5B2LA

A crucial role of cys218 in the stabilization of an unprecedented auto-inhibition form of map2k7
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
300
structure length
288
Chain Sequence
GYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTSAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 7
publication title A crucial role of Cys218 in configuring an unprecedented auto-inhibition form of MAP2K7
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 288
sequence length 300
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2016-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5b2lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5b2lA01
5E4HA 1XH6A 2WU6A 4QTDA 3PJ8A 3OUKA 4Y85A 5IH6A 1OM1A 5EG3A 3AXWA 3PXYA 5DE2A 4BI0A 2WTJA 5IQEA 4H3QA 1JKLA 3HECA 3NW7A 4OAVB 2UW9A 3V51A 5L2IA 3ORZA 4BR3A 3NYXA 3D5XA 3R71A 4CSVA 2V7AA 1U54A 3CIKA 2PZPA 4BKZA 3VC4A 4LGDA 4MNEB 3F7ZA 1KE6A 4UV0A 4D4RA 3LIJA 5EK7A 3ID6C 4WT6A 5H2UA 4ZJVA 4OTQA 3R2YA 4G6LA 2WELA 2Y4IC 3PIYA 3Q32A 4GIHA 4JIKA 5EQPA 5IMEA 3EFKA 4O21A 3W55A 3W2CA 3D7ZA 3RZBA 4O82A 2VAGA 2FVDA 3LFBA 3NS9A 4FV2A 3I79A 5LVOA 2R3NA 2B0QA 3OHTA 3PWDA 4IIRA 3AOXA 4CZTA 3IDBA 5BVDA 4TYHB 5HLNA 3NYVA 5AR4A 3GP0A 4CNHA 1SZMA 3MSSA 3L9MA 3ZEPA 2B9IA 3UOHA 2GNLA 3KA0A 2CGVA 3F66A 5EM7A 2JEDA 4UMRA 1VEBA 2X81A 3AC2A 3BLHA 3COHA 5E1EA 3AD5A 5F4NA 1FVTA 3ZO4A 1F5QA 4Y8DA 2GPHA 5H8EA 2CMWA 3ATTA 4KWPA 3VS6A 2Z60A 3GU5A 4YZBA 2C0OA 2GU8A 3ELJA 4I1ZA 2OG8A 2O63A 3ENMA 4DITA 5J7HA 2VTAA 1JSVA 4I6HA 3R22A 3SC1A 3DBQA 2OU7A 4D55A 4FTCA 3BV2A 3Q9YA 3EFLA 3OXIA 2QONA 3QX4A 4KKGA 2BIYA 2VTNA 4F4PA 5KUPA 3V6RA 4AZSA 2WMQA 1FOTA 2JKQA 2QG5A 3DB6A 4GJ2A 1U5RA 1UU9A 5E9EA 4IM2A 4AE6A 4GYGA 4L3JA 4DH1A 5K4IA 3N51A 3BEAA 3ZO2A 2JKMA 4XBUA 4E5WA 4RZWA 4QQ5A 3BZ3A 2OJFE 3VBVA 5EOLA 2I0YA 1DM2A 1ZOGA 4CYIA 2YHVA 4AZFA 3OS3A 1KE7A 3BPRA 2BDJA 3JYAA 3R0TA 4L9IA 2W96B 1W0XC 5FGKA 4X3FA 4K18A 3RCDA 4BKJA 2PL0A 4FIFA 3ZDUA 4PY1A 1K9AA 2F57A 3LJ1A 4PMMA 2BMCA 4MD9E 3RPRA 4B99A 5BUJA 5L2WA 4LRKA 4QRCA 3E8DA 3TZ8A 4D2PA 4BGHA 2QOCA 2P4IA 2BRGA 5H3QA 3TZ7A 3S95A 3TJCA 3TKIA 2FSTX 5B2KA 1H1WA 4PTGA 2WTCA 4GT4A 3P0MA 4F6WA 4BI2A 3UZTA 4U8ZA 2IO6A 3AC4A 2ZMDA 4NEUA 3RINA 3GQIA 5EDRA 2VTOA 3OC1A 3VUKA 4BICA 5HNIX 4IM0A 3FLZA 1YRPA 4UMPA 3KF7A 3PVWA 5CT0A 4Z7HA 2J0JA 4GU6A 4FZDB 5KNJA 3U6HA 4DGMA 4HNFA 3ERKA 2ZAZA 4O6EA 4KAOA 4ASDA 3MH0A 4M0YA 4GU9A 4RIWB 3CY3A 3FWQA 3BX5A 5HVYA 3NW6A 5D7VA 3AQVA 3NEWA 2WIHA 4FV7A 1GNGA 3OCTA 3OWLA 4MXXA 3JY9A 3IOKA 1YQJA 1PF8A 3H4JA 5JN2A 4MTAA 5L2QA 3R7OA 4AGWA 4FKRA 2PZRA 4L6QA 4NTTA 3ZZWA 4ZTHA 4FSZA 4MQ2A 4UMQA 4Y95A 5T6KA 2ZV8A 1ZXEA 2PVHA 3ATSA 3LMHA 2XIXA 3R7GA 4I21A 4JX3A 5E8YA 5IA2A 4DFBA 3SW7A 4QO9A 4AUAA 3F5GA 3ODZX 4Z55A 4HGLA 3PP1A 5EQYA 2VX0A 5IZFA 2QC6A 5ACKA 3UGCA 4IWOA 1SNUA 2PSQA 3NPCA 1Y8YA 1ZLTA 2OO8X 1OIYA 3Q2MA 4XV1A 4Y72A 4F64A 5HE1A 3RPYA 3R00A 4ZY5A 2QU5A 2X39A 3LHJA 3B2TA 2ITVA 4FTRA 3V5PA 4DFXE 2ZV2A 1RDQE 4IC7A 3P5KA 3CEKA 2F4JA 4U0IA 2WMWA 4S34A 1J1CA 3C5UA 3CTHA 3HRFA 3KXGA 4FVQA 4G6OA 4GYIA 4IZYA 4L01A 4A4XA 4AGUA 4C2VA 2Z7QA 3WZDA 4GT3A 1H01A 3L8XA 3IDCA 4MBLA 4WG4A 2WTKC 4XHKB 5C03A 3A60A 3VWAA 1TKIA 3L9NA 3V5LA 3K3IA 2EXEA 2WGJA 5AJQA 3FMJA 3C4WA 2ITWA 4FTMA 5BVNA 3E7OA 2VTMA 4C4IA 1ZYJA 4WO5A 3GGFA 4OR5A 4YZ9A 5HKMA 4APPA 4E6AA 1KSWA 3R83A 4C4JA 1YXVA 3HMMA 4EOIA 4YMJA 1J3HA 4AT5A 3KF4A 2ITOA 3T3VA 3PVBA 3FC2A 5DH3A 1AD5A 3TZ9A 2HWPA 5CEQA 4C7TA 2OK1A 2G2IA 4OTFA 2F9GA 4L44A 4AE9A 3CXWA 3DKCA 2YERA 3HMNA 5EYDA 5A4LA 3JVRA 5A54A 4GK4A 4OTPA 4M84A 5EDQA 1WZYA 5FBNC 3ZC6A 4R8QA 3HV5A 1U5QA 4QMQA 3EWHA 3ZBXA 4FT3A 3KRJA 4O7TA 3LQ8A 3UC4A 5FD2A 5HBEA 5L4QA 2PVRA 1ZWSA 2IZSA 5IISA 3F2AA 5DN3A 2X8DA 3B8QA 2B9JA 4RX9A 3RKBA 4P4CA 5IDPA 4TT7A 3U4UA 5C8KA 1OL5A 3BYVA 3EN9A 4PPAA 4O7WA 2G01A 5JFSA 3SXRA 2Y4PA 5D10A 3IW7A 1TQMA 2VX3A 4EHGA 2OIDA 3MDYA 3RK9A 2VTPA 4FTLA 4OTRA 4NTSA 2UVYA 2W06A 3Q9XA 4BIBA 5I3RA 4DT9A 5E8WA 3WF7A 2I0VA 4RLKA 4C62A 2GNJA 3I5ZA 5CU2A 3P7AA 4ERKA 4FIHA 5FP5A 5L2TA 1XBCA 4NM0A 2BAKA 5J1WA 5HG9A 3PY0A 3KRWA 4ENYA 4XOZA 3RAWA 5EM6A 1YXSA 1W82A 5I5ZA 4EOSA 2BR1A 3ALOA 4UXLA 5ANOA 5M53A 4C37A 4WUNA 4XP0A 2FUMA 4BRXA 5AP0A 4IJ9A 1MQ4A 2W5AA 3LM5A 4XG3A 4D9UA 4FE2A 5AP6A 2QD9A 2PHKA 3ROYA 3U51A 3SXSA 4BGGA 1XWSA 2CJMA 4E1ZA 5BVFA 5HTIA 1ZY5A 4YJNA 4FL1A 4FOBA 4LGGA 3PY1A 5CLPA 4A4LA 4YNOA 3BYMA 3VJNA 4P5QA 3ZONA 3UNKA 1NA7A 3OBGA 4AN2A 4E20A 4U41A 4J52A 3G33A 4F65A 2WQBA 4R1YA 4BDFA 1WBTA 5LCJA 3IGGA 4FV1A 4HYSA 1FGIA 2PTKA 2WNTA 3PIXA 1OVEA 1Q8UA 2YA9A 1REKA 3MYGA 5FLFA 4EH4A 3A7HA 5BYLA 2F7XE 2GHMA 3L8SA 4Q5EA 1IA9A 2E9VA 5JGAA 5IA1A 4C36A 2WOUA 4UZHA 2UZLA 3QRKA 1SVHA 4EH9A 2WKMA 4G31A 4KABA 4ZSAA 4FKPA 5IH5A 4KS8A 3TKHA 4JIAA 5CASA 2JAMA 2HENA 4E6CA 1MRVA 3CPBA 4U3YA 3I5NA 2NRYA 2VTIA 3I6WA 3ZUVA 5GZ8A 2I0HA 1A9UA 2IPXA 2OJ9A 3R73A 3OWKA 2GS2A 2HZNA 5AV1A 3F5UA 3UYTA 3IECA 1O6KA 3WIGA 2QI8A 4FUYA 2XF0A 2CKOA 4LL5A 3T3UA 4Q5HA 3ZM4A 4NW5A 2XJ2A 3COKA 5CVFA 1VYWA 4F7NA 5M06A 3TDVA 2HIWA 2GMXA 5GZ9A 5GNKA 4F1MA 3HMIA 4FX3A 4FG7A 4YO6A 