QA 5M44A 4GVAA 3WBLA 4V05A 1Y57A 5LQFA 1FGKA 1OIRA 2Q0NA 3LXKA 1TKIA 2X7GA 2WTWA 4RIOA 3GUBA 3NUSA 3VONA 5AP7A 3FDNA 4MNFA 5D11A 3QKKA 3PA4A 5CU2A 4CQGA 3TNPC 3VW8A 4HGTA 3GC0A 1YKRA 4PTEA 1VYZA 4IC7A 4I41A 2XRWA 2EUFB 5FEEA 3T9TA 2JITA 3OCBA 3UNKA 5IEYA 2XA4A 4DF3A 4NWMA 2EB3A 5HTCA 4BRXA 4M8TA 5GZ9A 3PRIA 4G34A 2WB8A 3HDNA 2YIYA 5EDPA 5JSMA 2HZ4A 3PE2A 4IMYA 4S30A 2RL5A 3LLTA 3DAJA 5HVKA 3R2YA 4JBVA 4WKQA 3WZDA 1YOJA 2Y9QA 4DEBA 2VWZA 2RKUA 2QOKA 3IDCA 4IZYA 2DQ7X 4FSZA 4C33A 5KMLA 3UYTA 4FTTA 4FTRA 4KWPA 5HNBA 2BZKB 1J1CA 1PHKA 2HZNA 2WZJA 5AR3A 3MI9A 2IW9A 2JEDA 1R0PA 3HA8A 3Q52A 3ZXZA 3TV7A 3C13A 2ITQA 4QMVA 4Y85A 3S3IA 3FLNC 3ZYAA 1GY3A 2UW4A 5AA9A 3ACJA 5F1ZA 2VNYA 3AKKA 4E6QA 3MH3A 3HVCA 2ZB1A 1MQBA 2W7XA 4RWJA 4O6EA 3NRMA 3C5UA 4CFNA 1OIYA 3FE3A 4UXLA 3BBTB 3KMUA 4M15A 4U42A 1XH5A 4DFXE 1FVVA 3DS6A 2QLQA 4R3CA 3TN8A 3TNWA 1H1SA 4DFBA 5FM2A 5JFWA 3EN7A 4IX5A 4UMUA 1G3NA 4HOKA 1Z5MA 4E5WA 4G3EA 4MD8E 2BR1A 2IG7A 2JD5A 4K18A 3Q6WA 3R0TA 5EKNA 5HZNA 4NL0A 2R3KA 2X2KA 4AF3A 3CPBA 2YABA 3FMHA 3NW6A 4YGAA 4LOPA 4LL5A 3U55A 3FYJX 3QTUA 2PE0A 4AXCA 4X6QC 4DDIA 4I5MA 4X2GA 4DAWA 4WNOA 4B6LA 3LFCA 4QNYA 2Z60A 3DK7A 3U8WA 4I21A 4EKKA 5IUIA 4FG9A 3U4WA 3MYGA 2C6KA 5EYMA 4M14A 3LAUA 3CEKA 5LXMA 2C5VA 3QCXA 5DWRA 3N4TA 4NW5A 3RCDA 3C4ZA 3QXPA 3S2PA 5HIBA 5AM7A 3IW7A 4E3CA 3TZ7A 3EQCA 3RAWA 5FWKK 4JG7A 4C57A 1UV5A 1WCCA 4RWIA 3KEXA 4JT3A 1M7NA 3GFWA 4FT0A 1XMLA 5KMMA 5IQIA 1YDSE 3HV4A 4O4FA 2HZ0A 3ZLXA 4QTCA 5FXRA 4D2TA 2UVZA 2OSCA 3JUHA 2W1DA 2A27A 1LP4A 4YC6A 3U9CA 2PVKA 5HCZA 2IW8A 2HWOA 3D7ZA 3DTCA 5DI1A 3CTQA 5HG7A 4BYIA 2GQSA 2QO9A 3DBFA 5BUIA 1OGUA 2X8DA 4ACDA 4EUTA 3C50A 3CGFA 2QR7A 4O21A 5AJQA 3WIGA 4DDGA 1PXKA 4FBXA 2JLDA 2B7AA 4R1VA 4KKGA 4EL9A 3W0RA 2BRHA 3FZPA 1NY3A 3DKGA 4UYNA 