4C58A 4GSBA 5IQCA 2IVUA 4FV5A 2B4SB 3OXZA 5DVRA 3CGOA 5HLWA 4D0XA 5AM7A 3G2FA 4HJOA 3V5WA 2QO2A 3KY2A 2YN8A 1YWVA 1PXMA 2WXVA 4BZOA 3FV8A 2Y9QA 5AA9A 4WNOA 2UW7A 4XV3A 4DFLA 3R2BA 4XV9A 2YM8A 3CTQA 5E8VA 4ANOA 1W8CA 4RG0A 3QQUA 4K2RA 4RZVA 2ZV9A 3QGYA 5EYKA 2JGZA 4I4FA 4A07A 2YM5A 4N4SA 5EW9A 3SW4A 3LQ5A 3RM7A 3SRVA 4B0GA 1OBGA 4YJRA 3KXMA 3R7UA 4CLIA 4NCTC 4N6ZA 2BZHB 4QP2A 4EBVA 4HCVA 5DEWA 4FKSA 5CEOA 3PP0A 5KMOA 1I09A 3NCGA 1S9JA 3SGCA 3H30A 4C4HA 3WF9A 2QOKA 4BDBA 3H9OA 5GJFA 3KB7A 1FPUA 3VHKA 1Q8WA 3ZLYA 2QOFA 4WSYA 4DA5A 2YDIA 3LVPA 3KN5A 3TZMA 4JLCA 3WF8A 3BBTB 4U6RA 4ZJJA 2UZDA 3VW8A 4G2FA 4D1ZA 2VNYA 3R9NA 4QP9A 3PRFA 2CGWA 3OOMA 3IW6A 3UQFA 4C8BA 3HGKA 3E87A 3K3JA 4O38A 5GIOE 3WE8A 2WQMA 4FIIA 3LCDA 4KIOA 4ITJA 4X3FC 1BLXA 4RFYA 4UEUA 5E8UA 2JKOA 3V04A 3QQHA 3NYOA 5CAQA 4WRSA 5L6OA 2R7BA 3QGWA 4O0WA 1OPKA 2PVFA 2WIPA 4DLIA 3GVUA 4GRBA 2WFYA 1S9IA 1J7LA 2B9HA 2VD5A 3KRLA 3OY3A 3ORPA 4JI9A 2PMNX 4HYIA 3W2SA 2R3IA 4G5JA 4FKVA 4HPTE 2R5TA 4FKGA 4EOLA 3OF0A 2NO3A 2P33A 3W2OA 3ZLWA 4FEQA 5LOHA 2NRUA 2BUJA 3MIYA 3VS3A 3G0EA 3BCEA 2PUNA 1O9UA 4FTJA 3LMIA 5T3QA 3D7TA 3F7WA 4QMZA 5EW3A 4EBWA 5DRBA 1RW8A 4UN0C 2WMXA 3F5PA 3VBTA 1VJYA 2UZBA 5HE0A 3BWJA 1YDRE 2QOOA 3OT3A 4TYIA 1IAJA 2IG7A 2QLQA 4FG9A 5B2MA 4FKJA 5I9WA 1VYZA 4RBLA 4X2JA 3Q5ZA 4QNAA 5C26A 2AYPA 4DF3A 4NFMA 5CXHA 3TL8A 4ZZNA 4H1JA 5AX3A 3QC4A 5L2SA 2OZAB 5JFVA 4QTCA 3LCSA 5ETFA 4OLIA 2X2MA 4GT5A 4TNDA 1YHSA 2R3RA 3K54A 3OTVA 2C6MA 2X9EA 2A2AA 3KEXA 1Q8TA 3E92A 4NFNA 5M51A 1SVGA 2J9MA 5H8BA 4LI5A 4YU2A 3R7EA 3G5DA 3POZA 5K5NA 2Y7JA 5AADA 3DBDA 2I40A 4D28A 1JSUA 3RWPA 4DEAA 5A4CA 4YHJA 4RJ5A 4XG4A 3FHRA 2PZIA 1NVSA 4J97A 3UPZA 2YZLA 3HMOA 3BV3A 3AC3A 3PVGA 4D2VA 1REJA 2IW6A 3KMWA 1YOMA 4IM3A 5M44A 4YZDA 4EZ7A 3H3CA 1TQIA 3NNWA 2BAQA 1UU8A 4CKIA 5FDPA 3NGAA 2VTLA 4D1XA 5A14A 5DR2A 3NUSA 4BCPA 3DTCA 3GQLA 3UOKA 5F94A 2E9NA 2XEYA 2W4KA 2YM3A 5CF6A 4HZSA 4AN3A 5CALA 4O7YA 4BCHA 2XK8A 4YTCA 4FKIA 4E6DA 1CDKA 4L8MA 4EH7A 3C13A 4FSWA 3FL5A 5J8IA 3QQKA 2R3GA 1H1PA 1XHAA 4R6VA 2O5KA 3SHEA 3IW5A 3VS4A 1H8FA 5CYIA 4JBQA 4PDOA 2JAVA 4RIXA 3AC5A 4ANSA 4FV0A 4QQJA 4CFWA 4DN5A 1XH5A 2QOLA 5HO7A 1H1QA 4OTDA 3NUUA 5D41A 5TOZA 3FL4A 3UNJA 4EOOA 4I6FA 4RT7A 5JK3A 4P7EA 5EM5A 3ROCA 4AW0A 1R39A 3NX8A 1H28A 5T68A 2CKEA 1J7UA 5K5XA 4TW9A 2IW9A 4ZLZA 1UWHA 2VWIA 3UYSA 2QR7A 4JAIA 3ZXTA 4X6QC 4C59A 4ZLYA 4I92A 4RIOA 5EHOA 4QPMA 4ZZOA 2ETKA 4UZDA 1BI7A 3VBYA 5L8JA 4DH8A 3D83A 3PXRA 4FI1A 3DCVA 4IJPA 4BYIA 5DYJA 3PY3A 3QBNA 3HV4A 4ANNA 4CV9A 1Q97A 1M17A 3RZFA 4CQEA 4PP7A 3C0IA 3HUCA 2C69A 3NNVA 4HOKA 4MNEA 4MX9A 4V01A 3HMPA 4DG0E 5I9YA 5HI2A 1QCFA 2PE1A 3QKLA 2XNGA 5HLPA 3TIZA 3UOLA 3R21A 5K0XA 2CNUA 3CJGA 3DQWA 4L52A 4BDAA 4LOPA 3GUBA 4AZWA 5FXSA 4HGEA 5DHJA 1KE9A 4P5ZA 3L9LA 3R63A 4G34A 1KUTA 4ORKA 4ZMFA 2OH4A 4RQKA 1DS5A 1H1RA 4BCOA 4TYHA 4Z3VA 4Z9LA 3NAXA 4O0YA 4DGOA 5CS6A 3VIDA 1UKHA 2CN5A 1UV5A 3SDJA 3Q6UA 4J95A 3I7BA 4YZMA 4EH8A 5TT7A 2RFNA 2PK9A 2O0UA 2UV2A 5HE2A 1Q62A 1XQZA 4EZ3A 1PRYA 3I6UA 3VN9A 2JDSA 2W05A 3OW4A 4MXZA 4R78A 1W98A 2CGUA 2XYUA 4PMTA 2Z7LA 4H39A 5FM2A 5FWKK 4R7HA 1XBBA 4CFNA 4WHZA 2F7EE 2BZJA 4FTTA 3GU7A 3RHKA 4XG6A 3DGKA 4EOKA 3MY1A 2ETMA 2GFCA 3MN3A 4HVIA 4K6ZA 3BQRA 3FDNA 3O2MA 2XK3A 4FNYA 2OIQA 2EXCX 2V55A 4CYJA 4GH2A 4WBBB 1WFCA 5G1XA 2CN8A 3VS1A 1LP4A 4XOYA 5KHXA 4TYEA 1EH4A 4F9YA 2B7AA 4YC6A 3WILA 3CE3A 4NIFB 4FKWA 3VS2A 2WPAA 3T8OA 1IEPA 3EOCA 3W32A 4AF3A 3GNIB 4TWPA 5AEPA 5M08A 3KXNA 4K9YA 5C9CA 4DC2A 2B1PA 4A9TA 4RMZA 3DAEA 4RRVA 4ZSGA 1SMHA 4HGTA 4QMVA 3BI6A 4O7LA 4BCKA 3LXNA 4FTKA 4OBOA 4GVJA 4TY1A 2UZVA 4M69B 3UNZA 5HBJA 3FZOA 1YOJA 3UE4A 3M2WA 4EHEA 3A61A 4DTKA 3O7LD 3QTSA 3FY2A 5HEZA 2DYLA 3TXOA 3U9NA 2C47A 1ZAOA 2GDOA 5EI8A 4GUBA 2WU7A 3NIZA 5FEQA 3C4EA 2PZ5A 3F9NA 3IS5A 2G1TA 3GCSA 4HGSA 4XP2A 3HP5A 3F82A 3HAVA 1U46A 3SLSA 4BDHA 4R3PA 3IKAA 1H07A 2ONLA 3ZBFA 3UBDA 3FHIA 3A7GA 3S2PA 1YW2A 2VO6A 3DZQA 3RJCA 3ULIA 2C5VA 4I6QA 5C27A 3D5WA 2HK5A 3R9OA 1OI9A 2VNWA 3AGLA 3W10A 2V7OA 4DEHA 4BF2A 3ZM9A 4TWOA 2J5FA 3LXPA 3OBJA 3OY1A 2EB3A 4M12A 3UPXA 3RGFA 1ZOHA 4RIWA 4D5HA 3QD3A 5KKRB 3FXWA 2P2HA 3JPVA 2J0IA 2PMIA 2QURA 4MD7E 4ASXA 5CF8A 3JR1A 5JGDA 2HOGA 3DXPA 4FKUA 1JOWB 1CKIA 4AXAA 5C4LA 4FT7A 2QO9A 3A7IA 3MH2A 4HYHA 4FNXA 4S31A 3ZLSA 2WMAA 5M4CA 4RLLA 1HCLA 2VUWA 3AD4A 4L3PA 1PXIA 3D0EA 2OJJA 2Z2WA 3UTOA 3KK9A 4KBAA 4WBOA 1OB3A 5FRIA 2R3LA 2B9FA 2W1GA 3C9WA 4GVAA 1YI3A 2O64A 2PUUA 2H8HA 4QP1A 3FMMA 3KC3A 1RJBA 4G5PA 4EHVA 4FUXA 3QYZA 4JDJA 2VO7A 4GEOA 2X2KA 4BDIA 5AUXA 4O27B 2JDVA 2HXLA 3ACKA 2EVAA 3DQXA 3P08A 3DTWA 4W4XA 3RK7A 4QP6A 3KGAA 3OCSA 1UNGA 4PP9A 4Y46A 3QTQA 4B6LA 3M11A 4DFZE 2FSLX 2ITQA 2C1AA 2YZAA 5AV2A 1JBPE 1OMWA 4JAJA 3QLFA 4ZSEA 4BDKA 5HORA 4WSQA 2OJIA 1ZYCA 4KUJA 1XH9A 1FQ1B 1TQPA 4G3DA 3UIBA 4AZTA 1GZNA 3Q4CA 4ZMEA 2C5NA 3BGPA 4ZY6A 3VUTA 3MESA 4HPUE 2F2UA 3ZDIA 3KU2A 1FVVA 2XJ0A 2YFXA 3Q60A 4JBOA 4MH7A 3THBA 4FYNA 5ICPA 2ZM4A 4EJNA 5I0BA 1KV2A 5FXQA 4U5JA 3VQHA 4LG4A 4EK3A 3OEFX 5CU4A 1G8SA 2YJRA 3QU0A 4NCTA 4X2NA 5AA8A 1XH4A 5JQ5A 1BL6A 2XA4A 3FKOA 