4YUQA 4I94A 3KVXA 2P2HA 4J97A 4BDGA 4CXAA 3EN5A 4PV0A 3HAVA 2XK8A 4RPVA 3OXZA 4B9DA 3I4BA 2VAGA 3VBVA 5E8SA 5B2MA 1XBAA 3VBTA 3PSDA 5CEKA 3VUGA 5I9UA 2V5QA 4EYMA 3RKBA 2GTMA 5EW8A 3ZEPA 5AUTA 1O6KA 4ZTMA 3PE1A 2J9MA 4BL1A 4QYYA 4UMRA 2UZVA 1IEPA 2W05A 3B2WA 3DJ5A 2YIRA 1UU8A 3QQUA 4Z9LA 3ZLWA 2XRUA 4J98A 4ANQA 5JK3A 5JRQA 1UU3A 5AM6A 4O0TA 4E5BA 3UYSA 4O91A 4CV8A 2UW9A 4AWIA 2X39A 4U6RA 1OITA 2ITPA 3EQFA 4E1ZA 2JGZA 2WMAA 3PUFC 1P14A 4U81A 3VF9A 5DT3A 3NYVA 4FL2A 2UZOA 3F2AA 4GK2A 3KF7A 2CLQA 3ORIA 1JPAA 2WTVA 2EU9A 4NT4A 5K5NA 4O7TA 2PZ5A 4IX4A 5L2IA 3ALNA 5IQHA 1REJA 2P55A 4XBRA 3EQIA 4RMZA 3MDYA 4LV7A 4ANMA 4J96A 5A4LA 5D7AA 3FI3A 3SXFA 5JFSA 3TUDA 2QVSE 2YACA 3QU0A 5C27A 4G31A 3DQWA 1KV2A 3BPRA 3DK3A 5M51A 4ZLZA 1F3MC 4O82A 2XKEA 3H3CA 5C26A 4FSNA 4IM0A 4QPSA 4R8QA 4UMTA 3LIJA 4ZS0A 4ONAA 3SDJA 1XKKA 3FZOA 4BDCA 2PUPA 2JDVA 5AAFA 1XWSA 3DA6A 3HRBA 3NLBA 3W10A 5ETCA 4FE2A 4O4BB 1FMKA 2XJ1A 3BYMA 5IU2A 4ZJVA 4J71A 2X2MA 5M57A 4I23A 4L9IA 4IW0A 1GJOA 2UUEA 5ITAA 4N70A 2X8IA 4FSQA 2WFYA 3IW6A 4O0XA 3KXMA 5FTOA 5TT7A 3BQRA 3S4QA 4GJ2A 5BVWA 4NTSA 5EM6A 4BDEA 2OFVA 4B8LA 5EQYA 4IFCA 5CSVA 2CKPA 2JBOA 3QTRA 2BAQA 3QTIA 3G0EA 2O64A 1CKPA 3Q5IA 3EN9A 4Q5EA 1YWNA 5CQWA 5BVFA 2PVFA 5BVOA 2ZM4A 2WMSA 3GI3A 5HO8A 1Q8YA 3JY0A 5F20A 4F6SA 5I5ZA 4WNPA 1RE8A 1YOLA 4EH9A 3VBQA 2O5KA 4Y8DA 3PSBA 3ZUTA 3A2CA 1L8TA 5A54A 3P78A 5K3YA 4ZZNA 3NZ0A 3TIYA 1FGIA 4QP2A 4EOSA 5E1EA 2CMWA 4J1RA 5KHXA 5HD4A 5JZNA 4V0GB 4BCMA 2ZJWA 5L6WL 4U40A 2XNOA 4EBVA 4O4CA 4G2FA 4A07A 5E91A 3HV6A 2PWLA 3HUCA 3DFCB 5AAEA 3LXPA 5CVHA 2JKQA 3SOCA 4FNYA 3PJ3A 5AR8A 4JX3A 1IAJA 3Q04A 4FSUA 1OB3A 2UZNA 4FRFA 4FTQA 3KN6A 4BBEA 3L1SA 2EWAA 2YERA 3QA8A 2CLXA 3A7JA 1GZOA 3DAKA 4FUYA 3DJ6A 4TWNA 3T8OA 3LFFA 2G9XA 1Q3WA 3EZVA 4BN1A 2XNMA 1XH6A 4KKHA 4YTFA 3UDZA 1F0QA 1QPEA 4ZJJA 4YBJA 3W8LA 5E8YA 4YURA 4DHIB 3EB0A 4QYFA 4DHFA 2ZMCA 3OROA 4J53A 5EKOA 1KUTA 3RNYA 3DZQA 1Y8YA 2R3LA 2WQBA 4M13A 4R7IA 5FQDC 5HE2A 4AOJA 4F0GA 4BDDA 2C68A 1XO2B 3CJFA 2Y0AA 2C30A 2GS7A 5ACKA 4M97A 4Y73A 5EW9A 4W9WA 4CYIA 4AGUA 4EOJA 3O7LD 4G5PA 2CGVA 3OBJA 3CCNA 3NEWA 4NU1A 3LMIA 5AV1A 2GQRA 3ZS5A 1JQHA 2R7BA 3TM0A 2BILB 4ENXA 2O63A 3OF0A 4Z55A 3NFFB 2W0JA 4LL0A 4NK9A 4Z7HA 4DE4A 3BV3A 4RIYA 3NFGB 2OI4X 5IQFA 4X0MA 3PWDA 4FNXA 4GG5A 3IGOA 5T68A 3W1FA 4EOQA 3DNEA 3LFQA 2DYLA 4QYHA 4TPTA 3TZ8A 4BJJA 4A06A 3CKWA 3BZ3A 3CIKA 4KSQA 1Z9XA 2IW6A 4YJOA 4YHFA 3PUPA 2VZ6A 3ZFMA 4XCUA 4HNIA 2QKWB 3OFMA 3PVWA 3UMWA 2E9OA 2R7IA 3R8MA 2R3HA 4GYIA 3RPVA 5HU9A 3AKJA 2OW3A 3ZONA 3MFTA 3MWUA 3R7IA 3D5VA 4KB8A 4E4XA 3EWHA 3B8RA 2FYSA 3JPVA 4BHZA 3OCTA 4ZXTA 3LQ3A 3Q4CA 5B0XA 4CG8A 4FR4A 3KULA 3NR9A 4G9CA 3RGFA 4EONA 4U41A 2VTRA 3R6XA 4TYGA 3G6HA 1X8BA 3BEAA 3GU6A 1RJBA 1PXMA 2C3IB 5HG9A 3RAKA 3UOLA 4AOTA 3K3IA 2WGJA 3EMGA 4KIPA 3PVBA 3MY1A 5L8KA 1Z57A 5CSHA 5IMXA 2BKZA 4OBPA 1BI8A 4BDHA 2WTDA 5A4TA 5ANGA 2HW6A 2ZOQA 4NIFA 5CYIA 4EI4A 2WEVA 1FVTA 1UA2A 1Q61A 1WBTA 2YM6A 4FT3A 2FSLX 4GK4A 4HGSA 4QP9A 5AR4A 5AUWA 3LMHA 3HV3A 2OICA 2V62A 4YO6A 4CFVA 3LM0A 2J0MB 4C4EA 3UQFA 1JOWB 4AP7A 2B55A 3AT2A 4AFJA 4L00A 2O0UA 4DBNA 1JSVA 1PXJA 4L01A 4MTAA 4TRLA 2F7ZE 3KXNA 3OG7A 3ZHPC 4IEBA 4IB0A 5CVGA 3JVSA 3PTGA 5HESA 3UZPA 5L2SA 3PVUA 5E90A 4O7RA 3M2WA 2GQGA 4C4IA 2C6DA 4IH8A 4QTBA 4YNOA 4RIXA 4CZUA 4EOPA 2YM4A 3QZIA 1ZYLA 5AP5A 3PFYA 1W0XC 2HIWA 3R1YA 1SNUA 2YDJA 1Q41A 4XV2A 5DRBA 2G1TA 2XM9A 3O50A 4ACGA 4EKLA 3FYKX 2CN8A 4NKSA 3WF6A 1YOMA 2EXCX 4JIAA 3WF7A 1MUOA 4BDKA 4CNHA 5AUZA 3D2IA 4OLIA 4P5ZA 5FDXA 3KRJA 3IOPA 4BCHA 3QUDA 3BYSA 2YJRA 3E7OA 3CP9A 1Q4LA 5KO1A 1S9IA 3AD6A 