4KRCA 4RVLA 3G9NA 3QKMA 5C8MA 3V5TA 1JKSA 4AT3A 1H00A 4IX5A 5E90A 3C50A 1PXKA 4ZOGA 5AFVA 4EYMA 4JQ8A 5BX0A 4K8AA 4AA0A 3GENA 3VNTA 4QMSA 2GS7A 3V8SA 3ZCLA 4AW1A 3OW3A 5A9UA 1YKRA 2WZJA 3ZZEA 3BHVA 1V0PA 3MI9A 5KHWA 4TN6A 3EQHA 4D4YA 4CTBA 2NPQA 2X4ZA 4ONAA 4O6LA 5HU9A 3DT1A 4G17A 3QRUA 4KIKB 3H0YA 4AOTA 3S4QA 3PG3A 3N4UA 3ZHPC 3PA3A 3PJ2A 4ZTMA 2YIYA 1OL1A 4GMYA 2G2HA 4RQVA 3RCJA 5HX6A 2XNOA 3R28A 4ARKA 4EOQA 4BHNA 3EQGA 5EYCA 4XLIA 5LWMA 3KCFA 4ZP5A 3JS2A 3FE3A 4EOJA 4NKAA 4JRVA 5CX9A 3COIA 5CZIA 4FTQA 3O17A 3SOCA 3U9CA 4EHZA 2QOQA 2YLFA 3C0HA 2R0UA 2XK4A 1SYKA 4PUZA 4TYJA 3E8NA 5CY3A 4AGDA 2Q83A 2WMSA 3C0GA 4I93A 4ZIMA 4E26A 2BALA 4TRLA 5C8NA 4O7ZA 2GQGA 1MUOA 4FV4A 4Q9SA 4YHTA 1URWA 3VF9A 1PYEA 4HCUA 4W8EA 3VF8A 2JLDA 2PE2A 4BDEA 3P4KA 4II5A 4XLVA 2YIXA 5HCYA 1Z9XA 3OUNB 5TO8A 1LPUA 3BGZA 3RPSA 5LARA 4AA5A 3KFAA 5E8XA 4L68A 3VHEA 2ZVAA 3HP2A 1R3CA 3A7JA 3DU8A 1GOLA 3CGFA 2X4FA 2UW4A 4IW0A 4EWHA 4CZUA 3R9RA 2RF9A 2XVDA 3R6XA 5DEYA 5J5TA 3DZOA 4GK2A 3MJ1A 4JDIA 5KKRC 3UOJA 4O83A 3QTXA 5J95A 4PPBA 3PSDA 3UO5A 2HAKA 2ERKA 4ZSLA 2BKKA 3QTUA 4X6RA 5HX8A 3N9XA 3Q6WA 1LUFA 3AT3A 4I5PA 4IMYA 4LUEA 4F70A 1JWHA 1PXPA 1ZY4A 3MWUA 4ZTRA 4PNKA 2VWUA 4EK6A 3MY0A 2XYNA 5FTGA 3FLYA 3V8WA 1QPJA 2GNFA 5IMXA 2JBOA 3I0QA 4IX3A 4FZ6A 1P5EA 4OTWA 5JRSA 3MFTA 4Q9ZA 2PVKA 2BTSA 5JH6A 2VZ6A 3EN6A 3KL8A 4O7NA 4AW2A 1YOLA 4N6YA 3DBEA 5DT0A 2QLUA 2W0JA 4MWIA 5I9VA 5CF4A 1YDSE 4L7SA 5DT3A 4D2TA 1PXNA 2QOBA 3EQRA 2OH0E 3LM0A 3UVPA 4UY9A 5HD4A 2R4BA 2JDTA 3PZHA 3E88A 3EN5A 3QXPA 5ANDA 4XRLA 4D2RA 4BBMA 2Q0NA 5A4EA 5CF5A 2XBJA 3QAME 4IX4A 3LW0A 5TE0A 4XS2A 1GZ8A 5CSVA 4O91A 2OI4X 4UX9A 4FSMA 3ZXZA 4CCBA 5IU2A 5AAFA 4IAKA 3FZTA 3M42A 3SKCA 2O2UA 4P90A 3R8ZA 4F99A 3MB6A 2QR8A 5IG1A 3W16A 3LFCA 5KMMA 3MIAA 3PXFA 2H34A 4YURA 3VUGA 2YAAA 4KD1A 5EW8A 2YEXA 2PVJA 2C6TA 4I0RA 4AZEA 3GB2A 4YPDA 1YXUA 4IZ7A 4MKCA 3FLNC 3ZO1A 1PY5A 3D9VA 4MYGA 3MFUA 4ACGA 1O6LA 3F3UA 3IDPA 4B8MA 3R9HA 1APME 4DYMA 4WNKA 3GI3A 3OG7A 2BTRA 4KS7A 3Q96A 2X0GA 3MPAA 4O0RA 4IAZA 4C3RA 2H96A 4FEXA 2HY0A 4DT8A 5CWZA 3POOA 5LMAA 3R8UA 4RVMA 2RFDA 1CTPE 1Z57A 2W1CA 4X2GA 2E9OA 3EKKA 5BPYA 4C57A 2RGPA 2J0KA 4I20A 1Q4LA 3AT2A 4X0MA 1KE8A 4JOAA 4RJ3A 3OWJA 3ZRKA 3FYKX 5D12A 2QG7A 3ZUUA 4M3QA 5AV4A 3LFSA 4KSPA 4FZ7A 2CLXA 2WOTA 3PG1A 4DGNA 2OW3A 5IQBA 2W9FB 4YSMA 3TV6A 4EONA 3LCTA 2PVLA 5FEDA 5HVKA 5M4UA 4NK9A 1Z5MA 1W84A 4FIEA 4O96A 3VVHA 2XIRA 4MXYA 5ANEA 2ITXA 4RVTA 4EOMA 4XNEA 4NSTA 1ERKA 2C3JA 3L9PA 3PXKA 1NT2A 3VW6A 3TNHA 3QL8A 1T46A 2IVVA 3DNDA 2QNJA 4M14A 1NY3A 4I0TA 3PLSA 3HX4A 3SOAA 5JSMA 5BVOA 2GHGA 2ONLC 3PWYA 2JD5A 4FK3A 4J53A 1B6CB 2H9VA 4IZAA 1YHVA 3V6SA 2BZKB 4NH1A 2IZTA 5LVLA 3NVKI 3KXXA 4EH6A 1KWPA 3GXLA 4HCTA 2GQRA 2J90A 4NYEA 2FA2A 4CFVA 3ACJA 4H58A 3NSZA 4J8MA 3CLYA 3ZFYA 5CAPA 3TUDA 3IQ7A 1BL7A 5HNBA 2ZB0A 3O8UA 3NWWA 4RC3A 1Q5KA 4RIYB 5AUYA 4FF8A 2QVSE 4F9CA 4QMTA 2ERZE 5F9EA 2CLQA 4JJRA 2RFEA 4UMUA 1E1VA 4JG7A 4AFJA 3P9JA 1V0BA 4QP8A 2OZAA 2SRCA 1YHWA 4H1MA 4CT2A 3DK6A 3QCXA 3MPMA 4O1PA 3PJCA 1OIRA 5HG7A 2RKUA 3C4FA 3Q9WA 4USDA 2OXXA 3MW1A 3O71A 4W4VA 4YJPA 2UW8A 3ORMA 4XEYA 4ZS0A 4KSQA 5FBOA 5DIAA 1XR1A 4BTMA 4BL1A 4WIHA 3GBZA 4XX9A 2HXQA 3KXZA 3A8WA 2YCRA 3VRYA 5CSPA 4HZRA 4PRJA 4QTAA 3QFVA 3RK5A 3KULB 3BHTA 4BDGA 1CSNA 4FGBA 2XRWA 4IB0A 4CZYB 1V1KA 3H9FA 2VO0A 4QMMA 5HO6A 2G2FA 2GCDA 5IDNA 3BELA 4NT4A 1QPEA 4EQCA 1FBNA 5FXRA 4YNEA 4MNFA 3UC3A 3EYGA 2V0DA 3JUHA 3HUBA 3NRMA 3BHYA 3QWKA 4WUAA 5CI7A 3AC1A 3LJ0A 4GKIA 4GCJA 5M07A 4QMOA 4JS8A 4ZSJA 5K3YA 2ZMCA 2UVXA 3OXTA 4I3ZA 2CHLA 3VJOA 2A0CX 5EM8A 3GT8A 2ZYBA 3CQWA 4GK3A 3ZLXA 2Z7SA 3VBXA 4E93A 4YC8A 2QHMA 2REIA 1UWJA 3ZC5A 4CFMA 3OROA 3U87A 2J51A 4IWQA 3W2RA 4RVKA 2HW6A 3DXNA 4NW6A 5CTPA 2XNEA 4OT5A 3F3WA 4Z16A 3KRRA 2VTHA 4XBRA 3LKMA 3N4VA 4D58A 4D2WA 2C0IA 2I1MA 3EKNA 3WF6A 4O0TA 5ANGA 3WYYA 4M97A 4ZY4A 4D4VA 4E5BA 2UZOA 4M67A 4YLJA 1H08A 1M7QA 2VRXA 4Z7GA 1WBVA 2C6DA 2C5OA 2J5EA 2VGOA 4G9CA 5E1SA 2JKKA 2VWVA 2JFLA 2ETRA 2YISA 3EN7A 2Y6MA 3QCQA 2ZM3A 4GS6A 4DFNA 3ORIA 5A46A 2UW0A 2W4JA 2WO6A 3KQ7A 3MB7A 4RWLA 2J7TA 4DAWA 3PUPA 3PPJA 2AC5A 3HLLA 5HICA 3ALNA 3HA8A 2Y0AA 5IA4A 5ANIA 4E7WA 1R0PA 2C30A 4ZAUA 5BQ0A 2WTWA 3RM6A 4XG2A 3WZKA 5CEMA 5J1VA 4Y5HA 4RWJA 2OXDA 3NLBA 1UU3A 3R1SA 3JVSA 3QRJA 3KXHA 4IADA 5IA0A 4FG8A 2QOHA 3SD0A 5AR7A 2IVTA 4OTGA 3SX9A 2WMVA 4FA2A 2XKCA 4JNWA 3EJ1A 5FDXA 1W7HA 3IONA 4IACA 2BILB 4CXAA 4FC0A 2BZIB 3OCBA 5J5SA 4YJOA 3UQCA 1MP8A 2PMLX 4FMQA 4IVDA 1H0VA 3LZBA 3TG1A 4AU8A 4EH2A 3A99A 3MPTA 4QPAA 4XG7A 5L3AA 3ZSIA 2QODA 4U7ZA 1Y57A 3RAHA 5F95A 2YM4A 1PKGA 2XJ1A 4XRJA 3ANQA 5BVEA 3TV4A 4ALWA 1PYXA 4MEDA 4YJSA 2BHEA 3R04A 3WZEA 2C68A 1UNLA 4APCA 4IFCA 4LV5A 3TUBA 3O8TA 1NVQA 2XNPA 4W4WA 2C3KA 4C61A 3Q5IA 3AC8A 2YM7A 4QP7A 1OKZA 5K0KA 4FEVA 3TCPA 4YHFA 3TNWA 4BTKA 3UIXA 3FKNA 3QHWA 4G3FA 3EHAA 3HKOA 4O2ZA 4B8LA 3BLRA 5HIEA 1G3NA 3P79A 4WRGA 2BCJA 5IEYA 2ZB1A 3CS9A 3DKFA 4EUTA 4X2FA 5FEEA 4NIFA 2C3IB 2FGIA 2OFVA 4GL9A 4MBIA 3GFEA 4USEA 3TNPC 1BKXA 3SV0A 5TF9A 5L8KA 4E6QA 4W8DA 3VS0A 3P86A 3OFMA 5ACBC 4JR7A 3MFRA 4KINA 3P7CA 3FMEA 3OWPA 4EKLA 4V0GB 5HZNA 2UW6A 5JFXA 3R7YA 4BC6A 4BCJA 3QF9A 4O86A 5AAEA 2UZWE 3DLSA 3F5XA 4LMNA 4V04A 1STCE 1GIHA 1MQBA 4M69A 3WBLA 4USFA 4O7SA 1YDTE 5J79A 4C4FA 4K33A 4A9SA 4U44A 1H0WA 4DBXA 2YJSA 1ZARA 2IN6A 3FMLA 3MH3A 4L00A 3OOGA 3LPBA 5ITAA 4AOJA 3O96A 3IW8A 4S2ZA 3QA8A 3Q3BA 4EJ7A 2XEZA 5AP1A 4FVRA 1Q41A 3HDNA 3LFEA 3DJ5A 2B53A 1PJKA 3QX2A 3UODA 4X7QA 4NWMA 3REPA 3C4XA 3U55A 2VTRA 3TT0A 4MCVA 4ACHA 2J6MA 4HVHA 3SG8A 2F2CB 2HZ0A 5K4JA 4DGLC 3QRTA 1GZKA 4PX6A 3EZRA 2OFUA 3PXZA 5LVMA 4M13A 3A4PA 1LEWA 1WBWA 3NUXA 4FSUA 3DXQA 4DH3A 4LMUA 1IR3A 3EMGA 1B39A 2CPKE 5LMBA 2I6LA 4RJ8A 4FZAB 2X1NA 4ZTLA 4GKHA 4H36A 4ACCA 1Y91A 3FUPA 4W9XA 3NNUA 5AWMA 2RSVA 1DAYA 2C6EA 4FK6A 1BX6A 1BUHA 2W99B 4O0SA 3EIDA 3EQBA 3E3BX 2GTMA 3LQ3A 2R2PA 1OL7A 3PXQA 4KKEA 4ANLA 3FI4A 4NM5A 1OGUA 4TYGA 1WBPA 1H26A 4WNMA 2KTYA 3B2WA 5FQDC 4IVCA 2FO0A 1O6YA 1PMEA 3NIEA 2X9FA 4E4LA 3K5UA 2RIOA 3DLZA 3K5VA 4MAOA 2Q0BA 3IOPA 1DI9A 4YLKA 5AP7A 3F69A 5HBHA 5HESA 4PDYA 4TWCA 4EORA 4ZJIA 1ZOEA 2O8YA 3TUCA 3LFFA 3UQGA 1ZMUA 4YTFA 2JITA 3UZPA 1WMKA 1H1SA 3QTZA 2NNWB 4DH5A 3HZTA 5K9IA 5BVWA 3G51A 4IEBA 2I0EA 1WBSA 3KKVA 3EN4A 4DBNA 3GC7A 4YJQA 5CNNA 4R3CA 5D7AA 5A6OA 2X8EA 4EZ5A 4BN1A 3SAYA 4GJ3A 4AW5A 2CKQA 1IASA 4IB3A 2JDRA 2OIBA 4U42A 5LJJA 3QTIA 3K2LA 2IJMA 5L8LA 2XIKA 2ITNA 3KRXA 3FSFA 5BYYA 4AZVA 3CC6A 5HOAA 3RI1A 1WVWA 1XH7A 3PPZA 4YBJA 4FICA 5AX9A 4O84A 3RNIA 1KV1A 2IVSA 4XCUA 4XG8A 5CANA 4O2PA 5KBQA 4G9RA 2R3HA 3CP9A 5AR3A 3RWQA 4AACA 5A6NA 4AP7A 1BYGA 1URCA 3LXLA 5BMMA 2HWOA 2XKFA 3IW4A 1P4FA 1CKPA 4W9WA 3RALA 4OW8A 1YXXA 4IB1A 3CPCA 1OPJA 4KIQA 2WMTA 2JIIA 5CEIA 3MS9A 4BVUA 4FTIA 2HZIA 5M09A 2ITUA 2P3GX 4Y73A 2E9UA 3V01A 4I41A 2R3OA 3D4QA 3F3ZA 2YWPA 5BVKA 3QXOA 4E3CA 3DKGA 1B38A 3QC9A 2HCKA 3L8PA 3QWJA 5IEVA 3DK3A 3QTWA 3RVGA 3ZRMA 1PMUA 4BDDA 3ORXA 4PWNA 3DAKA 3WIKA 3OVVA 1OUKA 1H24A 3H0ZA 5JQ8A 2R64A 4XMOA 2PUPA 1QPDA 1E9HA 4KIKA 1PHKA 2PY3A 2W1DA 3G0FA 3VRZA 3UIMA 3CQEA 1YI6A 3EQDA 4CFUA 5L6WL 5CAOA 3CBLA 3ZFXA 3TM0A 3BQCA 3FJQE 3SQQA 3D94A 2X2LA 3R1NA 2GTNA 4IXPA 2JIVA 4CV8A 4KB8A 2NP8A 4PTCA 3BKBA 3ZUTA 3NUPA 1SM2A 5HCXA 2I7QA 3TDWA 4CLJA 3UVQA 4DCAA 3F88A 2W4OA 3ITZA 4EKKA 5KCVA 2AUHA 2A27A 5ETIA 5FTOA 2C3LA 3QD2B 4BDJA 1IG1A 5HU3A 3BU6A 3MA3A 3V3VA 1OZ1A 2YDKA 3FQEA 3FYJX 5DPVA 5DRDA 5KZIA 4TNBA 5IH4A 5HO8A 4U3ZA 1P4OA 4TZRA 4K11A 4U97A 4F08A 2X7GA 4JVGA 4OBQA 1NVRA 3NZ0A 4AG8A 2RFSA 1CMKE 2X8IA 2YCSA 4RC4A 5EI6A 5EKOA 4BBEA 4C35A 4OAUC 3UIUA 5AUZA 3L1SA 4H3PA 3T9IA 2W1FA 3EL8A 4FODA 3WI6A 4WG3A 4N57A 4RX5A 4XG9A 5E8ZA 4RFMA 2VWZA 5GJDA 2CCHA 3WZJA 3ZYAA 1U59A 1ZZLA 2FSMX 4ID7A 4AX8A 3PDTA 3FQSA 4P2KA 4H3BA 3BGQA 5A4TA 3NMUF 4R3RA 2Y6OA 3DDQA 4FR4A 4JBVA 4LRMA 3S3IA 5A4QA 3OCGA 4LYNA 4YJUA 4BIEA 5KMIA 4J99A 1UU7A 3FY0A 3VQUA 4U45A 1R0EA 4XP3A 4O7RA 1P14A 5CVGA 4RWIA 3TWJA 2HW7A 4GUEA 5AR2A 5I3OA 1H27A 5IQHA 1IA8A 4M7IA 3DA6A 5EHLA 3C4CA 3FXXA 3QRIA 3QUPA 3PA4A 4PDSA 2PYWA 1PXJA 4HW7A 2R3JA 3TN8A 3IO7A 1JPAA 1BI8A 4CGAA 2GNGA 4ZTQA 4G3EA 1AGWA 5CEPA 3FPMA 3W33A 3ENHA 2UZUE 1ATPE 2WTVA 4LGHA 4UWBA 4CRLA 3CSVA 2VN9A 4MQ1A 4QNYA 4EEVA 3O23A 5F1ZA 3GCUA 2J4ZA 3E64A 3LLAA 5H8GA 4CRSA 4XH6A 1G8AA 3LCOA 1XJDA 2PE0A 2XNBA 4DINA 4MF1A 1WBOA 3FBVA 1OL2A 3FZPA 4KKHA 4BDCA 3O7LB 4E4MA 5BUEA 3ZOSA 3NR9A 3BIZA 3Q4UA 3R8LA 4QPSA 2WQNA 4IANA 3BU5A 4TXCA 4YJTA 1UKIA 1YVJA 3HDMA 4QMXA 3RNYA 5IEXA 4ANMA 4L67A 3ZO3A 3WARA 4MWHA 5AMNA 4FNZA 3GCPA 3KN6A 4BGQA 5AP2A 3VUDA 2CNVA 5KO1A 4BZDA 2WTKB 3GC0A 3HRCA 3PIZA 2WMRA 4NM7A 2WAJA 5FTQA 5CNOA 3R7IA 5GZAA 4PV0A 4AWIA 3F61A 4CMUA 2JDOA 1Q99A 2BDFA 3PSCA 3FZRA 5CSHA 3I0OA 1Q24A 3P7BA 4RJ6A 4EK8A 4YLLA 5E92A 3G9LX 1Q8YA 4IAAA 4R5YA 3LJ2A 4DG2E 5J9ZA 1ZYLA 3Q4ZA 1JKTA 3R02A 4LM5A 4BTFA 5AP5A 3AGMA 4QYYA 5B0XA 3UDBA 3LFDA 4I22A 4ZTNA 2BKZA 2WD1A 3E7VA 4D2SA 2Z7RA 3UG1A 5DWRA 3ZFMA 2BDWA 3A62A 2XM8A 2C4GA 3A2CA 4IBMA 4E5AX 4G6NA 4NJDA 3Q9ZA 2UUEA 4WOVA 4R1VA 5KMLA 4F0FA 1GZOA 3D15A 4FTNA 5CEKA 5JEBA 3Q2JA 3HVCA 4I4EA 3PYYA 4FT0A 3G90X 4U81A 3RBWA 1AQ1A 2FSOX 5IF1A 3TV7A 4DTAA 4DTBA 3BLQA 4MXOA 4EC8A 3D14A 2ZJWA 2WTDA 4O0VA 4DEEA 2VWWA 4O0UA 1OITA 3LFQA 1Y6AA 4I5MA 3SG9A 1R78A 4W4YA 4EQUA 4CFFA 5L6PA 4FV6A 4BCGA 2PULA 3GCQA 1XBAA 1JLUE 4DLJA 4RJ7A 1HOWA 1QMZA 4PNIA 3ZU7A 2EWAA 4RSSA 3DBFA 2W5BA 3FAAA 4CG9A 3RAKA 3Q04A 5LCKA 4DH7A 2C5XA 2J2IB 3R1QA 3ZSHA 4C0TA 2XS0A 4LRJA 3L8VA 1FMKA 3FI8A 3C7QA 2WEIA 2O3PA 3KK8A 4ITHA 4N0SA 2VV9A 3QCSA 5JT2A 3QZIA 4UB7A 3TNIA 2VGPA 1A06A 4FKOA 4LL0A 4CMTA 2E9PA 4L3LA 3II5A 4DGGA 4QMNA 5TR6A 4JQ7A 5BUIA 4YC3A 1KOBA 4F7JA 2GNIA 4F0GA 4L45A 1QL6A 4A9YA 3R30A 3DB8A 4A06A 2WHBA 1VZOA 3M1SA 3F3TA 4UYAA 3DOGA 4I5CA 4BY9E 4U40A 3RPOA 4BIDA 4Y83A 5LMKC 3OMVA 4RIYA 3QD0A 2WMUA 2PMOX 1IAHA 3ORLA 2W1HA 4IDTA 2Y8OA 5JKGA 2HY81 4ZXTA 4F7LA 1OBDA 3FMDA 4MF0A 3TTIA 3NUAA 5E7RA 3DJ7A 2C5YA 1NW1A 2UZTA 4RA4A 4YZCA 4QMYA 1Y8GA 3QUEA 4IHPA 3TIYA 3DJ6A 5BNJA 2VX1A 1NXKA 4GG7A 1WVXA 3E93A 3QLGA 3UP7A 2CKPA 3EZVA 1UVRA 5I9XA 3C1XA 3EFWA 3QZGA 4TWNA 3TACA 2OZOA 3BHHA 3UG2A 2YACA 3LAUA 1OKVA 3KULA 2UZEA 4DEIA 3WOWA 1PKDA 