4D0XA 5BVDA 3GQIA 2W1EA 3COMA 3LJ1A 3QX4A 1E9HA 3OXIA 3P5KA 4EOKA 3NWWA 3SX9A 4CFUA 4V04A 1M7QA 2GFSA 4ITIA 2CGUA 3QCYA 4RWKA 1U5QA 4ITJA 3SHEA 4AW2A 2R5TA 5FBOA 4CTBA 4E4NA 4C3RA 3ZMMA 5I3RA 3LCKA 4GT4A 5JGAA 2CKEA 3ID6C 4AN9A 5M06A 4HGLA 4I6QA 5M09A 4F65A 4DLJA 3SXRA 5ETFA 3EQPA 4FZDB 2IWIA 3OS3A 3P79A 3TKUA 3W55A 1H0VA 2BZHB 4QRCA 3WZEA 2C3LA 5JN2A 2DWBA 2X4ZA 1AGWA 3P4KA 5IH6A 5DT4A 5M4UA 4G3GA 2R2PA 4KBCA 3RTPA 1CTPE 4HPTE 4BI1A 2OF2A 2I7QA 4M66A 4L3JA 2VWVA 4TKSA 3BRBA 1IASA 4WD5A 4IIRA 3Q2JA 4C4FA 4RVKA 4IWOA 4DGLC 4BGGA 5L4QA 2WMVA 2J0JA 3W0OA 3O2MA 3V8SA 2A0CX 2E2BA 3R30A 2QOCA 2OJ9A 2VN9A 5EHOA 3VN9A 5AP6A 4X21A 3PY3A 2W9FB 2RG6A 5D10A 2FB8A 2J5FA 3POOA 4G3CA 3TNQB 4AGCA 5HNIX 4DGGA 2HZIA 2VU3A 3E3PA 4FK3A 4IADA 4ACCA 4AOIA 5AADA 2XIYA 5CU0A 1PY5A 4O38A 1OGYA 1APME 4FKVA 4X7QA 2I0HA 4FKUA 4MWIA 5AIRA 5FGKA 4PDYA 4S2ZA 5IQEA 5HORA 2PVLA 3MIAA 4LMNA 4IVAA 4FTOA 3UBDA 5CZHA 3A7FA 4HCUA 2R64A 3DT1A 4IHPA 4DH5A 3VS5A 5TF9A 4HVIA 5HE0A 2B0QA 4ZP5A 2PVHA 2VD5A 4MCVA 4J8NA 5AV3A 4GKHA 3OW4A 1HCLA 4FZFB 4BCNA 4H3BA 5LVOA 2BFYA 4BWKA 2WOUA 5L8LA 4ZS4A 3R9NA 3C4CA 2HY81 2OZOA 2V55A 2X7OA 3BGZA 4MYGA 4NJDA 4YJSA 5I9VA 1PMEA 5EM5A 4OAUC 3RINA 1SNXA 4H1MA 5HGIA 5D7VA 3VBWA 3FSKA 2CPKE 3KXZA 4YLKA 4ZY4A 4C8BA 1YI3A 4FKWA 4B7TA 2X0OA 3SLSA 4F0IA 2WELA 5DPVA 1GAGA 2PZPA 3QTZA 3RM6A 4E7WA 4EOOA 3JR1A 2BROA 3D2KA 4XHKB 3C0IA 4K77A 1H25A 2OU7A 4AZWA 2UZEA 4AX8A 4RVLA 2XYNA 3D4QA 3QCSA 4Y72A 4EOMA 2PMNX 3CBLA 2ZFYA 2CCHA 1XH9A 5C03A 4CV9A 5IQCA 4UEUA 2OZAA 4AW5A 4EZ7A 4F1MA 3TNIA 4HVHA 2VWXA 4N0SA 5E8XA 5FTGA 4GCJA 5JQ5A 1R0EA 1YW2A 4W4VA 2VTSA 3VBYA 4JBQA 3R7VA 2W96B 5BYZA 3MVJA 4GH2A 3LE6A 2BHHA 5HG5A 4C4GA 4GRBA 1BX6A 2OBJA 4AE6A 3MH2A 3NNVA 4A7CA 3ZLYA 2BMCA 3FZSA 3UOHA 3QGYA 2OLCA 3TKIA 2X0PA 