1A48A 5IQGA 2X7FA 4C33A 5JGBA 4FTAA 1TVOA 1U54B 5AIKA 2XIYA 3S00A 2XK7A 5HQ0A 3F2RA 4HNIA 4FEWA 3I7CA 3VO3A 4R5SA 3LCKA 4F9BA 2YAKA 4FKTA 3KVWA 4EI4A 1DI8A 1UA2A 5FM3A 3NAYA 3BE9A 5AAGA 1LR4A 5JFWA 2DWBA 2V62A 2R3PA 3W8LA 3D5UA 3HV7A 3V5JA 4DG3E 2HYYA 4F6UA 4EUUA 4HVSA 4A9RA 5HTCA 3V5QA 3PE1A 4FTUA 1FINA 3BYOA 3O0GA 4C02A 2VTQA 4IX6A 4G3GA 1F3MC 4I6BA 2PU8A 2OICA 4I24A 4BTJA 2UW3A 4YTIA 5LVNA 2X7OA 4OGRA 3EQFA 4RJ4A 4QQCA 3FKLA 3GC9A 3HV3A 4JDKA 1XO2B 3VBWA 3W8QA 4BBFA 4D9TA 3GU6A 4ZS4A 3GOPA 2XKDA 1R1WA 3EYHA 4FL2A 1M2PA 2OF4A 4PF4A 1RE8A 2VTTA 2VWYA 1GIIA 3E62A 4QTEA 3AT4A 4R7BA 3CY2A 1HCKA 4HYUA 4BKYA 1CKJA 1JQHA 2YIWA 2R3MA 5HTBA 2W1ZA 3QYWA 4IH8A 4AA4A 4QYGA 4CMOA 2AC3A 4FKLA 4FT9A 2BROA 2BFXA 3HA6A 2BRNA 4JBPA 4QP4A 4ASZA 4BWXA 4TPTA 4ZK5A 4JQEA 2FB8A 3DFAA 2RL5A 3GC8A 5EHYA 4HVGA 5IUHA 3DK7A 4KNBA 1GJOA 2J0MB 5DR9A 3O8PA 4D4SA 2BRBA 3O51A 3UVRA 4XV2A 4L7FA 5IA3A 3HRBA 3R01A 3QKKA 2C6OA 4QMLA 3LFNA 4M8TA 3MH1A 4X3JA 3E5AA 3E8EA 4U9AA 4R77A 5FUTA 2CSNA 4LFIA 3R9DA 3H9RA 5EH0A 3QD4A 2QOIA 3QUDA 4CG8A 3UP2A 2XRUA 4CFXA 4M15A 4FSQA 4GG5A 4TKSA 4AFEA 4EYJA 5CSXA 2RG5A 2WEVA 5CXZA 3FLWA 3DNEA 4FSTA 2PZYA 3UJGA 3DPKA 2JC6A 2XK9A 3A7FA 3GEQA 5CI6A 3HNGA 4K0YA 4X3FB 3RPVA 2YIRA 4ANQA 4ASEA 2DQ7X 4EH5A 1JVPP 4UBAA 5AV0A 1M2QA 3NVMB 4O0XA 4YZNA 4L53A 4BFMA 4A9UA 3R8MA 4NKSA 4C3PA 2QCSA 5GHVA 4D0WA 1L8TA 2CCIA 3LE6A 3MY5A 1H4LA 3G6HA 3GU8A 4FSRA 4RGJA 5GINE 4B9DA 4FTOA 4IAIA 4LOQA 4YGAA 1ZZ2A 3DKOA 5J87A 4DEBA 4FL3A 3R8PA 3BWFA 4MD8E 4IAYA 1IRKA 4BCFA 2W1IA 4JXFA 5F20A 2OJGA 2XCHA 5KMNA 3ORNA 4FYOA 4O1OA 4OTIA 5ANKA 5E8SA 4GFMA 3Q4TA 1X8BA 4MXAA 4S30A 5DT4A 3FMHA 3LFAA 4FV3A 2XUUA 2HELA 5D11A 3P1AA 2VWBA 3QTRA 2QO7A 4Y5QA 5CQUA 3OP5A 2RG6A 3HL7A 3GFWA 5AIRA 4E4XA 2ITPA 5IQIA 5AUTA 2ZM1A 3DBCA 3MJ2A 2LAVA 4LOOA 4QD6A 4V0GA 1J7IA 2X6DA 4BZNA 3EFJA 2BRHA 3OTUA 5EYMA 5M4FA 5CT7A 3KREA 4DEDA 3FSKA 4U79A 1V0OA 5HCZA 3AMAA 4FV9A 3BU3A 5C01A 4FNWA 1XH8A 3R7VA 1H25A 3AMYA 2X6EA 2XBAA 3E3PA 2PVYA 5DFPA 3TNQB 4BWKA 5IQFA 2JFMA 3S1HA 3COMA 2XNMA 4F9WA 2Z8CA 3R8VA 1P2AA 4EK5A 2EXMA 2VTSA 3PZEA 1M14A 5DG5A 4O22A 4JDHA 5DA3A 5H9BA 4NU1A 5ANJA 3CJFA 4IB5A 2A1AB 2HZ4A 5D1JA 2VU3A 5FG8A 4UWYA 2J0LA 4D5KA 5BMSA 4B7TA 1Q3DA 2A19B 4L42A 5CVHA 3MFSA 2PPQA 3NYNA 4J71A 3ZEWA 3IK3A 4EK4A 3UO4A 2XB7A 2PVNA 1YI4A 3I4BA 4PL3A 4XUFA 1J1BA 3EL7A 1I44A 3A8XA 5CENA 1SNXA 1UNHA 5JZNA 2O65A 1M2RA 3AMBA 1M7NA 2BFYA 4BCIA 2C6KA 3BEGA 5HE3A 4BHZA 1K2PA 5AM6A 3VS5A 4UYNA 4N70A 5JZJA 4BI1A 1WAKA 3MTLA 4G1WA 3CD3A 3LXKA 3QHRA 4I0SA 5LWNA 5GIPE 2QHNA 2OSCA 4J96A 4GFOA 4JL9A 3RAIA 4EH3A 4LQMA 4F6SA 5KX8A 2P2IA 2JIUA 3VAPA 4WA9A 4QYHA 3WF5A 3EQCA 3MVJA 5CAVA 4UXQA 2OXYA 3OZ6A 2YCQA 5IKWA 1FGKA 5EI2A 4BB4A 1M52A 4CKRA 2YABA 4EOPA 3ETAA 5DMZA 4QMWA 3LOKA 4NUSA 4QQTA 1W83A 3HV6A 4RFZA 2P55A 4F09A 3HAMA 4H05A 1SVEA 3EQIA 4QYEA 4ACMA 4BCNA 4YUQA 5EFQA 3I81A 4RX8A 3GCVA 4G3CA 5HD7A 3WYXA 4C2WA 5EQEA 2PWLA 5C1QB 3DY7A 5I4NA 1CM8A 4K77A 1FMOE 3DAJA 3FQHA 3QCYA 4RA5A 3U6IA 2XNNA 1MRYA 1LEZA 1OPLA 2IWIA 2QKRA 2R3QA 4AOIA 2R3KA 2CNQA 3ZH8A 3FLSA 1FVRA 5DLSA 2BVAA 2FH9A 3MVLA 2GS6A 4UALA 3NCZA 2YLEA 4KBKA 5ETAA 4B4LA 4ACDA 2OGVA 3ZRLA 5FP6A 3ZS5A 4DE4A 3F6XA 3U54A 5AUUA 5IQAA 3FLQA 1VR2A 5AP4A 1PMVA 5C4KA 3W2PA 5LXMA 4FKQA 4IVBA 5HVJA 2OF2A 4K1BA 4G16A 2P0CA 4M66A 2G15A 2R9SA 3PJ1A 5KBRA 4YP8A 2R3FA 4UWCA 3C4ZA 4FT5A 4XJ0A 4GIIA 4O7VA 5M4IA 4X21A 2YIQA 4MK0A 5E8TA 4FOCA 1ZMWA 4F1OA 4EWQA 1Q3WA 4ENXA 2XMYA 4MBJA 4FIJA 5AP3A 3IGOA 4FVPA 5G6VA 3PRIA 4QMUA 2OWBA 3FXZA 4HVDA 3FZ1A 5IUIA 3ZSGA 1GY3A 3MA6A 5DOSA 2DUVA 1OIUA 4L43A 5CU6A 3UZRA 4S32A 2GFSA 3CCNA 3FPQA 1E1XA 3KCKA 4X2KA 2ZV7A 4IAFA 4E8AA 1T45A 2BPMA 4IDVA 1U4DA 1G5SA 3QZHA 4J8NA 4JX7A 3D2KA 5DR6A 5HG8A 5HGIA 5M55A 3SVVA 4PL4A 3PLAE 3JXWA 4WD5A 4R7IA 3PE2A 3FI3A 3OD6X 5HIBA 5I9UA 4BCQA 2ZOQA 4AAAA 3QQFA 3NUNA 3ODYX 3QQGA 4EL9A 3LMGA 3E8CA 4PDPA 2B54A 2W9ZB 3MVMA 3IG7A 5JMSA 4CD0A 4CT1A 3IPHA 5AR8A 4O81A 4RC2A 2ITZA 3KVXA 4YPSA 5LVPA 4ZEGA 1PW2A 3DDPA 3RMFA 1L3RE 4YO4A 1ZYSA 5IQDA 3FZSA 3MTFA 3D5VA 4FSYA 3PSBA 3G6GA 3V8TA 5I9ZA 4ANBA 1Y6BA 3D2IA 4KBCA 2E2BA 4IZ5A 5AV3A 5IA5A 3VS7A 4F0IA 4NL0A 2WB8A 4AS0A 1Q8ZA 4C4EA 5LMKA 2PVMA 4WKQA 4AT4A 2YCFA 4DHFA 4RX7A 5HNGA 5M57A 3BBWA 4JG8A 2B52A 3G15A 3ORKA 4F63A 2UVZA 3ORTA 2A4LA 3PPKA 3RHXA 2GNHA 3TKUA 3H10A 2W17A 4FGRA 4BWPA 3VUHA 4PL5A 3RP9A 5GJGA 3TEIA 3UO6A 2W1EA 4GW8A 4FV8A 4CKJA 3PFQA 3CKXA 3GOKA 1WCCA 3CR0A 3FMNA 3AD6A 3KMMA 4AGCA 5CZHA 3MGYA 4FZFB 3BE2A 4WNPA 3I60A 3HYHA 4ZTSA 3SRVB 5CU0A 4OBPA 4PQNA 2GQSA 2GSFA 4FIGA 2R0IA 3FEGA 1YWRA 3WE4A 4GFGA 4S33A 3RTPA 4UMTA 5AUWA 2IZRA 1J91A 1OIQA 4M68A 3TI1A 2CGXA 3C51A 3TJDA 1XKKA 1KOAA 2EB2A 4MVFA 4NM3A 5DBXA 5HG5A 1MRUA 5EDPA 4C34A 4F9AA 2EUFB 3AG9A 3PA5A 3ANRA 3O50A 4A7CA 3QALE 1PXOA 2XK6A 4ZZMA 3BYUA 4GV1A 3U8WA 4YBKA 2OBJA 2Y4IB 1GAGA 3R1YA 3W18A 5CAUA 2XCKA 5EKNA 5DI1A 2XKEA 2LGCA 3PJ3A 4CQGA 2WMBA 3W1FA 5KE0A 5B2LA 4CTCA 2QKWB 2V5QA 3FMKA 3EQPA 2FYSA 2XM9A 2KULA 3CQUA 3VBQA 4NJ3A 4ERWA 4AQCA 4JRNA 3KMUA 2IZUA 3NW5A 4I5HA 5AR5A 4DFYA 2PUIA 3NUYA 3NNXA 2BIKB 1ZRZA 2ZDUA 3F3VA 4IWPA 5DGZA 4YR8A 1GIJA 5M56A 3EB0A 3QQLA 4RWKA 4U43A 4ZLOA 3DFCB 3QA0A 3PTGA 5KZ0A 2OLCA 4IVAA 1JAMA 2YM6A 1OKYA 2F7ZE 4IWDA 3VULA 1BMKA 3MVHA 2H6DA 2WQOA 4IQ6A 4KIPA 2ITYA 3E63A 3Q52A 2C1BA 2WTIA 3EH9A 5HHWA 4AN9A 4BCMA 2OKRA 4C38A 3VUMA 1KE5A 4DFUA 3ZTXA 3Q53A 2VWXA 3DV3A 3D7TB 2WQEA 3FC1X 4Q2AA 1WVYA 4QT1A 4U80A 4ALUA 4PTEA 5DNRA 4C4GA 4OUCA 4A4OA 4QMPA 1WBNA 4IE9A 5D9HA 4I23A 4V05A 3F2NA 1DAWA 3QQJA 2YITA 3GU4A 4RPVA 1RQQA 3CD8A 5LQFA 1ND4A 4F1TA 1JNKA 3NDMA 4QTBA 5KMKA 4JR3A 5IPJA 4IC8A 1ZMVA 4J7BA 3TTJA 2BHHA 4PMSA 4EQMA 4FEUA 2Z02A 3CTJA 1PXLA 4L46A 2QQ7A 2B55A 2YDJA 4BYJA 3SA0A 1Q61A 4XYFA 1JKKA 2QU6A 2YWVA 3T9TA 1OL6A 1F0QA 5JRQA 2ESMA 3C5IA 3WZUA 3LLTA 1OUYA 3FI2A 3ET7A 2DS1A 2G9XA 4LV8A 4WG5A 5A3XA 4QYFA 3UMWA 2XP2A 2V22A 3PVUA 4OT6A 4PPCA 4CEGA 2EU9A 3ZMMA 2J50A 4E4NA 2XZSA 2W5HA 2W7XA 3MBLA 5J9YA 4FSNA 4MXCA 4M0ZA 4JG6A 4I94A 3BHUA 3DS6A 4J1RA 1OECA 4LUDA 4QOXA 5HIDA 4C3FA 4QP3A 5J7BA 5KMJA 4OTHA 3CKWA 5ETCA 3QZFA 3SXFA 3N4TA 5CU3A 3BYSA 2CDZA 2UZNA 4TL0A 2R7IA 5CSWA 4E73A 1YXTA 2GHLA 3P23A 3P78A 4PMPA 2XIZA 2C6IA 3HEGA 4MHAA 2BAJA 5BYZA 4FBXA 4JT3A 4TTHB 4IFGA 3ULZA 5CQWA 2ACXA 1JSTA 1PMNA 1YWNA 3JY0A 5TKDA 2JBPA 3OEZA 5E91A 5J9LA 4CCUA 2XH5A 4EC9A 4NZWB 4F7SA 2ZDTA 3UMXA 4ALVA 2C6LA 2UW5A 5B7VA 3U4WA 3U6JA 2VO3A 3W2QA 3OT8A 2BRMA 4DCEA 4KRDA 4RIXB 1ZYDA 1K3AA 3BRBA 4YJVA 4DEGA 3VUIA 4J98A 4YSJA 3S0OA 3MV5A 4ITIA 2IW8A 3I1AA 5AUVA 5IUGA 1QPCA 4YTHA 3A4OX 4CVAA 2C0TA 2VTJA 2F49A 1OKWA 4KA3A 5EOBA 4D1SA 3B8RA 2ITTA
chains in the Genus database with same CATH superfamily
5E4HA 1XH6A 2WU6A 4QTDA 3PJ8A 3OUKA 4Y85A 5IH6A 1OM1A 5EG3A 3AXWA 3PXYA 5DE2A 4BI0A 2WTJA 3AKJA 5IQEA 4H3QA 1JKLA 3HECA 3NW7A 4OAVB 2UW9A 3V51A 5L2IA 3ORZA 4BR3A 3NYXA 3D5XA 3R71A 4CSVA 2V7AA 1U54A 3CIKA 2PZPA 4BKZA 3VC4A 4LGDA 4MNEB 3F7ZA 1KE6A 4UV0A 4D4RA 3LIJA 5EK7A 3ID6C 4WT6A 5H2UA 4ZJVA 4OTQA 3R2YA 4G6LA 2WELA 2Y4IC 3PIYA 3Q32A 4GIHA 4JIKA 5EQPA 5IMEA 3EFKA 4O21A 3W55A 3W2CA 3D7ZA 3RZBA 4O82A 2VAGA 2FVDA 3LFBA 3NS9A 4FV2A 4DDIA 3I79A 5LVOA 2R3NA 2B0QA 3OHTA 3PWDA 4IIRA 3AOXA 4CZTA 3IDBA 5BVDA 4TYHB 5HLNA 3NYVA 5AR4A 3GP0A 4CNHA 1SZMA 3MSSA 3L9MA 3ZEPA 3O5AA 2B9IA 3UOHA 2GNLA 3KA0A 2CGVA 3F66A 5EM7A 2JEDA 4UMRA 1VEBA 2X81A 3AC2A 3BLHA 3COHA 5E1EA 3AD5A 5F4NA 1FVTA 3ZO4A 4I6LA 3ML1A 1F5QA 4Y8DA 2GPHA 5H8EA 2CMWA 3ATTA 4KWPA 3VS6A 2Z60A 4AQKA 3GU5A 4YZBA 2C0OA 2GU8A 3ELJA 4I1ZA 2OG8A 2O63A 3ENMA 4DITA 5J7HA 2VTAA 3UDTA 1JSVA 4I6HA 3R22A 3SC1A 3DBQA 2OU7A 4D55A 4FTCA 3BV2A 3Q9YA 3EFLA 3OXIA 2QONA 3QX4A 4KKGA 2BIYA 2VTNA 4F4PA 5KUPA 3V6RA 4AZSA 2WMQA 1FOTA 2JKQA 2QG5A 3DB6A 4GJ2A 1U5RA 1UU9A 5E9EA 4IM2A 4AE6A 4GYGA 4L3JA 4DH1A 5K4IA 3N51A 3BEAA 3ZO2A 2JKMA 4XBUA 3NFGB 4E5WA 4RZWA 4QQ5A 3BZ3A 2OJFE 3VBVA 5EOLA 2I0YA 1DM2A 1ZOGA 1VLRA 4CYIA 2YHVA 4AZFA 3OS3A 1KE7A 3BPRA 2BDJA 3JYAA 3R0TA 4L9IA 2W96B 1W0XC 5FGKA 4X3FA 4K18A 3RCDA 4BKJA 2PL0A 4FIFA 3ZDUA 4PY1A 1K9AA 2F57A 3LJ1A 4PMMA 2BMCA 4MD9E 3RPRA 4B99A 5BUJA 5L2WA 4LRKA 4QRCA 3E8DA 3TZ8A 4D2PA 4BGHA 2QOCA 3PUFC 2P4IA 2BRGA 5H3QA 3TZ7A 3S95A 3TJCA 3TKIA 2FSTX 5B2KA 1H1WA 4PTGA 2WTCA 4GT4A 3P0MA 4F6WA 4BI2A 3UZTA 4U8ZA 2IO6A 3AC4A 2ZMDA 4NEUA 3RINA 3GQIA 5EDRA 2VTOA 3OC1A 3VUKA 4BICA 5HNIX 4IM0A 3FLZA 1YRPA 4UMPA 3KF7A 3PVWA 5CT0A 4Z7HA 2J0JA 4GU6A 4FZDB 5KNJA 3U6HA 4DGMA 4HNFA 3ERKA 2ZAZA 4O6EA 4KAOA 4ASDA 3MH0A 4M0YA 2X0QA 4GU9A 4RIWB 5BV3A 3CY3A 3FWQA 3BX5A 5HVYA 3NW6A 5D7VA 3AQVA 3NEWA 2WIHA 4FV7A 1GNGA 3OCTA 3OWLA 4MXXA 3JY9A 3IOKA 1YQJA 1PF8A 3H4JA 5JN2A 4MTAA 5L2QA 3R7OA 4AGWA 4FKRA 2PZRA 4L6QA 4NTTA 3ZZWA 4ZTHA 4FSZA 4MQ2A 4UMQA 4Y95A 5T6KA 2ZV8A 1ZXEA 2PVHA 3ATSA 3LMHA 2XIXA 3R7GA 4I21A 4JX3A 5E8YA 5IA2A 4DFBA 3SW7A 4QO9A 4AUAA 3F5GA 3ODZX 4Z55A 4HGLA 3PP1A 5EQYA 2VX0A 5IZFA 2QC6A 5ACKA 3UGCA 4IWOA 1SNUA 2PSQA 3NPCA 1Y8YA 1ZLTA 2OO8X 1OIYA 3Q2MA 4XV1A 4Y72A 4F64A 5HE1A 3RPYA 3R00A 4ZY5A 2QU5A 2X39A 3LHJA 3B2TA 2ITVA 4FTRA 3V5PA 4DFXE 2ZV2A 1RDQE 4IC7A 3P5KA 3CEKA 2F4JA 4U0IA 4F78A 2WMWA 4S34A 1J1CA 3C5UA 3CTHA 3HRFA 3KXGA 4FVQA 4G6OA 4GYIA 4IZYA 4L01A 4A4XA 4AGUA 4C2VA 2Z7QA 3WZDA 4GT3A 1H01A 3L8XA 3IDCA 4MBLA 4WG4A 2WTKC 4XHKB 5C03A 3A60A 3VWAA 1TKIA 3L9NA 3V5LA 4DHZA 2X0OA 3K3IA 2EXEA 2WGJA 5AJQA 3FMJA 3C4WA 2ITWA 4FTMA 5BVNA 3E7OA 2VTMA 4C4IA 1ZYJA 4WO5A 3GGFA 4OR5A 4YZ9A 5HKMA 4APPA 4E6AA 1KSWA 3R83A 4C4JA 1YXVA 3HMMA 4EOIA 4YMJA 1J3HA 4AT5A 3KF4A 2ITOA 3T3VA 3PVBA 3FC2A 5DH3A 1AD5A 3TZ9A 2HWPA 5CEQA 4C7TA 2OK1A 2G2IA 4OTFA 2F9GA 4L44A 4AE9A 3CXWA 3DKCA 2YERA 3HMNA 5EYDA 5A4LA 3JVRA 5A54A 4GK4A 4LV7A 4OTPA 4M84A 5EDQA 1WZYA 5FBNC 3ZC6A 4R8QA 3HV5A 1U5QA 4QMQA 3EWHA 3ZBXA 4FT3A 3KRJA 4O7TA 3LQ8A 3UC4A 5FD2A 5HBEA 5L4QA 2PVRA 1ZWSA 2IZSA 5IISA 3F2AA 5DN3A 2X8DA 3B8QA 2B9JA 4RX9A 3RKBA 4P4CA 5IDPA 4TT7A 3U4UA 5C8KA 1OL5A 3BYVA 3EN9A 4PPAA 4O7WA 2G01A 5JFSA 3SXRA 2Y4PA 5D10A 3IW7A 4FJVA 1TQMA 2VX3A 4EHGA 2OIDA 3MDYA 3RK9A 2VTPA 4FTLA 4OTRA 4NTSA 2UVYA 2W06A 3Q9XA 4BIBA 5I3RA 4DT9A 5E8WA 3WF7A 2I0VA 4RLKA 4C62A 2GNJA 3I5ZA 5CU2A 3P7AA 4ERKA 4FIHA 5FP5A 5L2TA 1XBCA 4NM0A 2BAKA 