2VTMA 4MVFA 1OL2A 4YZ9A 2CNVA 4FTIA 4L6QA 3F66A 2WTJA 3TEIA 4ZSGA 3GU4A 3JYAA 2Y4IC 3LFBA 3EFJA 3BWJA 3NUAA 3PSCA 4FV4A 3ORNA 2VTAA 2YDKA 3AC4A 2ZV7A 3Q6UA 1YXSA 2YM8A 1YHVA 3KRRA 5KHWA 5KMNA 3QRUA 3LHJA 4UY9A 4MAOA 3K3JA 3ULZA 4OUCA 1ZARA 5DEYA 3BU5A 4FSMA 3MPTA 5L2TA 4JJRA 2B53A 2C6OA 2ZM3A 4BCQA 2VTPA 5J5SA 2HYYA 4H58A 3G33A 2XK6A 4TTHB 4TWPA 5CU4A 4AACA 5JQ8A 1ZRZA 3DLZA 3QD3A 4WUAA 4KSPA 1YI4A 1UNGA 5CEPA 5GJDA 4NW6A 4PDSA 3F69A 4YHTA 3QALE 3HYHA 4H36A 5J1WA 1Q62A 4XV3A 3QC4A 4Z16A 4FKPA 2PTKA 1Y6AA 5BUEA 4WHZA 1U4DA 3DZOA 5EI8A 5LVMA 2YCRA 4FIIA 3V04A 4QMTA 2WMWA 3W33A 4EUUA 4U9AA 4DEGA 3DXQA 4EZ3A 2VTOA 4YJVA 4DITA 4EH7A 3U87A 5JH6A 4O1OA 4R3RA 2BRGA 3R9DA 3QYWA 5E1SA 4D1ZA 1ZYCA 2OG8A 3KF4A 2RFEA 2FSMX 3EZRA 4ASEA 3V3VA 4GVJA 1UU9A 4YZCA 4L7SA 1BL7A 4APCA 2E9PA 4PP7A 3EYGA 2Q83A 5TE0A 4JG6A 3I7BA 4BZNA 3FLSA 1PXLA 4FVQA 4Y46A 4D9TA 2PL0A 4JLCA 4U0IA 3H9FA 1OIUA 3R02A 3DDPA 4NFNA 5I9ZA 3QQLA 4AG8A 2GNLA 2C3KA 2XALA 1J3HA 3CGOA 4P90A 3SGCA 1Q24A 4RX5A 2CHLA 3RPOA 1ZYDA 2VWYA 2XK9A 2YM3A 3TTIA 2J50A 4FTJA 4IWQA 3EQBA 3R9HA 4AZTA 1WAKA 2QCSA 5DH3A 3RM7A 4J95A 4IE9A 4WG5A 5B2LA 3HX4A 3L8XA 3RCJA 4FIGA 4F4PA 2PUUA 4G6OA 4H05A 1PMUA 2UZWE 4DTAA 3C1XA 2F49A 4IQ6A 4CZTA 5HLNA 4O7ZA 5LMBA 4WSYA 5D12A 5D41A 3UQGA 4BTFA 2JDOA 2AEGA 4U79A 1XH7A 3P5JC 2W4JA 4F0FA 2NPQA 3IDPA 4ERWA 4AQKA 4YJUA 4I92A 3WOWA 4EYJA 3WF5A 3Q60A 3U9NA 4AXFA 4IB3A 5IPJA 2PZYA 1G8AA 1U54B 3KCKA 4KIKA 4PTGA 2JIUA 4F7NA 1NVRA 5CXHA 2CGXA 4Z7GA 5IA5A 3ZTXA 2PVJA 4JBOA 3NUNA 4XOZA 2JDTA 4OAVB 1O6YA 2I40A 5FP5A 5JGDA 4CRLA 4O4DA 4QMZA 3NVMB 4EH8A 2OJIA 4DG2E 4C62A 2I0EA 3EJ1A 5FXQA 4YP8A 4QOXA 1H1WA 3E8CA 3RVGA 3DBCA 3QGWA 4IWDA 4QPMA 3HEGA 4TWCA 3A7IA 4JMQA 5CS6A 2P33A 2V0DA 3PY0A 4HYHA 3ORKA 5M55A 4B0GA 4NM5A 4ITHA 4KRDA