5J1WA 5HG9A 3PY0A 3KRWA 4ENYA 4XOZA 3RAWA 5EM6A 1YXSA 1W82A 5I5ZA 4EOSA 2BR1A 3ALOA 4UXLA 5ANOA 5M53A 4C37A 4WUNA 4XP0A 2FUMA 4MUQA 1W2DA 5AP0A 4IJ9A 1MQ4A 2W5AA 3LM5A 4XG3A 4BRXA 4D9UA 4FE2A 5AP6A 2QD9A 2PHKA 3ROYA 3U51A 3SXSA 4BGGA 1XWSA 2CJMA 4E1ZA 5BVFA 5HTIA 1ZY5A 4YJNA 4FL1A 4FOBA 4LGGA 3PY1A 5CLPA 4A4LA 4YNOA 3BYMA 3VJNA 4P5QA 3ZONA 3UNKA 1NA7A 3OBGA 4AN2A 4E20A 4U41A 4J52A 3G33A 4F65A 2WQBA 4R1YA 4BDFA 1WBTA 5LCJA 3IGGA 4FV1A 4HYSA 1FGIA 2PTKA 2WNTA 3PIXA 1OVEA 1Q8UA 2YA9A 1REKA 3MYGA 5FLFA 4EH4A 3A7HA 5BYLA 2F7XE 2GHMA 3L8SA 4Q5EA 3W0MA 1IA9A 2E9VA 5JGAA 5IA1A 2X0PA 4C36A 2WOUA 4UZHA 2UZLA 3QRKA 1SVHA 4EH9A 2WKMA 4G31A 4KABA 4ZSAA 4FKPA 5IH5A 4KS8A 3TKHA 4JIAA 5CASA 2JAMA 2HENA 4E6CA 1MRVA 3CPBA 4U3YA 3I5NA 2NRYA 2VTIA 1OGYA 4QDVA 3I6WA 3ZUVA 5GZ8A 2I0HA 1A9UA 2IPXA 2OJ9A 3R73A 3OWKA 2GS2A 2HZNA 5AV1A 3F5UA 3UYTA 3IECA 1O6KA 3WIGA 2QI8A 4FUYA 2XF0A 2CKOA 4LL5A 3T3UA 4Q5HA 3ZM4A 4NW5A 2XJ2A 3COKA 5CVFA 1VYWA 4F7NA 5M06A 3TDVA 2HIWA 2GMXA 5GZ9A 5GNKA 4F1MA 3HMIA 4FX3A 4FG7A 4O4CA 4YO6A 4C58A 4GSBA 5IQCA 2IVUA 4FV5A 4BJJB 2B4SB 3OXZA 5DVRA 3CGOA 5HLWA 4D0XA 5AM7A 3G2FA 4HJOA 3V5WA 2QO2A 3KY2A 2YN8A 1YWVA 2A98A 1PXMA 2WXVA 4BZOA 3FV8A 2Y9QA 5AA9A 4WNOA 2UW7A 4XV3A 4DFLA 3R2BA 4XV9A 2YM8A 3CTQA 5E8VA 4ANOA 1W8CA 4RG0A 3QQUA 4K2RA 4RZVA 2ZV9A 3QGYA 5EYKA 2JGZA 4I4FA 4A07A 2YM5A 4N4SA 5EW9A 3SW4A 3LQ5A 3RM7A 3SRVA 4B0GA 1OBGA 4YJRA 3KXMA 3R7UA 4CLIA 4NCTC 4N6ZA 2BZHB 4QP2A 4EBVA 4HCVA 5DEWA 3BLAA 4FKSA 5CEOA 3PP0A 5KMOA 1I09A 3NCGA 1S9JA 3SGCA 3H30A 4C4HA 3WF9A 2QOKA 4BDBA 3H9OA 5GJFA 3KB7A 1FPUA 3VHKA 1Q8WA 4AXFA 3ZLYA 2QOFA 4WSYA 4DA5A 2YDIA 3LVPA 3KN5A 3TZMA 4JLCA 3WF8A 3BBTB 4U6RA 4ZJJA 2UZDA 3VW8A 4G2FA 4D1ZA 2VNYA 3R9NA 4QP9A 3PRFA 2CGWA 3OOMA 3IW6A 3UQFA 4C8BA 3HGKA 3E87A 3K3JA 4O38A 5GIOE 3WE8A 2WQMA 4FIIA 3LCDA 4KIOA 4ITJA 4X3FC 1BLXA 4RFYA 4UEUA 5E8UA 2JKOA 3V04A 3QQHA 3NYOA 5CAQA 4WRSA 5L6OA 2R7BA 3QGWA 4O0WA 1OPKA 2PVFA 2WIPA 4DLIA 3GVUA 4GRBA 2WFYA 1S9IA 1J7LA 2B9HA 2VD5A 3KRLA 3OY3A 3ORPA 4JI9A 2PMNX 4HYIA 3W2SA 2R3IA 4G5JA 4FKVA 4HPTE 2R5TA 4FKGA 4EOLA 3OF0A 2NO3A 2P33A 3W2OA 3ZLWA 4FEQA 5LOHA 2NRUA 2BUJA 3MIYA 3VS3A 3G0EA 3BCEA 2PUNA 1O9UA 4FTJA 3LMIA 5T3QA 3D7TA 3F7WA 4QMZA 5EW3A 4EBWA 5DRBA 1RW8A 4UN0C 2WMXA 3F5PA 3VBTA 1VJYA 2UZBA 5HE0A 3BWJA 1YDRE 2QOOA 3OT3A 4TYIA 1IAJA 2IG7A 2QLQA 4FG9A 5B2MA 4FKJA 5I9WA 1VYZA 4RBLA 4X2JA 3Q5ZA 4QNAA 5C26A 2AYPA 4DF3A 4NFMA 5CXHA 3TL8A 4ZZNA 4H1JA 5AX3A 3QC4A 5L2SA 2OZAB 1XMLA 5JFVA 4QTCA 3LCSA 5ETFA 4OLIA 2X2MA 4GT5A 4TNDA 1YHSA 2R3RA 3K54A 3OTVA 2C6MA 2X9EA 2A2AA 3KEXA 1Q8TA 3E92A 4NFNA 5M51A 1SVGA 2J9MA 5H8BA 4LI5A 4YU2A 3R7EA 3G5DA 3POZA 5K5NA 2Y7JA 5AADA 3DBDA 2I40A 4D28A 1JSUA 3RWPA 4DEAA 5A4CA 4YHJA 4RJ5A 4XG4A 3FHRA 2PZIA 1NVSA 4J97A 3UPZA 2YZLA 3HMOA 3BV3A 3AC3A 3PVGA 4D2VA 1REJA 2IW6A 3KMWA 1YOMA 4IM3A 5M44A 4YZDA 4EZ7A 3H3CA 1TQIA 3NNWA 2BAQA 1UU8A 4CKIA 5FDPA 3NGAA 2VTLA 4D1XA 5A14A 5DR2A 3NUSA 4BCPA 3DTCA 3GQLA 3UOKA 5F94A 2E9NA 2XEYA 2W4KA 2YM3A 5CF6A 4HZSA 4AN3A 5CALA 4O7YA 4BCHA 2XK8A 4YTCA 4FKIA 4E6DA 1CDKA 4L8MA 4EH7A 3C13A 4FSWA 3FL5A 5J8IA 3QQKA 2R3GA 1H1PA 1XHAA 4R6VA 2O5KA 3SHEA 3IW5A 3VS4A 1H8FA 5CYIA 4JBQA 4PDOA 2JAVA 4RIXA 3AC5A 4ANSA 4FV0A 4QQJA 4CFWA 4DN5A 1XH5A 2QOLA 5HO7A 1H1QA 4OTDA 3NUUA 5D41A 5TOZA 3FL4A 3UNJA 4EOOA 4I6FA 4RT7A 5JK3A 4P7EA 5EM5A 3ROCA 4AW0A 1R39A 3NX8A 1H28A 5T68A 2CKEA 1J7UA 5K5XA 4TW9A 2IW9A 4ZLZA 1UWHA 2VWIA 3UYSA 2QR7A 4JAIA 3ZXTA 4X6QC 4C59A 4ZLYA 4I92A 4RIOA 5EHOA 4LDTA 4QPMA 4ZZOA 2ETKA 4UZDA 1BI7A 3VBYA 5L8JA 4DH8A 3D83A 3PXRA 4FI1A 3DCVA 4IJPA 4BYIA 5DYJA 3PY3A 3QBNA 3HV4A 4ANNA 4CV9A 1Q97A 1M17A 3RZFA 4CQEA 4PP7A 3C0IA 3HUCA 2C69A 3NNVA 4HOKA 4MNEA 4MX9A 4V01A 3HMPA 4DG0E 5I9YA 5HI2A 1QCFA 2PE1A 3QKLA 2XNGA 2XANA 5HLPA 3TIZA 3UOLA 3R21A 5K0XA 2CNUA 3CJGA 3DQWA 4L52A 4BDAA 4LOPA 3GUBA 4AZWA 5FXSA 4HGEA 5DHJA 1KE9A 4P5ZA 3L9LA 3R63A 4G34A 1KUTA 4ORKA 4ZMFA 2OH4A 4RQKA 1DS5A 1H1RA 4BCOA 4TYHA 4Z3VA 4Z9LA 3NAXA 4O0YA 4DGOA 5CS6A 3VIDA 1UKHA 2CN5A 1UV5A 3SDJA 3Q6UA 4J95A 3I7BA 4YZMA 4EH8A 5TT7A 2RFNA 2PK9A 2O0UA 2UV2A 5HE2A 1Q62A 1XQZA 4EZ3A 1PRYA 3I6UA 3VN9A 2JDSA 2W05A 3OW4A 4MXZA 4R78A 1W98A 2CGUA 2XYUA 4PMTA 2Z7LA 4H39A 5FM2A 5FWKK 4R7HA 1XBBA 4CFNA 4WHZA 2F7EE 2BZJA 4FTTA 3GU7A 3RHKA 4XG6A 3DGKA 4EOKA 3MY1A 2ETMA 2GFCA 3MN3A 4HVIA 4K6ZA 3BQRA 3FDNA 3O2MA 2XK3A 4FNYA 2OIQA 2EXCX 2V55A 4CYJA 4GH2A 4WBBB 1WFCA 5G1XA 2CN8A 1W2FA 1LP4A 4XOYA 3VS1A 5KHXA 4TYEA 1EH4A 4DDGA 4F9YA 2B7AA 4YC6A 3WILA 3CE3A 4NIFB 4FKWA 3VS2A 2WPAA 3T8OA 1IEPA 3EOCA 3W32A 4AF3A 3GNIB 4TWPA 5AEPA 5M08A 3KXNA 4K9YA 5C9CA 4DC2A 2B1PA 4A9TA 4RMZA 3DAEA 4RRVA 4ZSGA 1SMHA 4HGTA 4QMVA 3BI6A 4O7LA 4BCKA 3LXNA 4FTKA 4OBOA 4GVJA 4TY1A 2UZVA 4M69B 3UNZA 5HBJA 3FZOA 1YOJA 3UE4A 3M2WA 4EHEA 3A61A 4DTKA 3O7LD 3QTSA 3KIOC 3FY2A 5HEZA 2DYLA 3TXOA 3U9NA 2C47A 1ZAOA 2GDOA 5EI8A 4GUBA 2WU7A 3NIZA 5FEQA 3C4EA 2PZ5A 3F9NA 3IS5A 2G1TA 3GCSA 4HGSA 4XP2A 3HP5A 3F82A 3HAVA 1U46A 3SLSA 4BDHA 4R3PA 3IKAA 3W0NA 1H07A 2ONLA 3ZBFA 3UBDA 3FHIA 3A7GA 3S2PA 1YW2A 2VO6A 3DZQA 3RJCA 3ULIA 2C5VA 4I6QA 5C27A 3D5WA 2HK5A 3R9OA 1OI9A 2VNWA 3AGLA 3W10A 2V7OA 4DEHA 4BF2A 2XARA 3ZM9A 4TWOA 2J5FA 3LXPA 3OBJA 3OY1A 2EB3A 4M12A 3UPXA 3RGFA 1ZOHA 4RIWA 4D5HA 3QD3A 5KKRB 3FXWA 2P2HA 3JPVA 2J0IA 2PMIA 2QURA 4MD7E 4ASXA 5CF8A 3JR1A 5JGDA 2HOGA 3DXPA 4FKUA 1JOWB 1CKIA 4AXAA 5C4LA 4FT7A 2QO9A 3A7IA 3MH2A 4HYHA 4FNXA 4S31A 3ZLSA 2WMAA 5M4CA 4RLLA 1HCLA 2VUWA 3AD4A 4L3PA 1PXIA 3D0EA 2OJJA 2Z2WA 3UTOA 3KK9A 4KBAA 4WBOA 2XALA 1OB3A 5FRIA 2R3LA 2B9FA 2W1GA 3C9WA 4GVAA 1YI3A 2O64A 2PUUA 2H8HA 4QP1A 3FMMA 3KC3A 1RJBA 4G5PA 4EHVA 4FUXA 3QYZA 4JDJA 2VO7A 4GEOA 2X2KA 4BDIA 5AUXA 4O27B 2JDVA 2HXLA 3ACKA 2EVAA 3DQXA 3P08A 3DTWA 4W4XA 3RK7A 4QP6A 3KGAA 3OCSA 1UNGA 4PP9A 4Y46A 3QTQA 4B6LA 3M11A 4DFZE 2FSLX 2ITQA 2C1AA 2YZAA 5AV2A 1JBPE 1OMWA 4JAJA 3W0PA 3QLFA 4ZSEA 4BDKA 5HORA 4WSQA 2OJIA 1ZYCA 4KUJA 1XH9A 1FQ1B 1TQPA 4G3DA 3UIBA 4AZTA 1GZNA 3Q4CA 4ZMEA 2C5NA 3BGPA 4ZY6A 3VUTA 3MESA 4HPUE 2F2UA 3ZDIA 3KU2A 1FVVA 2XJ0A 2YFXA 3Q60A 4JBOA 4MH7A 3THBA 4FYNA 5ICPA 2ZM4A 4EJNA 5I0BA 1KV2A 5FXQA 4U5JA 3VQHA 4LG4A 4EK3A 3OEFX 5CU4A 1G8SA 2YJRA 3QU0A 4NCTA 4X2NA 5AA8A 1XH4A 5JQ5A 1BL6A 2XA4A 3FKOA 4KRCA 4RVLA 3G9NA 3QKMA 5C8MA 3V5TA 1JKSA 4AT3A 1H00A 4IX5A 5E90A 3C50A 1PXKA 4ZOGA 5AFVA 4EYMA 4JQ8A 5BX0A 4K8AA 1G8KA 4AA0A 3GENA 3VNTA 4QMSA 2GS7A 3V8SA 3ZCLA 4AW1A 3OW3A 5A9UA 1YKRA 2WZJA 3ZZEA 3BHVA 1V0PA 3MI9A 5KHWA 4TN6A 3EQHA 4D4YA 4CTBA 2NPQA 2X4ZA 4ONAA 4O6LA 5HU9A 3DT1A 4G17A 3QRUA 4KIKB 3H0YA 4AOTA 3S4QA 3PG3A 3N4UA 3ZHPC 3PA3A 3PJ2A 4ZTMA 2YIYA 1OL1A 4GMYA 2G2HA 4RQVA 3RCJA 5HX6A 2XNOA 3R28A 4ARKA 4EOQA 2XAMA 4BHNA 3EQGA 5EYCA 4XLIA 5LWMA 3KCFA 4ZP5A 3JS2A 3FE3A 4EOJA 4NKAA 4JRVA 5CX9A 3COIA 5CZIA 4FTQA 3O17A 3SOCA 3U9CA 4EHZA 2QOQA 2YLFA 3C0HA 2R0UA 2XK4A 1SYKA 4PUZA 4TYJA 3E8NA 5CY3A 4AGDA 2Q83A 2WMSA 3C0GA 4I93A 4ZIMA 4E26A 2BALA 4TRLA 5C8NA 4O7ZA 2GQGA 1MUOA 4FV4A 4Q9SA 4YHTA 1URWA 3VF9A 1PYEA 4HCUA 4W8EA 3VF8A 2JLDA 2PE2A 4BDEA 3P4KA 4II5A 4XLVA 2YIXA 5HCYA 1Z9XA 3OUNB 5TO8A 1LPUA 3BGZA 3RPSA 5LARA 4AA5A 3KFAA 5E8XA 4L68A 3VHEA 2ZVAA 3HP2A 4QDEA 2XAOA 1R3CA 3A7JA 3DU8A 1GOLA 3CGFA 2X4FA 2UW4A 4IW0A 4EWHA 4CZUA 3R9RA 2RF9A 2XVDA 3R6XA 5DEYA 5J5TA 3DZOA 4GK2A 3MJ1A 4JDIA 5KKRC 3UOJA 4O83A 3QTXA 5J95A 4PPBA 3PSDA 3UO5A 2HAKA 2ERKA 4ZSLA 2BKKA 3QTUA 4X6RA 5HX8A 3N9XA 3Q6WA 1LUFA 3AT3A 4I5PA 4IMYA 4LUEA 4F70A 1JWHA 1PXPA 1ZY4A 3MWUA 4ZTRA 4PNKA 2VWUA 4EK6A 3MY0A 2XYNA 5FTGA 3FLYA 3V8WA 1QPJA 2GNFA 5IMXA 2JBOA 3I0QA 4IX3A 4FZ6A 1P5EA 4OTWA 5JRSA 3MFTA 4Q9ZA 4O4BB 2PVKA 2BTSA 5JH6A 2VZ6A 3EN6A 3KL8A 4O7NA 4AW2A 1YOLA 4N6YA 3DBEA 5DT0A 2QLUA 2W0JA 4MWIA 5I9VA 5CF4A 1YDSE 4L7SA 5DT3A 4D2TA 1PXNA 2QOBA 3EQRA 2OH0E 3LM0A 3UVPA 4UY9A 5HD4A 2R4BA 2JDTA 3PZHA 3E88A 3EN5A 3QXPA 5ANDA 4XRLA 4D2RA 4BBMA 2Q0NA 5A4EA 5CF5A 2XBJA 3QAME 4IX4A 4BJJA 3LW0A 5TE0A 4XS2A 1GZ8A 5CSVA 4O91A 1TFFA 2OI4X 4UX9A 4FSMA 3ZXZA 4CCBA 5IU2A 5AAFA 4IAKA 3FZTA 3M42A 3SKCA 2O2UA 4P90A 3R8ZA 4F99A 3MB6A 2QR8A 5IG1A 3W16A 3LFCA 5KMMA 3MIAA 3PXFA 2H34A 4YURA 3VUGA 2YAAA 4KD1A 5EW8A 2YEXA 2PVJA 2C6TA 4I0RA 4AZEA 3GB2A 4YPDA 1YXUA 4IZ7A 4MKCA 3FLNC 3ZO1A 1PY5A 3D9VA 4MYGA 3MFUA 4ACGA 1O6LA 3F3UA 3IDPA 4B8MA 3R9HA 1APME 4DYMA 4WNKA 3GI3A 3OG7A 2BTRA 4KS7A 3Q96A 2X0GA 3MPAA 4O0RA 4IAZA 4C3RA 2H96A 4FEXA 2HY0A 4DT8A 5CWZA 3POOA 5LMAA 3R8UA 4RVMA 2RFDA 1CTPE 1Z57A 2W1CA 4X2GA 2E9OA 3EKKA 5BPYA 4C57A 2RGPA 2J0KA 3W0QA 4I20A 1Q4LA 3AT2A 4X0MA 1KE8A 4JOAA 4RJ3A 3OWJA 3ZRKA 3FYKX 5D12A 2QG7A 3ZUUA 4M3QA 5AV4A 3LFSA 4KSPA 4FZ7A 2CLXA 2WOTA 3PG1A 4DGNA 2OW3A 5IQBA 2W9FB 4YSMA 3TV6A 4EONA 3LCTA 2PVLA 5FEDA 5HVKA 5M4UA 4NK9A 1Z5MA 1W84A 4FIEA 4O96A 3VVHA 2XIRA 4MXYA 5ANEA 2ITXA 4RVTA 4EOMA 4XNEA 4NSTA 1ERKA 2C3JA 3L9PA 3PXKA 1NT2A 3VW6A 3TNHA 3QL8A 1T46A 2IVVA 3DNDA 2QNJA 4M14A 1NY3A 4I0TA 3PLSA 3HX4A 3SOAA 5JSMA 5BVOA 2GHGA 2ONLC 3PWYA 2JD5A 4FK3A 4J53A 1B6CB 2H9VA 4IZAA 1YHVA 3V6SA 2BZKB 4NH1A 2IZTA 5LVLA 3NVKI 4AXEA 3KXXA 4EH6A 1KWPA 3GXLA 4HCTA 2GQRA 2J90A 4NYEA 2FA2A 4CFVA 3ACJA 4H58A 3NSZA 4J8MA 3CLYA 3ZFYA 5CAPA 3TUDA 3IQ7A 1BL7A 5HNBA 2ZB0A 3O8UA 3NWWA 4RC3A 1Q5KA 4RIYB 5AUYA 4FF8A 2QVSE 4F9CA 4QMTA 2ERZE 5F9EA 2CLQA 4JJRA 2RFEA 4UMUA 1E1VA 4JG7A 4AFJA 3P9JA 1V0BA 4QP8A 2OZAA 2SRCA 1YHWA 4H1MA 4CT2A 3DK6A 3QCXA 3MPMA 4O1PA 3PJCA 1OIRA 5HG7A 2RKUA 3C4FA 3Q9WA 4USDA 2OXXA 3MW1A 3O71A 4W4VA 4YJPA 2UW8A 3ORMA 4XEYA 4ZS0A 4KSQA 5FBOA 5DIAA 1XR1A 4BTMA 4BL1A 4WIHA 3GBZA 4XX9A 2HXQA 3KXZA 3A8WA 2YCRA 3VRYA 5CSPA 4HZRA 4PRJA 4QTAA 3QFVA 3RK5A 3KULB 3BHTA 4BDGA 1CSNA 4FGBA 2XRWA 4IB0A 4CZYB 1V1KA 3H9FA 2VO0A 4QMMA 5HO6A 2G2FA 2GCDA 5IDNA 3BELA 4NT4A 1QPEA 4EQCA 1FBNA 5FXRA 4YNEA 4MNFA 3UC3A 3EYGA 2V0DA 3JUHA 3HUBA 3NRMA 3BHYA 3QWKA 4WUAA 5CI7A 3AC1A 3LJ0A 4GKIA 4GCJA 5M07A 4QMOA 4JS8A 4ZSJA 5K3YA 2ZMCA 2UVXA 3OXTA 4I3ZA 2CHLA 3VJOA 2A0CX 5EM8A 3GT8A 2ZYBA 3CQWA 4GK3A 3ZLXA 2Z7SA 3VBXA 4E93A 4YC8A 2QHMA 2REIA 1UWJA 3ZC5A 4CFMA 3OROA 3U87A 2J51A 4IWQA 3W2RA 4RVKA 2HW6A 3DXNA 4NW6A 5CTPA 2XNEA 4OT5A 3F3WA 4Z16A 3KRRA 2VTHA 4XBRA 3LKMA 3N4VA 4D58A 4D2WA 2C0IA 2I1MA 3EKNA 3WF6A 4O0TA 5ANGA 3WYYA 4M97A 4ZY4A 4D4VA